BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF012H22

Length=573
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU30283.1|  hypothetical protein MIMGU_mgv1a000455mg                159   4e-57   Erythranthe guttata [common monkey flower]
gb|KHN41309.1|  Protein GIGANTEA                                        146   7e-54   Glycine soja [wild soybean]
gb|KJB59492.1|  hypothetical protein B456_009G258800                    155   1e-53   Gossypium raimondii
gb|KCW69153.1|  hypothetical protein EUGRSUZ_F02686                     147   4e-53   Eucalyptus grandis [rose gum]
ref|XP_010062087.1|  PREDICTED: protein GIGANTEA isoform X1             147   4e-53   Eucalyptus grandis [rose gum]
ref|XP_010097648.1|  hypothetical protein L484_023788                   144   7e-52   
ref|XP_010681263.1|  PREDICTED: protein GIGANTEA                        145   1e-51   
dbj|BAK19067.1|  GIGANTEA                                               184   1e-49   Ipomoea nil [qian niu]
ref|XP_004140955.1|  PREDICTED: protein GIGANTEA-like                   143   2e-48   Cucumis sativus [cucumbers]
ref|XP_004160322.1|  PREDICTED: protein GIGANTEA-like                   143   2e-48   
ref|XP_008456743.1|  PREDICTED: protein GIGANTEA-like                   142   2e-48   Cucumis melo [Oriental melon]
ref|XP_010915066.1|  PREDICTED: protein GIGANTEA-like                   142   4e-48   Elaeis guineensis
ref|XP_009408935.1|  PREDICTED: protein GIGANTEA-like isoform X2        139   8e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408933.1|  PREDICTED: protein GIGANTEA-like isoform X1        138   9e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008786518.1|  PREDICTED: protein GIGANTEA-like                   139   3e-47   
ref|XP_009381150.1|  PREDICTED: protein GIGANTEA-like                   133   3e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001042220.1|  Os01g0182600                                       140   4e-47   
gb|EEE54000.1|  hypothetical protein OsJ_00641                          140   4e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010925341.1|  PREDICTED: protein GIGANTEA-like                   140   4e-47   Elaeis guineensis
gb|EEC70061.1|  hypothetical protein OsI_00663                          140   4e-47   Oryza sativa Indica Group [Indian rice]
gb|EPS65289.1|  hypothetical protein M569_09488                         143   4e-47   Genlisea aurea
ref|XP_008793464.1|  PREDICTED: protein GIGANTEA-like                   139   5e-47   Phoenix dactylifera
ref|XP_006643836.1|  PREDICTED: protein GIGANTEA-like isoform X1        140   7e-47   Oryza brachyantha
gb|ACJ65314.1|  GI3 protein                                             121   1e-46   Glycine max [soybeans]
pir||T00767  hypothetical protein T22J18.6 - Arabidopsis thaliana       132   2e-46
gb|ACJ09488.1|  putative gigantea                                       138   3e-46   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ09482.1|  putative gigantea                                       137   3e-46   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ09478.1|  putative gigantea                                       137   3e-46   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ09481.1|  putative gigantea                                       137   4e-46   Oryza sativa Indica Group [Indian rice]
gb|ACJ09480.1|  putative gigantea                                       135   1e-45   Oryza sativa Indica Group [Indian rice]
gb|ACJ09483.1|  putative gigantea                                       135   2e-45   Oryza sativa Japonica Group [Japonica rice]
gb|AAW66945.1|  gigantea-like protein                                   137   2e-45   Hordeum vulgare [barley]
ref|XP_006359040.1|  PREDICTED: protein GIGANTEA-like isoform X2        171   3e-45   Solanum tuberosum [potatoes]
ref|XP_009631434.1|  PREDICTED: protein GIGANTEA-like isoform X5        171   3e-45   Nicotiana tomentosiformis
ref|XP_009631433.1|  PREDICTED: protein GIGANTEA-like isoform X4        171   4e-45   Nicotiana tomentosiformis
ref|XP_009631431.1|  PREDICTED: protein GIGANTEA-like isoform X2        171   4e-45   Nicotiana tomentosiformis
ref|XP_009631429.1|  PREDICTED: protein GIGANTEA-like isoform X1        171   4e-45   Nicotiana tomentosiformis
emb|CDP11443.1|  unnamed protein product                                171   4e-45   Coffea canephora [robusta coffee]
gb|AFW80279.1|  gigantea1A isoform 1                                    130   7e-45   
ref|NP_001288586.1|  gigantea like1a                                    131   7e-45   Zea mays [maize]
gb|AFW80282.1|  gigantea1A                                              130   8e-45   
ref|XP_003564357.1|  PREDICTED: protein GIGANTEA                        134   1e-44   
ref|XP_009772049.1|  PREDICTED: protein GIGANTEA-like                   169   1e-44   Nicotiana sylvestris
gb|AIC83986.1|  gigantea-like protein                                   135   2e-44   Festuca pratensis [meadow ryegrass]
emb|CDM81775.1|  unnamed protein product                                134   2e-44   Triticum aestivum [Canadian hard winter wheat]
gb|AAQ11738.1|  gigantea                                                134   2e-44   Triticum aestivum [Canadian hard winter wheat]
gb|AAT79487.1|  gigantea 3                                              133   2e-44   Triticum aestivum [Canadian hard winter wheat]
gb|ABZ81992.1|  gigantea                                                129   3e-44   Zea mays [maize]
ref|NP_001140728.1|  uncharacterized protein LOC100272803               130   3e-44   
ref|XP_008672375.1|  PREDICTED: uncharacterized protein LOC100272...    130   3e-44   Zea mays [maize]
gb|AFW80281.1|  gigantea1A                                              130   3e-44   
ref|XP_004968438.1|  PREDICTED: protein GIGANTEA-like                   132   3e-44   Setaria italica
ref|XP_004237832.1|  PREDICTED: protein GIGANTEA                        168   4e-44   Solanum lycopersicum
gb|AAT79486.1|  gigantea 2                                              134   6e-44   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008461912.1|  PREDICTED: protein GIGANTEA-like isoform X1        140   8e-44   Cucumis melo [Oriental melon]
emb|CBI22760.3|  unnamed protein product                                163   1e-43   Vitis vinifera
ref|XP_009380419.1|  PREDICTED: protein GIGANTEA-like isoform X1        126   1e-43   
emb|CAY26028.1|  GIGANTEA                                               133   3e-43   Lolium perenne [perennial ryegrass]
ref|XP_002264755.1|  PREDICTED: protein GIGANTEA                        165   3e-43   
ref|XP_006359039.1|  PREDICTED: protein GIGANTEA-like isoform X1        114   1e-42   Solanum tuberosum [potatoes]
gb|ADR51711.1|  GI                                                      128   3e-42   Secale cereale
gb|AII99806.1|  gigantea                                                161   1e-41   Dimocarpus longan [longan]
gb|KDP36552.1|  hypothetical protein JCGZ_08319                         160   2e-41   Jatropha curcas
ref|XP_004252566.1|  PREDICTED: protein GIGANTEA-like isoform X1        159   3e-41   Solanum lycopersicum
ref|XP_010314472.1|  PREDICTED: protein GIGANTEA-like isoform X2        159   3e-41   
ref|XP_006361617.1|  PREDICTED: protein GIGANTEA-like isoform X2        159   3e-41   Solanum tuberosum [potatoes]
ref|XP_006361616.1|  PREDICTED: protein GIGANTEA-like isoform X1        159   3e-41   Solanum tuberosum [potatoes]
ref|XP_011074103.1|  PREDICTED: protein GIGANTEA-like isoform X1        158   1e-40   Sesamum indicum [beniseed]
ref|XP_011074106.1|  PREDICTED: protein GIGANTEA-like isoform X2        158   1e-40   
ref|XP_011100590.1|  PREDICTED: protein GIGANTEA-like                   157   2e-40   Sesamum indicum [beniseed]
ref|XP_002307516.1|  GIGANTEA family protein                            157   3e-40   
ref|XP_011044276.1|  PREDICTED: protein GIGANTEA-like                   156   4e-40   Populus euphratica
ref|XP_009610493.1|  PREDICTED: protein GIGANTEA-like                   156   5e-40   Nicotiana tomentosiformis
ref|XP_007019601.1|  Gigantea protein isoform 1                         156   6e-40   
ref|XP_007019603.1|  Gigantea protein isoform 3                         156   6e-40   
ref|XP_007019604.1|  Gigantea protein isoform 4                         155   7e-40   
gb|KJB59491.1|  hypothetical protein B456_009G258800                    155   8e-40   Gossypium raimondii
gb|KJB59493.1|  hypothetical protein B456_009G258800                    155   8e-40   Gossypium raimondii
gb|KJB59494.1|  hypothetical protein B456_009G258800                    155   1e-39   Gossypium raimondii
gb|ACY30446.1|  gigantea-like protein                                 97.4    1e-39   Liriodendron tulipifera
gb|AES62297.2|  gigantea protein 1B                                     154   3e-39   Medicago truncatula
gb|ABP81863.1|  LATE BLOOMER 1                                          154   3e-39   Pisum sativum [garden pea]
gb|AES62299.2|  gigantea protein 1B                                     153   5e-39   Medicago truncatula
ref|XP_003592046.1|  Protein GIGANTEA                                   153   5e-39   
ref|XP_003592048.1|  Protein GIGANTEA                                   153   6e-39   
gb|ACJ09479.1|  putative gigantea                                       113   6e-39   Oryza sativa Japonica Group [Japonica rice]
gb|KJB28963.1|  hypothetical protein B456_005G077100                    152   7e-39   Gossypium raimondii
gb|KJB28960.1|  hypothetical protein B456_005G077100                    152   7e-39   Gossypium raimondii
ref|XP_004290483.1|  PREDICTED: protein GIGANTEA                        152   9e-39   Fragaria vesca subsp. vesca
gb|KJB28964.1|  hypothetical protein B456_005G077100                    152   9e-39   Gossypium raimondii
gb|KJB28961.1|  hypothetical protein B456_005G077100                    152   1e-38   Gossypium raimondii
gb|KJB28962.1|  hypothetical protein B456_005G077100                    152   1e-38   Gossypium raimondii
gb|AJC01622.1|  gigantea                                                152   1e-38   Prunus dulcis [sweet almond]
ref|XP_008237480.1|  PREDICTED: protein GIGANTEA                        152   1e-38   
dbj|BAJ22595.1|  GIGANTEA                                               152   1e-38   Glycine max [soybeans]
ref|XP_007151935.1|  hypothetical protein PHAVU_004G088300g             152   1e-38   Phaseolus vulgaris [French bean]
gb|KHG25928.1|  Protein GIGANTEA                                        150   2e-38   Gossypium arboreum [tree cotton]
ref|XP_007143577.1|  hypothetical protein PHAVU_007G083500g             151   3e-38   Phaseolus vulgaris [French bean]
dbj|BAM67030.1|  gigantea-like                                          151   3e-38   Chrysanthemum seticuspe f. boreale
ref|XP_006473104.1|  PREDICTED: protein GIGANTEA-like isoform X1        150   5e-38   Citrus sinensis [apfelsine]
ref|XP_008381855.1|  PREDICTED: protein GIGANTEA-like                   150   5e-38   
ref|XP_009336496.1|  PREDICTED: protein GIGANTEA-like                   150   6e-38   Pyrus x bretschneideri [bai li]
ref|XP_011042897.1|  PREDICTED: protein GIGANTEA-like                   150   6e-38   Populus euphratica
ref|XP_010268583.1|  PREDICTED: protein GIGANTEA-like isoform X1        149   8e-38   Nelumbo nucifera [Indian lotus]
ref|XP_009802612.1|  PREDICTED: protein GIGANTEA-like                   149   1e-37   Nicotiana sylvestris
ref|NP_001239995.1|  uncharacterized protein LOC100800578               149   1e-37   
dbj|BAN82581.1|  gigantea                                               149   2e-37   Glycine max [soybeans]
dbj|BAN82586.1|  gigantea                                               149   2e-37   Glycine max [soybeans]
gb|EYU36555.1|  hypothetical protein MIMGU_mgv1a000427mg                148   3e-37   Erythranthe guttata [common monkey flower]
ref|XP_002300901.2|  GIGANTEA family protein                            148   3e-37   
ref|XP_006386299.1|  hypothetical protein POPTR_0002s06490g             148   3e-37   
gb|AGL61504.1|  gigantea-like protein                                   147   4e-37   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_009631432.1|  PREDICTED: protein GIGANTEA-like isoform X3        147   6e-37   Nicotiana tomentosiformis
ref|XP_010261024.1|  PREDICTED: protein GIGANTEA-like isoform X1        147   8e-37   Nelumbo nucifera [Indian lotus]
ref|XP_002961231.1|  hypothetical protein SELMODRAFT_140066             107   1e-36   
ref|XP_010261026.1|  PREDICTED: protein GIGANTEA-like isoform X3        146   1e-36   Nelumbo nucifera [Indian lotus]
ref|XP_002969462.1|  hypothetical protein SELMODRAFT_170553             107   1e-36   
ref|XP_004496435.1|  PREDICTED: protein GIGANTEA-like isoform X1        146   1e-36   Cicer arietinum [garbanzo]
ref|XP_006416158.1|  hypothetical protein EUTSA_v10006603mg             145   2e-36   
gb|KFK44368.1|  gigantea                                                146   2e-36   Arabis alpina [alpine rockcress]
ref|XP_006416159.1|  hypothetical protein EUTSA_v10006603mg             145   2e-36   
ref|XP_003556164.1|  PREDICTED: protein GIGANTEA isoformX1              145   2e-36   
gb|ACJ65312.1|  GI1 protein                                             145   2e-36   Glycine max [soybeans]
gb|ACA24490.1|  gigantea-like protein 2                                 145   2e-36   Glycine max [soybeans]
ref|XP_009335139.1|  PREDICTED: protein GIGANTEA-like                   145   4e-36   Pyrus x bretschneideri [bai li]
emb|CAN81809.1|  hypothetical protein VITISV_032939                     128   4e-36   Vitis vinifera
ref|XP_010268589.1|  PREDICTED: protein GIGANTEA-like isoform X2        145   4e-36   Nelumbo nucifera [Indian lotus]
gb|ACT22764.1|  GIGANTEA                                                144   5e-36   Allium cepa
gb|AGU91438.1|  GIGANTEA-like protein                                   144   5e-36   Chrysanthemum boreale
dbj|BAN82589.1|  gigantea                                               144   6e-36   Glycine max [soybeans]
ref|XP_006306336.1|  hypothetical protein CARUB_v10012213mg             143   1e-35   Capsella rubella
ref|XP_008386373.1|  PREDICTED: protein GIGANTEA-like                   143   1e-35   
gb|KHN17039.1|  Protein GIGANTEA                                        143   2e-35   Glycine soja [wild soybean]
ref|XP_006588466.1|  PREDICTED: uncharacterized protein LOC100800...    143   2e-35   Glycine max [soybeans]
gb|ACT22765.1|  GIGANTEA                                                142   2e-35   Allium cepa
gb|AAF00023.1|  GIGANTEA                                                142   3e-35   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD97869.1|  GI homologue                                           142   3e-35   Lemna gibba
gb|AAT97404.1|  gigantea                                                142   3e-35   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96496.1|  GIGANTEA                                                142   3e-35   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96498.1|  GIGANTEA                                                142   3e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564180.1|  protein GIGANTEA                                      142   3e-35   Arabidopsis thaliana [mouse-ear cress]
gb|AAT80910.1|  GIGANTEA                                                142   3e-35   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96484.1|  GIGANTEA                                                142   3e-35   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96482.1|  GIGANTEA                                                142   3e-35   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96485.1|  GIGANTEA                                                142   3e-35   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96483.1|  GIGANTEA                                                142   3e-35   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96488.1|  GIGANTEA                                                142   3e-35   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96497.1|  GIGANTEA                                                142   3e-35   Arabidopsis thaliana [mouse-ear cress]
emb|CAA72908.1|  hypothetical protein                                   142   3e-35   Arabidopsis thaliana [mouse-ear cress]
gb|AFK65758.1|  GIGANTEA                                                142   5e-35   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_010477545.1|  PREDICTED: protein GIGANTEA-like isoform X3        142   5e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010477546.1|  PREDICTED: protein GIGANTEA-like isoform X4        142   5e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010498761.1|  PREDICTED: protein GIGANTEA                        142   5e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010477543.1|  PREDICTED: protein GIGANTEA-like isoform X1        142   5e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010477544.1|  PREDICTED: protein GIGANTEA-like isoform X2        142   5e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010462850.1|  PREDICTED: protein GIGANTEA-like                   141   6e-35   Camelina sativa [gold-of-pleasure]
dbj|BAP76055.1|  putative GI                                            119   6e-35   Cryptomeria japonica
ref|XP_002890532.1|  hypothetical protein ARALYDRAFT_889789             141   1e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_004139688.1|  PREDICTED: protein GIGANTEA-like                   140   2e-34   
dbj|BAD97864.1|  GI homologue 1                                         140   2e-34   Lemna aequinoctialis
emb|CDY04787.1|  BnaC05g18020D                                          140   2e-34   
ref|XP_009115601.1|  PREDICTED: protein GIGANTEA                        140   2e-34   Brassica rapa
emb|CDY21388.1|  BnaA09g30390D                                          140   2e-34   Brassica napus [oilseed rape]
ref|NP_001288824.1|  protein GIGANTEA                                   140   3e-34   Brassica rapa
gb|ABP96481.1|  GIGANTEA                                                139   4e-34   Arabidopsis lyrata subsp. petraea
gb|ADX35837.1|  gigantea                                                109   3e-33   Brachypodium rupestre
gb|ADP92454.1|  GIGANTEA 1                                              136   4e-33   x Doritaenopsis hybrid cultivar
gb|ADX35848.1|  gigantea                                                109   5e-33   Brachypodium distachyon [annual false brome]
gb|ADX35839.1|  gigantea                                                109   7e-33   Brachypodium retusum
gb|ADX35845.1|  gigantea                                                107   8e-33   Brachypodium mexicanum
gb|ADX35846.1|  gigantea                                                107   1e-32   Brachypodium distachyon [annual false brome]
gb|ADX35844.1|  gigantea                                                109   2e-32   Brachypodium mexicanum
gb|AFB78142.1|  gigantea                                                109   4e-32   Brachypodium boissieri
ref|XP_010535090.1|  PREDICTED: protein GIGANTEA                        125   3e-29   Tarenaya hassleriana [spider flower]
ref|XP_002524341.1|  Protein GIGANTEA, putative                         120   1e-27   
gb|AGM20686.1|  GI1-2                                                 77.4    1e-27   Populus tomentosa [Chinese white poplar]
ref|XP_004173872.1|  PREDICTED: protein GIGANTEA-like                 87.8    4e-27   
gb|ABR18021.1|  unknown                                                 117   1e-26   Picea sitchensis
gb|AGH20049.1|  GI                                                      117   2e-26   Picea abies
gb|AGW52153.1|  GI                                                      114   3e-25   Populus tomentosa [Chinese white poplar]
dbj|BAO66507.1|  GIGANTEA                                               102   3e-21   Marchantia polymorpha
ref|XP_004496436.1|  PREDICTED: protein GIGANTEA-like isoform X2        100   7e-21   
gb|KHN46389.1|  Protein GIGANTEA                                      98.6    5e-20   Glycine soja [wild soybean]
gb|AIR93790.1|  gigantea                                              97.8    9e-20   Kalanchoe fedtschenkoi [lavender-scallops]
gb|AEK05858.1|  gigantea-5                                            90.5    2e-19   Populus balsamifera [balsam poplar]
gb|AEK05878.1|  gigantea-5                                            90.5    2e-19   Populus balsamifera [balsam poplar]
gb|AEK05888.1|  gigantea-5                                            90.5    3e-19   Populus balsamifera [balsam poplar]
gb|AEK26574.1|  gigantea 5                                            90.1    3e-19   Populus tremula [European aspen]
gb|AEK05813.1|  gigantea-5                                            90.1    3e-19   Populus balsamifera [balsam poplar]
gb|AEK05848.1|  gigantea-5                                            90.1    4e-19   Populus balsamifera [balsam poplar]
ref|XP_007199688.1|  hypothetical protein PRUPE_ppa000556mg           90.1    3e-18   
ref|XP_006842209.1|  hypothetical protein AMTR_s00078p00173230        92.8    5e-18   
gb|KDO83806.1|  hypothetical protein CISIN_1g001216mg                 92.4    7e-18   Citrus sinensis [apfelsine]
gb|AEK05801.1|  gigantea 2                                            92.0    7e-18   Populus balsamifera [balsam poplar]
gb|AEK05807.1|  gigantea 2                                            92.0    7e-18   Populus balsamifera [balsam poplar]
gb|AEK05795.1|  gigantea 2                                            92.0    7e-18   Populus balsamifera [balsam poplar]
gb|AEK05791.1|  gigantea 2                                            92.0    7e-18   Populus balsamifera [balsam poplar]
gb|AEK05803.1|  gigantea 2                                            92.0    8e-18   Populus balsamifera [balsam poplar]
gb|AEK05802.1|  gigantea 2                                            92.0    8e-18   Populus balsamifera [balsam poplar]
gb|AEK05799.1|  gigantea 2                                            92.0    8e-18   Populus balsamifera [balsam poplar]
gb|AEK05793.1|  gigantea 2                                            92.0    8e-18   Populus balsamifera [balsam poplar]
gb|AEK05790.1|  gigantea 2                                            92.0    8e-18   Populus balsamifera [balsam poplar]
ref|XP_006434519.1|  hypothetical protein CICLE_v10004044mg           89.0    9e-17   
ref|XP_010261025.1|  PREDICTED: protein GIGANTEA-like isoform X2      85.1    1e-16   Nelumbo nucifera [Indian lotus]
gb|EMS55238.1|  hypothetical protein TRIUR3_30834                     86.3    8e-16   Triticum urartu
gb|EMT06342.1|  hypothetical protein F775_28583                       83.6    5e-15   
emb|CDP21210.1|  unnamed protein product                              53.9    5e-07   Coffea canephora [robusta coffee]
gb|AEK05812.1|  gigantea-5                                            52.4    2e-06   Populus balsamifera [balsam poplar]
dbj|BAO74110.1|  GIGANTEA                                             51.2    2e-04   Lotus japonicus
dbj|BAO74118.1|  GIGANTEA                                             51.2    2e-04   Lotus japonicus



>gb|EYU30283.1| hypothetical protein MIMGU_mgv1a000455mg [Erythranthe guttata]
Length=1141

 Score =   159 bits (401),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA S E+WID LQ SSLFWPPPQDA+QRK QITAYVEYFGQFTSEHFP++IAELIR+RYP
Sbjct  1    MATSNEKWIDSLQPSSLFWPPPQDAEQRKAQITAYVEYFGQFTSEHFPDEIAELIRSRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGH  428
            SKENRLFDDVLATF+LHHPEHGH
Sbjct  61   SKENRLFDDVLATFVLHHPEHGH  83


 Score = 89.7 bits (221),  Expect(2) = 4e-57, Method: Composition-based stats.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G +VIHPIISCIID TLEYDK+ PPFASFISLV P S+NE SEQWALACG
Sbjct  82   GHSVIHPIISCIIDSTLEYDKSGPPFASFISLVSPKSENEYSEQWALACG  131



>gb|KHN41309.1| Protein GIGANTEA [Glycine soja]
Length=1166

 Score =   146 bits (369),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            AAS ERW+DRLQFSSLFWPPP D QQRKDQ+ AYVEY GQFTSE F EDIAELIRN YPS
Sbjct  3    AASGERWMDRLQFSSLFWPPPLDDQQRKDQVAAYVEYIGQFTSEQFSEDIAELIRNHYPS  62

Query  363  KENRLFDDVLATFLLHHPEHGHG  431
            KE  LFDDVLA  +LHHPEHGH 
Sbjct  63   KEMLLFDDVLAVLVLHHPEHGHA  85


 Score = 91.3 bits (225),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+ PIISCIIDGTL+YDK SPPFASFISLVCP ++NE SEQWA+ACG
Sbjct  83   GHAVVLPIISCIIDGTLDYDKTSPPFASFISLVCPKNENEYSEQWAMACG  132



>gb|KJB59492.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=1055

 Score =   155 bits (391),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA   +RWID LQFSSLFWPPPQD Q+RK QITAYVEYFGQFTSE FPEDIAELIR RYP
Sbjct  1    MANPSKRWIDGLQFSSLFWPPPQDPQERKVQITAYVEYFGQFTSEQFPEDIAELIRTRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SKE RLFDDVLATF+LHHPEHGH 
Sbjct  61   SKEQRLFDDVLATFVLHHPEHGHA  84


 Score = 81.6 bits (200),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+ PIIS IIDG+L YDK+S PFASFISLVCP+S+NE SEQWALACG
Sbjct  82   GHAVVLPIISGIIDGSLVYDKSSLPFASFISLVCPSSENEYSEQWALACG  131



>gb|KCW69153.1| hypothetical protein EUGRSUZ_F02686 [Eucalyptus grandis]
Length=1167

 Score =   147 bits (372),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  186  ASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSK  365
            A+CERWID LQ+SSLFWPPPQD  Q+K Q+ AYVE FGQFTSE FP+DIAELIR+RYPSK
Sbjct  2    AACERWIDGLQYSSLFWPPPQDILQKKAQVNAYVELFGQFTSEQFPDDIAELIRSRYPSK  61

Query  366  ENRLFDDVLATFLLHHPEHGHG  431
            E  LFDDVLATF+LHHPEHGH 
Sbjct  62   EKCLFDDVLATFVLHHPEHGHA  83


 Score = 87.4 bits (215),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+ PIISC+IDG+L YD++ PPFASFISLVCP+S+NE SEQWALACG
Sbjct  81   GHAVVLPIISCLIDGSLVYDRDKPPFASFISLVCPSSENEYSEQWALACG  130



>ref|XP_010062087.1| PREDICTED: protein GIGANTEA isoform X1 [Eucalyptus grandis]
 ref|XP_010062088.1| PREDICTED: protein GIGANTEA isoform X1 [Eucalyptus grandis]
 ref|XP_010062089.1| PREDICTED: protein GIGANTEA isoform X1 [Eucalyptus grandis]
 gb|KCW69154.1| hypothetical protein EUGRSUZ_F02686 [Eucalyptus grandis]
Length=1166

 Score =   147 bits (372),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  186  ASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSK  365
            A+CERWID LQ+SSLFWPPPQD  Q+K Q+ AYVE FGQFTSE FP+DIAELIR+RYPSK
Sbjct  2    AACERWIDGLQYSSLFWPPPQDILQKKAQVNAYVELFGQFTSEQFPDDIAELIRSRYPSK  61

Query  366  ENRLFDDVLATFLLHHPEHGHG  431
            E  LFDDVLATF+LHHPEHGH 
Sbjct  62   EKCLFDDVLATFVLHHPEHGHA  83


 Score = 87.4 bits (215),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+ PIISC+IDG+L YD++ PPFASFISLVCP+S+NE SEQWALACG
Sbjct  81   GHAVVLPIISCLIDGSLVYDRDKPPFASFISLVCPSSENEYSEQWALACG  130



>ref|XP_010097648.1| hypothetical protein L484_023788 [Morus notabilis]
 gb|EXB70603.1| hypothetical protein L484_023788 [Morus notabilis]
Length=1195

 Score =   144 bits (364),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA + ERWIDRLQFSSLF  P QDA Q+K Q+ AYV+YFGQFTSE FP+DIAELIRNRYP
Sbjct  1    MADTRERWIDRLQFSSLFCHPSQDAHQKKAQVIAYVDYFGQFTSEQFPDDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SKE+RLFDDVLATF+LHHPEHGH 
Sbjct  61   SKEHRLFDDVLATFVLHHPEHGHA  84


 Score = 86.3 bits (212),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+ PIIS IIDGTL YD+ +PPFASFISLVCP+S+NE SEQWALACG
Sbjct  82   GHAVVLPIISGIIDGTLVYDRTTPPFASFISLVCPSSENEYSEQWALACG  131



>ref|XP_010681263.1| PREDICTED: protein GIGANTEA [Beta vulgaris subsp. vulgaris]
 ref|XP_010681268.1| PREDICTED: protein GIGANTEA [Beta vulgaris subsp. vulgaris]
Length=1178

 Score =   145 bits (365),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  195  ERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENR  374
            ERWID LQFSSLFWPPPQ+ QQRK Q TAYVEYFGQF SE FPED+AELIR+RYP  E R
Sbjct  6    ERWIDGLQFSSLFWPPPQETQQRKAQTTAYVEYFGQFISEQFPEDLAELIRSRYPFDEKR  65

Query  375  LFDDVLATFLLHHPEHGHG  431
            LFDDVLATF+LHHPEHGH 
Sbjct  66   LFDDVLATFVLHHPEHGHA  84


 Score = 85.5 bits (210),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+ PIIS IIDGTL YDK  PPFASFISL CPN +NE SEQWALACG
Sbjct  82   GHAVVLPIISIIIDGTLVYDKERPPFASFISLFCPNDENEYSEQWALACG  131



>dbj|BAK19067.1| GIGANTEA [Ipomoea nil]
Length=1166

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP
Sbjct  1    MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SKENRLFDDVLATFLLHHPEHGH 
Sbjct  61   SKENRLFDDVLATFLLHHPEHGHA  84


 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 53/67 (79%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE
Sbjct  69   DVLATFLLHHPE----HGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>ref|XP_004140955.1| PREDICTED: protein GIGANTEA-like [Cucumis sativus]
 gb|KGN46115.1| hypothetical protein Csa_6G055360 [Cucumis sativus]
Length=1170

 Score =   143 bits (361),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+S ERWIDRLQFSSLFW PP+D QQRK +IT YVE  GQFTSE FPEDIAELIR+ YP
Sbjct  2    MASSSERWIDRLQFSSLFWTPPRDEQQRKAEITTYVECLGQFTSEQFPEDIAELIRSHYP  61

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
             KE RL DDVLATF+LHHPEHGH 
Sbjct  62   WKEKRLIDDVLATFVLHHPEHGHA  85


 Score = 75.9 bits (185),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AVI PIISCIIDGT+ Y K+  PF+SFISL CP+++++ SEQWALACG
Sbjct  83   GHAVILPIISCIIDGTMVYCKDGSPFSSFISLFCPDTEHDYSEQWALACG  132



>ref|XP_004160322.1| PREDICTED: protein GIGANTEA-like, partial [Cucumis sativus]
Length=994

 Score =   143 bits (361),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+S ERWIDRLQFSSLFW PP+D QQRK +IT YVE  GQFTSE FPEDIAELIR+ YP
Sbjct  2    MASSSERWIDRLQFSSLFWTPPRDEQQRKAEITTYVECLGQFTSEQFPEDIAELIRSHYP  61

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
             KE RL DDVLATF+LHHPEHGH 
Sbjct  62   WKEKRLIDDVLATFVLHHPEHGHA  85


 Score = 75.9 bits (185),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AVI PIISCIIDGT+ Y K+  PF+SFISL CP+++++ SEQWALACG
Sbjct  83   GHAVILPIISCIIDGTMVYCKDGSPFSSFISLFCPDTEHDYSEQWALACG  132



>ref|XP_008456743.1| PREDICTED: protein GIGANTEA-like [Cucumis melo]
 ref|XP_008456744.1| PREDICTED: protein GIGANTEA-like [Cucumis melo]
 ref|XP_008456745.1| PREDICTED: protein GIGANTEA-like [Cucumis melo]
Length=1170

 Score =   142 bits (359),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+S ERWIDRLQFSSLFW PP+D QQRK +IT YVE  GQFTSE FPEDIAELIR+ YP
Sbjct  2    MASSSERWIDRLQFSSLFWTPPRDEQQRKAEITTYVECLGQFTSEQFPEDIAELIRSHYP  61

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
             +E RL DDVLATF+LHHPEHGH 
Sbjct  62   WREKRLIDDVLATFVLHHPEHGHA  85


 Score = 76.6 bits (187),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AVI PIISCIIDGT+ Y K+  PF+SFISL CP+++++ SEQWALACG
Sbjct  83   GHAVILPIISCIIDGTMAYCKDGSPFSSFISLFCPDTEHDYSEQWALACG  132



>ref|XP_010915066.1| PREDICTED: protein GIGANTEA-like [Elaeis guineensis]
Length=1171

 Score =   142 bits (359),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M+ S E+WID LQFSSL WPPPQD QQR+ QI AYVEYFGQF SE FPED+A+LI+N YP
Sbjct  1    MSVSNEKWIDGLQFSSLLWPPPQDEQQRQAQIVAYVEYFGQFISEQFPEDVAQLIQNYYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SKE RL DDVLA F+LHHPEHGH 
Sbjct  61   SKEKRLLDDVLAIFVLHHPEHGHA  84


 Score = 75.9 bits (185),  Expect(2) = 4e-48, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G A++HPI+S IIDGTL YDKN PPF+SFISL   N++ + +EQWALACG
Sbjct  82   GHAIVHPILSRIIDGTLVYDKNDPPFSSFISLFSQNNEKDYNEQWALACG  131



>ref|XP_009408935.1| PREDICTED: protein GIGANTEA-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=1163

 Score =   139 bits (349),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA S E+WID LQFSSLFWPPPQD  QR+ Q+ AYVEYF QFTSE FPEDIA+LI++ YP
Sbjct  1    MAVSNEKWIDGLQFSSLFWPPPQDETQRQAQVLAYVEYFSQFTSEEFPEDIAQLIQSHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SKE RL D+VLA F+LHHPEHGH 
Sbjct  61   SKEKRLLDEVLALFILHHPEHGHA  84


 Score = 78.6 bits (192),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G A++HPI+S IIDGTL Y++N+PPF+SFISLV  NS+ + SEQWALACG
Sbjct  82   GHAIVHPILSLIIDGTLVYNRNNPPFSSFISLVSQNSEKQCSEQWALACG  131



>ref|XP_009408933.1| PREDICTED: protein GIGANTEA-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009408934.1| PREDICTED: protein GIGANTEA-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=1205

 Score =   138 bits (348),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA S E+WID LQFSSLFWPPPQD  QR+ Q+ AYVEYF QFTSE FPEDIA+LI++ YP
Sbjct  1    MAVSNEKWIDGLQFSSLFWPPPQDETQRQAQVLAYVEYFSQFTSEEFPEDIAQLIQSHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SKE RL D+VLA F+LHHPEHGH 
Sbjct  61   SKEKRLLDEVLALFILHHPEHGHA  84


 Score = 78.6 bits (192),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G A++HPI+S IIDGTL Y++N+PPF+SFISLV  NS+ + SEQWALACG
Sbjct  82   GHAIVHPILSLIIDGTLVYNRNNPPFSSFISLVSQNSEKQCSEQWALACG  131



>ref|XP_008786518.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
 ref|XP_008786528.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
 ref|XP_008786537.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
Length=1170

 Score =   139 bits (349),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M+ S  +WID LQFSSL WPPP D QQR+ QITAYVEYFGQFTSE FPED+A+LI+N YP
Sbjct  1    MSISYGKWIDGLQFSSLLWPPPHDEQQRQAQITAYVEYFGQFTSEQFPEDVAQLIQNYYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SKE RL D+VLA F+LHHPEHGH 
Sbjct  61   SKEKRLLDEVLAIFVLHHPEHGHA  84


 Score = 76.6 bits (187),  Expect(2) = 3e-47, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G A++HPI+S IIDGTL YDKN PPF+SFI LV  N++ E +EQWALACG
Sbjct  82   GHAIVHPILSRIIDGTLVYDKNDPPFSSFIYLVSQNNEKEYNEQWALACG  131



>ref|XP_009381150.1| PREDICTED: protein GIGANTEA-like [Musa acuminata subsp. malaccensis]
Length=1171

 Score =   133 bits (334),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M+ S E+WID LQFSSLFWPPPQD  QR+ Q+ AYVEYF QFT+E FPEDI +LI+  YP
Sbjct  1    MSISNEKWIDGLQFSSLFWPPPQDENQRQAQVLAYVEYFSQFTTEEFPEDITQLIQTHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            S+E RL D+VLA F+LHHPEHGH 
Sbjct  61   SQEKRLLDEVLAIFILHHPEHGHA  84


 Score = 82.0 bits (201),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G A++HPI+S IIDGTL YD+N PPF+SFISLV  NS+ E SEQWALACG
Sbjct  82   GHAIVHPILSLIIDGTLVYDRNDPPFSSFISLVGQNSEKEYSEQWALACG  131



>ref|NP_001042220.1| Os01g0182600 [Oryza sativa Japonica Group]
 sp|Q9AWL7.2|GIGAN_ORYSJ RecName: Full=Protein GIGANTEA [Oryza sativa Japonica Group]
 dbj|BAD68052.1| putative gigantea [Oryza sativa Japonica Group]
 dbj|BAF04134.1| Os01g0182600 [Oryza sativa Japonica Group]
Length=1160

 Score =   140 bits (354),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+AS E+WID LQFSSLFWPPPQD+QQ++ QI AYVEYFGQFT  SE FPEDIA+LI++ 
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDSQQKQAQILAYVEYFGQFTADSEQFPEDIAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YPSKE RL D+VLATF+LHHPEHGH 
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHA  86


 Score = 74.7 bits (182),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+HPI+S IIDGTL YD+N  PF SFISL    S+ E SEQWALACG
Sbjct  84   GHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTSEKEYSEQWALACG  133



>gb|EEE54000.1| hypothetical protein OsJ_00641 [Oryza sativa Japonica Group]
Length=1176

 Score =   140 bits (353),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+AS E+WID LQFSSLFWPPPQD+QQ++ QI AYVEYFGQFT  SE FPEDIA+LI++ 
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDSQQKQAQILAYVEYFGQFTADSEQFPEDIAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YPSKE RL D+VLATF+LHHPEHGH 
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHA  86


 Score = 74.3 bits (181),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+HPI+S IIDGTL YD+N  PF SFISL    S+ E SEQWALACG
Sbjct  84   GHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTSEKEYSEQWALACG  133



>ref|XP_010925341.1| PREDICTED: protein GIGANTEA-like [Elaeis guineensis]
Length=1170

 Score =   140 bits (352),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M+ S E+WID LQFSSLFWPPPQD QQR+ QI AYVEYFGQFTSE FPED+A+LI+N YP
Sbjct  1    MSVSYEKWIDGLQFSSLFWPPPQDEQQRQVQIMAYVEYFGQFTSERFPEDVAQLIQNYYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
             KE RL D+VLA F+LHHPEHGH 
Sbjct  61   YKEKRLLDEVLAIFVLHHPEHGHA  84


 Score = 74.7 bits (182),  Expect(2) = 4e-47, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G A++HPI+S IIDGTL YDKN PPF SFI LV  N++ E +EQWALAC 
Sbjct  82   GHAIVHPILSRIIDGTLVYDKNDPPFCSFIYLVSQNNEKEYNEQWALACA  131



>gb|EEC70061.1| hypothetical protein OsI_00663 [Oryza sativa Indica Group]
Length=1176

 Score =   140 bits (353),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+AS E+WID LQFSSLFWPPPQD+QQ++ QI AYVEYFGQFT  SE FPEDIA+LI++ 
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDSQQKQAQILAYVEYFGQFTADSEQFPEDIAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YPSKE RL D+VLATF+LHHPEHGH 
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHA  86


 Score = 74.3 bits (181),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+HPI+S IIDGTL YD+N  PF SFISL    S+ E SEQWALACG
Sbjct  84   GHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTSEKEYSEQWALACG  133



>gb|EPS65289.1| hypothetical protein M569_09488 [Genlisea aurea]
Length=305

 Score =   143 bits (360),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA  E+W D LQFSSLFWPPPQD  QRK Q+ A+VEYFGQFTSE FP++IAELIR+RYP
Sbjct  1    MAALTEKWTDSLQFSSLFWPPPQDEGQRKAQVAAFVEYFGQFTSEQFPDEIAELIRSRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGH  428
            S+ +RLFDDVLATF+LHHPEHGH
Sbjct  61   SQRSRLFDDVLATFVLHHPEHGH  83


 Score = 71.6 bits (174),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G  VI PIISC+ID ++EYDK+  PF+SFISL   N++N+ SEQWALACG
Sbjct  82   GHDVILPIISCVIDSSVEYDKDGAPFSSFISLFSLNTENDYSEQWALACG  131



>ref|XP_008793464.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
Length=1169

 Score =   139 bits (349),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M+ S E+WID LQFSSL W PPQD +QR+ QI AYVEYFGQFTSE FPED+A+LI+N YP
Sbjct  1    MSVSNEKWIDGLQFSSLLWRPPQDERQRQAQIVAYVEYFGQFTSEQFPEDVAQLIQNYYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SKE RL DDVLA F+LHHPEHGH 
Sbjct  61   SKEKRLLDDVLAIFVLHHPEHGHA  84


 Score = 75.9 bits (185),  Expect(2) = 5e-47, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G A++HPI+S IIDGTL YDKN PPF+SFISL   N++ + +EQWALACG
Sbjct  82   GHAIVHPILSRIIDGTLVYDKNDPPFSSFISLFSQNNEKDYNEQWALACG  131



>ref|XP_006643836.1| PREDICTED: protein GIGANTEA-like isoform X1 [Oryza brachyantha]
 ref|XP_006643837.1| PREDICTED: protein GIGANTEA-like isoform X2 [Oryza brachyantha]
Length=1162

 Score =   140 bits (352),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 74/86 (86%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+AS E+WID LQFSSLFWPPPQD QQ++ QI AYVEYFGQFT  SE FPEDIA+LI++ 
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDVQQKQAQILAYVEYFGQFTADSEQFPEDIAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YPSKE RL D+VLATF+LHHPEHGH 
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHA  86


 Score = 73.9 bits (180),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+HPI+S IIDGT+ YD+N  PF SFISL    S+ E SEQWALACG
Sbjct  84   GHAVVHPILSRIIDGTMSYDRNGFPFKSFISLFSHTSEKEYSEQWALACG  133



>gb|ACJ65314.1| GI3 protein [Glycine max]
Length=1155

 Score =   121 bits (303),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 61/83 (73%), Gaps = 11/83 (13%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            AAS ERW+DRLQFSSLFWPPP D QQRKDQ+ AYVEY GQFTSE F EDIAELIRN YPS
Sbjct  3    AASGERWMDRLQFSSLFWPPPLDDQQRKDQVAAYVEYIGQFTSEQFSEDIAELIRNHYPS  62

Query  363  KENRLFDDVLATFLLHHPEHGHG  431
            KE  LFDD           HGH 
Sbjct  63   KEMLLFDD-----------HGHA  74


 Score = 92.4 bits (228),  Expect(2) = 1e-46, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+ PIISCIIDGTL+YDK SPPFASFISLVCP ++NE SEQWA+ACG
Sbjct  72   GHAVVLPIISCIIDGTLDYDKTSPPFASFISLVCPKNENEYSEQWAMACG  121



>pir||T00767 hypothetical protein T22J18.6 - Arabidopsis thaliana
 gb|AAC25507.1|AAC25507 T22J18.6 [Arabidopsis thaliana]
Length=1070

 Score =   132 bits (332),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 70/95 (74%), Gaps = 12/95 (13%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLA------------TFLLHHPEHGHG  431
             E RL DDVL              F+LHHPEHGH 
Sbjct  64   TEKRLLDDVLGMINIYDPHFSFSMFVLHHPEHGHA  98


 Score = 80.9 bits (198),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SEQWALACG
Sbjct  96   GHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALACG  145



>gb|ACJ09488.1| putative gigantea, partial [Oryza sativa Japonica Group]
Length=208

 Score =   138 bits (347),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+AS E+WID LQFSSLFWPPPQD+QQ++ QI AYVEYFGQFT  SE FPEDIA+LI++ 
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDSQQKQAQILAYVEYFGQFTADSEQFPEDIAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YPSKE RL D+VLATF+LHHPEHGH 
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHA  86


 Score = 74.3 bits (181),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+HPI+S IIDGTL YD+N  PF SFISL    S+ E SEQWALACG
Sbjct  84   GHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTSEKEYSEQWALACG  133



>gb|ACJ09482.1| putative gigantea, partial [Oryza sativa Japonica Group]
Length=208

 Score =   137 bits (346),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+AS E+WID LQFSSLFWPPPQD+QQ++ QI AYVEYFGQFT  SE FPEDIA+LI++ 
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDSQQKQAQILAYVEYFGQFTANSEQFPEDIAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YPSKE RL D+VLATF+LHHPEHGH 
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHA  86


 Score = 74.3 bits (181),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+HPI+S IIDGTL YD+N  PF SFISL    S+ E SEQWALACG
Sbjct  84   GHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTSEKEYSEQWALACG  133



>gb|ACJ09478.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09484.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09485.1| putative gigantea, partial [Oryza sativa Indica Group]
 gb|ACJ09486.1| putative gigantea, partial [Oryza sativa Indica Group]
 gb|ACJ09487.1| putative gigantea, partial [Oryza sativa]
 gb|ACJ09489.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09490.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09491.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09492.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09493.1| putative gigantea, partial [Oryza sativa Japonica Group]
Length=208

 Score =   137 bits (346),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+AS E+WID LQFSSLFWPPPQD+QQ++ QI AYVEYFGQFT  SE FPEDIA+LI++ 
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDSQQKQAQILAYVEYFGQFTADSEQFPEDIAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YPSKE RL D+VLATF+LHHPEHGH 
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHA  86


 Score = 74.3 bits (181),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+HPI+S IIDGTL YD+N  PF SFISL    S+ E SEQWALACG
Sbjct  84   GHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTSEKEYSEQWALACG  133



>gb|ACJ09481.1| putative gigantea, partial [Oryza sativa Indica Group]
Length=208

 Score =   137 bits (345),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+AS E+WID LQFSSLFWPPPQD+QQ++ Q+ AYVEYFGQFT  SE FPEDIA+LI++ 
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDSQQKQAQVLAYVEYFGQFTADSEQFPEDIAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YPSKE RL D+VLATF+LHHPEHGH 
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHA  86


 Score = 74.3 bits (181),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+HPI+S IIDGTL YD+N  PF SFISL    S+ E SEQWALACG
Sbjct  84   GHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTSEKEYSEQWALACG  133



>gb|ACJ09480.1| putative gigantea, partial [Oryza sativa Indica Group]
Length=208

 Score =   135 bits (341),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 74/86 (86%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+AS E+WID LQF SLFWPPPQD+QQ++ QI AYVEYFGQFT  SE FPEDIA+LI++ 
Sbjct  1    MSASNEKWIDGLQFPSLFWPPPQDSQQKQAQILAYVEYFGQFTADSEQFPEDIAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YPSKE RL D+VLATF+LHHPEHGH 
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHA  86


 Score = 73.9 bits (180),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+HPI+S IIDGTL YD+N  PF SFISL    S+ E SEQWALACG
Sbjct  84   GHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTSEKEYSEQWALACG  133



>gb|ACJ09483.1| putative gigantea, partial [Oryza sativa Japonica Group]
Length=208

 Score =   135 bits (341),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 74/86 (86%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+A  E+WID LQFSSLFWPPPQD+QQ++ QI AYVEYFGQFT  SE FPEDIA+LI++ 
Sbjct  1    MSAPNEKWIDGLQFSSLFWPPPQDSQQKQAQILAYVEYFGQFTADSEQFPEDIAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YPSKE RL D+VLATF+LHHPEHGH 
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHA  86


 Score = 73.9 bits (180),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+HPI+S IIDGTL YD+N  PF SFISL    S+ E SEQWALACG
Sbjct  84   GHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTSEKEYSEQWALACG  133



>gb|AAW66945.1| gigantea-like protein [Hordeum vulgare]
 gb|AAW66946.1| gigantea-like protein [Hordeum vulgare subsp. vulgare]
Length=1155

 Score =   137 bits (344),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 72/86 (84%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+AS  +WID LQFSSLFWPPP DAQQ++ QI AYVEYFGQFT  SE FPED+A+LI+  
Sbjct  1    MSASNGKWIDGLQFSSLFWPPPHDAQQKQAQILAYVEYFGQFTSDSEQFPEDVAQLIQTC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YPSKE RL D+VLATF+LHHPEHGH 
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHA  86


 Score = 72.4 bits (176),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+HPI+S IIDGTL YD +  PF SFISL   +S+ E SEQWALACG
Sbjct  84   GHAVVHPILSRIIDGTLSYDSHGSPFNSFISLFTQSSEKEYSEQWALACG  133



>ref|XP_006359040.1| PREDICTED: protein GIGANTEA-like isoform X2 [Solanum tuberosum]
Length=1166

 Score =   171 bits (433),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/83 (92%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+CERWID LQ+SS+FWPPPQDAQQRK QITAYVEYFGQFTSE FPEDIAELIRNRYP
Sbjct  1    MAATCERWIDGLQYSSIFWPPPQDAQQRKAQITAYVEYFGQFTSEQFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGH  428
            SKENRLFDDVLATF+LHHPEHGH
Sbjct  61   SKENRLFDDVLATFVLHHPEHGH  83


 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 47/67 (70%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G  VI PIISCIIDGTL+YDK+ PPF SFISLVCP+S+ E SE
Sbjct  69   DVLATFVLHHPE----HGHTVILPIISCIIDGTLDYDKSCPPFTSFISLVCPSSEKEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>ref|XP_009631434.1| PREDICTED: protein GIGANTEA-like isoform X5 [Nicotiana tomentosiformis]
Length=1155

 Score =   171 bits (433),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+CERWID LQFSSLFWPPPQDAQQRK QITAYVEYFGQFTSE FPEDIAELIR+RYP
Sbjct  1    MAATCERWIDGLQFSSLFWPPPQDAQQRKAQITAYVEYFGQFTSEQFPEDIAELIRHRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SKENRLFDDVLATF+LHHPEHGH 
Sbjct  61   SKENRLFDDVLATFVLHHPEHGHA  84


 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AVI PIISCIIDGTL+YDK+ PPFASFISLVCP+S+ E SE
Sbjct  69   DVLATFVLHHPE----HGHAVILPIISCIIDGTLDYDKSCPPFASFISLVCPSSEKEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>ref|XP_009631433.1| PREDICTED: protein GIGANTEA-like isoform X4 [Nicotiana tomentosiformis]
Length=1159

 Score =   171 bits (432),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+CERWID LQFSSLFWPPPQDAQQRK QITAYVEYFGQFTSE FPEDIAELIR+RYP
Sbjct  1    MAATCERWIDGLQFSSLFWPPPQDAQQRKAQITAYVEYFGQFTSEQFPEDIAELIRHRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SKENRLFDDVLATF+LHHPEHGH 
Sbjct  61   SKENRLFDDVLATFVLHHPEHGHA  84


 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AVI PIISCIIDGTL+YDK+ PPFASFISLVCP+S+ E SE
Sbjct  69   DVLATFVLHHPE----HGHAVILPIISCIIDGTLDYDKSCPPFASFISLVCPSSEKEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>ref|XP_009631431.1| PREDICTED: protein GIGANTEA-like isoform X2 [Nicotiana tomentosiformis]
Length=1169

 Score =   171 bits (432),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+CERWID LQFSSLFWPPPQDAQQRK QITAYVEYFGQFTSE FPEDIAELIR+RYP
Sbjct  1    MAATCERWIDGLQFSSLFWPPPQDAQQRKAQITAYVEYFGQFTSEQFPEDIAELIRHRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SKENRLFDDVLATF+LHHPEHGH 
Sbjct  61   SKENRLFDDVLATFVLHHPEHGHA  84


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 49/81 (60%), Gaps = 18/81 (22%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQ-----  537
            D L  F  H        G AVI PIISCIIDGTL+YDK+ PPFASFISLVCP+S+     
Sbjct  69   DVLATFVLHHPE----HGHAVILPIISCIIDGTLDYDKSCPPFASFISLVCPSSEVLRIL  124

Query  538  ---------NELSEQWALACG  573
                      E SEQWALACG
Sbjct  125  NYQFEGLSHKEYSEQWALACG  145



>ref|XP_009631429.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009631430.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nicotiana tomentosiformis]
Length=1173

 Score =   171 bits (432),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+CERWID LQFSSLFWPPPQDAQQRK QITAYVEYFGQFTSE FPEDIAELIR+RYP
Sbjct  1    MAATCERWIDGLQFSSLFWPPPQDAQQRKAQITAYVEYFGQFTSEQFPEDIAELIRHRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SKENRLFDDVLATF+LHHPEHGH 
Sbjct  61   SKENRLFDDVLATFVLHHPEHGHA  84


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 49/81 (60%), Gaps = 18/81 (22%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQ-----  537
            D L  F  H        G AVI PIISCIIDGTL+YDK+ PPFASFISLVCP+S+     
Sbjct  69   DVLATFVLHHPE----HGHAVILPIISCIIDGTLDYDKSCPPFASFISLVCPSSEVLRIL  124

Query  538  ---------NELSEQWALACG  573
                      E SEQWALACG
Sbjct  125  NYQFEGLSHKEYSEQWALACG  145



>emb|CDP11443.1| unnamed protein product [Coffea canephora]
Length=1167

 Score =   171 bits (432),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAASCERWID LQFSSLFWPPPQDA+QRK QITAYVEYFGQFTSE FPEDIAELIRNRYP
Sbjct  1    MAASCERWIDGLQFSSLFWPPPQDAEQRKAQITAYVEYFGQFTSEAFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            S+ENRLFDDVLATF+LHHPEHGH 
Sbjct  61   SEENRLFDDVLATFVLHHPEHGHA  84


 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AVI PIISCIIDG LEYDKN PPFASFISLVCP+S+NE SE
Sbjct  69   DVLATFVLHHPE----HGHAVILPIISCIIDGLLEYDKNCPPFASFISLVCPSSENEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>gb|AFW80279.1| gigantea1A isoform 1 [Zea mays]
 gb|AFW80280.1| gigantea1A isoform 2 [Zea mays]
Length=968

 Score =   130 bits (328),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+ S  +WID LQF+SL+WPPP DA+Q++ QI AYVEYFGQFT  ++ FPEDIA+LI++ 
Sbjct  1    MSDSNVKWIDGLQFTSLYWPPPLDAEQKQAQILAYVEYFGQFTADTDQFPEDIAQLIQSS  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YPSKENRL D+VLATF+LHHPEHGH 
Sbjct  61   YPSKENRLVDEVLATFVLHHPEHGHA  86


 Score = 76.6 bits (187),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV HPI+S IIDGTL YD++ PPF+SFISL   NS+ E SEQWALACG
Sbjct  84   GHAVAHPILSRIIDGTLCYDRHGPPFSSFISLFSHNSEQEYSEQWALACG  133



>ref|NP_001288586.1| gigantea like1a [Zea mays]
 ref|XP_008655715.1| PREDICTED: protein GIGANTEA [Zea mays]
 ref|XP_008655716.1| PREDICTED: protein GIGANTEA [Zea mays]
 tpg|DAA06172.1| TPA_inf: gigantea 1A [Zea mays]
 gb|AFW80283.1| gigantea isoform 1 [Zea mays]
 gb|AFW80284.1| gigantea isoform 2 [Zea mays]
Length=1162

 Score =   131 bits (329),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+ S  +WID LQF+SL+WPPP DA+Q++ QI AYVEYFGQFT  ++ FPEDIA+LI++ 
Sbjct  1    MSDSNVKWIDGLQFTSLYWPPPLDAEQKQAQILAYVEYFGQFTADTDQFPEDIAQLIQSS  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YPSKENRL D+VLATF+LHHPEHGH 
Sbjct  61   YPSKENRLVDEVLATFVLHHPEHGHA  86


 Score = 76.6 bits (187),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV HPI+S IIDGTL YD++ PPF+SFISL   NS+ E SEQWALACG
Sbjct  84   GHAVAHPILSRIIDGTLCYDRHGPPFSSFISLFSHNSEQEYSEQWALACG  133



>gb|AFW80282.1| gigantea1A [Zea mays]
Length=1085

 Score =   130 bits (328),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+ S  +WID LQF+SL+WPPP DA+Q++ QI AYVEYFGQFT  ++ FPEDIA+LI++ 
Sbjct  1    MSDSNVKWIDGLQFTSLYWPPPLDAEQKQAQILAYVEYFGQFTADTDQFPEDIAQLIQSS  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YPSKENRL D+VLATF+LHHPEHGH 
Sbjct  61   YPSKENRLVDEVLATFVLHHPEHGHA  86


 Score = 76.6 bits (187),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV HPI+S IIDGTL YD++ PPF+SFISL   NS+ E SEQWALACG
Sbjct  84   GHAVAHPILSRIIDGTLCYDRHGPPFSSFISLFSHNSEQEYSEQWALACG  133



>ref|XP_003564357.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230544.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230545.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230546.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230547.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
Length=1155

 Score =   134 bits (337),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 73/86 (85%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+AS  +WID LQ+SSLFWPPP DAQQ++ QI AYVEYFGQFT  SE FPED+A+LI++ 
Sbjct  1    MSASNGKWIDGLQYSSLFWPPPHDAQQKQVQILAYVEYFGQFTSDSEQFPEDVAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YP+KE RL D+VLATF+LHHPEHGH 
Sbjct  61   YPAKEKRLVDEVLATFVLHHPEHGHA  86


 Score = 72.8 bits (177),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+HPI+S IIDGTL YD++  PF SFISL    S+ E SEQWALACG
Sbjct  84   GHAVVHPILSRIIDGTLSYDRHGFPFNSFISLFTQTSEKEYSEQWALACG  133



>ref|XP_009772049.1| PREDICTED: protein GIGANTEA-like [Nicotiana sylvestris]
Length=1155

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+CERWID LQFSSLFWPPPQDAQQRK QITAYVEYFGQFTSE FPEDIAELIR+RYP
Sbjct  1    MAATCERWIDGLQFSSLFWPPPQDAQQRKAQITAYVEYFGQFTSEQFPEDIAELIRHRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SKENRLFDDVLATF+LHHP+HGH 
Sbjct  61   SKENRLFDDVLATFVLHHPDHGHA  84


 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AVI PIISCIIDGTL+YDK+ PPFASFISLVCPNS+ E SE
Sbjct  69   DVLATFVLHHPD----HGHAVILPIISCIIDGTLDYDKSCPPFASFISLVCPNSEKEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>gb|AIC83986.1| gigantea-like protein [Festuca pratensis]
Length=1149

 Score =   135 bits (339),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 72/86 (84%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+AS  +WID LQFSSLFWPPP DAQQ++ Q  AYVEYFGQFT  SE FPED+A+LI++ 
Sbjct  1    MSASNGKWIDGLQFSSLFWPPPHDAQQKQAQTLAYVEYFGQFTSDSEQFPEDVAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YPSKE RL D+VLATF+LHHPEHGH 
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHA  86


 Score = 71.2 bits (173),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+HPI+S IIDG+L YD++  PF SFISL    ++ E SEQWALACG
Sbjct  84   GHAVVHPILSRIIDGSLSYDRHGSPFNSFISLFTQTAEKEYSEQWALACG  133



>emb|CDM81775.1| unnamed protein product [Triticum aestivum]
Length=1155

 Score =   134 bits (336),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 71/86 (83%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+ S  +WID LQFSSLFWPPP D QQ++ QI AYVEYFGQFT  SE FPED+A+LI++ 
Sbjct  1    MSVSNGKWIDGLQFSSLFWPPPHDVQQKQAQILAYVEYFGQFTSDSEQFPEDVAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YPSKE RL D+VLATF+LHHPEHGH 
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHA  86


 Score = 72.4 bits (176),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+HPI+S IIDGTL YD +  PF SFISL   +S+ E SEQWALACG
Sbjct  84   GHAVVHPILSRIIDGTLSYDSHGSPFNSFISLFTQSSEKEYSEQWALACG  133



>gb|AAQ11738.1| gigantea [Triticum aestivum]
Length=1155

 Score =   134 bits (336),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 71/86 (83%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+ S  +WID LQFSSLFWPPP D QQ++ QI AYVEYFGQFT  SE FPED+A+LI++ 
Sbjct  1    MSVSNGKWIDGLQFSSLFWPPPHDVQQKQAQILAYVEYFGQFTSDSEQFPEDVAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YPSKE RL D+VLATF+LHHPEHGH 
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHA  86


 Score = 72.4 bits (176),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+HPI+S IIDGTL YD +  PF SFISL   +S+ E SEQWALACG
Sbjct  84   GHAVVHPILSRIIDGTLSYDSHGSPFNSFISLFTQSSEKEYSEQWALACG  133



>gb|AAT79487.1| gigantea 3 [Triticum aestivum]
Length=1155

 Score =   133 bits (335),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 71/86 (83%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+ S  +WID LQFSSLFWPPP D QQ++ QI AYVEYFGQFT  SE FPED+A+LI++ 
Sbjct  1    MSVSNGKWIDGLQFSSLFWPPPHDVQQKQAQILAYVEYFGQFTSDSEQFPEDVAQLIQSY  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YPSKE RL D+VLATF+LHHPEHGH 
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHA  86


 Score = 72.4 bits (176),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+HPI+S IIDGTL YD +  PF SFISL   +S+ E SEQWALACG
Sbjct  84   GHAVVHPILSRIIDGTLSYDSHGSPFNSFISLFTQSSEKEYSEQWALACG  133



>gb|ABZ81992.1| gigantea [Zea mays]
Length=1162

 Score =   129 bits (324),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 72/86 (84%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+ S  +WID LQF+SL+WPPP DA+Q++ QI AYVEYFGQFT  ++ FPEDIA+LI++ 
Sbjct  1    MSESNVKWIDGLQFTSLYWPPPLDAEQKQAQILAYVEYFGQFTADTDQFPEDIAQLIQSS  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YPSKENRL  +VLATF+LHHPEHGH 
Sbjct  61   YPSKENRLVGEVLATFVLHHPEHGHA  86


 Score = 76.6 bits (187),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV HPI+S IIDGTL YD++ PPF+SFISL   NS+ E SEQWALACG
Sbjct  84   GHAVAHPILSRIIDGTLCYDRHGPPFSSFISLFSHNSEQEYSEQWALACG  133



>ref|NP_001140728.1| uncharacterized protein LOC100272803 [Zea mays]
 tpg|DAA06171.1| TPA_inf: gigantea 1B [Zea mays]
Length=1160

 Score =   130 bits (327),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 72/86 (84%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+ S  +WID L F+SL+WPPPQD +Q++ QI AYVEYFGQFT  SE FPED+A+LI++ 
Sbjct  1    MSESNVKWIDGLHFTSLYWPPPQDVEQKQAQILAYVEYFGQFTADSEQFPEDVAQLIQSS  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YPSKE+RL D+VLATF+LHHPEHGH 
Sbjct  61   YPSKESRLIDEVLATFVLHHPEHGHA  86


 Score = 75.5 bits (184),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+HPI+S IIDGTL YD++ PPF+SFISL    S+ E SEQWALACG
Sbjct  84   GHAVVHPILSPIIDGTLCYDRHGPPFSSFISLFSHTSEQEYSEQWALACG  133



>ref|XP_008672375.1| PREDICTED: uncharacterized protein LOC100272803 isoform X1 [Zea 
mays]
 ref|XP_008672376.1| PREDICTED: uncharacterized protein LOC100272803 isoform X1 [Zea 
mays]
 ref|XP_008672377.1| PREDICTED: uncharacterized protein LOC100272803 isoform X1 [Zea 
mays]
 tpg|DAA53146.1| TPA: gigantea1B [Zea mays]
Length=1160

 Score =   130 bits (327),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 72/86 (84%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+ S  +WID L F+SL+WPPPQD +Q++ QI AYVEYFGQFT  SE FPED+A+LI++ 
Sbjct  1    MSESNVKWIDGLHFTSLYWPPPQDVEQKQAQILAYVEYFGQFTADSEQFPEDVAQLIQSS  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YPSKE+RL D+VLATF+LHHPEHGH 
Sbjct  61   YPSKESRLIDEVLATFVLHHPEHGHA  86


 Score = 75.5 bits (184),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+HPI+S IIDGTL YD++ PPF+SFISL    S+ E SEQWALACG
Sbjct  84   GHAVVHPILSPIIDGTLCYDRHGPPFSSFISLFSHTSEQEYSEQWALACG  133



>gb|AFW80281.1| gigantea1A [Zea mays]
Length=1086

 Score =   130 bits (328),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+ S  +WID LQF+SL+WPPP DA+Q++ QI AYVEYFGQFT  ++ FPEDIA+LI++ 
Sbjct  1    MSDSNVKWIDGLQFTSLYWPPPLDAEQKQAQILAYVEYFGQFTADTDQFPEDIAQLIQSS  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YPSKENRL D+VLATF+LHHPEHGH 
Sbjct  61   YPSKENRLVDEVLATFVLHHPEHGHA  86


 Score = 74.7 bits (182),  Expect(2) = 3e-44, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV HPI+S IIDGTL YD++ PPF+SFISL   NS+ E SEQWALACG
Sbjct  84   GHAVAHPILSRIIDGTLCYDRHGPPFSSFISLFSHNSEQEYSEQWALACG  133



>ref|XP_004968438.1| PREDICTED: protein GIGANTEA-like [Setaria italica]
Length=1160

 Score =   132 bits (333),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 72/86 (84%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+AS E+WID LQF+SLF PPPQD  Q++ QI AYVEYFGQFT  SE FPED+A+LI++ 
Sbjct  1    MSASNEKWIDGLQFTSLFCPPPQDVAQKQAQILAYVEYFGQFTADSEQFPEDVAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YPSKE RL D+VLATF+LHHPEHGH 
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHA  86


 Score = 72.8 bits (177),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+HPI+S IIDGTL YD++  PF+SFISL    S+ E SEQWALACG
Sbjct  84   GHAVVHPILSRIIDGTLCYDRHGAPFSSFISLFSHTSEKEYSEQWALACG  133



>ref|XP_004237832.1| PREDICTED: protein GIGANTEA [Solanum lycopersicum]
Length=1167

 Score =   168 bits (425),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+CERWID LQ+SS+FWPPPQDAQQRK QITAYVEYF QFTSE FPEDIAELIRNRYP
Sbjct  1    MAATCERWIDGLQYSSIFWPPPQDAQQRKAQITAYVEYFVQFTSEQFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGH  428
            SKENRLFDDVLATF+LHHPEHGH
Sbjct  61   SKENRLFDDVLATFVLHHPEHGH  83


 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G  VI PIISCIIDGTL+YDK+ PPFASFISLVCP+S+ E SE
Sbjct  69   DVLATFVLHHPE----HGHTVILPIISCIIDGTLDYDKSCPPFASFISLVCPSSEKEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>gb|AAT79486.1| gigantea 2 [Triticum aestivum]
Length=1153

 Score =   134 bits (336),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 71/86 (83%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+ S  +WID LQFSSLFWPPP D QQ++ QI AYVEYFGQFT  SE FPED+A+LI++ 
Sbjct  1    MSVSNGKWIDGLQFSSLFWPPPHDVQQKQAQILAYVEYFGQFTSDSEQFPEDVAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YPSKE RL D+VLATF+LHHPEHGH 
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHA  86


 Score = 70.9 bits (172),  Expect(2) = 6e-44, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+HPI+S IIDGTL YD +  PF SFISL   +S+ E SEQWALACG
Sbjct  84   GHAVVHPILSRIIDGTLSYDSHGSPFNSFISLFTQSSEKEYSEQWALACG  133



>ref|XP_008461912.1| PREDICTED: protein GIGANTEA-like isoform X1 [Cucumis melo]
Length=1168

 Score =   140 bits (352),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA S ERWIDRLQ SSLFWPPP D QQRK Q +AYVEY GQFTSE F EDIAELIR R+ 
Sbjct  1    MATSSERWIDRLQLSSLFWPPPDDDQQRKVQCSAYVEYLGQFTSERFSEDIAELIRIRFQ  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SKE RLFDDVLA F+LHHPE+GH 
Sbjct  61   SKEKRLFDDVLALFVLHHPENGHA  84


 Score = 63.9 bits (154),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  463  DGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            +G LEY++N PPFASFISL CP  +N+ SEQWALACG
Sbjct  95   NGALEYNRNDPPFASFISLFCPGIENDYSEQWALACG  131



>emb|CBI22760.3| unnamed protein product [Vitis vinifera]
Length=549

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 82/100 (82%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+SCERWID LQFSSLFWPPPQD QQRK QITAYV+YFGQFTSE FPEDIAELIR+RYP
Sbjct  1    MASSCERWIDGLQFSSLFWPPPQDVQQRKAQITAYVDYFGQFTSEQFPEDIAELIRSRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            SKE RLFDDVLATF+LHHPEHGH        C     L+Y
Sbjct  61   SKEQRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVY  100


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+ PIISCIIDGTL YD+ +PPFASFISLVCP+S+NE SEQWALACG
Sbjct  82   GHAVVLPIISCIIDGTLVYDRCTPPFASFISLVCPSSENEYSEQWALACG  131



>ref|XP_009380419.1| PREDICTED: protein GIGANTEA-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380420.1| PREDICTED: protein GIGANTEA-like isoform X2 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380421.1| PREDICTED: protein GIGANTEA-like isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=1162

 Score =   126 bits (317),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M+AS  +W + LQFSSLFWPPP   QQ++ Q+ AYVEYFGQFTSE F EDIA+LI++ YP
Sbjct  1    MSASHGKWTNGLQFSSLFWPPPLGEQQKQAQVMAYVEYFGQFTSEEFQEDIAQLIQSHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SK+ RL D+VLA F+LHHPEHGH 
Sbjct  61   SKDKRLLDEVLAVFVLHHPEHGHA  84


 Score = 77.0 bits (188),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G A+IHPI+S IIDGTL YD+N  PF SFISL   NS+ E SEQWALACG
Sbjct  82   GHAIIHPILSLIIDGTLAYDRNDSPFCSFISLFKQNSEKEYSEQWALACG  131



>emb|CAY26028.1| GIGANTEA [Lolium perenne]
 gb|ABF83898.2| GIGANTEA [Lolium perenne]
Length=1148

 Score =   133 bits (334),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 71/86 (83%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+ S  +WID LQFSSLFWPPP DAQQ++ Q  AYVEYFGQFT  SE FPED+A+LI++ 
Sbjct  1    MSVSNGKWIDGLQFSSLFWPPPHDAQQKQAQTLAYVEYFGQFTSDSEQFPEDVAQLIQSY  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YPSKE RL D+VLATF+LHHPEHGH 
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHA  86


 Score = 68.9 bits (167),  Expect(2) = 3e-43, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+HPI+S IIDG+L YD++  PF SFISL    ++ E SEQWALACG
Sbjct  84   GHAVVHPILSRIIDGSLSYDRHGSPFNSFISLFTQTAEKEYSEQWALACG  133



>ref|XP_002264755.1| PREDICTED: protein GIGANTEA [Vitis vinifera]
 ref|XP_010665061.1| PREDICTED: protein GIGANTEA [Vitis vinifera]
 ref|XP_010665062.1| PREDICTED: protein GIGANTEA [Vitis vinifera]
Length=1170

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 82/100 (82%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+SCERWID LQFSSLFWPPPQD QQRK QITAYV+YFGQFTSE FPEDIAELIR+RYP
Sbjct  1    MASSCERWIDGLQFSSLFWPPPQDVQQRKAQITAYVDYFGQFTSEQFPEDIAELIRSRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            SKE RLFDDVLATF+LHHPEHGH        C     L+Y
Sbjct  61   SKEQRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVY  100


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+ PIISCIIDGTL YD+ +PPFASFISLVCP+S+NE SEQWALACG
Sbjct  82   GHAVVLPIISCIIDGTLVYDRCTPPFASFISLVCPSSENEYSEQWALACG  131



>ref|XP_006359039.1| PREDICTED: protein GIGANTEA-like isoform X1 [Solanum tuberosum]
Length=1189

 Score =   114 bits (284),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +3

Query  270  QITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGH  428
            QITAYVEYFGQFTSE FPEDIAELIRNRYPSKENRLFDDVLATF+LHHPEHGH
Sbjct  54   QITAYVEYFGQFTSEQFPEDIAELIRNRYPSKENRLFDDVLATFVLHHPEHGH  106


 Score = 85.9 bits (211),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G  VI PIISCIIDGTL+YDK+ PPF SFISLVCP+S+ E SEQWALACG
Sbjct  105  GHTVILPIISCIIDGTLDYDKSCPPFTSFISLVCPSSEKEYSEQWALACG  154



>gb|ADR51711.1| GI [Secale cereale]
Length=1142

 Score =   128 bits (321),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 67/78 (86%), Gaps = 2/78 (3%)
 Frame = +3

Query  204  IDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTS--EHFPEDIAELIRNRYPSKENRL  377
            ID LQFSSLFWPPP DAQQ++ QI AYVEYFGQFTS  E FPED+A+LI++ YPSKE RL
Sbjct  1    IDGLQFSSLFWPPPHDAQQKQAQILAYVEYFGQFTSDSEQFPEDVAQLIQSCYPSKEKRL  60

Query  378  FDDVLATFLLHHPEHGHG  431
             D+VLATF+LHHPEHGH 
Sbjct  61   VDEVLATFVLHHPEHGHA  78


 Score = 70.9 bits (172),  Expect(2) = 3e-42, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+HPI+S IIDGTL YD +  PF SFISL   +S+ E SEQWALACG
Sbjct  76   GHAVVHPILSRIIDGTLSYDSHGSPFNSFISLFTQSSEKEYSEQWALACG  125



>gb|AII99806.1| gigantea [Dimocarpus longan]
Length=1171

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+S ERWID LQFSSLFWPPPQDAQQRK Q TAYVEYFGQFTSE FPEDIAELIRNRYP
Sbjct  1    MASSSERWIDGLQFSSLFWPPPQDAQQRKAQTTAYVEYFGQFTSEQFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SKE RLFDDVLA F+LHHPEHGH 
Sbjct  61   SKEMRLFDDVLAMFVLHHPEHGHA  84


 Score = 89.0 bits (219),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AV+ PIIS II+GTL YDK+SPPFASFISLVCP+S+NE SE
Sbjct  69   DVLAMFVLHHPE----HGHAVVLPIISSIIEGTLVYDKSSPPFASFISLVCPSSENEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>gb|KDP36552.1| hypothetical protein JCGZ_08319 [Jatropha curcas]
Length=1168

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 80/100 (80%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+S ERWID LQFSSLFWP PQD QQRK QITAYVEYFGQFTSE FP+DIAELIRNRYP
Sbjct  1    MASSSERWIDGLQFSSLFWPAPQDVQQRKAQITAYVEYFGQFTSEQFPDDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            SKE RLFDDVLATF+LHHPEHGH        C     L+Y
Sbjct  61   SKEKRLFDDVLATFVLHHPEHGHAVVLPIISCLIDGTLVY  100


 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+ PIISC+IDGTL YD++SPPFASFISLVCP+S+NE SEQWALACG
Sbjct  82   GHAVVLPIISCLIDGTLVYDRSSPPFASFISLVCPSSENEYSEQWALACG  131



>ref|XP_004252566.1| PREDICTED: protein GIGANTEA-like isoform X1 [Solanum lycopersicum]
Length=1167

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+S ERWID L FSSLFW PPQ A+QRKDQITAYV+YFGQFTSE FPEDIAELIRNRYP
Sbjct  1    MASSSERWIDSLHFSSLFWVPPQAAEQRKDQITAYVKYFGQFTSEQFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SKENRLFDDVLATF+LHHPEHGH 
Sbjct  61   SKENRLFDDVLATFVLHHPEHGHA  84


 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+HPIISCIIDGTLEYDK+SPPFASFISLVC +S+ E SE
Sbjct  69   DVLATFVLHHPE----HGHAVVHPIISCIIDGTLEYDKSSPPFASFISLVCSSSEKEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>ref|XP_010314472.1| PREDICTED: protein GIGANTEA-like isoform X2 [Solanum lycopersicum]
Length=1166

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+S ERWID L FSSLFW PPQ A+QRKDQITAYV+YFGQFTSE FPEDIAELIRNRYP
Sbjct  1    MASSSERWIDSLHFSSLFWVPPQAAEQRKDQITAYVKYFGQFTSEQFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SKENRLFDDVLATF+LHHPEHGH 
Sbjct  61   SKENRLFDDVLATFVLHHPEHGHA  84


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 50/67 (75%), Gaps = 5/67 (7%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+HPIISCIIDGTLEYDK+SPPFASFISLVC +S+ E SE
Sbjct  69   DVLATFVLHHPE----HGHAVVHPIISCIIDGTLEYDKSSPPFASFISLVCSSSE-EYSE  123

Query  553  QWALACG  573
            QWALACG
Sbjct  124  QWALACG  130



>ref|XP_006361617.1| PREDICTED: protein GIGANTEA-like isoform X2 [Solanum tuberosum]
Length=1170

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+S  RWID L FSSLFW PPQDA+QRKDQITAYV+YFGQFTSE FPEDIAELIRNRYP
Sbjct  1    MASSSTRWIDSLHFSSLFWLPPQDAEQRKDQITAYVKYFGQFTSEQFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SKENRLFDDVLATF+LHHPEHGH 
Sbjct  61   SKENRLFDDVLATFVLHHPEHGHA  84


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 49/67 (73%), Gaps = 5/67 (7%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+HPIISCIIDGTLEYDK+SPPFASFISLVC  S+ E SE
Sbjct  69   DVLATFVLHHPE----HGHAVVHPIISCIIDGTLEYDKSSPPFASFISLVCSRSE-EYSE  123

Query  553  QWALACG  573
            QWALACG
Sbjct  124  QWALACG  130



>ref|XP_006361616.1| PREDICTED: protein GIGANTEA-like isoform X1 [Solanum tuberosum]
Length=1171

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+S  RWID L FSSLFW PPQDA+QRKDQITAYV+YFGQFTSE FPEDIAELIRNRYP
Sbjct  1    MASSSTRWIDSLHFSSLFWLPPQDAEQRKDQITAYVKYFGQFTSEQFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SKENRLFDDVLATF+LHHPEHGH 
Sbjct  61   SKENRLFDDVLATFVLHHPEHGHA  84


 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+HPIISCIIDGTLEYDK+SPPFASFISLVC  S+ E SE
Sbjct  69   DVLATFVLHHPE----HGHAVVHPIISCIIDGTLEYDKSSPPFASFISLVCSRSEKEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>ref|XP_011074103.1| PREDICTED: protein GIGANTEA-like isoform X1 [Sesamum indicum]
 ref|XP_011074104.1| PREDICTED: protein GIGANTEA-like isoform X1 [Sesamum indicum]
 ref|XP_011074105.1| PREDICTED: protein GIGANTEA-like isoform X1 [Sesamum indicum]
Length=1169

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA S ERWID LQFSSLFWPPPQD +QRK QI AYVE+FGQFTSE FP+DIAELIRNRYP
Sbjct  1    MATSNERWIDSLQFSSLFWPPPQDVKQRKAQIAAYVEFFGQFTSEQFPDDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            S ENRLFDDVLATF+LHHPEHGH 
Sbjct  61   SNENRLFDDVLATFVLHHPEHGHA  84


 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AVI PIISCIIDG+LEYD++ PPFASFISLVCPNS+ E +E
Sbjct  69   DVLATFVLHHPE----HGHAVILPIISCIIDGSLEYDRSGPPFASFISLVCPNSEMEYTE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>ref|XP_011074106.1| PREDICTED: protein GIGANTEA-like isoform X2 [Sesamum indicum]
Length=1138

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA S ERWID LQFSSLFWPPPQD +QRK QI AYVE+FGQFTSE FP+DIAELIRNRYP
Sbjct  1    MATSNERWIDSLQFSSLFWPPPQDVKQRKAQIAAYVEFFGQFTSEQFPDDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            S ENRLFDDVLATF+LHHPEHGH 
Sbjct  61   SNENRLFDDVLATFVLHHPEHGHA  84


 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AVI PIISCIIDG+LEYD++ PPFASFISLVCPNS+ E +E
Sbjct  69   DVLATFVLHHPE----HGHAVILPIISCIIDGSLEYDRSGPPFASFISLVCPNSEMEYTE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>ref|XP_011100590.1| PREDICTED: protein GIGANTEA-like [Sesamum indicum]
Length=1166

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA S E+WID LQFSSLFWPPPQDA+QRK Q+TAYVEYFGQFTSE FP+DIAELIR+RYP
Sbjct  1    MATSNEKWIDSLQFSSLFWPPPQDAEQRKAQVTAYVEYFGQFTSEQFPDDIAELIRSRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SKE RLFDDVLATF+LHHPEHGH 
Sbjct  61   SKEIRLFDDVLATFVLHHPEHGHA  84


 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AVI PIISCIID +LEYD++SPPFASFISLV PNS+NE  E
Sbjct  69   DVLATFVLHHPE----HGHAVILPIISCIIDCSLEYDRSSPPFASFISLVYPNSENEYLE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>ref|XP_002307516.1| GIGANTEA family protein [Populus trichocarpa]
 gb|EEE94512.1| GIGANTEA family protein [Populus trichocarpa]
Length=1171

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 81/99 (82%), Gaps = 7/99 (7%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSLFWPPPQDAQQRK QITAYV+YFGQ TSEHFP+DI+ELIRNRYPS
Sbjct  3    SSSSERWIDGLQFSSLFWPPPQDAQQRKAQITAYVDYFGQCTSEHFPDDISELIRNRYPS  62

Query  363  KENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            K+ RLFDDVLATF+LHHPEHGH        C     L+Y
Sbjct  63   KDKRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVY  101


 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+ PIISCIIDGTL YD++SPPFASFISLVCP S+NE SEQWALACG
Sbjct  83   GHAVVLPIISCIIDGTLVYDRSSPPFASFISLVCPGSENEYSEQWALACG  132



>ref|XP_011044276.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
Length=1171

 Score =   156 bits (395),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 81/99 (82%), Gaps = 7/99 (7%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSLFWPPPQDAQQRK QITAYV+YFGQ TSEHFP+DI+ELIRNRYPS
Sbjct  3    SSSSERWIDGLQFSSLFWPPPQDAQQRKAQITAYVDYFGQCTSEHFPDDISELIRNRYPS  62

Query  363  KENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            K+ RLFDDVLATF+LHHPEHGH        C     L+Y
Sbjct  63   KDKRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVY  101


 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+ PIISCIIDGTL YD++SPPFASFISLVCP S+NE SEQWALACG
Sbjct  83   GHAVVLPIISCIIDGTLVYDRSSPPFASFISLVCPGSENEYSEQWALACG  132



>ref|XP_009610493.1| PREDICTED: protein GIGANTEA-like [Nicotiana tomentosiformis]
 ref|XP_009610494.1| PREDICTED: protein GIGANTEA-like [Nicotiana tomentosiformis]
Length=1158

 Score =   156 bits (394),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +3

Query  186  ASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSK  365
            A+ ERWID L FSSLFWPPPQDAQQRK Q TAYV+YFGQ TSE FPEDIAELIRNRYPSK
Sbjct  6    AASERWIDGLHFSSLFWPPPQDAQQRKAQTTAYVKYFGQSTSEQFPEDIAELIRNRYPSK  65

Query  366  ENRLFDDVLATFLLHHPEHGHG  431
            ENRLFDDVLATF+LHHPEHGH 
Sbjct  66   ENRLFDDVLATFVLHHPEHGHA  87


 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 51/67 (76%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AVIHPIISCIIDGTLEYDK+SPPFASFISLVCP+S+N  SE
Sbjct  72   DVLATFVLHHPE----HGHAVIHPIISCIIDGTLEYDKSSPPFASFISLVCPSSENGYSE  127

Query  553  QWALACG  573
            QWALACG
Sbjct  128  QWALACG  134



>ref|XP_007019601.1| Gigantea protein isoform 1 [Theobroma cacao]
 ref|XP_007019602.1| Gigantea protein isoform 1 [Theobroma cacao]
 gb|EOY16826.1| Gigantea protein isoform 1 [Theobroma cacao]
 gb|EOY16827.1| Gigantea protein isoform 1 [Theobroma cacao]
Length=1170

 Score =   156 bits (394),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 78/100 (78%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+  ERWID LQFSSLFWPPPQD QQRK QITAYVEYFGQFTSE FPEDIAEL+RNRYP
Sbjct  1    MASPSERWIDGLQFSSLFWPPPQDPQQRKVQITAYVEYFGQFTSEQFPEDIAELVRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
             KE RLFDDVLA F+LHHPEHGH        C     L+Y
Sbjct  61   HKEQRLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVY  100


 Score = 93.2 bits (230),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 51/67 (76%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AV+ PIISCIIDGTL YDK++PPFASFISLVCP+S+NE SE
Sbjct  69   DVLAMFVLHHPE----HGHAVVLPIISCIIDGTLVYDKSTPPFASFISLVCPSSENEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>ref|XP_007019603.1| Gigantea protein isoform 3 [Theobroma cacao]
 gb|EOY16828.1| Gigantea protein isoform 3 [Theobroma cacao]
Length=1171

 Score =   156 bits (394),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 78/100 (78%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+  ERWID LQFSSLFWPPPQD QQRK QITAYVEYFGQFTSE FPEDIAEL+RNRYP
Sbjct  1    MASPSERWIDGLQFSSLFWPPPQDPQQRKVQITAYVEYFGQFTSEQFPEDIAELVRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
             KE RLFDDVLA F+LHHPEHGH        C     L+Y
Sbjct  61   HKEQRLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVY  100


 Score = 93.2 bits (230),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 51/67 (76%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AV+ PIISCIIDGTL YDK++PPFASFISLVCP+S+NE SE
Sbjct  69   DVLAMFVLHHPE----HGHAVVLPIISCIIDGTLVYDKSTPPFASFISLVCPSSENEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>ref|XP_007019604.1| Gigantea protein isoform 4 [Theobroma cacao]
 gb|EOY16829.1| Gigantea protein isoform 4 [Theobroma cacao]
Length=1147

 Score =   155 bits (393),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 78/100 (78%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+  ERWID LQFSSLFWPPPQD QQRK QITAYVEYFGQFTSE FPEDIAEL+RNRYP
Sbjct  1    MASPSERWIDGLQFSSLFWPPPQDPQQRKVQITAYVEYFGQFTSEQFPEDIAELVRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
             KE RLFDDVLA F+LHHPEHGH        C     L+Y
Sbjct  61   HKEQRLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVY  100


 Score = 93.2 bits (230),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 51/67 (76%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AV+ PIISCIIDGTL YDK++PPFASFISLVCP+S+NE SE
Sbjct  69   DVLAMFVLHHPE----HGHAVVLPIISCIIDGTLVYDKSTPPFASFISLVCPSSENEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>gb|KJB59491.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=975

 Score =   155 bits (392),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA   +RWID LQFSSLFWPPPQD Q+RK QITAYVEYFGQFTSE FPEDIAELIR RYP
Sbjct  1    MANPSKRWIDGLQFSSLFWPPPQDPQERKVQITAYVEYFGQFTSEQFPEDIAELIRTRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SKE RLFDDVLATF+LHHPEHGH 
Sbjct  61   SKEQRLFDDVLATFVLHHPEHGHA  84


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIIS IIDG+L YDK+S PFASFISLVCP+S+NE SE
Sbjct  69   DVLATFVLHHPE----HGHAVVLPIISGIIDGSLVYDKSSLPFASFISLVCPSSENEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>gb|KJB59493.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=973

 Score =   155 bits (392),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA   +RWID LQFSSLFWPPPQD Q+RK QITAYVEYFGQFTSE FPEDIAELIR RYP
Sbjct  1    MANPSKRWIDGLQFSSLFWPPPQDPQERKVQITAYVEYFGQFTSEQFPEDIAELIRTRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SKE RLFDDVLATF+LHHPEHGH 
Sbjct  61   SKEQRLFDDVLATFVLHHPEHGHA  84


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIIS IIDG+L YDK+S PFASFISLVCP+S+NE SE
Sbjct  69   DVLATFVLHHPE----HGHAVVLPIISGIIDGSLVYDKSSLPFASFISLVCPSSENEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>gb|KJB59494.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59495.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59496.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59497.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59498.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=1168

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA   +RWID LQFSSLFWPPPQD Q+RK QITAYVEYFGQFTSE FPEDIAELIR RYP
Sbjct  1    MANPSKRWIDGLQFSSLFWPPPQDPQERKVQITAYVEYFGQFTSEQFPEDIAELIRTRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SKE RLFDDVLATF+LHHPEHGH 
Sbjct  61   SKEQRLFDDVLATFVLHHPEHGHA  84


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIIS IIDG+L YDK+S PFASFISLVCP+S+NE SE
Sbjct  69   DVLATFVLHHPE----HGHAVVLPIISGIIDGSLVYDKSSLPFASFISLVCPSSENEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>gb|ACY30446.1| gigantea-like protein [Liriodendron tulipifera]
Length=1209

 Score = 97.4 bits (241),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +3

Query  270  QITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHG  431
            QI AYVEYFGQFTSE FPED+AELIR  YPSKE RL D+VLA F+LHHPEHGH 
Sbjct  51   QIMAYVEYFGQFTSERFPEDVAELIRTCYPSKEKRLLDEVLAIFVLHHPEHGHA  104


 Score = 92.4 bits (228),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+HPI+SCIIDGTL YDKN PPF+SFISLVCP+S+ E SEQWALACG
Sbjct  102  GHAVVHPILSCIIDGTLVYDKNDPPFSSFISLVCPSSEKEYSEQWALACG  151



>gb|AES62297.2| gigantea protein 1B [Medicago truncatula]
Length=975

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 79/105 (75%), Gaps = 7/105 (7%)
 Frame = +3

Query  165  LVDRYMAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELI  344
            +    MAA+ ERWIDRLQFSSLFWPPPQD QQ+KDQI AYVEY  QFTSE F +DIAELI
Sbjct  1    MTSSSMAATSERWIDRLQFSSLFWPPPQDVQQKKDQIAAYVEYLIQFTSEQFADDIAELI  60

Query  345  RNRYPSKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            RNRYPSKE  LFDDVLATF+LHHPEHGH        C     L+Y
Sbjct  61   RNRYPSKEIILFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVY  105


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YDK SPPFAS ISLVCP  +NE SE
Sbjct  74   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDKTSPPFASLISLVCPKDENEYSE  129

Query  553  QWALACG  573
            QWALACG
Sbjct  130  QWALACG  136



>gb|ABP81863.1| LATE BLOOMER 1 [Pisum sativum]
Length=1175

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 78/100 (78%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+ ERWIDRLQFSSLFWPPPQD QQ+KDQI AYVEY  QFTSE F +DIAELIRNRYP
Sbjct  5    MAATSERWIDRLQFSSLFWPPPQDGQQKKDQIAAYVEYLIQFTSEQFADDIAELIRNRYP  64

Query  360  SKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            SKE  LFDDVLATF+LHHPEHGH        C     L+Y
Sbjct  65   SKEILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVY  104


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 47/67 (70%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YDK SPPFAS ISLVCP ++NE SE
Sbjct  73   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDKTSPPFASLISLVCPKNENEYSE  128

Query  553  QWALACG  573
            QWALACG
Sbjct  129  QWALACG  135



>gb|AES62299.2| gigantea protein 1B [Medicago truncatula]
Length=1177

 Score =   153 bits (387),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 79/105 (75%), Gaps = 7/105 (7%)
 Frame = +3

Query  165  LVDRYMAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELI  344
            +    MAA+ ERWIDRLQFSSLFWPPPQD QQ+KDQI AYVEY  QFTSE F +DIAELI
Sbjct  1    MTSSSMAATSERWIDRLQFSSLFWPPPQDVQQKKDQIAAYVEYLIQFTSEQFADDIAELI  60

Query  345  RNRYPSKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            RNRYPSKE  LFDDVLATF+LHHPEHGH        C     L+Y
Sbjct  61   RNRYPSKEIILFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVY  105


 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YDK SPPFAS ISLVCP  +NE SE
Sbjct  74   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDKTSPPFASLISLVCPKDENEYSE  129

Query  553  QWALACG  573
            QWALACG
Sbjct  130  QWALACG  136



>ref|XP_003592046.1| Protein GIGANTEA [Medicago truncatula]
Length=1172

 Score =   153 bits (387),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 78/100 (78%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+ ERWIDRLQFSSLFWPPPQD QQ+KDQI AYVEY  QFTSE F +DIAELIRNRYP
Sbjct  1    MAATSERWIDRLQFSSLFWPPPQDVQQKKDQIAAYVEYLIQFTSEQFADDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            SKE  LFDDVLATF+LHHPEHGH        C     L+Y
Sbjct  61   SKEIILFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVY  100


 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YDK SPPFAS ISLVCP  +NE SE
Sbjct  69   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDKTSPPFASLISLVCPKDENEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>ref|XP_003592048.1| Protein GIGANTEA [Medicago truncatula]
Length=1200

 Score =   153 bits (387),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 78/100 (78%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+ ERWIDRLQFSSLFWPPPQD QQ+KDQI AYVEY  QFTSE F +DIAELIRNRYP
Sbjct  1    MAATSERWIDRLQFSSLFWPPPQDVQQKKDQIAAYVEYLIQFTSEQFADDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            SKE  LFDDVLATF+LHHPEHGH        C     L+Y
Sbjct  61   SKEIILFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVY  100


 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YDK SPPFAS ISLVCP  +NE SE
Sbjct  69   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDKTSPPFASLISLVCPKDENEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>gb|ACJ09479.1| putative gigantea, partial [Oryza sativa Japonica Group]
Length=208

 Score =   113 bits (283),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 73/86 (85%), Gaps = 2/86 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+AS E+WID LQFSSLFWPPPQD QQ++ QI AYVEYFGQFT  SE FPEDIA+LI+  
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDPQQKQAQILAYVEYFGQFTADSEQFPEDIAQLIQGC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHG  431
            YPSKE RL D+VLATF+LHHPEHGH 
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHA  86


 Score = 74.3 bits (181),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+HPI+S IIDGTL YD+N  PF SFISL    S+ E SEQWALACG
Sbjct  84   GHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTSEKEYSEQWALACG  133



>gb|KJB28963.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=970

 Score =   152 bits (385),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 76/100 (76%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA   ERWID LQFSSLF PPPQD Q RK QITAYVEYFGQFTSE FPEDIAEL+RNRYP
Sbjct  1    MANPSERWIDGLQFSSLFRPPPQDPQHRKVQITAYVEYFGQFTSEQFPEDIAELVRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGH-------GCYSSNYLMY  458
            S E RLFDDVLATF+LHHPEHGH        C     LMY
Sbjct  61   SDEQRLFDDVLATFVLHHPEHGHAVVLPIIACIIDGTLMY  100


 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PII+CIIDGTL YDKN+PPF+SFISLVCP+S+NE SE
Sbjct  69   DVLATFVLHHPE----HGHAVVLPIIACIIDGTLMYDKNAPPFSSFISLVCPSSENEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>gb|KJB28960.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1001

 Score =   152 bits (385),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 76/100 (76%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA   ERWID LQFSSLF PPPQD Q RK QITAYVEYFGQFTSE FPEDIAEL+RNRYP
Sbjct  1    MANPSERWIDGLQFSSLFRPPPQDPQHRKVQITAYVEYFGQFTSEQFPEDIAELVRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGH-------GCYSSNYLMY  458
            S E RLFDDVLATF+LHHPEHGH        C     LMY
Sbjct  61   SDEQRLFDDVLATFVLHHPEHGHAVVLPIIACIIDGTLMY  100


 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+ PII+CIIDGTL YDKN+PPF+SFISLVCP+S+NE SEQWALACG
Sbjct  82   GHAVVLPIIACIIDGTLMYDKNAPPFSSFISLVCPSSENEYSEQWALACG  131



>ref|XP_004290483.1| PREDICTED: protein GIGANTEA [Fragaria vesca subsp. vesca]
 ref|XP_011458472.1| PREDICTED: protein GIGANTEA [Fragaria vesca subsp. vesca]
 ref|XP_011458473.1| PREDICTED: protein GIGANTEA [Fragaria vesca subsp. vesca]
Length=1178

 Score =   152 bits (385),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA S ERWIDRLQFSSLF PPPQDA +RK QITAYVEYFGQFTSE FPEDI+ELIRNRYP
Sbjct  1    MACSSERWIDRLQFSSLFGPPPQDAPRRKAQITAYVEYFGQFTSEQFPEDISELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            S+  RLFDDVLA F+LHHPEHGH 
Sbjct  61   SEVKRLFDDVLAMFVLHHPEHGHA  84


 Score = 89.4 bits (220),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AV+ PIISCIIDGTL Y++ SPPFASFISLVCP+S+ E SE
Sbjct  69   DVLAMFVLHHPE----HGHAVVLPIISCIIDGTLPYERTSPPFASFISLVCPSSEKEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>gb|KJB28964.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1080

 Score =   152 bits (385),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 76/100 (76%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA   ERWID LQFSSLF PPPQD Q RK QITAYVEYFGQFTSE FPEDIAEL+RNRYP
Sbjct  1    MANPSERWIDGLQFSSLFRPPPQDPQHRKVQITAYVEYFGQFTSEQFPEDIAELVRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGH-------GCYSSNYLMY  458
            S E RLFDDVLATF+LHHPEHGH        C     LMY
Sbjct  61   SDEQRLFDDVLATFVLHHPEHGHAVVLPIIACIIDGTLMY  100


 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PII+CIIDGTL YDKN+PPF+SFISLVCP+S+NE SE
Sbjct  69   DVLATFVLHHPE----HGHAVVLPIIACIIDGTLMYDKNAPPFSSFISLVCPSSENEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>gb|KJB28961.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1155

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 76/100 (76%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA   ERWID LQFSSLF PPPQD Q RK QITAYVEYFGQFTSE FPEDIAEL+RNRYP
Sbjct  1    MANPSERWIDGLQFSSLFRPPPQDPQHRKVQITAYVEYFGQFTSEQFPEDIAELVRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGH-------GCYSSNYLMY  458
            S E RLFDDVLATF+LHHPEHGH        C     LMY
Sbjct  61   SDEQRLFDDVLATFVLHHPEHGHAVVLPIIACIIDGTLMY  100


 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PII+CIIDGTL YDKN+PPF+SFISLVCP+S+NE SE
Sbjct  69   DVLATFVLHHPE----HGHAVVLPIIACIIDGTLMYDKNAPPFSSFISLVCPSSENEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>gb|KJB28962.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1147

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 76/100 (76%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA   ERWID LQFSSLF PPPQD Q RK QITAYVEYFGQFTSE FPEDIAEL+RNRYP
Sbjct  1    MANPSERWIDGLQFSSLFRPPPQDPQHRKVQITAYVEYFGQFTSEQFPEDIAELVRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGH-------GCYSSNYLMY  458
            S E RLFDDVLATF+LHHPEHGH        C     LMY
Sbjct  61   SDEQRLFDDVLATFVLHHPEHGHAVVLPIIACIIDGTLMY  100


 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PII+CIIDGTL YDKN+PPF+SFISLVCP+S+NE SE
Sbjct  69   DVLATFVLHHPE----HGHAVVLPIIACIIDGTLMYDKNAPPFSSFISLVCPSSENEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>gb|AJC01622.1| gigantea [Prunus dulcis]
Length=1170

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+ ERWIDRLQFSSLF PPPQDA +RK Q+TAYV+YFGQFTSE FPEDIAELIRNRYP
Sbjct  1    MAATSERWIDRLQFSSLFGPPPQDALRRKAQVTAYVDYFGQFTSEQFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            S+  RLFDDVLA F+LHHPEHGH 
Sbjct  61   SEVKRLFDDVLAMFVLHHPEHGHA  84


 Score = 92.8 bits (229),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISCIIDGTL Y++ SPPFASFISLVCP+S+NE SE
Sbjct  69   DVLAMFVLHHPE----HGHAVILPIISCIIDGTLAYERTSPPFASFISLVCPSSENEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>ref|XP_008237480.1| PREDICTED: protein GIGANTEA [Prunus mume]
 ref|XP_008237481.1| PREDICTED: protein GIGANTEA [Prunus mume]
 ref|XP_008237482.1| PREDICTED: protein GIGANTEA [Prunus mume]
 ref|XP_008237483.1| PREDICTED: protein GIGANTEA [Prunus mume]
Length=1170

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+ ERWIDRLQFSSLF PPPQDA +RK Q+TAYV+YFGQFTSE FPEDIAELIRNRYP
Sbjct  1    MAATSERWIDRLQFSSLFGPPPQDALRRKAQVTAYVDYFGQFTSEQFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            S+  RLFDDVLA F+LHHPEHGH 
Sbjct  61   SEVKRLFDDVLAMFVLHHPEHGHA  84


 Score = 91.7 bits (226),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISCIIDGTL Y++ SPPFASFISLVCP+S+NE SE
Sbjct  69   DVLAMFVLHHPE----HGHAVILPIISCIIDGTLAYERISPPFASFISLVCPSSENEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>dbj|BAJ22595.1| GIGANTEA [Glycine max]
Length=1168

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 78/100 (78%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAAS ERWIDRLQ+SSLFWPPP D QQRKDQI AYVEYF QFTSE F +DIAELIRNRYP
Sbjct  1    MAASSERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFTSEQFADDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            SK+  LFDDVLATF+LHHPEHGH        C     L+Y
Sbjct  61   SKDILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVY  100


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SE
Sbjct  69   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>ref|XP_007151935.1| hypothetical protein PHAVU_004G088300g [Phaseolus vulgaris]
 gb|ESW23929.1| hypothetical protein PHAVU_004G088300g [Phaseolus vulgaris]
Length=1169

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 77/100 (77%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAAS ERWIDRLQFSSLFWPPP + QQRKDQI AYVEY GQFTSE FP+DIAELIRNRYP
Sbjct  5    MAASSERWIDRLQFSSLFWPPPLEDQQRKDQIAAYVEYIGQFTSEQFPDDIAELIRNRYP  64

Query  360  SKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            SKE  LFD+VLA  +LHHPEHGH        C     L+Y
Sbjct  65   SKEMLLFDEVLAVLVLHHPEHGHAVVLPIISCIIDGTLVY  104


 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+ PIISCIIDGTL YDK SPPFASFISLVCP ++NE SEQWALACG
Sbjct  86   GHAVVLPIISCIIDGTLVYDKTSPPFASFISLVCPKNENEYSEQWALACG  135



>gb|KHG25928.1| Protein GIGANTEA [Gossypium arboreum]
 gb|KHG25929.1| Protein GIGANTEA [Gossypium arboreum]
Length=755

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 76/100 (76%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA   ERWID LQFSSLF PPPQD Q RK QITAYVEYFGQFTSE FPEDIAEL+RNRYP
Sbjct  1    MANPSERWIDGLQFSSLFRPPPQDPQHRKVQITAYVEYFGQFTSEQFPEDIAELVRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            S E RLFDDVLATF+LHHPEHGH        C     L+Y
Sbjct  61   SDEQRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVY  100


 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YDKN+PPF+SFISLVCP+S+NE SE
Sbjct  69   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDKNAPPFSSFISLVCPSSENEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>ref|XP_007143577.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
 ref|XP_007143578.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
 gb|ESW15571.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
 gb|ESW15572.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
Length=1199

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 77/100 (77%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA  E+WIDRLQFSSLFWPPP D QQRKDQI AYVEYF QFTSE F +DIAELIRNRYP
Sbjct  8    MAAPSEKWIDRLQFSSLFWPPPPDGQQRKDQIAAYVEYFIQFTSEQFTDDIAELIRNRYP  67

Query  360  SKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            SKE  LFDDVLATF+LHHPEHGH        C     L+Y
Sbjct  68   SKEILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVY  107


 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SE
Sbjct  76   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKVENEYSE  131

Query  553  QWALACG  573
            QWALACG
Sbjct  132  QWALACG  138



>dbj|BAM67030.1| gigantea-like [Chrysanthemum seticuspe f. boreale]
Length=1145

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA +  RW D LQFSSLFWPPP D QQRK+QITAYV+YFGQFTSE FPEDIAEL+R+RYP
Sbjct  1    MADTSTRWTDSLQFSSLFWPPPLDTQQRKEQITAYVDYFGQFTSEQFPEDIAELVRHRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGH  428
            S+E RLFDDVLATF+LHHPEHGH
Sbjct  61   SQEKRLFDDVLATFVLHHPEHGH  83


 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G +VI PIISCIIDGT+EYD+++PPFASFISLVCP++  E SE
Sbjct  69   DVLATFVLHHPE----HGHSVILPIISCIIDGTMEYDRSTPPFASFISLVCPSTDKEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>ref|XP_006473104.1| PREDICTED: protein GIGANTEA-like isoform X1 [Citrus sinensis]
 ref|XP_006473105.1| PREDICTED: protein GIGANTEA-like isoform X2 [Citrus sinensis]
 ref|XP_006473106.1| PREDICTED: protein GIGANTEA-like isoform X3 [Citrus sinensis]
 ref|XP_006473107.1| PREDICTED: protein GIGANTEA-like isoform X4 [Citrus sinensis]
Length=1165

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 78/100 (78%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+S ERWID LQFSSLFWPPPQDA+QRK Q TAYVEYFGQFTSE FPE+IAELIR+ YP
Sbjct  1    MASSSERWIDGLQFSSLFWPPPQDAEQRKIQTTAYVEYFGQFTSEQFPEEIAELIRSHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
             KE RLFDDVLA F+LHHPEHGH        C     L+Y
Sbjct  61   HKERRLFDDVLAMFVLHHPEHGHAVALPIISCIIDGTLVY  100


 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 49/66 (74%), Gaps = 4/66 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AV  PIISCIIDGTL YDK+SPPFASF+SLVCPNS+NE SE
Sbjct  69   DVLAMFVLHHPE----HGHAVALPIISCIIDGTLVYDKSSPPFASFVSLVCPNSENEYSE  124

Query  553  QWALAC  570
            QWALAC
Sbjct  125  QWALAC  130



>ref|XP_008381855.1| PREDICTED: protein GIGANTEA-like [Malus domestica]
Length=1170

 Score =   150 bits (379),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+ ERW DRLQFSSLF PPPQDA +RK QITAYV+YFGQFTSE FPEDIAELIRNRYP
Sbjct  1    MAATSERWFDRLQFSSLFGPPPQDALRRKAQITAYVDYFGQFTSEQFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            S+  RLFDDVLA F+LHHPEHGH 
Sbjct  61   SEVKRLFDDVLAMFVLHHPEHGHA  84


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISCIIDGTL Y  +SPPFASFISLVCP+S+ E SE
Sbjct  69   DVLAMFVLHHPE----HGHAVILPIISCIIDGTLXYKSSSPPFASFISLVCPSSEKEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>ref|XP_009336496.1| PREDICTED: protein GIGANTEA-like [Pyrus x bretschneideri]
Length=1170

 Score =   150 bits (379),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+ ERW DRLQFSSLF PPPQDA +RK QITAYV+YFGQFTSE FPEDIAELIRNRYP
Sbjct  1    MAATSERWFDRLQFSSLFGPPPQDALRRKAQITAYVDYFGQFTSEQFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            S+  RLFDDVLA F+LHHPEHGH 
Sbjct  61   SEVKRLFDDVLAMFVLHHPEHGHA  84


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISCIIDGTL Y  +SPPFASFISLVCP+S+ E SE
Sbjct  69   DVLAMFVLHHPE----HGHAVILPIISCIIDGTLAYKSSSPPFASFISLVCPSSEKEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>ref|XP_011042897.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
 ref|XP_011042898.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
 ref|XP_011042899.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
Length=1169

 Score =   150 bits (379),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 78/99 (79%), Gaps = 7/99 (7%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSLF PPPQDAQQRK QITAYVEYFGQ TSE FP+DIAELIRNRYPS
Sbjct  3    SSSSERWIDGLQFSSLFCPPPQDAQQRKAQITAYVEYFGQCTSEQFPDDIAELIRNRYPS  62

Query  363  KENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            K+  LFDDVLATF+LHHPEHGH        C     L+Y
Sbjct  63   KDKHLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVY  101


 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE SE
Sbjct  70   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENEYSE  125

Query  553  QWALACG  573
            QWALACG
Sbjct  126  QWALACG  132



>ref|XP_010268583.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268584.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268585.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268586.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268587.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268588.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
Length=1083

 Score =   149 bits (377),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+S ERWID LQFSSLFWPPPQD QQR+ QI AYVEYFGQFTSE FP+DI ELIR+RYP
Sbjct  1    MASSSERWIDGLQFSSLFWPPPQDVQQRQAQINAYVEYFGQFTSERFPDDIGELIRSRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SK+ RLFD+VLA F+LHHPEHGH 
Sbjct  61   SKDKRLFDEVLAMFVLHHPEHGHA  84


 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            + L MF  H        G AV+ PIISC+IDGTL YDK+SPPF+SFI LVCP+S+NE SE
Sbjct  69   EVLAMFVLHHPE----HGHAVLLPIISCVIDGTLVYDKSSPPFSSFICLVCPSSENEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>ref|XP_009802612.1| PREDICTED: protein GIGANTEA-like [Nicotiana sylvestris]
 ref|XP_009802613.1| PREDICTED: protein GIGANTEA-like [Nicotiana sylvestris]
Length=1156

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +3

Query  195  ERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENR  374
            ERWID L  SSLFWPPPQDAQQRK Q  AYV+YFGQ TSE FPEDIAELIRNRYPSK+NR
Sbjct  9    ERWIDGLHVSSLFWPPPQDAQQRKAQTAAYVKYFGQSTSEQFPEDIAELIRNRYPSKQNR  68

Query  375  LFDDVLATFLLHHPEHGHG  431
            LFDDVLATF+LHHPEHGH 
Sbjct  69   LFDDVLATFVLHHPEHGHA  87


 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 51/67 (76%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AVIHPIISCIIDGTLEYDK+SPPFASFISLVCP+S+N  SE
Sbjct  72   DVLATFVLHHPE----HGHAVIHPIISCIIDGTLEYDKSSPPFASFISLVCPSSENGYSE  127

Query  553  QWALACG  573
            QWALACG
Sbjct  128  QWALACG  134



>ref|NP_001239995.1| uncharacterized protein LOC100800578 [Glycine max]
 gb|ACJ65313.1| GI2 protein [Glycine max]
 dbj|BAJ22594.1| GIGANTEA [Glycine max]
Length=1170

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 77/100 (77%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAAS ERWIDRLQ+SSLFWPPP D QQRKDQI AYVEYF QFTSE F +DIAELIRN YP
Sbjct  1    MAASSERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFTSEQFADDIAELIRNHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            SK+  LFDDVLATF+LHHPEHGH        C     L+Y
Sbjct  61   SKDILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVY  100


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SE
Sbjct  69   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSE  124

Query  553  QWALACG  573
            +WALACG
Sbjct  125  EWALACG  131



>dbj|BAN82581.1| gigantea [Glycine max]
 dbj|BAN82582.1| gigantea [Glycine max]
 dbj|BAN82583.1| gigantea [Glycine max]
 dbj|BAN82584.1| gigantea [Glycine max]
 dbj|BAN82585.1| gigantea [Glycine max]
 dbj|BAN82587.1| gigantea [Glycine max]
 dbj|BAN82588.1| gigantea [Glycine max]
Length=1170

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 77/100 (77%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAAS ERWIDRLQ+SSLFWPPP D QQRKDQI AYVEYF QFTSE F +DIAELIRN YP
Sbjct  1    MAASSERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFTSEQFADDIAELIRNHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            SK+  LFDDVLATF+LHHPEHGH        C     L+Y
Sbjct  61   SKDILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVY  100


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SE
Sbjct  69   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSE  124

Query  553  QWALACG  573
            +WALACG
Sbjct  125  EWALACG  131



>dbj|BAN82586.1| gigantea [Glycine max]
 dbj|BAN82590.1| gigantea [Glycine max]
 dbj|BAN82591.1| gigantea [Glycine max]
 dbj|BAN82592.1| gigantea [Glycine max]
Length=1170

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 77/100 (77%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAAS ERWIDRLQ+SSLFWPPP D QQRKDQI AYVEYF QFTSE F +DIAELIRN YP
Sbjct  1    MAASSERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFTSEQFADDIAELIRNHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            SK+  LFDDVLATF+LHHPEHGH        C     L+Y
Sbjct  61   SKDILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVY  100


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SE
Sbjct  69   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSE  124

Query  553  QWALACG  573
            +WALACG
Sbjct  125  EWALACG  131



>gb|EYU36555.1| hypothetical protein MIMGU_mgv1a000427mg [Erythranthe guttata]
Length=1160

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA   ERWID LQFSSLFWPPPQD ++RK QI AYVE+FGQFTSE FP+DIAEL+R+RYP
Sbjct  1    MATQNERWIDSLQFSSLFWPPPQDTEERKAQINAYVEFFGQFTSEQFPDDIAELVRSRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            S +NRLFDDVLA F+LHHPEHGH 
Sbjct  61   SDQNRLFDDVLAKFVLHHPEHGHA  84


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AVI PIISCIIDG +EY ++ PPFASFISLVCPNS+NE SE
Sbjct  69   DVLAKFVLHHPE----HGHAVILPIISCIIDGLVEYKRSGPPFASFISLVCPNSENEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>ref|XP_002300901.2| GIGANTEA family protein [Populus trichocarpa]
 gb|EEE80174.2| GIGANTEA family protein [Populus trichocarpa]
Length=1194

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 77/99 (78%), Gaps = 7/99 (7%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSLF PPPQDAQQRK QITAYVEYFGQ TSE FP+DIAELIRNRYPS
Sbjct  3    SSSSERWIDGLQFSSLFCPPPQDAQQRKAQITAYVEYFGQCTSEQFPDDIAELIRNRYPS  62

Query  363  KENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            K+  LFDDVLA F+LHHPEHGH        C     L+Y
Sbjct  63   KDKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVY  101


 Score = 92.0 bits (227),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE SE
Sbjct  70   DVLAMFVLHHPE----HGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENEYSE  125

Query  553  QWALACG  573
            QWALACG
Sbjct  126  QWALACG  132



>ref|XP_006386299.1| hypothetical protein POPTR_0002s06490g [Populus trichocarpa]
 gb|ERP64096.1| hypothetical protein POPTR_0002s06490g [Populus trichocarpa]
Length=1171

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 77/99 (78%), Gaps = 7/99 (7%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSLF PPPQDAQQRK QITAYVEYFGQ TSE FP+DIAELIRNRYPS
Sbjct  3    SSSSERWIDGLQFSSLFCPPPQDAQQRKAQITAYVEYFGQCTSEQFPDDIAELIRNRYPS  62

Query  363  KENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            K+  LFDDVLA F+LHHPEHGH        C     L+Y
Sbjct  63   KDKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVY  101


 Score = 91.7 bits (226),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE SE
Sbjct  70   DVLAMFVLHHPE----HGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENEYSE  125

Query  553  QWALACG  573
            QWALACG
Sbjct  126  QWALACG  132



>gb|AGL61504.1| gigantea-like protein [Chrysanthemum x morifolium]
Length=1145

 Score =   147 bits (372),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA +  RW D LQFSSLFWPPP D QQ K+QITAYV+YFGQFTSE FPEDIAEL+R+RYP
Sbjct  1    MADTSTRWTDSLQFSSLFWPPPLDTQQCKEQITAYVDYFGQFTSEQFPEDIAELVRHRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGH  428
            S+E RLFDDVLATF+LHHPEHGH
Sbjct  61   SQEKRLFDDVLATFVLHHPEHGH  83


 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G +VI PIISCIIDGT+EYD+++PPFASFISLVCP++  E SE
Sbjct  69   DVLATFVLHHPE----HGHSVILPIISCIIDGTMEYDRSTPPFASFISLVCPSTDKEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>ref|XP_009631432.1| PREDICTED: protein GIGANTEA-like isoform X3 [Nicotiana tomentosiformis]
Length=1165

 Score =   147 bits (371),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 72/84 (86%), Gaps = 8/84 (10%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+CERWID LQFSSLFWPPPQDAQQRK QITAYVEYFGQFTSE FPEDIAELIR+RYP
Sbjct  1    MAATCERWIDGLQFSSLFWPPPQDAQQRKAQITAYVEYFGQFTSEQFPEDIAELIRHRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SKENRLFDDVL        EHGH 
Sbjct  61   SKENRLFDDVL--------EHGHA  76


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 49/72 (68%), Gaps = 15/72 (21%)
 Frame = +1

Query  400  FSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQ--------------  537
            F  +++  G AVI PIISCIIDGTL+YDK+ PPFASFISLVCP+S+              
Sbjct  67   FDDVLEH-GHAVILPIISCIIDGTLDYDKSCPPFASFISLVCPSSEVLRILNYQFEGLSH  125

Query  538  NELSEQWALACG  573
             E SEQWALACG
Sbjct  126  KEYSEQWALACG  137



>ref|XP_010261024.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
Length=1174

 Score =   147 bits (370),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M++SCERWID LQFSSLFWP PQDAQQR+ QITAYVEYFGQFTSE F EDI ELIR  YP
Sbjct  1    MSSSCERWIDGLQFSSLFWPSPQDAQQRQAQITAYVEYFGQFTSERFAEDIGELIRCHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            S+  RLFD+VLA F+LHHPEHGH 
Sbjct  61   SQNKRLFDEVLAMFVLHHPEHGHA  84


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            + L MF  H        G AV+ P+ISCIID TL Y+KNSPPF+SFISLVCP+++NE SE
Sbjct  69   EVLAMFVLHHPE----HGHAVLLPLISCIIDDTLAYNKNSPPFSSFISLVCPSNENEYSE  124

Query  553  QWALACG  573
            QWA+ACG
Sbjct  125  QWAMACG  131



>ref|XP_002961231.1| hypothetical protein SELMODRAFT_140066 [Selaginella moellendorffii]
 gb|EFJ38770.1| hypothetical protein SELMODRAFT_140066 [Selaginella moellendorffii]
Length=1063

 Score =   107 bits (267),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M++  ++W+  L+ +SLF  PP D  +R+ +  AYVE FGQF S+ FPEDIAEL+R+ YP
Sbjct  1    MSSPQQKWLTGLKSTSLFRAPPLDLHERQTKTVAYVELFGQFASDSFPEDIAELVRDHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGH  428
             KE  L DDVLATF+LHHPEHGH
Sbjct  61   HKEPCLLDDVLATFVLHHPEHGH  83


 Score = 72.8 bits (177),  Expect(2) = 1e-36, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G  ++HP++SC+IDGTL Y K +PPF SF+S+   +S+ +L+EQWALACG
Sbjct  82   GHTILHPLLSCVIDGTLAYSKTTPPFGSFVSVFGVSSERDLTEQWALACG  131



>ref|XP_010261026.1| PREDICTED: protein GIGANTEA-like isoform X3 [Nelumbo nucifera]
Length=1079

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M++SCERWID LQFSSLFWP PQDAQQR+ QITAYVEYFGQFTSE F EDI ELIR  YP
Sbjct  1    MSSSCERWIDGLQFSSLFWPSPQDAQQRQAQITAYVEYFGQFTSERFAEDIGELIRCHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            S+  RLFD+VLA F+LHHPEHGH 
Sbjct  61   SQNKRLFDEVLAMFVLHHPEHGHA  84


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            + L MF  H        G AV+ P+ISCIID TL Y+KNSPPF+SFISLVCP+++NE SE
Sbjct  69   EVLAMFVLHHPE----HGHAVLLPLISCIIDDTLAYNKNSPPFSSFISLVCPSNENEYSE  124

Query  553  QWALACG  573
            QWA+ACG
Sbjct  125  QWAMACG  131



>ref|XP_002969462.1| hypothetical protein SELMODRAFT_170553 [Selaginella moellendorffii]
 gb|EFJ29550.1| hypothetical protein SELMODRAFT_170553 [Selaginella moellendorffii]
Length=1056

 Score =   107 bits (267),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M++  ++W+  L+ +SLF  PP D  +R+ +  AYVE FGQF S+ FPEDIAEL+R+ YP
Sbjct  1    MSSPQQKWLTGLKSTSLFRAPPLDLHERQTKTVAYVELFGQFASDSFPEDIAELVRDHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGH  428
             KE  L DDVLATF+LHHPEHGH
Sbjct  61   HKEPCLLDDVLATFVLHHPEHGH  83


 Score = 72.4 bits (176),  Expect(2) = 1e-36, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G  ++HP++SC+IDGTL Y K +PPF SF+S+   +S+ +L+EQWALACG
Sbjct  82   GHTILHPLLSCVIDGTLAYSKTTPPFGSFVSVFGVSSERDLTEQWALACG  131



>ref|XP_004496435.1| PREDICTED: protein GIGANTEA-like isoform X1 [Cicer arietinum]
Length=1180

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 74/95 (78%), Gaps = 7/95 (7%)
 Frame = +3

Query  195  ERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENR  374
            ERWIDRLQ+SSLFWPPPQD QQ+KDQI AYVEY  QFTSE F +DIAE+IRNRYPSKE  
Sbjct  11   ERWIDRLQYSSLFWPPPQDGQQKKDQIAAYVEYLIQFTSEQFADDIAEMIRNRYPSKEIL  70

Query  375  LFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            LFDDVLATF+LHHPEHGH        C     L+Y
Sbjct  71   LFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVY  105


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 47/67 (70%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YDK SPPFAS ISLVCP ++NE SE
Sbjct  74   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDKTSPPFASLISLVCPKNENEYSE  129

Query  553  QWALACG  573
            QWALACG
Sbjct  130  QWALACG  136



>ref|XP_006416158.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 gb|ESQ34511.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
Length=984

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA S ERWID LQFSSL WPPP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+R++YP
Sbjct  1    MATSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            S E RL DDVLA F+LHHPEHGH 
Sbjct  61   STEKRLLDDVLAMFVLHHPEHGHA  84


 Score = 82.8 bits (203),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 41/67 (61%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI P+ISC+IDG+L Y K + PFASFISLVCP+S+N+ SE
Sbjct  69   DVLAMFVLHHPE----HGHAVILPMISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>gb|KFK44368.1| gigantea [Arabis alpina]
Length=1173

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA S ERWID LQFSSL WPPP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+R +YP
Sbjct  1    MATSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRQQYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            S E RL DDVLA F+LHHPEHGH 
Sbjct  61   SNEKRLLDDVLAMFVLHHPEHGHA  84


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SE
Sbjct  69   DVLAMFVLHHPE----HGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>ref|XP_006416159.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 ref|XP_006416160.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 gb|ESQ34512.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 gb|ESQ34513.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
Length=1171

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA S ERWID LQFSSL WPPP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+R++YP
Sbjct  1    MATSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            S E RL DDVLA F+LHHPEHGH 
Sbjct  61   STEKRLLDDVLAMFVLHHPEHGHA  84


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 41/67 (61%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI P+ISC+IDG+L Y K + PFASFISLVCP+S+N+ SE
Sbjct  69   DVLAMFVLHHPE----HGHAVILPMISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>ref|XP_003556164.1| PREDICTED: protein GIGANTEA isoformX1 [Glycine max]
 ref|XP_006606175.1| PREDICTED: protein GIGANTEA isoform X2 [Glycine max]
 ref|XP_006606176.1| PREDICTED: protein GIGANTEA isoform X3 [Glycine max]
 ref|XP_006606177.1| PREDICTED: protein GIGANTEA isoform X4 [Glycine max]
 gb|ACA24489.1| gigantea-like protein 1 [Glycine max]
Length=1175

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 74/95 (78%), Gaps = 7/95 (7%)
 Frame = +3

Query  195  ERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENR  374
            ERWIDRLQ+SSLFWPPP D QQRKDQI AYVEYF QFTSE F +DIAELIRNRYPSK+  
Sbjct  13   ERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFTSEQFADDIAELIRNRYPSKDIL  72

Query  375  LFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            LFDDVLATF+LHHPEHGH        C     L+Y
Sbjct  73   LFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVY  107


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SE
Sbjct  76   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSE  131

Query  553  QWALACG  573
            QWALACG
Sbjct  132  QWALACG  138



>gb|ACJ65312.1| GI1 protein [Glycine max]
Length=1176

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 74/95 (78%), Gaps = 7/95 (7%)
 Frame = +3

Query  195  ERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENR  374
            ERWIDRLQ+SSLFWPPP D QQRKDQI AYVEYF QFTSE F +DIAELIRNRYPSK+  
Sbjct  13   ERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFTSEQFADDIAELIRNRYPSKDIL  72

Query  375  LFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            LFDDVLATF+LHHPEHGH        C     L+Y
Sbjct  73   LFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVY  107


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SE
Sbjct  76   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSE  131

Query  553  QWALACG  573
            QWALACG
Sbjct  132  QWALACG  138



>gb|ACA24490.1| gigantea-like protein 2 [Glycine max]
Length=990

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 74/95 (78%), Gaps = 7/95 (7%)
 Frame = +3

Query  195  ERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENR  374
            ERWIDRLQ+SSLFWPPP D QQRKDQI AYVEYF QFTSE F +DIAELIRNRYPSK+  
Sbjct  13   ERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFTSEQFADDIAELIRNRYPSKDIL  72

Query  375  LFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            LFDDVLATF+LHHPEHGH        C     L+Y
Sbjct  73   LFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVY  107


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SE
Sbjct  76   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSE  131

Query  553  QWALACG  573
            QWALACG
Sbjct  132  QWALACG  138



>ref|XP_009335139.1| PREDICTED: protein GIGANTEA-like [Pyrus x bretschneideri]
 ref|XP_009335140.1| PREDICTED: protein GIGANTEA-like [Pyrus x bretschneideri]
Length=1169

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+ ERW DRLQ SSLF PPPQD   RK QITAYV+YFGQFTSE FPEDIAELIRNRYP
Sbjct  1    MAATSERWFDRLQCSSLFGPPPQDTLPRKAQITAYVDYFGQFTSEQFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            S+  RLFDDVLA F+LHHPEHGH 
Sbjct  61   SEVKRLFDDVLAMFVLHHPEHGHA  84


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 48/67 (72%), Gaps = 5/67 (7%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISCIIDGTL Y  +SPPFASFISLVCP+S+ E SE
Sbjct  69   DVLAMFVLHHPE----HGHAVILPIISCIIDGTLAYKSSSPPFASFISLVCPSSE-EYSE  123

Query  553  QWALACG  573
            QWALACG
Sbjct  124  QWALACG  130



>emb|CAN81809.1| hypothetical protein VITISV_032939 [Vitis vinifera]
Length=1172

 Score =   128 bits (322),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+SCERWID LQFSSLFWPPPQD QQRK QITAYV+YFGQFTSE FPEDIAELIR+RYP
Sbjct  1    MASSCERWIDGLQFSSLFWPPPQDVQQRKAQITAYVDYFGQFTSEQFPEDIAELIRSRYP  60

Query  360  SKENRLF  380
            SKE RL 
Sbjct  61   SKEQRLL  67


 Score = 49.7 bits (117),  Expect(2) = 4e-36, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +2

Query  416  RAWAWLLFIQLSHVSLMVHWSMIKIVHLLPLSFHWSVQTVR  538
            R    L F QL  VSLMVHW MI ++ LLPLSF WS Q  R
Sbjct  79   RNMGMLSFFQLFRVSLMVHWCMIGVLLLLPLSFPWSAQAAR  119



>ref|XP_010268589.1| PREDICTED: protein GIGANTEA-like isoform X2 [Nelumbo nucifera]
Length=1081

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 73/84 (87%), Gaps = 2/84 (2%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+S ERWID LQFSSLFWPPPQD QQR  QI AYVEYFGQFTSE FP+DI ELIR+RYP
Sbjct  1    MASSSERWIDGLQFSSLFWPPPQDVQQR--QINAYVEYFGQFTSERFPDDIGELIRSRYP  58

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SK+ RLFD+VLA F+LHHPEHGH 
Sbjct  59   SKDKRLFDEVLAMFVLHHPEHGHA  82


 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            + L MF  H        G AV+ PIISC+IDGTL YDK+SPPF+SFI LVCP+S+NE SE
Sbjct  67   EVLAMFVLHHPE----HGHAVLLPIISCVIDGTLVYDKSSPPFSSFICLVCPSSENEYSE  122

Query  553  QWALACG  573
            QWALACG
Sbjct  123  QWALACG  129



>gb|ACT22764.1| GIGANTEA [Allium cepa]
Length=1109

 Score =   144 bits (364),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 75/100 (75%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M+  CE+WID LQ+SSL WPPPQD  QR+ QI AYVEYFGQFTSE FPED+A+LI+N YP
Sbjct  1    MSVVCEKWIDGLQYSSLLWPPPQDEHQRQAQILAYVEYFGQFTSEQFPEDVAQLIQNHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            SKE RL D+VLATF+LHHPEHGH        C     L+Y
Sbjct  61   SKEQRLLDEVLATFVLHHPEHGHAIVHPILSCIIDGTLVY  100


 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G A++HPI+SCIIDGTL YDK+ PPF+SFISL   NS+ E SEQWALACG
Sbjct  82   GHAIVHPILSCIIDGTLVYDKHDPPFSSFISLFNQNSEKEYSEQWALACG  131



>gb|AGU91438.1| GIGANTEA-like protein, partial [Chrysanthemum boreale]
Length=949

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+ ERWID LQFSSLF PPPQD  QRK QITAYV+YF QFTSE FPEDIAEL+RNRYP
Sbjct  1    MAATSERWIDGLQFSSLFRPPPQDPDQRKAQITAYVDYFAQFTSEQFPEDIAELVRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHG  425
            S E RL DDVLA F+LHHPEHG
Sbjct  61   SSEKRLIDDVLAMFVLHHPEHG  82


 Score = 87.0 bits (214),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 50/66 (76%), Gaps = 4/66 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AV+ PIISCIIDGT+EY++++PPFASFISL+CP++ NE SE
Sbjct  69   DVLAMFVLHHPE----HGDAVMLPIISCIIDGTIEYERSTPPFASFISLICPSTDNEYSE  124

Query  553  QWALAC  570
            QWALAC
Sbjct  125  QWALAC  130



>dbj|BAN82589.1| gigantea [Glycine max]
Length=1171

 Score =   144 bits (364),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 77/101 (76%), Gaps = 8/101 (8%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAE-LIRNRY  356
            MAAS ERWIDRLQ+SSLFWPPP D QQRKDQI AYVEYF QFTSE F +DIAE LIRN Y
Sbjct  1    MAASSERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFTSEQFADDIAEVLIRNHY  60

Query  357  PSKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            PSK+  LFDDVLATF+LHHPEHGH        C     L+Y
Sbjct  61   PSKDILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVY  101


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SE
Sbjct  70   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSE  125

Query  553  QWALACG  573
            +WALACG
Sbjct  126  EWALACG  132



>ref|XP_006306336.1| hypothetical protein CARUB_v10012213mg [Capsella rubella]
 gb|EOA39234.1| hypothetical protein CARUB_v10012213mg [Capsella rubella]
Length=1171

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            A S ERWID LQFSSL WPPP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  3    ATSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  62

Query  363  KENRLFDDVLATFLLHHPEHGHG  431
             E RL DDVLA F+LHHPEHGH 
Sbjct  63   NEKRLLDDVLAMFVLHHPEHGHA  85


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SE
Sbjct  70   DVLAMFVLHHPE----HGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSE  125

Query  553  QWALACG  573
            QWALACG
Sbjct  126  QWALACG  132



>ref|XP_008386373.1| PREDICTED: protein GIGANTEA-like [Malus domestica]
Length=1169

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+ ERW DRLQFSSLF PPP D  +RK +ITAYV+YFGQFTSE FPED+AELIRNRYP
Sbjct  1    MAATSERWFDRLQFSSLFGPPPPDNLRRKAEITAYVDYFGQFTSEQFPEDVAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            S+  RLFDDVLA F+LHHPEHGH 
Sbjct  61   SEVKRLFDDVLAMFVLHHPEHGHA  84


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 47/67 (70%), Gaps = 5/67 (7%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISCIIDGTL Y  + PPFASFISLVCP+S+ E SE
Sbjct  69   DVLAMFVLHHPE----HGHAVILPIISCIIDGTLAYKSSGPPFASFISLVCPSSE-EYSE  123

Query  553  QWALACG  573
            QWALACG
Sbjct  124  QWALACG  130



>gb|KHN17039.1| Protein GIGANTEA [Glycine soja]
Length=1149

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 73/95 (77%), Gaps = 7/95 (7%)
 Frame = +3

Query  195  ERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENR  374
            ERWIDRLQ+SSLFWPPP D QQRKDQI AYVEYF QFTSE F +DIAELIRN YPSK+  
Sbjct  13   ERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFTSEQFADDIAELIRNHYPSKDIL  72

Query  375  LFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            LFDDVLATF+LHHPEHGH        C     L+Y
Sbjct  73   LFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVY  107


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SE
Sbjct  76   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSE  131

Query  553  QWALACG  573
            +WALACG
Sbjct  132  EWALACG  138



>ref|XP_006588466.1| PREDICTED: uncharacterized protein LOC100800578 isoform X1 [Glycine 
max]
 ref|XP_006588467.1| PREDICTED: uncharacterized protein LOC100800578 isoform X2 [Glycine 
max]
 ref|XP_006588468.1| PREDICTED: uncharacterized protein LOC100800578 isoform X3 [Glycine 
max]
Length=1177

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 73/95 (77%), Gaps = 7/95 (7%)
 Frame = +3

Query  195  ERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENR  374
            ERWIDRLQ+SSLFWPPP D QQRKDQI AYVEYF QFTSE F +DIAELIRN YPSK+  
Sbjct  13   ERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFTSEQFADDIAELIRNHYPSKDIL  72

Query  375  LFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            LFDDVLATF+LHHPEHGH        C     L+Y
Sbjct  73   LFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVY  107


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SE
Sbjct  76   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSE  131

Query  553  QWALACG  573
            +WALACG
Sbjct  132  EWALACG  138



>gb|ACT22765.1| GIGANTEA [Allium cepa]
Length=1109

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 75/100 (75%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M+  CE+WID L++SSL WPPPQD  QR+ QI AYVEYFGQFTSE FPED+A+LI+N YP
Sbjct  1    MSVVCEKWIDGLRYSSLLWPPPQDEHQRQAQILAYVEYFGQFTSEQFPEDVAQLIQNHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            SKE RL D+VLATF+LHHPEHGH        C     L+Y
Sbjct  61   SKEQRLLDEVLATFVLHHPEHGHAIVHPILSCIIDGTLVY  100


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G A++HPI+SCIIDGTL YDK+ PPF+SFISL   NS+ E SEQWALACG
Sbjct  82   GHAIVHPILSCIIDGTLVYDKHDPPFSSFISLFNQNSEKEYSEQWALACG  131



>gb|AAF00023.1| GIGANTEA [Arabidopsis thaliana]
Length=1155

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHG  431
             E RL DDVLA F+LHHPEHGH 
Sbjct  64   TEKRLLDDVLAMFVLHHPEHGHA  86


 Score = 83.6 bits (205),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SE
Sbjct  71   DVLAMFVLHHPE----HGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSE  126

Query  553  QWALACG  573
            QWALACG
Sbjct  127  QWALACG  133



>dbj|BAD97869.1| GI homologue [Lemna gibba]
Length=1116

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 76/100 (76%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M +S ERWID LQF SLFWPPPQD QQR+ Q TAYVEYF QFTSE FPED+A+LI+N YP
Sbjct  1    MPSSTERWIDGLQFPSLFWPPPQDEQQRQAQTTAYVEYFVQFTSERFPEDVAQLIQNHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            SKE+RL D+VLATF+LHHPEHGH        C     L+Y
Sbjct  61   SKESRLLDEVLATFVLHHPEHGHAIVHPTLSCIIEGSLVY  100


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G A++HP +SCII+G+L Y KN PPF SFISLV  N++ E SEQWALACG
Sbjct  82   GHAIVHPTLSCIIEGSLVYSKNVPPFNSFISLVSQNNEKEYSEQWALACG  131



>gb|AAT97404.1| gigantea [Arabidopsis thaliana]
Length=1173

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHG  431
             E RL DDVLA F+LHHPEHGH 
Sbjct  64   TEKRLLDDVLAMFVLHHPEHGHA  86


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SE
Sbjct  71   DVLAMFVLHHPE----HGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSE  126

Query  553  QWALACG  573
            QWALACG
Sbjct  127  QWALACG  133



>gb|ABP96496.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHG  431
             E RL DDVLA F+LHHPEHGH 
Sbjct  64   TEKRLLDDVLAMFVLHHPEHGHA  86


 Score = 83.2 bits (204),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 41/67 (61%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISC+IDG+L Y K + PFASF+SLVCP+S+N+ SE
Sbjct  71   DVLAMFVLHHPE----HGHAVILPIISCLIDGSLVYSKEAHPFASFVSLVCPSSENDYSE  126

Query  553  QWALACG  573
            QWALACG
Sbjct  127  QWALACG  133



>gb|ABP96498.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHG  431
             E RL DDVLA F+LHHPEHGH 
Sbjct  64   TEKRLLDDVLAMFVLHHPEHGHA  86


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SE
Sbjct  71   DVLAMFVLHHPE----HGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSE  126

Query  553  QWALACG  573
            QWALACG
Sbjct  127  QWALACG  133



>ref|NP_564180.1| protein GIGANTEA [Arabidopsis thaliana]
 sp|Q9SQI2.2|GIGAN_ARATH RecName: Full=Protein GIGANTEA [Arabidopsis thaliana]
 gb|AAF00092.1|AF105064_1 GIGANTEA [Arabidopsis thaliana]
 emb|CAB56039.1| gigantea protein [Arabidopsis thaliana]
 gb|AAT97405.1| gigantea [Arabidopsis thaliana]
 gb|AEE30286.1| gigantea protein (GI) [Arabidopsis thaliana]
Length=1173

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHG  431
             E RL DDVLA F+LHHPEHGH 
Sbjct  64   TEKRLLDDVLAMFVLHHPEHGHA  86


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SE
Sbjct  71   DVLAMFVLHHPE----HGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSE  126

Query  553  QWALACG  573
            QWALACG
Sbjct  127  QWALACG  133



>gb|AAT80910.1| GIGANTEA [Arabidopsis thaliana]
Length=1173

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHG  431
             E RL DDVLA F+LHHPEHGH 
Sbjct  64   TEKRLLDDVLAMFVLHHPEHGHA  86


 Score = 83.2 bits (204),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 41/67 (61%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISC+IDG+L Y K + PFASF+SLVCP+S+N+ SE
Sbjct  71   DVLAMFVLHHPE----HGHAVILPIISCLIDGSLVYSKEAHPFASFVSLVCPSSENDYSE  126

Query  553  QWALACG  573
            QWALACG
Sbjct  127  QWALACG  133



>gb|ABP96484.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96487.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96489.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96500.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96501.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHG  431
             E RL DDVLA F+LHHPEHGH 
Sbjct  64   TEKRLLDDVLAMFVLHHPEHGHA  86


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SE
Sbjct  71   DVLAMFVLHHPE----HGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSE  126

Query  553  QWALACG  573
            QWALACG
Sbjct  127  QWALACG  133



>gb|ABP96482.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHG  431
             E RL DDVLA F+LHHPEHGH 
Sbjct  64   TEKRLLDDVLAMFVLHHPEHGHA  86


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SE
Sbjct  71   DVLAMFVLHHPE----HGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSE  126

Query  553  QWALACG  573
            QWALACG
Sbjct  127  QWALACG  133



>gb|ABP96485.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96486.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96499.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHG  431
             E RL DDVLA F+LHHPEHGH 
Sbjct  64   TEKRLLDDVLAMFVLHHPEHGHA  86


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SE
Sbjct  71   DVLAMFVLHHPE----HGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSE  126

Query  553  QWALACG  573
            QWALACG
Sbjct  127  QWALACG  133



>gb|ABP96483.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96490.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96491.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96492.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96493.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96494.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96495.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96502.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHG  431
             E RL DDVLA F+LHHPEHGH 
Sbjct  64   TEKRLLDDVLAMFVLHHPEHGHA  86


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SE
Sbjct  71   DVLAMFVLHHPE----HGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSE  126

Query  553  QWALACG  573
            QWALACG
Sbjct  127  QWALACG  133



>gb|ABP96488.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHG  431
             E RL DDVLA F+LHHPEHGH 
Sbjct  64   TEKRLLDDVLAMFVLHHPEHGHA  86


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SE
Sbjct  71   DVLAMFVLHHPE----HGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSE  126

Query  553  QWALACG  573
            QWALACG
Sbjct  127  QWALACG  133



>gb|ABP96497.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHG  431
             E RL DDVLA F+LHHPEHGH 
Sbjct  64   TEKRLLDDVLAMFVLHHPEHGHA  86


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SE
Sbjct  71   DVLAMFVLHHPE----HGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSE  126

Query  553  QWALACG  573
            QWALACG
Sbjct  127  QWALACG  133



>emb|CAA72908.1| hypothetical protein [Arabidopsis thaliana]
Length=1167

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHG  431
             E RL DDVLA F+LHHPEHGH 
Sbjct  64   TEKRLLDDVLAMFVLHHPEHGHA  86


 Score = 83.6 bits (205),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SE
Sbjct  71   DVLAMFVLHHPE----HGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSE  126

Query  553  QWALACG  573
            QWALACG
Sbjct  127  QWALACG  133



>gb|AFK65758.1| GIGANTEA, partial [Chrysanthemum x morifolium]
Length=1151

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA +  RW D LQ SSLF PPP D QQRK+QITAYV+YFGQFTSE FPEDIAEL+R+ YP
Sbjct  2    MADTSTRWTDSLQLSSLFSPPPLDTQQRKEQITAYVDYFGQFTSEQFPEDIAELVRHHYP  61

Query  360  SKENRLFDDVLATFLLHHPEHGH  428
            S+E RLFDDVLATF+LHHPEHGH
Sbjct  62   SQEKRLFDDVLATFVLHHPEHGH  84


 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G +VI PIISCIIDGT+EYD+++PPFASFISLVCP++  E SE
Sbjct  70   DVLATFVLHHPE----HGHSVILPIISCIIDGTMEYDRSTPPFASFISLVCPSTDKEYSE  125

Query  553  QWALACG  573
            QWALACG
Sbjct  126  QWALACG  132



>ref|XP_010477545.1| PREDICTED: protein GIGANTEA-like isoform X3 [Camelina sativa]
Length=1169

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            A S ERWID LQFSS+ WPPP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    ATSSERWIDGLQFSSVLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHG  431
             E RL DDVLA F+LHHPEHGH 
Sbjct  64   DEKRLLDDVLAMFVLHHPEHGHA  86


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SE
Sbjct  71   DVLAMFVLHHPE----HGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSE  126

Query  553  QWALACG  573
            QWALACG
Sbjct  127  QWALACG  133



>ref|XP_010477546.1| PREDICTED: protein GIGANTEA-like isoform X4 [Camelina sativa]
Length=1169

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            A S ERWID LQFSS+ WPPP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    ATSSERWIDGLQFSSVLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHG  431
             E RL DDVLA F+LHHPEHGH 
Sbjct  64   DEKRLLDDVLAMFVLHHPEHGHA  86


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SE
Sbjct  71   DVLAMFVLHHPE----HGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSE  126

Query  553  QWALACG  573
            QWALACG
Sbjct  127  QWALACG  133



>ref|XP_010498761.1| PREDICTED: protein GIGANTEA [Camelina sativa]
Length=1169

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            A S ERWID LQFSS+ WPPP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    ATSSERWIDGLQFSSVLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHG  431
             E RL DDVLA F+LHHPEHGH 
Sbjct  64   DEKRLLDDVLAMFVLHHPEHGHA  86


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SE
Sbjct  71   DVLAMFVLHHPE----HGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSE  126

Query  553  QWALACG  573
            QWALACG
Sbjct  127  QWALACG  133



>ref|XP_010477543.1| PREDICTED: protein GIGANTEA-like isoform X1 [Camelina sativa]
Length=1170

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            A S ERWID LQFSS+ WPPP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    ATSSERWIDGLQFSSVLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHG  431
             E RL DDVLA F+LHHPEHGH 
Sbjct  64   DEKRLLDDVLAMFVLHHPEHGHA  86


 Score = 80.5 bits (197),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 43/68 (63%), Positives = 48/68 (71%), Gaps = 5/68 (7%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS-QNELS  549
            D L MF  H        G AVI PIISC+IDG+L Y K + PFASFISLVCP+S QN+ S
Sbjct  71   DVLAMFVLHHPE----HGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSEQNDYS  126

Query  550  EQWALACG  573
            EQWALACG
Sbjct  127  EQWALACG  134



>ref|XP_010477544.1| PREDICTED: protein GIGANTEA-like isoform X2 [Camelina sativa]
Length=1170

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            A S ERWID LQFSS+ WPPP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    ATSSERWIDGLQFSSVLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHG  431
             E RL DDVLA F+LHHPEHGH 
Sbjct  64   DEKRLLDDVLAMFVLHHPEHGHA  86


 Score = 80.5 bits (197),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 43/68 (63%), Positives = 48/68 (71%), Gaps = 5/68 (7%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS-QNELS  549
            D L MF  H        G AVI PIISC+IDG+L Y K + PFASFISLVCP+S QN+ S
Sbjct  71   DVLAMFVLHHPE----HGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSEQNDYS  126

Query  550  EQWALACG  573
            EQWALACG
Sbjct  127  EQWALACG  134



>ref|XP_010462850.1| PREDICTED: protein GIGANTEA-like [Camelina sativa]
Length=1138

 Score =   141 bits (356),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            A S ERWID LQFSS+ WPPP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    ATSSERWIDGLQFSSVLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHG  431
             E RL DDVLA F+LHHPEHGH 
Sbjct  64   DEKRLLDDVLAMFVLHHPEHGHA  86


 Score = 83.6 bits (205),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SE
Sbjct  71   DVLAMFVLHHPE----HGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSE  126

Query  553  QWALACG  573
            QWALACG
Sbjct  127  QWALACG  133



>dbj|BAP76055.1| putative GI [Cryptomeria japonica]
Length=1197

 Score =   119 bits (297),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +3

Query  195  ERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENR  374
            ++WI+ LQ SSLF PPPQDAQQR+ +I AYVE FGQ+TSE FP DIAE+I   YP++E  
Sbjct  6    QKWIEGLQSSSLFRPPPQDAQQRQIEILAYVELFGQYTSEEFPHDIAEIIHCHYPNEEVC  65

Query  375  LFDDVLATFLLHHPEHGH  428
            L DDVLATF+LHHPEHGH
Sbjct  66   LLDDVLATFVLHHPEHGH  83


 Score = 55.1 bits (131),  Expect(2) = 6e-35, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 34/55 (62%), Gaps = 6/55 (11%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS------QNELSEQWALAC  570
            G   IHP++S IID  + YDK  PPF+SFISL  P+S      Q +  EQW +AC
Sbjct  82   GHTFIHPLLSLIIDRIVIYDKKIPPFSSFISLFSPSSKLHFPWQKDYPEQWGVAC  136



>ref|XP_002890532.1| hypothetical protein ARALYDRAFT_889789 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66791.1| hypothetical protein ARALYDRAFT_889789 [Arabidopsis lyrata subsp. 
lyrata]
Length=1174

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  195  ERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENR  374
            ERWID LQFSSL WPPP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS E R
Sbjct  9    ERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPSTEKR  68

Query  375  LFDDVLATFLLHHPEHGHG  431
            L DDVLA F+LHHPEHGH 
Sbjct  69   LLDDVLAMFVLHHPEHGHA  87


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SE
Sbjct  72   DVLAMFVLHHPE----HGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSE  127

Query  553  QWALACG  573
            QWALACG
Sbjct  128  QWALACG  134



>ref|XP_004139688.1| PREDICTED: protein GIGANTEA-like [Cucumis sativus]
Length=1168

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA S ERWIDRLQ SSLFWPPP D QQRK Q +AYVEY GQFTSE F EDIAELIR R+ 
Sbjct  1    MATSSERWIDRLQLSSLFWPPPDDDQQRKVQCSAYVEYLGQFTSERFSEDIAELIRIRFQ  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
            SKE RLFDDVLA F+LHHPE+GH 
Sbjct  61   SKEKRLFDDVLALFVLHHPENGHA  84


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L +F  H        G A+I PIISCI DG LEY++N PPFASFISL CP  +N+ SE
Sbjct  69   DVLALFVLHHPE----NGHAIILPIISCIFDGALEYNRNDPPFASFISLFCPGIENDYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>dbj|BAD97864.1| GI homologue 1 [Lemna paucicostata]
Length=1115

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 73/100 (73%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M AS ERWID LQFSSLFWPPP D QQR+ Q  AYVEYF QFTSE FPED+A+LI+N YP
Sbjct  1    MVASTERWIDGLQFSSLFWPPPPDEQQRQAQTMAYVEYFVQFTSERFPEDVAQLIQNNYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            SKE RL DDVLATF+LHHPEH H        C     L+Y
Sbjct  61   SKEIRLLDDVLATFVLHHPEHSHAIVHPILSCIIDGSLLY  100


 Score = 80.5 bits (197),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  430  AVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            A++HPI+SCIIDG+L YDKN PPF+SFISLV  N++ E SEQWA+ACG
Sbjct  84   AIVHPILSCIIDGSLLYDKNEPPFSSFISLVGQNNEKEYSEQWAMACG  131



>emb|CDY04787.1| BnaC05g18020D [Brassica napus]
Length=1170

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 71/97 (73%), Gaps = 7/97 (7%)
 Frame = +3

Query  189  SCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKE  368
            S ERW D LQFSSL W PP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+RN+YPS E
Sbjct  6    SSERWTDGLQFSSLLWSPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRNQYPSTE  65

Query  369  NRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
             RL DDVLA F+LHHPEHGH        C     L+Y
Sbjct  66   KRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGTLVY  102


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISC+IDGTL Y K + PFASFISLV P S+N+ SE
Sbjct  71   DVLAMFVLHHPE----HGHAVILPIISCLIDGTLVYSKEAHPFASFISLVSPTSENDYSE  126

Query  553  QWALACG  573
            QWALACG
Sbjct  127  QWALACG  133



>ref|XP_009115601.1| PREDICTED: protein GIGANTEA [Brassica rapa]
Length=1171

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 71/97 (73%), Gaps = 7/97 (7%)
 Frame = +3

Query  189  SCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKE  368
            S ERW D LQFSSL W PP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+RN+YPS E
Sbjct  6    SSERWTDGLQFSSLLWSPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRNQYPSTE  65

Query  369  NRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
             RL DDVLA F+LHHPEHGH        C     L+Y
Sbjct  66   KRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGTLVY  102


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 47/67 (70%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISC+IDGTL Y K + PFASFISLV PNS+N+ SE
Sbjct  71   DVLAMFVLHHPE----HGHAVILPIISCLIDGTLVYSKEAHPFASFISLVSPNSENDYSE  126

Query  553  QWALACG  573
            QWALACG
Sbjct  127  QWALACG  133



>emb|CDY21388.1| BnaA09g30390D [Brassica napus]
Length=1171

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 71/97 (73%), Gaps = 7/97 (7%)
 Frame = +3

Query  189  SCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKE  368
            S ERW D LQFSSL W PP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+RN+YPS E
Sbjct  6    SSERWTDGLQFSSLLWSPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRNQYPSTE  65

Query  369  NRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
             RL DDVLA F+LHHPEHGH        C     L+Y
Sbjct  66   KRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGTLVY  102


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 47/67 (70%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISC+IDGTL Y K + PFASFISLV PNS+N+ SE
Sbjct  71   DVLAMFVLHHPE----HGHAVILPIISCLIDGTLVYSKEAHPFASFISLVSPNSENDYSE  126

Query  553  QWALACG  573
            QWALACG
Sbjct  127  QWALACG  133



>ref|NP_001288824.1| protein GIGANTEA [Brassica rapa]
 gb|AEB33730.1| GIGANTEA [Brassica rapa]
Length=1183

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 71/97 (73%), Gaps = 7/97 (7%)
 Frame = +3

Query  189  SCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKE  368
            S ERW D LQFSSL W PP+D QQ KDQ+ AYVEYFGQFTSE FP+DIAEL+RN+YPS E
Sbjct  6    SSERWTDGLQFSSLLWSPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRNQYPSTE  65

Query  369  NRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
             RL DDVLA F+LHHPEHGH        C     L+Y
Sbjct  66   KRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGTLVY  102


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 47/67 (70%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISC+IDGTL Y K + PFASFISLV PNS+N+ SE
Sbjct  71   DVLAMFVLHHPE----HGHAVILPIISCLIDGTLVYSKEAHPFASFISLVSPNSENDYSE  126

Query  553  QWALACG  573
            QWALACG
Sbjct  127  QWALACG  133



>gb|ABP96481.1| GIGANTEA [Arabidopsis lyrata subsp. petraea]
Length=1173

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  195  ERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENR  374
            ERWID LQFSSL WPPP+D QQ KDQ+ AYV+YFGQFTSE FP+DIAEL+R++YPS E R
Sbjct  9    ERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVDYFGQFTSEQFPDDIAELVRHQYPSTEKR  68

Query  375  LFDDVLATFLLHHPEHGHG  431
            L DDVLA F+LHHPEHGH 
Sbjct  69   LLDDVLAMFVLHHPEHGHA  87


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SE
Sbjct  72   DVLAMFVLHHPE----HGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSE  127

Query  553  QWALACG  573
            QWALACG
Sbjct  128  QWALACG  134



>gb|ADX35837.1| gigantea, partial [Brachypodium rupestre]
 gb|ADX35838.1| gigantea, partial [Brachypodium retusum]
 gb|ADX35840.1| gigantea, partial [Brachypodium retusum]
 gb|ADX35841.1| gigantea, partial [Brachypodium pinnatum]
 gb|ADX35842.1| gigantea, partial [Brachypodium pinnatum]
 gb|ADX35843.1| gigantea, partial [Brachypodium pinnatum]
 gb|ADX35850.1| gigantea, partial [Brachypodium sylvaticum subsp. glaucovirens]
 gb|ADX35851.1| gigantea, partial [Brachypodium phoenicoides]
 gb|ADX35852.1| gigantea, partial [Brachypodium phoenicoides]
 gb|ADX35853.1| gigantea, partial [Brachypodium sylvaticum]
 gb|ADX35854.1| gigantea, partial [Brachypodium sylvaticum]
 gb|AFB78140.1| gigantea, partial [Brachypodium arbuscula]
 gb|AFB78141.1| gigantea, partial [Brachypodium arbuscula]
Length=110

 Score =   109 bits (273),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 59/70 (84%), Gaps = 2/70 (3%)
 Frame = +3

Query  231  FWPPPQDAQQRKDQITAYVEYFGQFTS--EHFPEDIAELIRNRYPSKENRLFDDVLATFL  404
            FWPPP DAQQ++ QI AYVEYFGQFTS  E FPED+A+LI++ YP+KE RL D+VLATF+
Sbjct  1    FWPPPHDAQQKQVQILAYVEYFGQFTSDSEQFPEDVAQLIQSCYPAKEKRLVDEVLATFV  60

Query  405  LHHPEHGHGC  434
            LHHPEHGH  
Sbjct  61   LHHPEHGHAV  70


 Score = 59.3 bits (142),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  555
            G AV+HPI+S IIDGTL YD++  PF SFISL    S+ E SEQ
Sbjct  67   GHAVVHPILSRIIDGTLSYDRHGSPFNSFISLFTQTSEKEYSEQ  110



>gb|ADP92454.1| GIGANTEA 1 [x Doritaenopsis hybrid cultivar]
Length=1160

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M++S ++WID LQFSSL WPPPQD QQR+ QI AYVEYF QFTSE FPEDIA+LI+  YP
Sbjct  1    MSSSSQKWIDGLQFSSLLWPPPQDEQQRQVQIMAYVEYFAQFTSEQFPEDIAQLIQRHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG  431
             KE R+ DDVLA F+LHHPEHGH 
Sbjct  61   VKEKRVLDDVLAIFVLHHPEHGHA  84


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L +F  H        G A++HPI+SCIIDGTL + KN+PPF+SFISL+   ++ E SE
Sbjct  69   DVLAIFVLHHPE----HGHAIVHPILSCIIDGTLVHGKNNPPFSSFISLIGQTTEKEYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>gb|ADX35848.1| gigantea, partial [Brachypodium distachyon]
 gb|ADX35849.1| gigantea, partial [Brachypodium distachyon]
Length=110

 Score =   109 bits (272),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 59/70 (84%), Gaps = 2/70 (3%)
 Frame = +3

Query  231  FWPPPQDAQQRKDQITAYVEYFGQFTS--EHFPEDIAELIRNRYPSKENRLFDDVLATFL  404
            FWPPP DAQQ++ QI AYVEYFGQFTS  E FPED+A+LI++ YP+KE RL D+VLATF+
Sbjct  1    FWPPPHDAQQKQVQILAYVEYFGQFTSDSEQFPEDVAQLIQSCYPAKEKRLVDEVLATFV  60

Query  405  LHHPEHGHGC  434
            LHHPEHGH  
Sbjct  61   LHHPEHGHAV  70


 Score = 58.5 bits (140),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  555
            G AV+HPI+S IIDGTL YD++  PF SFISL    S+ E SEQ
Sbjct  67   GHAVVHPILSRIIDGTLSYDRHGFPFNSFISLFTQTSEKEYSEQ  110



>gb|ADX35839.1| gigantea, partial [Brachypodium retusum]
 gb|AFB78143.1| gigantea, partial [Brachypodium boissieri]
 gb|AFB78144.1| gigantea, partial [Brachypodium boissieri]
Length=110

 Score =   109 bits (273),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 59/69 (86%), Gaps = 2/69 (3%)
 Frame = +3

Query  231  FWPPPQDAQQRKDQITAYVEYFGQFTS--EHFPEDIAELIRNRYPSKENRLFDDVLATFL  404
            FWPPP DAQQ++ QI AYVEYFGQFTS  E FPED+A+LI++ YP+KE RL D+VLATF+
Sbjct  1    FWPPPHDAQQKQVQILAYVEYFGQFTSDSEQFPEDVAQLIQSCYPAKEKRLVDEVLATFV  60

Query  405  LHHPEHGHG  431
            LHHPEHGH 
Sbjct  61   LHHPEHGHA  69


 Score = 58.2 bits (139),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  555
            G AV+HPI+S IIDGTL YD++  PF+SFISL    S+ E SEQ
Sbjct  67   GHAVVHPILSRIIDGTLCYDRHGSPFSSFISLFTQTSEKEYSEQ  110



>gb|ADX35845.1| gigantea, partial [Brachypodium mexicanum]
Length=110

 Score =   107 bits (268),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 58/69 (84%), Gaps = 2/69 (3%)
 Frame = +3

Query  231  FWPPPQDAQQRKDQITAYVEYFGQFTS--EHFPEDIAELIRNRYPSKENRLFDDVLATFL  404
            FWPPP DAQQ++ QI AYVEYFGQFTS  E FPED+A+LI++ YP+KE RL D+VLA F+
Sbjct  1    FWPPPHDAQQKQVQILAYVEYFGQFTSDSEQFPEDVAQLIQSCYPAKEKRLVDEVLANFV  60

Query  405  LHHPEHGHG  431
            LHHPEHGH 
Sbjct  61   LHHPEHGHA  69


 Score = 59.3 bits (142),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  555
            G AV+HPI+SCIIDGTL YD++  PF SFISL    S+   SEQ
Sbjct  67   GHAVVHPILSCIIDGTLSYDRHGSPFNSFISLFTQTSEKMYSEQ  110



>gb|ADX35846.1| gigantea, partial [Brachypodium distachyon]
 gb|ADX35847.1| gigantea, partial [Brachypodium distachyon]
Length=110

 Score =   107 bits (268),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 58/70 (83%), Gaps = 2/70 (3%)
 Frame = +3

Query  231  FWPPPQDAQQRKDQITAYVEYFGQFTS--EHFPEDIAELIRNRYPSKENRLFDDVLATFL  404
            FWPPP DAQQ++ QI AYVEYFGQFTS  E FPED+A+LI++ YP+KE RL D+VLA F+
Sbjct  1    FWPPPHDAQQKQVQILAYVEYFGQFTSDSEQFPEDVAQLIQSCYPAKEKRLVDEVLANFV  60

Query  405  LHHPEHGHGC  434
            LHHPEHGH  
Sbjct  61   LHHPEHGHAV  70


 Score = 59.3 bits (142),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  555
            G AV+HPI+S IIDGTL YD++  PF SFISL    S+ E SEQ
Sbjct  67   GHAVVHPILSRIIDGTLSYDRHGSPFNSFISLFTQTSEKEYSEQ  110



>gb|ADX35844.1| gigantea, partial [Brachypodium mexicanum]
Length=110

 Score =   109 bits (272),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 59/69 (86%), Gaps = 2/69 (3%)
 Frame = +3

Query  231  FWPPPQDAQQRKDQITAYVEYFGQFTS--EHFPEDIAELIRNRYPSKENRLFDDVLATFL  404
            FWPPP DAQQ++ QI AYVEYFGQFTS  E FPED+A+LI++ YP+KE RL D+VLATF+
Sbjct  1    FWPPPHDAQQKQVQILAYVEYFGQFTSDSEQFPEDVAQLIQSCYPAKEKRLVDEVLATFV  60

Query  405  LHHPEHGHG  431
            LHHPEHGH 
Sbjct  61   LHHPEHGHA  69


 Score = 57.0 bits (136),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  555
            G AV+HPI+S IIDGTL YD++  PF SFISL    S+ E SEQ
Sbjct  67   GHAVVHPILSRIIDGTLCYDRHGSPFNSFISLFTQTSEKEYSEQ  110



>gb|AFB78142.1| gigantea, partial [Brachypodium boissieri]
Length=110

 Score =   109 bits (272),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 59/69 (86%), Gaps = 2/69 (3%)
 Frame = +3

Query  231  FWPPPQDAQQRKDQITAYVEYFGQFTS--EHFPEDIAELIRNRYPSKENRLFDDVLATFL  404
            FWPPP DAQQ++ QI AYVEYFGQFTS  E FPED+A+LI++ YP+KE RL D+VLATF+
Sbjct  1    FWPPPHDAQQKQVQILAYVEYFGQFTSDSEQFPEDVAQLIQSCYPAKEKRLVDEVLATFV  60

Query  405  LHHPEHGHG  431
            LHHPEHGH 
Sbjct  61   LHHPEHGHA  69


 Score = 55.5 bits (132),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  555
            G AV+HPI+S IIDGTL YD++  PF+SFISL    S+ E  EQ
Sbjct  67   GHAVVHPILSRIIDGTLCYDRHGSPFSSFISLFTQTSEKEYLEQ  110



>ref|XP_010535090.1| PREDICTED: protein GIGANTEA [Tarenaya hassleriana]
 ref|XP_010535098.1| PREDICTED: protein GIGANTEA [Tarenaya hassleriana]
 ref|XP_010535104.1| PREDICTED: protein GIGANTEA [Tarenaya hassleriana]
Length=1167

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 79/101 (78%), Gaps = 7/101 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+S E+WID LQFSSLFWPPPQD QQR+DQ+ AYVEYFGQFTSE FPEDIAEL+RN+YP
Sbjct  1    MASSSEKWIDGLQFSSLFWPPPQDPQQRQDQVIAYVEYFGQFTSEQFPEDIAELVRNQYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGH-------GCYSSNYLMYH  461
            S E RL DDV+A F+LHHPEHGH        C     L+Y+
Sbjct  61   STEKRLLDDVMAMFVLHHPEHGHAVILPIIACIIDGSLVYN  101


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 41/67 (61%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D + MF  H        G AVI PII+CIIDG+L Y+K +PPFASFISLVC +S+N+ SE
Sbjct  69   DVMAMFVLHHPE----HGHAVILPIIACIIDGSLVYNKETPPFASFISLVCSSSENDYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>ref|XP_002524341.1| Protein GIGANTEA, putative [Ricinus communis]
 gb|EEF38081.1| Protein GIGANTEA, putative [Ricinus communis]
Length=1161

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 67/98 (68%), Gaps = 14/98 (14%)
 Frame = +3

Query  186  ASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSK  365
            AS ERWID LQFSSLFWPPPQDAQQRK QITAYVEYFGQFTSE FP+DIAE+  + +   
Sbjct  2    ASSERWIDGLQFSSLFWPPPQDAQQRKAQITAYVEYFGQFTSEQFPDDIAEVTASHF---  58

Query  366  ENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
                F    ATF+LHHPEHGH        C     L+Y
Sbjct  59   ----FSSNPATFVLHHPEHGHAVVLPIISCLIDGTLVY  92


 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+ PIISC+IDGTL YD+++PPFASFISLVCP+S+NE SEQWALACG
Sbjct  74   GHAVVLPIISCLIDGTLVYDRSTPPFASFISLVCPSSENEYSEQWALACG  123



>gb|AGM20686.1| GI1-2 [Populus tomentosa]
Length=1170

 Score = 77.4 bits (189),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +3

Query  270  QITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENRLFDDVLATFLLH  410
            QITAYVEYFGQ TSE FP+DIAELIRNRYPSK+  LFDDVL   L++
Sbjct  44   QITAYVEYFGQCTSEQFPDDIAELIRNRYPSKDKHLFDDVLDGTLVY  90


 Score = 72.0 bits (175),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  457  IIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            ++DGTL YD +SPPFASFISLVCP+S+NE SEQWALACG
Sbjct  83   VLDGTLVYDGSSPPFASFISLVCPSSENEYSEQWALACG  121



>ref|XP_004173872.1| PREDICTED: protein GIGANTEA-like, partial [Cucumis sativus]
Length=92

 Score = 87.8 bits (216),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  270  QITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHG  431
            Q +AYVEY GQFTSE F EDIAELIR R+ SKE RLFDDVLA F+LHHPE+GH 
Sbjct  4    QCSAYVEYLGQFTSERFSEDIAELIRIRFQSKEKRLFDDVLALFVLHHPENGHA  57


 Score = 60.1 bits (144),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCP  528
            G A+I PIISCI DG LEY++N PPFASFISL CP
Sbjct  55   GHAIILPIISCIFDGALEYNRNDPPFASFISLFCP  89



>gb|ABR18021.1| unknown [Picea sitchensis]
Length=1179

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 68/100 (68%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M+ S ++WI  LQ SSL  PPPQDAQQR+ +I AYVE F QFTSE FP+DIAEL+ + YP
Sbjct  1    MSISEQKWIHGLQSSSLVRPPPQDAQQRQAEILAYVELFAQFTSEEFPDDIAELVHSHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            + E  L DDVLA F+LHHPEHGH        C     L+Y
Sbjct  61   NGEASLLDDVLAIFVLHHPEHGHAIIHPLLSCIIDGTLIY  100


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G A+IHP++SCIIDGTL YDK  PPF+SF SL  P+S+N+ SEQWALACG
Sbjct  82   GHAIIHPLLSCIIDGTLIYDKKMPPFSSFNSLFSPSSENDYSEQWALACG  131



>gb|AGH20049.1| GI [Picea abies]
Length=1179

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 69/100 (69%), Gaps = 7/100 (7%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M+ S ++WI  LQ SSLF PPPQDAQQR+ +I AYVE F QFTSE FP+DIAEL+ + YP
Sbjct  1    MSISEQKWIHGLQSSSLFRPPPQDAQQRQAEILAYVELFAQFTSEEFPDDIAELVHSHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            + E  L DDVLA F+LH+PEHGH        C     L+Y
Sbjct  61   NGEASLLDDVLAIFVLHYPEHGHAIIHPLLSCIIDGTLIY  100


 Score = 80.5 bits (197),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 38/67 (57%), Positives = 47/67 (70%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L +F  H+       G A+IHP++SCIIDGTL YDK   PF+SF SL  P+S+N+ SE
Sbjct  69   DVLAIFVLHYPE----HGHAIIHPLLSCIIDGTLIYDKKMSPFSSFNSLFSPSSENDYSE  124

Query  553  QWALACG  573
            QWALACG
Sbjct  125  QWALACG  131



>gb|AGW52153.1| GI [Populus tomentosa]
Length=1241

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 78/158 (49%), Gaps = 66/158 (42%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPP---------------------------------------  245
            ++S ERWID LQFSSLF PPP                                       
Sbjct  3    SSSSERWIDGLQFSSLFCPPPQDAQQRKIEEILNLFMRKEKLGFRQHSSDLDIFSISWHF  62

Query  246  ---QDAQQR-----------------KDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSK  365
               QD  Q+                 + QITAYV+YFGQ TSEHFP+DI+ELIRNRYPSK
Sbjct  63   PLRQDIDQKLQNQHLLAVIKTSTFEFEAQITAYVDYFGQCTSEHFPDDISELIRNRYPSK  122

Query  366  ENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            + RLFDDVLATF+LHHPEHGH        C     L+Y
Sbjct  123  DKRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVY  160


 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+ PIISCIIDGTL YD++SPPFASFISLVCP S+NE SEQWALACG
Sbjct  142  GHAVVLPIISCIIDGTLVYDRSSPPFASFISLVCPGSENEYSEQWALACG  191



>dbj|BAO66507.1| GIGANTEA [Marchantia polymorpha]
Length=1187

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 63/96 (66%), Gaps = 7/96 (7%)
 Frame = +3

Query  195  ERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENR  374
            ++W+  LQ SSLF PPP+ A +++ +I A VE FG F SE F +DI EL+R  YP+ E+ 
Sbjct  6    QKWLRGLQSSSLFRPPPESAIRKQAEILASVELFGHFASESFVDDIGELVRAHYPTNEHC  65

Query  375  LFDDVLATFLLHHPEHGHG-------CYSSNYLMYH  461
            L DDVLATF+LHHPEHGH        C     L+Y+
Sbjct  66   LLDDVLATFVLHHPEHGHAVLHALLSCVIDGTLIYN  101


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+H ++SC+IDGTL Y+K +PPF SF+SL  P+++ + SEQWALACG
Sbjct  82   GHAVLHALLSCVIDGTLIYNKKTPPFGSFVSLFSPSTERDFSEQWALACG  131



>ref|XP_004496436.1| PREDICTED: protein GIGANTEA-like isoform X2 [Cicer arietinum]
Length=1152

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 54/74 (73%), Gaps = 7/74 (9%)
 Frame = +3

Query  258  QRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHG--  431
            ++KDQI AYVEY  QFTSE F +DIAE+IRNRYPSKE  LFDDVLATF+LHHPEHGH   
Sbjct  4    KKKDQIAAYVEYLIQFTSEQFADDIAEMIRNRYPSKEILLFDDVLATFVLHHPEHGHAVV  63

Query  432  -----CYSSNYLMY  458
                 C     L+Y
Sbjct  64   LPIISCIIDGTLVY  77


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 47/67 (70%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YDK SPPFAS ISLVCP ++NE SE
Sbjct  46   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDKTSPPFASLISLVCPKNENEYSE  101

Query  553  QWALACG  573
            QWALACG
Sbjct  102  QWALACG  108



>gb|KHN46389.1| Protein GIGANTEA, partial [Glycine soja]
Length=1157

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 52/71 (73%), Gaps = 7/71 (10%)
 Frame = +3

Query  267  DQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHG-----  431
            DQI AYVEYF QFTSE F +DIAELIRNRYPSK+  LFDDVLATF+LHHPEHGH      
Sbjct  1    DQIAAYVEYFIQFTSEQFADDIAELIRNRYPSKDILLFDDVLATFVLHHPEHGHAVVLPI  60

Query  432  --CYSSNYLMY  458
              C     L+Y
Sbjct  61   ISCIIDGTLVY  71


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SE
Sbjct  40   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSE  95

Query  553  QWALACG  573
            QWALACG
Sbjct  96   QWALACG  102



>gb|AIR93790.1| gigantea [Kalanchoe fedtschenkoi]
Length=1149

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  264  KDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHG  431
            + Q TAYVEYFGQFTSE FP+D+AELI+N YPS + RLFDDVLA F+LHHPEHGH 
Sbjct  17   EGQTTAYVEYFGQFTSEQFPDDVAELIQNNYPSHDKRLFDDVLAMFVLHHPEHGHA  72


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 51/75 (68%), Gaps = 6/75 (8%)
 Frame = +1

Query  355  THPKK--TDFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCP  528
            +H K+   D L MF  H        G AV+ PIIS +IDGTL YD+  PPFASFISLVCP
Sbjct  49   SHDKRLFDDVLAMFVLHHPE----HGHAVMLPIISLVIDGTLFYDRCCPPFASFISLVCP  104

Query  529  NSQNELSEQWALACG  573
            +S+N  SEQWALACG
Sbjct  105  SSENYYSEQWALACG  119



>gb|AEK05858.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05863.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05868.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05873.1| gigantea-5, partial [Populus balsamifera]
Length=137

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YD++SPPFASFISLVCP S+NE SE
Sbjct  21   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDRSSPPFASFISLVCPGSENEYSE  76

Query  553  QWALACG  573
            QWALACG
Sbjct  77   QWALACG  83


 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  324  EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHG  431
            +DI+ELIRNRYPSK+ RLFDDVLATF+LHHPEHGH 
Sbjct  1    DDISELIRNRYPSKDKRLFDDVLATFVLHHPEHGHA  36



>gb|AEK05878.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05883.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05893.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05898.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05903.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05913.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05918.1| gigantea-5, partial [Populus balsamifera]
Length=137

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YD++SPPFASFISLVCP S+NE SE
Sbjct  21   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDRSSPPFASFISLVCPGSENEYSE  76

Query  553  QWALACG  573
            QWALACG
Sbjct  77   QWALACG  83


 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  324  EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHG  431
            +DI+ELIRNRYPSK+ RLFDDVLATF+LHHPEHGH 
Sbjct  1    DDISELIRNRYPSKDKRLFDDVLATFVLHHPEHGHA  36



>gb|AEK05888.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05908.1| gigantea-5, partial [Populus balsamifera]
Length=137

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YD++SPPFASFISLVCP S+NE SE
Sbjct  21   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDRSSPPFASFISLVCPGSENEYSE  76

Query  553  QWALACG  573
            QWALACG
Sbjct  77   QWALACG  83


 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  324  EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHG  431
            +DI+ELIRNRYPSK+ RLFDDVLATF+LHHPEHGH 
Sbjct  1    DDISELIRNRYPSKDKRLFDDVLATFVLHHPEHGHA  36



>gb|AEK26574.1| gigantea 5 [Populus tremula]
Length=138

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YD++SPPFASFISLVCP S+NE SE
Sbjct  21   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDRSSPPFASFISLVCPGSENEYSE  76

Query  553  QWALACG  573
            QWALACG
Sbjct  77   QWALACG  83


 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  324  EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHG  431
            +DI+ELIRNRYPSK+ RLFDDVLATF+LHHPEHGH 
Sbjct  1    DDISELIRNRYPSKDKRLFDDVLATFVLHHPEHGHA  36



>gb|AEK05813.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05818.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05823.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05828.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05833.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05838.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05843.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05853.1| gigantea-5, partial [Populus balsamifera]
Length=137

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YD++SPPFASFISLVCP S+NE SE
Sbjct  21   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDRSSPPFASFISLVCPGSENEYSE  76

Query  553  QWALACG  573
            QWALACG
Sbjct  77   QWALACG  83


 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  324  EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHG  431
            +DI+ELIRNRYPSK+ RLFDDVLATF+LHHPEHGH 
Sbjct  1    DDISELIRNRYPSKDKRLFDDVLATFVLHHPEHGHA  36



>gb|AEK05848.1| gigantea-5, partial [Populus balsamifera]
Length=137

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L  F  H        G AV+ PIISCIIDGTL YD++SPPFASFISLVCP S+NE SE
Sbjct  21   DVLATFVLHHPE----HGHAVVLPIISCIIDGTLVYDRSSPPFASFISLVCPGSENEYSE  76

Query  553  QWALACG  573
            QWALACG
Sbjct  77   QWALACG  83


 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  324  EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHG  431
            +DI+ELIRNRYPSK+ RLFDDVLATF+LHHPEHGH 
Sbjct  1    DDISELIRNRYPSKDKRLFDDVLATFVLHHPEHGHA  36



>ref|XP_007199688.1| hypothetical protein PRUPE_ppa000556mg [Prunus persica]
 gb|EMJ00887.1| hypothetical protein PRUPE_ppa000556mg [Prunus persica]
Length=1098

 Score = 90.1 bits (222),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AVI PIISCIIDGTL Y++ SPPFASFISLVCP+S+NE SEQWALACG
Sbjct  10   GHAVILPIISCIIDGTLAYERTSPPFASFISLVCPSSENEYSEQWALACG  59


 Score = 28.1 bits (61),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  399  FLLHHPEHGHG  431
            F+LHHPEHGH 
Sbjct  2    FVLHHPEHGHA  12



>ref|XP_006842209.1| hypothetical protein AMTR_s00078p00173230 [Amborella trichopoda]
 gb|ERN03884.1| hypothetical protein AMTR_s00078p00173230 [Amborella trichopoda]
Length=1143

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 50/70 (71%), Gaps = 7/70 (10%)
 Frame = +3

Query  270  QITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHG------  431
            QI AYVE F QFTSEHFP+DI+ELI++RYPSKE  L DDVLA F+LHHPEHGH       
Sbjct  4    QIMAYVELFAQFTSEHFPDDISELIQSRYPSKEVCLLDDVLAIFVLHHPEHGHAVIHPIL  63

Query  432  -CYSSNYLMY  458
             C     L+Y
Sbjct  64   SCIIDGTLIY  73


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L +F  H        G AVIHPI+SCIIDGTL YDK +PPF+SFISL  P+S+ + SE
Sbjct  42   DVLAIFVLHHPE----HGHAVIHPILSCIIDGTLIYDKGNPPFSSFISLFSPSSEKDYSE  97

Query  553  QWALACG  573
            QWALACG
Sbjct  98   QWALACG  104



>gb|KDO83806.1| hypothetical protein CISIN_1g001216mg [Citrus sinensis]
Length=1122

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 46/66 (70%), Positives = 49/66 (74%), Gaps = 4/66 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AV  PIISCIIDGTL YDK+SPPFASF+SLVCPNS+NE SE
Sbjct  26   DVLAMFVLHHPE----HGHAVALPIISCIIDGTLVYDKSSPPFASFVSLVCPNSENEYSE  81

Query  553  QWALAC  570
            QWALAC
Sbjct  82   QWALAC  87


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 32/50 (64%), Gaps = 7/50 (14%)
 Frame = +3

Query  330  IAELIRNRYPSKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            + +LIR+ YP KE RLFDDVLA F+LHHPEHGH        C     L+Y
Sbjct  8    LVQLIRSHYPHKERRLFDDVLAMFVLHHPEHGHAVALPIISCIIDGTLVY  57



>gb|AEK05801.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE SE
Sbjct  22   DVLAMFVLHHPE----HGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENEYSE  77

Query  553  QWALACG  573
            QWALACG
Sbjct  78   QWALACG  84


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 36/53 (68%), Gaps = 7/53 (13%)
 Frame = +3

Query  321  PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGH        C     L+Y
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVY  53



>gb|AEK05807.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05810.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05811.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE SE
Sbjct  22   DVLAMFVLHHPE----HGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENEYSE  77

Query  553  QWALACG  573
            QWALACG
Sbjct  78   QWALACG  84


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 36/53 (68%), Gaps = 7/53 (13%)
 Frame = +3

Query  321  PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGH        C     L+Y
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVY  53



>gb|AEK05795.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05800.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE SE
Sbjct  22   DVLAMFVLHHPE----HGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENEYSE  77

Query  553  QWALACG  573
            QWALACG
Sbjct  78   QWALACG  84


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 36/53 (68%), Gaps = 7/53 (13%)
 Frame = +3

Query  321  PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGH        C     L+Y
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVY  53



>gb|AEK05791.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05792.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE SE
Sbjct  22   DVLAMFVLHHPE----HGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENEYSE  77

Query  553  QWALACG  573
            QWALACG
Sbjct  78   QWALACG  84


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 36/53 (68%), Gaps = 7/53 (13%)
 Frame = +3

Query  321  PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGH        C     L+Y
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVY  53



>gb|AEK05803.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE SE
Sbjct  22   DVLAMFVLHHPE----HGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENEYSE  77

Query  553  QWALACG  573
            QWALACG
Sbjct  78   QWALACG  84


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 36/53 (68%), Gaps = 7/53 (13%)
 Frame = +3

Query  321  PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGH        C     L+Y
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVY  53



>gb|AEK05802.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE SE
Sbjct  22   DVLAMFVLHHPE----HGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENEYSE  77

Query  553  QWALACG  573
            QWALACG
Sbjct  78   QWALACG  84


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 36/53 (68%), Gaps = 7/53 (13%)
 Frame = +3

Query  321  PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGH        C     L+Y
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVY  53



>gb|AEK05799.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE SE
Sbjct  22   DVLAMFVLHHPE----HGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENEYSE  77

Query  553  QWALACG  573
            QWALACG
Sbjct  78   QWALACG  84


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 36/53 (68%), Gaps = 7/53 (13%)
 Frame = +3

Query  321  PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGH        C     L+Y
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVY  53



>gb|AEK05793.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05794.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05796.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05797.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05798.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05804.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05805.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05806.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05809.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE SE
Sbjct  22   DVLAMFVLHHPE----HGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENEYSE  77

Query  553  QWALACG  573
            QWALACG
Sbjct  78   QWALACG  84


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 36/53 (68%), Gaps = 7/53 (13%)
 Frame = +3

Query  321  PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGH        C     L+Y
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVY  53



>gb|AEK05790.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05808.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +1

Query  373  DFLMMFWQHFSSIIQSMGMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSE  552
            D L MF  H        G AV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE SE
Sbjct  22   DVLAMFVLHHPE----HGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENEYSE  77

Query  553  QWALACG  573
            QWALACG
Sbjct  78   QWALACG  84


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 36/53 (68%), Gaps = 7/53 (13%)
 Frame = +3

Query  321  PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHG-------CYSSNYLMY  458
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGH        C     L+Y
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVY  53



>ref|XP_006434519.1| hypothetical protein CICLE_v10004044mg [Citrus clementina]
 gb|ESR47759.1| hypothetical protein CICLE_v10004044mg [Citrus clementina]
Length=1082

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALAC  570
            G AV  PIISCIIDGTL YDK+SPPFASF+SLVCPNS+NE SEQWALAC
Sbjct  10   GHAVALPIISCIIDGTLVYDKSSPPFASFVSLVCPNSENEYSEQWALAC  58



>ref|XP_010261025.1| PREDICTED: protein GIGANTEA-like isoform X2 [Nelumbo nucifera]
Length=1102

 Score = 85.1 bits (209),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  424  GMAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  573
            G AV+ P+ISCIID TL Y+KNSPPF+SFISLVCP+++NE SEQWA+ACG
Sbjct  10   GHAVLLPLISCIIDDTLAYNKNSPPFSSFISLVCPSNENEYSEQWAMACG  59


 Score = 27.7 bits (60),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  399  FLLHHPEHGHG  431
            F+LHHPEHGH 
Sbjct  2    FVLHHPEHGHA  12



>gb|EMS55238.1| hypothetical protein TRIUR3_30834 [Triticum urartu]
Length=1126

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 2/55 (4%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAE  338
            M+ S  +WID LQFSSLFWPPP D QQ++ QI AYVEYFGQFT  SE FPED+A+
Sbjct  38   MSVSNGKWIDGLQFSSLFWPPPHDVQQKQAQILAYVEYFGQFTSDSEQFPEDVAQ  92



>gb|EMT06342.1| hypothetical protein F775_28583 [Aegilops tauschii]
Length=1146

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 2/55 (4%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT--SEHFPEDIAE  338
            M+ S  +WID LQFSSLFWPPP D QQ++ QI AYVEYFGQFT  SE FPED+A+
Sbjct  60   MSVSNGKWIDGLQFSSLFWPPPHDVQQKQAQILAYVEYFGQFTSDSEQFPEDVAQ  114



>emb|CDP21210.1| unnamed protein product [Coffea canephora]
Length=26

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQ  257
            MAASCERWID LQFSSLFWPPP+DA+
Sbjct  1    MAASCERWIDGLQFSSLFWPPPKDAE  26



>gb|AEK05812.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05817.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05822.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05827.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05832.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05837.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05842.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05847.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05852.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05857.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05862.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05867.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05872.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05877.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05882.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05887.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05892.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05897.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05902.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05907.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05912.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05917.1| gigantea-5, partial [Populus balsamifera]
Length=26

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  189  SCERWIDRLQFSSLFWPPPQDAQQRK  266
            S ERWID LQFSSLFWPPPQDAQQRK
Sbjct  1    SSERWIDGLQFSSLFWPPPQDAQQRK  26



>dbj|BAO74110.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74111.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74112.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74113.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74114.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74115.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74116.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74117.1| GIGANTEA, partial [Lotus japonicus]
Length=976

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +1

Query  496  PFASFISLVCPNSQNELSEQWALACG  573
            PFASFISLVCP ++N+ SEQWALACG
Sbjct  2    PFASFISLVCPKNENDYSEQWALACG  27



>dbj|BAO74118.1| GIGANTEA, partial [Lotus japonicus]
Length=976

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +1

Query  496  PFASFISLVCPNSQNELSEQWALACG  573
            PFASFISLVCP ++N+ SEQWALACG
Sbjct  2    PFASFISLVCPKNENDYSEQWALACG  27



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750