BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF012D07

Length=513
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|Q42961.1|PGKH_TOBAC  RecName: Full=Phosphoglycerate kinase, ch...    202   5e-59   Nicotiana tabacum [American tobacco]
ref|XP_009763674.1|  PREDICTED: phosphoglycerate kinase, chloropl...    202   7e-59   Nicotiana sylvestris
ref|XP_009622055.1|  PREDICTED: phosphoglycerate kinase, chloropl...    201   8e-59   Nicotiana tomentosiformis
gb|AAC26785.1|  phosphoglycerate kinase precursor                       199   7e-58   Solanum tuberosum [potatoes]
ref|XP_011086346.1|  PREDICTED: phosphoglycerate kinase, chloropl...    199   8e-58   Sesamum indicum [beniseed]
gb|ABB86255.1|  phosphoglycerate kinase precursor-like                  198   1e-57   Solanum tuberosum [potatoes]
ref|NP_001275227.1|  phosphoglycerate kinase, chloroplastic-like        198   2e-57   Solanum tuberosum [potatoes]
ref|XP_011095719.1|  PREDICTED: phosphoglycerate kinase, chloropl...    197   5e-57   Sesamum indicum [beniseed]
gb|ADR71054.1|  phosphoglycerate kinase                                 196   1e-56   Nicotiana benthamiana
ref|XP_004243968.1|  PREDICTED: phosphoglycerate kinase, chloropl...    194   4e-56   Solanum lycopersicum
ref|XP_006359791.1|  PREDICTED: uncharacterized protein LOC102577647    196   2e-54   
gb|EYU33792.1|  hypothetical protein MIMGU_mgv1a005422mg                179   3e-50   Erythranthe guttata [common monkey flower]
gb|EPS66037.1|  phosphoglycerate kinase, chloroplastic                  179   5e-50   Genlisea aurea
ref|XP_009402843.1|  PREDICTED: phosphoglycerate kinase, chloropl...    167   1e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002513353.1|  phosphoglycerate kinase, putative                  166   2e-45   Ricinus communis
ref|XP_011013857.1|  PREDICTED: phosphoglycerate kinase, chloropl...    165   4e-45   Populus euphratica
ref|XP_011016496.1|  PREDICTED: phosphoglycerate kinase, chloropl...    165   6e-45   Populus euphratica
ref|XP_004488763.1|  PREDICTED: phosphoglycerate kinase, chloropl...    165   6e-45   Cicer arietinum [garbanzo]
ref|XP_002315066.1|  PHOSPHOGLYCERATE KINASE 1 family protein           164   2e-44   
ref|XP_002263796.1|  PREDICTED: phosphoglycerate kinase, chloropl...    163   3e-44   Vitis vinifera
ref|XP_002312238.1|  hypothetical protein POPTR_0008s08410g             162   5e-44   Populus trichocarpa [western balsam poplar]
gb|ABK96267.1|  unknown                                                 162   5e-44   Populus trichocarpa x Populus deltoides
ref|XP_010923458.1|  PREDICTED: phosphoglycerate kinase, chloropl...    158   2e-42   Elaeis guineensis
ref|XP_010269369.1|  PREDICTED: phosphoglycerate kinase, chloropl...    158   2e-42   Nelumbo nucifera [Indian lotus]
gb|ADV16381.1|  chloroplast phosphoglycerate kinase 3                   157   3e-42   Helianthus annuus
gb|KJB14025.1|  hypothetical protein B456_002G107300                    157   4e-42   Gossypium raimondii
ref|XP_008372155.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    155   4e-42   
gb|KJB14026.1|  hypothetical protein B456_002G107300                    157   4e-42   Gossypium raimondii
ref|XP_003596091.1|  Phosphoglycerate kinase                            156   7e-42   Medicago truncatula
ref|XP_008226130.1|  PREDICTED: phosphoglycerate kinase, chloropl...    156   9e-42   Prunus mume [ume]
ref|XP_008371996.1|  PREDICTED: phosphoglycerate kinase, chloropl...    156   1e-41   
ref|XP_008346077.1|  PREDICTED: phosphoglycerate kinase, chloropl...    156   1e-41   
ref|XP_008805983.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    155   2e-41   Phoenix dactylifera
ref|XP_009397212.1|  PREDICTED: phosphoglycerate kinase, chloropl...    155   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG01489.1|  hypothetical protein F383_22605                         155   2e-41   Gossypium arboreum [tree cotton]
ref|XP_007213965.1|  hypothetical protein PRUPE_ppa005031mg             155   3e-41   Prunus persica
ref|XP_008349091.1|  PREDICTED: phosphoglycerate kinase, chloropl...    154   4e-41   
ref|XP_008383150.1|  PREDICTED: phosphoglycerate kinase, chloropl...    154   5e-41   Malus domestica [apple tree]
gb|KDP25067.1|  hypothetical protein JCGZ_22602                         154   1e-40   Jatropha curcas
ref|XP_008456300.1|  PREDICTED: phosphoglycerate kinase, chloropl...    153   1e-40   Cucumis melo [Oriental melon]
ref|XP_008786111.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    153   1e-40   Phoenix dactylifera
gb|KDO61595.1|  hypothetical protein CISIN_1g011942mg                   150   3e-40   Citrus sinensis [apfelsine]
ref|XP_010060861.1|  PREDICTED: phosphoglycerate kinase, chloropl...    152   4e-40   Eucalyptus grandis [rose gum]
ref|XP_004139904.1|  PREDICTED: phosphoglycerate kinase, chloropl...    152   4e-40   Cucumis sativus [cucumbers]
ref|XP_007022578.1|  Phosphoglycerate kinase 1                          151   6e-40   
ref|XP_004306579.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    151   7e-40   Fragaria vesca subsp. vesca
ref|XP_010936574.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    150   1e-39   Elaeis guineensis
ref|XP_006422251.1|  hypothetical protein CICLE_v10004891mg             150   1e-39   Citrus clementina [clementine]
gb|KDO61594.1|  hypothetical protein CISIN_1g011942mg                   150   1e-39   Citrus sinensis [apfelsine]
ref|XP_003531482.1|  PREDICTED: phosphoglycerate kinase, chloropl...    150   1e-39   Glycine max [soybeans]
sp|P29409.2|PGKH_SPIOL  RecName: Full=Phosphoglycerate kinase, ch...    149   3e-39   Spinacia oleracea
ref|XP_010669994.1|  PREDICTED: phosphoglycerate kinase, chloropl...    148   7e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_187884.1|  phosphoglycerate kinase 1                             147   3e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010094703.1|  Phosphoglycerate kinase                            147   3e-38   Morus notabilis
ref|XP_006407295.1|  hypothetical protein EUTSA_v10020621mg             146   4e-38   Eutrema salsugineum [saltwater cress]
emb|CDY43401.1|  BnaA01g30320D                                          146   4e-38   Brassica napus [oilseed rape]
emb|CDX73803.1|  BnaA03g32440D                                          146   4e-38   
ref|XP_009124670.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    146   5e-38   Brassica rapa
ref|XP_010487004.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    146   5e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010499471.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    146   6e-38   Camelina sativa [gold-of-pleasure]
emb|CDY24247.1|  BnaC01g38270D                                          146   6e-38   Brassica napus [oilseed rape]
ref|XP_009146585.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    145   7e-38   Brassica rapa
ref|XP_010465058.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    145   8e-38   Camelina sativa [gold-of-pleasure]
ref|XP_009135249.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    145   9e-38   Brassica rapa
ref|XP_006297559.1|  hypothetical protein CARUB_v10013582mg             145   1e-37   Capsella rubella
ref|XP_002884926.1|  hypothetical protein ARALYDRAFT_478641             145   1e-37   Arabidopsis lyrata subsp. lyrata
emb|CDY00798.1|  BnaC03g37820D                                          144   2e-37   
ref|XP_002891879.1|  hypothetical protein ARALYDRAFT_474689             144   2e-37   
tpg|DAA57248.1|  TPA: hypothetical protein ZEAMMB73_321071              138   4e-37   
gb|AAF02830.1|AC009894_1  phosphoglycerate kinase                       140   6e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CDY52872.1|  BnaCnng23600D                                          145   8e-37   Brassica napus [oilseed rape]
ref|NP_176015.1|  phosphoglycerate kinase                               140   4e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003546820.1|  PREDICTED: phosphoglycerate kinase, chloropl...    140   7e-36   
ref|NP_001167912.1|  phosphoglycerate kinase                            138   1e-35   Zea mays [maize]
ref|XP_003568189.1|  PREDICTED: phosphoglycerate kinase, chloropl...    139   2e-35   
ref|XP_002456487.1|  hypothetical protein SORBIDRAFT_03g037165          131   6e-35   
gb|AFW82396.1|  hypothetical protein ZEAMMB73_945417                    135   3e-34   
gb|AAT07576.1|  putative chloroplast phosphoglycerate kinase            132   7e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007149208.1|  hypothetical protein PHAVU_005G050700g             134   8e-34   Phaseolus vulgaris [French bean]
ref|XP_002441313.1|  hypothetical protein SORBIDRAFT_09g024340          133   2e-33   Sorghum bicolor [broomcorn]
gb|AGV54662.1|  phosphoglycerate kinase chloroplastic-like protein      133   2e-33   Phaseolus vulgaris [French bean]
ref|XP_008656415.1|  PREDICTED: phosphoglycerate kinase, chloropl...    134   2e-33   
ref|XP_010544343.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoglyce...    133   2e-33   Tarenaya hassleriana [spider flower]
ref|XP_004961633.1|  PREDICTED: phosphoglycerate kinase, chloropl...    132   3e-33   Setaria italica
sp|P12782.1|PGKH_WHEAT  RecName: Full=Phosphoglycerate kinase, ch...    132   5e-33   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006858226.1|  hypothetical protein AMTR_s00062p00189550          129   5e-32   Amborella trichopoda
gb|EEC71648.1|  hypothetical protein OsI_04088                          128   1e-31   Oryza sativa Indica Group [Indian rice]
gb|AFW78532.1|  phosphoglycerate kinase                                 128   1e-31   
gb|AFW78533.1|  phosphoglycerate kinase                                 128   1e-31   
ref|XP_004970258.1|  PREDICTED: phosphoglycerate kinase, chloropl...    128   2e-31   Setaria italica
emb|CBL95264.1|  phosphoglycerate kinase 1                              128   2e-31   Pinus pinaster [cluster pine]
ref|XP_004970259.1|  PREDICTED: phosphoglycerate kinase, chloropl...    128   2e-31   Setaria italica
gb|AIZ74346.1|  phosphoglycerate kinase 1                               128   2e-31   Pinus massoniana [Chinese red pine]
ref|NP_001172606.1|  Os01g0800266                                       125   9e-31   
ref|NP_001147628.1|  phosphoglycerate kinase                            125   1e-30   
gb|EEE55536.1|  hypothetical protein OsJ_03768                          125   1e-30   Oryza sativa Japonica Group [Japonica rice]
gb|AGT16255.1|  phosphoglycerate kinase                                 125   2e-30   Saccharum hybrid cultivar R570
gb|ABR16231.1|  unknown                                                 124   2e-30   Picea sitchensis
gb|ABK24564.1|  unknown                                                 124   3e-30   Picea sitchensis
emb|CBI24182.3|  unnamed protein product                                123   7e-30   Vitis vinifera
ref|XP_002971814.1|  hypothetical protein SELMODRAFT_267533             123   8e-30   
emb|CDP13574.1|  unnamed protein product                                122   1e-29   Coffea canephora [robusta coffee]
gb|EAY98560.1|  hypothetical protein OsI_20474                          120   1e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_006654593.1|  PREDICTED: phosphoglycerate kinase, chloropl...    119   1e-28   Oryza brachyantha
gb|EMS54865.1|  Phosphoglycerate kinase, chloroplastic                  119   2e-28   Triticum urartu
ref|NP_001117503.1|  phosphoglycerate kinase                            118   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002972334.1|  hypothetical protein SELMODRAFT_231942             115   3e-27   
gb|ACN32155.1|  unknown                                                 114   8e-27   Zea mays [maize]
ref|XP_006858233.1|  hypothetical protein AMTR_s00062p00191350          112   3e-26   Amborella trichopoda
gb|AAB60303.1|  phosphoglycerate kinase                                 112   4e-26   Arabidopsis thaliana [mouse-ear cress]
gb|ADV16380.1|  cytosolic phosphoglycerate kinase 2                     109   4e-25   Helianthus annuus
gb|AFW70285.1|  hypothetical protein ZEAMMB73_319281                    106   4e-25   
gb|AIZ68220.1|  phosphoglycerate kinase                                 109   5e-25   Ornithogalum longebracteatum [sea-onion]
sp|P12783.1|PGKY_WHEAT  RecName: Full=Phosphoglycerate kinase, cy...    108   8e-25   Triticum aestivum [Canadian hard winter wheat]
gb|ABH10990.1|  phosphoglycerate kinase                                 106   2e-24   Polytomella parva
gb|AAW79325.1|  phosphoglycerate kinase                                 107   2e-24   Isochrysis galbana
gb|EMS46092.1|  Phosphoglycerate kinase, cytosolic                      107   2e-24   Triticum urartu
gb|AIN39803.1|  hypothetical protein                                    106   2e-24   Zoysia matrella [Japanese carpet grass]
gb|EMT29203.1|  Phosphoglycerate kinase, cytosolic                      108   2e-24   
ref|XP_005646469.1|  phosphoglycerate kinase precursor                  107   3e-24   Coccomyxa subellipsoidea C-169
gb|ACJ11718.1|  phosphoglycerate kinase                                 107   3e-24   Gossypium hirsutum [American cotton]
gb|KJB14019.1|  hypothetical protein B456_002G107200                    107   3e-24   Gossypium raimondii
ref|NP_001058317.1|  Os06g0668200                                       107   4e-24   
ref|NP_001142404.1|  uncharacterized protein LOC100274579               106   4e-24   Zea mays [maize]
gb|KIY97385.1|  phosphoglycerate kinase                                 104   5e-24   Monoraphidium neglectum
ref|XP_003570108.1|  PREDICTED: phosphoglycerate kinase, cytosolic      106   5e-24   Brachypodium distachyon [annual false brome]
ref|XP_005757596.1|  phosphoglycerate kinase                            103   6e-24   Emiliania huxleyi CCMP1516
ref|XP_011086347.1|  PREDICTED: phosphoglycerate kinase, cytosolic      106   6e-24   Sesamum indicum [beniseed]
emb|CBY84995.1|  phosphoglycerate kinase                                106   6e-24   Polytomella sp. Pringsheim 198.80
ref|XP_010324204.1|  PREDICTED: phosphoglycerate kinase, cytosolic      105   7e-24   
gb|ABI18157.1|  cytosolic phosphoglycerate kinase                       105   1e-23   Helianthus annuus
gb|EWM26407.1|  phosphoglycerate kinase                                 105   1e-23   Nannochloropsis gaditana
ref|XP_005791258.1|  phosphoglycerate kinase                            103   1e-23   Emiliania huxleyi CCMP1516
gb|EYU33791.1|  hypothetical protein MIMGU_mgv1a006853mg                105   1e-23   Erythranthe guttata [common monkey flower]
emb|CDP16886.1|  unnamed protein product                                105   2e-23   Coffea canephora [robusta coffee]
ref|NP_001046020.1|  Os02g0169300                                       104   2e-23   
gb|ABI74567.1|  phosphoglycerate kinase                                 104   2e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_005851391.1|  hypothetical protein CHLNCDRAFT_48457              104   2e-23   Chlorella variabilis
ref|XP_004966316.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    104   2e-23   Setaria italica
ref|XP_004951776.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    104   2e-23   Setaria italica
ref|XP_008798227.1|  PREDICTED: phosphoglycerate kinase, cytosolic      104   2e-23   Phoenix dactylifera
ref|XP_009417722.1|  PREDICTED: phosphoglycerate kinase, cytosolic      104   2e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002263950.1|  PREDICTED: phosphoglycerate kinase, cytosolic      104   2e-23   Vitis vinifera
ref|XP_006646936.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    104   3e-23   Oryza brachyantha
ref|XP_009399252.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    104   3e-23   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABB86242.1|  phosphoglycerate kinase-like                            104   3e-23   Solanum tuberosum [potatoes]
gb|AFW70281.1|  phosphoglycerate kinase                                 105   4e-23   
ref|NP_001275451.1|  phosphoglycerate kinase, cytosolic-like            103   4e-23   Solanum tuberosum [potatoes]
ref|XP_006656354.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    103   5e-23   Oryza brachyantha
ref|XP_001699523.1|  phosphoglycerate kinase                            104   5e-23   Chlamydomonas reinhardtii
ref|XP_011396717.1|  Phosphoglycerate kinase, chloroplastic             103   6e-23   Auxenochlorella protothecoides
ref|XP_010275944.1|  PREDICTED: phosphoglycerate kinase, cytosolic      103   6e-23   Nelumbo nucifera [Indian lotus]
ref|XP_004139837.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    103   7e-23   Cucumis sativus [cucumbers]
ref|XP_010941661.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    103   8e-23   Elaeis guineensis
ref|XP_010941660.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    102   9e-23   
gb|ABF69999.1|  phosphoglycerate kinase, putative                       102   1e-22   Musa acuminata [banana]
ref|XP_009414502.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    102   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010544342.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    102   1e-22   Tarenaya hassleriana [spider flower]
ref|XP_002951648.1|  phosphoglycerate kinase                            102   1e-22   Volvox carteri f. nagariensis
ref|XP_010557291.1|  PREDICTED: phosphoglycerate kinase, cytosolic      102   2e-22   Tarenaya hassleriana [spider flower]
ref|XP_007022579.1|  Phosphoglycerate kinase isoform 1                  102   2e-22   
gb|ABI74568.1|  phosphoglycerate kinase                                 102   2e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_008447095.1|  PREDICTED: phosphoglycerate kinase, cytosolic      102   2e-22   Cucumis melo [Oriental melon]
sp|P41758.1|PGKH_CHLRE  RecName: Full=Phosphoglycerate kinase, ch...    102   2e-22   Chlamydomonas reinhardtii
gb|ACU18322.1|  unknown                                                 100   2e-22   Glycine max [soybeans]
gb|AAF85975.1|AF275639_1  cytosolic phosphoglycerate kinase             101   2e-22   Pisum sativum [garden pea]
ref|XP_011095716.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    101   2e-22   Sesamum indicum [beniseed]
gb|KCW71392.1|  hypothetical protein EUGRSUZ_F04463                     100   3e-22   Eucalyptus grandis [rose gum]
ref|XP_002312237.1|  hypothetical protein POPTR_0008s08400g             101   3e-22   
gb|ABK92531.1|  unknown                                                 101   3e-22   Populus trichocarpa [western balsam poplar]
gb|ACJ84593.1|  unknown                                               99.8    3e-22   Medicago truncatula
ref|XP_009106677.1|  PREDICTED: phosphoglycerate kinase, cytosolic      101   4e-22   Brassica rapa
ref|XP_010936568.1|  PREDICTED: phosphoglycerate kinase, cytosolic      101   4e-22   Elaeis guineensis
ref|XP_002500825.1|  phosphoglycerate kinase                            101   4e-22   Micromonas commoda
ref|XP_010417621.1|  PREDICTED: phosphoglycerate kinase, cytosolic      100   4e-22   Camelina sativa [gold-of-pleasure]
gb|KIY97218.1|  Phosphoglycerate kinase                                 102   5e-22   Monoraphidium neglectum
ref|XP_010472814.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    100   5e-22   Camelina sativa [gold-of-pleasure]
emb|CDY49746.1|  BnaA02g19260D                                          100   5e-22   Brassica napus [oilseed rape]
ref|XP_002889253.1|  hypothetical protein ARALYDRAFT_477124             100   5e-22   
ref|XP_006300323.1|  hypothetical protein CARUB_v10020404mg             100   6e-22   
ref|XP_010064085.1|  PREDICTED: phosphoglycerate kinase, cytosolic      100   6e-22   Eucalyptus grandis [rose gum]
gb|AAM61185.1|  phosphoglycerate kinase, putative                       100   6e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CDY70232.1|  BnaC02g46710D                                          100   6e-22   Brassica napus [oilseed rape]
gb|KCW71391.1|  hypothetical protein EUGRSUZ_F04463                     100   6e-22   Eucalyptus grandis [rose gum]
ref|XP_009128369.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    100   6e-22   Brassica rapa
ref|NP_178073.1|  phosphoglycerate kinase                               100   6e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CDX88547.1|  BnaC06g39910D                                          100   7e-22   
ref|XP_011468861.1|  PREDICTED: phosphoglycerate kinase, cytosolic      100   7e-22   Fragaria vesca subsp. vesca
ref|XP_006389877.1|  hypothetical protein EUTSA_v10018657mg             100   7e-22   Eutrema salsugineum [saltwater cress]
emb|CDX87375.1|  BnaA07g34980D                                          100   8e-22   
ref|XP_003531483.1|  PREDICTED: phosphoglycerate kinase, cytosolic      100   8e-22   
emb|CDX67989.1|  BnaA07g20290D                                        99.8    9e-22   
gb|AAO63774.1|  3-phosphoglycerate kinase                               100   1e-21   Populus tremuloides
ref|XP_009104523.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    100   1e-21   Brassica rapa
ref|WP_016924803.1|  phosphoglycerate kinase                          99.8    1e-21   Prochlorothrix hollandica
ref|XP_011016588.1|  PREDICTED: phosphoglycerate kinase, cytosolic    99.8    1e-21   Populus euphratica
ref|XP_003059407.1|  predicted protein                                99.8    1e-21   Micromonas pusilla CCMP1545
ref|XP_007149209.1|  hypothetical protein PHAVU_005G050800g           99.8    1e-21   Phaseolus vulgaris [French bean]
ref|WP_006515662.1|  phosphoglycerate kinase                          99.8    1e-21   Leptolyngbya sp. PCC 7375
ref|XP_003546821.1|  PREDICTED: phosphoglycerate kinase, cytosoli...  99.8    1e-21   Glycine max [soybeans]
gb|KDO61597.1|  hypothetical protein CISIN_1g040813mg                 99.4    1e-21   Citrus sinensis [apfelsine]
ref|XP_009791377.1|  PREDICTED: phosphoglycerate kinase, cytosolic    99.4    1e-21   Nicotiana sylvestris
ref|XP_006422250.1|  hypothetical protein CICLE_v10005101mg           99.4    1e-21   Citrus clementina [clementine]
emb|CDX79326.1|  BnaC06g19770D                                        99.4    1e-21   
ref|XP_009777860.1|  PREDICTED: phosphoglycerate kinase, cytosoli...  99.4    1e-21   Nicotiana sylvestris
ref|XP_009384174.1|  PREDICTED: phosphoglycerate kinase, cytosolic    99.4    2e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008383158.1|  PREDICTED: phosphoglycerate kinase, cytosolic    99.4    2e-21   Malus domestica [apple tree]
ref|XP_004488762.1|  PREDICTED: phosphoglycerate kinase, cytosoli...  99.4    2e-21   Cicer arietinum [garbanzo]
gb|AFK46712.1|  unknown                                               99.4    2e-21   Medicago truncatula
ref|XP_003596092.1|  Phosphoglycerate kinase                          99.4    2e-21   Medicago truncatula
ref|XP_009618219.1|  PREDICTED: phosphoglycerate kinase, cytosoli...  99.0    2e-21   Nicotiana tomentosiformis
dbj|BAA33801.1|  cytosolic phosphoglycerate kinase 1                  99.0    2e-21   Populus nigra [black poplar]
ref|XP_002977295.1|  hypothetical protein SELMODRAFT_107116           99.0    2e-21   Selaginella moellendorffii
ref|WP_023076270.1|  phosphoglycerate kinase                          98.6    3e-21   Leptolyngbya sp. Heron Island J
emb|CDP13576.1|  unnamed protein product                              98.6    3e-21   Coffea canephora [robusta coffee]
ref|XP_005855869.1|  phosphoglycerate kinase                          96.3    3e-21   Nannochloropsis gaditana CCMP526
ref|XP_010537804.1|  PREDICTED: phosphoglycerate kinase, cytosolic    98.6    3e-21   Tarenaya hassleriana [spider flower]
ref|XP_003596093.1|  Phosphoglycerate kinase                          98.2    4e-21   Medicago truncatula
ref|WP_012626442.1|  phosphoglycerate kinase                          98.2    5e-21   Cyanothece sp. PCC 7425
ref|XP_009607754.1|  PREDICTED: phosphoglycerate kinase, cytosolic    97.8    5e-21   Nicotiana tomentosiformis
emb|CAL85629.1|  phosphoglycerate kinase                              96.3    6e-21   Guillardia theta
ref|WP_040940054.1|  phosphoglycerate kinase                          97.8    6e-21   
ref|WP_040931032.1|  phosphoglycerate kinase                          97.8    6e-21   
ref|XP_008226131.1|  PREDICTED: phosphoglycerate kinase, cytosolic    97.8    6e-21   Prunus mume [ume]
gb|EPS64076.1|  phosphoglycerate kinase                               97.4    7e-21   Genlisea aurea
ref|XP_010094705.1|  Phosphoglycerate kinase                          97.4    8e-21   Morus notabilis
ref|WP_030007016.1|  phosphoglycerate kinase                          97.4    8e-21   Synechococcus sp. NKBG042902
emb|CBN79775.1|  Phosphoglycerate kinase                              98.2    9e-21   Ectocarpus siliculosus
ref|XP_008805982.1|  PREDICTED: phosphoglycerate kinase, cytosolic    97.4    9e-21   Phoenix dactylifera
ref|WP_028953033.1|  phosphoglycerate kinase                          97.1    1e-20   Synechococcus sp. CC9616
ref|WP_012307199.1|  phosphoglycerate kinase                          97.1    1e-20   Synechococcus
ref|WP_038547249.1|  phosphoglycerate kinase                          97.1    1e-20   Synechococcus sp. KORDI-100
ref|XP_002513352.1|  phosphoglycerate kinase, putative                97.1    1e-20   Ricinus communis
ref|WP_024545807.1|  phosphoglycerate kinase                          97.1    1e-20   Synechococcus sp. NKBG15041c
ref|XP_007213914.1|  hypothetical protein PRUPE_ppa005669mg           97.4    1e-20   
ref|WP_015193656.1|  phosphoglycerate kinase                          96.7    1e-20   Stanieria cyanosphaera
ref|WP_015124821.1|  phosphoglycerate kinase                          96.7    1e-20   Synechococcus sp. PCC 6312
ref|XP_001418373.1|  predicted protein                                97.1    1e-20   Ostreococcus lucimarinus CCE9901
ref|WP_041765481.1|  phosphoglycerate kinase                          96.7    2e-20   Leptolyngbya sp. PCC 7376
ref|WP_006528046.1|  phosphoglycerate kinase                          96.7    2e-20   Gloeocapsa sp. PCC 73106
ref|XP_011013882.1|  PREDICTED: phosphoglycerate kinase, cytosoli...  96.7    2e-20   Populus euphratica
ref|XP_002315067.1|  cytosolic phosphoglycerate kinase family pro...  96.3    2e-20   
ref|XP_002972143.1|  hypothetical protein SELMODRAFT_96742            96.3    2e-20   Selaginella moellendorffii
ref|WP_026097925.1|  phosphoglycerate kinase                          96.3    2e-20   Geitlerinema sp. PCC 7105
ref|XP_011013868.1|  PREDICTED: phosphoglycerate kinase, cytosoli...  96.7    2e-20   Populus euphratica
ref|WP_009769345.1|  phosphoglycerate kinase                          96.3    2e-20   Oscillatoriales cyanobacterium JSC-12
emb|CDX79325.1|  BnaC06g19780D                                        95.5    3e-20   
dbj|BAA33802.1|  cytosolic phosphoglycerate kinase 1                  95.9    3e-20   Populus nigra [black poplar]
ref|XP_010669985.1|  PREDICTED: phosphoglycerate kinase, cytosolic    95.9    3e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|WP_036005350.1|  phosphoglycerate kinase                          95.9    3e-20   [Leptolyngbya] sp. JSC-1
ref|WP_019507461.1|  phosphoglycerate kinase                          95.5    4e-20   Pleurocapsa sp. PCC 7319
ref|WP_006456361.1|  phosphoglycerate kinase                          95.5    4e-20   Synechococcus sp. PCC 7335
ref|WP_015162225.1|  phosphoglycerate kinase                          95.5    4e-20   Chamaesiphon minutus
gb|KDP25066.1|  hypothetical protein JCGZ_22601                       95.5    4e-20   Jatropha curcas
ref|WP_008311068.1|  phosphoglycerate kinase                          95.5    4e-20   Leptolyngbya sp. PCC 6406
ref|WP_010471014.1|  phosphoglycerate kinase                          95.1    6e-20   Acaryochloris sp. CCMEE 5410
ref|WP_026719925.1|  phosphoglycerate kinase                          94.7    6e-20   Fischerella sp. PCC 9431
ref|WP_012161281.1|  phosphoglycerate kinase                          94.7    7e-20   Acaryochloris marina
ref|WP_008189591.1|  phosphoglycerate kinase                          94.7    7e-20   Moorea producens
ref|WP_035992253.1|  phosphoglycerate kinase                          94.7    7e-20   Leptolyngbya sp. KIOST-1
ref|XP_005821497.1|  phosphoglycerate kinase, plastid-targeted        95.9    7e-20   Guillardia theta CCMP2712
ref|WP_017300589.1|  phosphoglycerate kinase                          94.4    1e-19   Nodosilinea nodulosa
gb|AFY38465.1|  phosphoglycerate kinase                               94.7    1e-19   Leptolyngbya sp. PCC 7376
ref|WP_015149149.1|  phosphoglycerate kinase                          94.0    1e-19   Oscillatoria acuminata
ref|WP_019495207.1|  phosphoglycerate kinase                          94.0    2e-19   Calothrix sp. PCC 7103
emb|CDP13575.1|  unnamed protein product                              96.3    2e-19   Coffea canephora [robusta coffee]
ref|WP_007304168.1|  phosphoglycerate kinase                          93.6    2e-19   Crocosphaera watsonii
ref|WP_015204810.1|  phosphoglycerate kinase                          93.6    2e-19   Crinalium epipsammum
ref|WP_007309560.1|  phosphoglycerate kinase                          93.6    2e-19   Crocosphaera watsonii
ref|WP_024125258.1|  phosphoglycerate kinase                          93.6    2e-19   Thermosynechococcus sp. NK55a
ref|XP_005822051.1|  hypothetical protein GUITHDRAFT_80135            93.6    2e-19   Guillardia theta CCMP2712
ref|WP_039728851.1|  MULTISPECIES: phosphoglycerate kinase            93.6    2e-19   Lyngbya confervoides
ref|WP_016873269.1|  phosphoglycerate kinase                          93.6    2e-19   Chlorogloeopsis fritschii
ref|WP_017289328.1|  phosphoglycerate kinase                          93.2    2e-19   Leptolyngbya boryana
ref|WP_015173530.1|  phosphoglycerate kinase                          93.2    3e-19   Geitlerinema sp. PCC 7407
ref|WP_006507734.1|  phosphoglycerate kinase                          93.2    3e-19   Xenococcus sp. PCC 7305
ref|XP_005709175.1|  phosphoglycerate kinase                          94.0    3e-19   Galdieria sulphuraria
ref|WP_037220338.1|  phosphoglycerate kinase                          93.2    3e-19   
ref|WP_017323648.1|  phosphoglycerate kinase                          92.8    3e-19   cyanobacterium PCC 7702
ref|WP_017294263.1|  phosphoglycerate kinase                          92.8    4e-19   
ref|WP_015166011.1|  phosphoglycerate kinase                          92.8    4e-19   
ref|WP_018397328.1|  phosphoglycerate kinase                          92.8    4e-19   
ref|WP_036484843.1|  phosphoglycerate kinase                          92.8    4e-19   
ref|WP_011377868.1|  MULTISPECIES: phosphoglycerate kinase            92.4    5e-19   
ref|WP_011242745.1|  phosphoglycerate kinase                          92.4    5e-19   
ref|XP_011401929.1|  Phosphoglycerate kinase, cytosolic               94.7    5e-19   
ref|WP_006173249.1|  phosphoglycerate kinase                          92.4    5e-19   
ref|WP_011365387.1|  phosphoglycerate kinase                          92.4    6e-19   
ref|WP_012598967.1|  phosphoglycerate kinase                          92.0    6e-19   
dbj|BAG09537.1|  phosphoglycerate kinase                              92.8    7e-19   
ref|WP_028947361.1|  phosphoglycerate kinase                          92.0    7e-19   
ref|WP_009628155.1|  phosphoglycerate kinase                          92.0    8e-19   
ref|WP_007099195.1|  phosphoglycerate kinase                          92.0    8e-19   
ref|WP_010873144.1|  phosphoglycerate kinase                          91.7    9e-19   
gb|KIE11439.1|  phosphoglycerate kinase                               91.7    9e-19   
ref|WP_009543708.1|  MULTISPECIES: phosphoglycerate kinase            91.7    9e-19   
ref|WP_009454679.1|  MULTISPECIES: phosphoglycerate kinase            91.7    1e-18   
dbj|BAJ85222.1|  predicted protein                                    91.7    1e-18   
ref|WP_026734580.1|  phosphoglycerate kinase                          91.7    1e-18   
ref|WP_011058101.1|  phosphoglycerate kinase                          91.7    1e-18   
dbj|BAJ87335.1|  predicted protein                                    90.9    1e-18   
ref|WP_017303631.1|  phosphoglycerate kinase                          91.3    1e-18   
ref|WP_016861411.1|  phosphoglycerate kinase                          91.3    1e-18   
ref|WP_035157181.1|  phosphoglycerate kinase                          91.3    1e-18   
ref|WP_017309094.1|  MULTISPECIES: phosphoglycerate kinase            91.3    1e-18   
gb|ACB53567.1|  phosphoglycerate kinase                               91.3    1e-18   
ref|WP_023175125.1|  phosphoglycerate kinase                          91.3    1e-18   
ref|WP_006042911.1|  phosphoglycerate kinase                          91.3    2e-18   
ref|WP_019224946.1|  MULTISPECIES: phosphoglycerate kinase            90.9    2e-18   
ref|WP_019478026.1|  phosphoglycerate kinase                          90.9    2e-18   
ref|WP_015119342.1|  phosphoglycerate kinase                          90.9    2e-18   
ref|WP_011934238.1|  phosphoglycerate kinase                          90.9    2e-18   
ref|WP_015110302.1|  phosphoglycerate kinase                          90.5    2e-18   
ref|WP_006626244.1|  MULTISPECIES: phosphoglycerate kinase            90.5    3e-18   
ref|WP_026098466.1|  phosphoglycerate kinase                          90.5    3e-18   
ref|WP_016865730.1|  phosphoglycerate kinase                          90.5    3e-18   
ref|WP_015184203.1|  phosphoglycerate kinase                          90.5    3e-18   
ref|WP_038552523.1|  phosphoglycerate kinase                          90.5    3e-18   
sp|P74421.2|PGK_SYNY3  RecName: Full=Phosphoglycerate kinase          90.1    3e-18   
ref|WP_041844740.1|  phosphoglycerate kinase                          90.1    3e-18   
ref|WP_015153171.1|  phosphoglycerate kinase                          90.1    3e-18   
ref|WP_015190859.1|  phosphoglycerate kinase                          90.1    3e-18   
ref|WP_039715776.1|  phosphoglycerate kinase                          90.1    4e-18   
ref|WP_022604954.1|  phosphoglycerate kinase                          90.1    4e-18   
ref|WP_006105635.1|  phosphoglycerate kinase                          90.1    4e-18   
ref|WP_015224558.1|  phosphoglycerate kinase                          90.1    4e-18   
ref|WP_034772457.1|  phosphoglycerate kinase                          89.7    4e-18   
ref|WP_010998270.1|  phosphoglycerate kinase                          89.7    4e-18   
ref|WP_013321558.1|  phosphoglycerate kinase                          89.7    5e-18   
ref|WP_041903090.1|  phosphoglycerate kinase                          89.7    5e-18   
ref|WP_011317630.1|  phosphoglycerate kinase                          89.7    5e-18   
ref|WP_011142310.1|  phosphoglycerate kinase                          89.7    5e-18   
ref|WP_016949614.1|  phosphoglycerate kinase                          89.7    5e-18   
ref|WP_006199298.1|  phosphoglycerate kinase                          89.4    5e-18   
gb|AHF64875.1|  Phosphoglycerate kinase                               89.7    5e-18   
ref|WP_015221859.1|  phosphoglycerate kinase                          89.7    5e-18   
gb|EMT08517.1|  Phosphoglycerate kinase, cytosolic                    89.7    6e-18   
ref|WP_008275737.1|  phosphoglycerate kinase                          89.4    6e-18   
ref|WP_026794289.1|  MULTISPECIES: phosphoglycerate kinase            89.4    6e-18   
ref|WP_027249107.1|  phosphoglycerate kinase                          89.4    6e-18   
ref|WP_035831895.1|  phosphoglycerate kinase                          89.4    6e-18   
gb|EMS52006.1|  Phosphoglycerate kinase, cytosolic                    90.5    6e-18   
ref|WP_042152714.1|  phosphoglycerate kinase                          89.4    6e-18   
ref|WP_019502041.1|  phosphoglycerate kinase                          89.4    6e-18   
ref|WP_017803962.1|  phosphoglycerate kinase                          89.4    6e-18   
ref|XP_001762684.1|  predicted protein                                90.1    6e-18   
emb|CBN75623.1|  phosphoglycerate kinase                              89.7    7e-18   
ref|WP_006620004.1|  phosphoglycerate kinase                          89.4    7e-18   
ref|WP_022483437.1|  phosphoglycerate kinase                          89.4    7e-18   
ref|WP_011131834.1|  phosphoglycerate kinase                          89.4    8e-18   
ref|WP_015044861.1|  MULTISPECIES: phosphoglycerate kinase            89.0    8e-18   
ref|WP_026156411.1|  phosphoglycerate kinase                          89.0    9e-18   
ref|WP_009788740.1|  phosphoglycerate kinase                          89.0    9e-18   
ref|WP_009786889.1|  phosphoglycerate kinase                          89.0    9e-18   
ref|WP_015140688.1|  phosphoglycerate kinase                          89.0    9e-18   
ref|WP_003540450.1|  phosphoglycerate kinase                          89.0    1e-17   
ref|WP_013810778.1|  phosphoglycerate kinase                          89.0    1e-17   
ref|WP_009343450.1|  phosphoglycerate kinase                          89.0    1e-17   
ref|WP_011129182.1|  phosphoglycerate kinase                          89.0    1e-17   
ref|WP_036922086.1|  phosphoglycerate kinase                          88.6    1e-17   
ref|WP_029637902.1|  phosphoglycerate kinase [                        88.6    1e-17   
ref|WP_023068245.1|  phosphoglycerate kinase                          88.6    1e-17   
ref|WP_009623623.1|  phosphoglycerate kinase                          88.6    1e-17   
ref|WP_039739530.1|  phosphoglycerate kinase                          88.6    1e-17   
ref|WP_006854064.1|  phosphoglycerate kinase                          88.6    1e-17   
ref|WP_043693415.1|  phosphoglycerate kinase                          88.6    1e-17   
ref|WP_022451887.1|  phosphoglycerate kinase                          88.2    1e-17   
ref|WP_015177490.1|  phosphoglycerate kinase                          88.6    1e-17   
ref|WP_012371262.1|  phosphoglycerate kinase                          88.2    2e-17   
ref|WP_023510529.1|  phosphoglycerate kinase                          88.2    2e-17   
ref|WP_026827584.1|  phosphoglycerate kinase                          88.2    2e-17   
ref|WP_015080710.1|  phosphoglycerate kinase                          88.2    2e-17   
ref|WP_014971163.1|  phosphoglycerate kinase                          88.2    2e-17   
ref|WP_006633515.1|  phosphoglycerate kinase                          88.2    2e-17   
ref|WP_027404640.1|  phosphoglycerate kinase                          88.2    2e-17   
ref|WP_011819547.1|  phosphoglycerate kinase                          88.2    2e-17   
ref|WP_026789199.1|  phosphoglycerate kinase                          88.2    2e-17   
gb|AGH55660.1|  phosphoglycerate kinase                               87.8    2e-17   
ref|WP_019476955.1|  phosphoglycerate kinase                          88.2    2e-17   
ref|WP_028105778.1|  phosphoglycerate kinase                          88.2    2e-17   
ref|WP_015205969.1|  phosphoglycerate kinase                          88.2    2e-17   
ref|WP_022182979.1|  phosphoglycerate kinase                          88.2    2e-17   
ref|WP_002776135.1|  phosphoglycerate kinase                          88.2    2e-17   
ref|WP_029342478.1|  phosphoglycerate kinase                          88.2    2e-17   
ref|WP_010313479.1|  phosphoglycerate kinase                          88.2    2e-17   
ref|WP_007101320.1|  phosphoglycerate kinase                          88.2    2e-17   
ref|WP_026832174.1|  phosphoglycerate kinase                          88.2    2e-17   
ref|WP_028089947.1|  phosphoglycerate kinase                          88.2    2e-17   
ref|WP_028085373.1|  phosphoglycerate kinase                          88.2    2e-17   
ref|WP_002737838.1|  phosphoglycerate kinase                          88.2    2e-17   
ref|WP_015218887.1|  phosphoglycerate kinase                          88.2    2e-17   
ref|WP_034613156.1|  phosphoglycerate kinase                          87.8    2e-17   
ref|WP_023469216.1|  phosphoglycerate kinase                          87.8    2e-17   
ref|WP_011131470.1|  phosphoglycerate kinase                          88.2    2e-17   
ref|WP_013192657.1|  phosphoglycerate kinase                          87.8    2e-17   
gb|KGG29033.1|  Phosphoglycerate kinase                               88.2    2e-17   
ref|WP_011360883.1|  phosphoglycerate kinase                          87.8    2e-17   
dbj|BAJ88371.1|  predicted protein                                    87.4    2e-17   
ref|WP_035396304.1|  MULTISPECIES: phosphoglycerate kinase            87.8    3e-17   
ref|WP_029501199.1|  phosphoglycerate kinase                          87.8    3e-17   
ref|WP_015145174.1|  phosphoglycerate kinase                          87.8    3e-17   
gb|AGL76992.1|  phosphoglycerate kinase                               87.0    3e-17   
ref|WP_017317549.1|  phosphoglycerate kinase                          87.4    3e-17   
ref|WP_011124376.1|  MULTISPECIES: phosphoglycerate kinase            87.4    3e-17   
gb|AAP79195.1|  phosphoglycerate kinase 1                             88.2    3e-17   
ref|WP_007352879.1|  MULTISPECIES: phosphoglycerate kinase            87.4    3e-17   
ref|WP_015217208.1|  phosphoglycerate kinase                          87.4    4e-17   
ref|WP_014829391.1|  phosphoglycerate kinase                          87.4    4e-17   
ref|WP_015127481.1|  phosphoglycerate kinase                          87.4    4e-17   
ref|XP_001776160.1|  predicted protein                                88.2    4e-17   
ref|WP_009631644.1|  phosphoglycerate kinase                          87.0    4e-17   
ref|WP_036911068.1|  MULTISPECIES: phosphoglycerate kinase            87.0    4e-17   
ref|WP_010196831.1|  phosphoglycerate kinase                          87.0    4e-17   
ref|WP_026135280.1|  phosphoglycerate kinase                          87.0    4e-17   
ref|WP_011620601.1|  phosphoglycerate kinase                          87.0    5e-17   
ref|WP_010290183.1|  phosphoglycerate kinase                          87.0    5e-17   
ref|WP_011827369.1|  phosphoglycerate kinase                          87.0    5e-17   
ref|WP_036916478.1|  MULTISPECIES: phosphoglycerate kinase            87.0    5e-17   
ref|WP_006278490.1|  phosphoglycerate kinase                          86.7    6e-17   
ref|WP_003330787.1|  phosphoglycerate kinase                          86.7    6e-17   
ref|WP_027842190.1|  phosphoglycerate kinase                          86.7    6e-17   
ref|WP_010305334.1|  phosphoglycerate kinase                          86.7    6e-17   
ref|WP_025747855.1|  phosphoglycerate kinase                          86.7    6e-17   
ref|XP_005535003.1|  phosphoglycerate kinase                          87.4    7e-17   
ref|WP_001036330.1|  phosphoglycerate kinase                          83.2    7e-17   
ref|XP_009035517.1|  hypothetical protein AURANDRAFT_71305            88.6    8e-17   
ref|WP_017655761.1|  phosphoglycerate kinase                          86.3    8e-17   
ref|WP_008234716.1|  phosphoglycerate kinase                          86.3    9e-17   
ref|WP_001036340.1|  phosphoglycerate kinase                          82.8    9e-17   
ref|WP_010306809.1|  phosphoglycerate kinase                          86.3    9e-17   
ref|YP_002049002.1|  Phosphoglycerate kinase                          86.3    1e-16   
ref|WP_028976537.1|  phosphoglycerate kinase                          85.9    1e-16   
gb|EKE04581.1|  hypothetical protein ACD_20C00046G0002                86.3    1e-16   
ref|WP_022412440.1|  phosphoglycerate kinase                          85.9    1e-16   
ref|WP_015111043.1|  phosphoglycerate kinase                          85.9    1e-16   
ref|WP_042231596.1|  phosphoglycerate kinase                          85.9    1e-16   
ref|WP_006911676.1|  phosphoglycerate kinase                          85.9    1e-16   
ref|WP_024969605.1|  phosphoglycerate kinase                          85.9    1e-16   
ref|WP_022258476.1|  phosphoglycerate kinase                          86.3    1e-16   
ref|WP_012194769.1|  phosphoglycerate kinase                          85.9    1e-16   
ref|WP_039302423.1|  phosphoglycerate kinase                          85.9    1e-16   
gb|AAK40345.1|  phosphoglycerate kinase                               86.3    1e-16   
dbj|GAL95079.1|  phosphoglycerate kinase                              85.9    1e-16   
ref|WP_028051679.1|  phosphoglycerate kinase                          85.5    1e-16   
ref|WP_029331351.1|  phosphoglycerate kinase                          85.5    1e-16   
ref|WP_017551319.1|  phosphoglycerate kinase                          85.5    1e-16   
ref|WP_020155097.1|  phosphoglycerate kinase                          85.5    1e-16   
ref|WP_042132755.1|  phosphoglycerate kinase                          85.5    1e-16   
ref|WP_013860188.1|  phosphoglycerate kinase                          85.5    1e-16   
gb|KIJ83619.1|  phosphoglycerate kinase                               85.9    1e-16   
ref|WP_022343655.1|  phosphoglycerate kinase                          85.5    1e-16   
ref|WP_016516026.1|  phosphoglycerate kinase                          85.9    1e-16   
ref|WP_002802732.1|  phosphoglycerate kinase                          85.9    1e-16   
ref|WP_035345523.1|  phosphoglycerate kinase                          85.5    1e-16   
ref|WP_017872268.1|  phosphoglycerate kinase                          85.5    1e-16   
ref|WP_002757146.1|  phosphoglycerate kinase                          85.5    1e-16   
ref|WP_004162197.1|  phosphoglycerate kinase                          85.5    1e-16   
ref|XP_001777571.1|  predicted protein                                85.5    1e-16   
ref|WP_002781096.1|  phosphoglycerate kinase                          85.5    2e-16   
ref|WP_002772098.1|  phosphoglycerate kinase                          85.5    2e-16   
ref|WP_002747672.1|  phosphoglycerate kinase                          85.5    2e-16   
ref|WP_002750594.1|  phosphoglycerate kinase                          85.5    2e-16   
ref|WP_004162782.1|  phosphoglycerate kinase                          85.5    2e-16   
ref|WP_029142774.1|  phosphoglycerate kinase                          85.5    2e-16   
ref|WP_004161358.1|  phosphoglycerate kinase                          85.5    2e-16   
ref|WP_014097473.1|  phosphoglycerate kinase                          85.5    2e-16   
ref|WP_039205250.1|  phosphoglycerate kinase                          85.5    2e-16   
ref|WP_015230038.1|  phosphoglycerate kinase                          85.5    2e-16   
ref|WP_008206385.1|  phosphoglycerate kinase                          85.5    2e-16   
ref|WP_011429225.1|  phosphoglycerate kinase                          85.5    2e-16   
ref|WP_042210028.1|  phosphoglycerate kinase                          85.5    2e-16   
emb|CEF98237.1|  Phosphoglycerate kinase, conserved site              85.5    2e-16   
ref|WP_014254443.1|  phosphoglycerate kinase [                        85.5    2e-16   
ref|WP_036726266.1|  phosphoglycerate kinase                          85.5    2e-16   
ref|WP_025704347.1|  phosphoglycerate kinase                          85.1    2e-16   
ref|WP_036690089.1|  phosphoglycerate kinase                          85.1    2e-16   
ref|WP_027622719.1|  phosphoglycerate kinase [                        85.5    2e-16   
ref|WP_038693000.1|  phosphoglycerate kinase                          85.1    2e-16   
ref|WP_034634945.1|  phosphoglycerate kinase                          85.1    2e-16   
ref|XP_005715401.1|  unnamed protein product                          85.9    2e-16   
ref|WP_026487158.1|  phosphoglycerate kinase                          85.1    2e-16   
ref|WP_020425586.1|  MULTISPECIES: phosphoglycerate kinase            85.1    2e-16   
ref|WP_036901530.1|  phosphoglycerate kinase                          85.1    2e-16   
ref|WP_015167138.1|  phosphoglycerate kinase                          85.1    2e-16   
ref|WP_042184036.1|  phosphoglycerate kinase                          85.1    2e-16   
ref|WP_035248630.1|  phosphoglycerate kinase                          85.1    2e-16   
emb|CDX04982.1|  Phosphoglycerate kinase                              85.1    2e-16   
ref|XP_002296228.1|  predicted protein                                85.5    2e-16   
ref|WP_036687122.1|  MULTISPECIES: phosphoglycerate kinase            85.1    2e-16   
ref|WP_042123322.1|  phosphoglycerate kinase                          85.1    2e-16   
ref|WP_025892554.1|  phosphoglycerate kinase                          82.0    2e-16   
ref|WP_035192623.1|  phosphoglycerate kinase                          84.7    3e-16   
ref|WP_025702038.1|  phosphoglycerate kinase                          84.7    3e-16   
ref|WP_018212134.1|  phosphoglycerate kinase                          84.7    3e-16   
ref|WP_017888984.1|  phosphoglycerate kinase                          84.7    3e-16   
ref|WP_041032823.1|  phosphoglycerate kinase                          85.1    3e-16   
gb|EHL05013.1|  phosphoglycerate kinase                               84.7    3e-16   
ref|WP_035214477.1|  phosphoglycerate kinase                          84.7    3e-16   
ref|WP_015759304.1|  phosphoglycerate kinase                          84.7    3e-16   
ref|WP_038288111.1|  phosphoglycerate kinase [                        84.7    3e-16   



>sp|Q42961.1|PGKH_TOBAC RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA88841.1| phosphoglycerate kinase [Nicotiana tabacum]
Length=481

 Score =   202 bits (514),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 121/142 (85%), Gaps = 3/142 (2%)
 Frame = +1

Query  88   AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  267
            A A+AS+T CGIP TSSS  + + +   A   RFL +TPLR LGFA AAAD  F++HVAT
Sbjct  2    ASATASHTLCGIPATSSSTTNKAIAPSSA---RFLAKTPLRRLGFAGAAADSLFTNHVAT  58

Query  268  QLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  447
            +LRSLK+S+KP+RGV SMAKKSVGDLTAA+LKGKKVFVRADLNVPLDD Q ITDDTRIRA
Sbjct  59   KLRSLKSSSKPIRGVASMAKKSVGDLTAAELKGKKVFVRADLNVPLDDNQNITDDTRIRA  118

Query  448  AIPTIKHLISNGAKVILSSHLG  513
            A+PTIKHL++NGAKVILSSHLG
Sbjct  119  AVPTIKHLMANGAKVILSSHLG  140



>ref|XP_009763674.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Nicotiana 
sylvestris]
Length=481

 Score =   202 bits (513),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 121/142 (85%), Gaps = 3/142 (2%)
 Frame = +1

Query  88   AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  267
            A A+AS+T CGIP TSSS  + + +   A   RFL +TPLR LGFA AAAD  F++HVAT
Sbjct  2    ASATASHTLCGIPATSSSTTNKAIAPSSA---RFLVKTPLRRLGFAGAAADSLFTNHVAT  58

Query  268  QLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  447
            +LRSLK+S+KP+RGV SMAKKSVGDLTAA+LKGKKVFVRADLNVPLDD Q ITDDTRIRA
Sbjct  59   KLRSLKSSSKPIRGVASMAKKSVGDLTAAELKGKKVFVRADLNVPLDDNQNITDDTRIRA  118

Query  448  AIPTIKHLISNGAKVILSSHLG  513
            A+PTIKHL++NGAKVILSSHLG
Sbjct  119  AVPTIKHLMANGAKVILSSHLG  140



>ref|XP_009622055.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Nicotiana 
tomentosiformis]
Length=481

 Score =   201 bits (512),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 120/142 (85%), Gaps = 3/142 (2%)
 Frame = +1

Query  88   AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  267
            A A+AS+T CGIP TSSS  + + +   A   RFL +TPLR LGFA AAAD  F++HVA 
Sbjct  2    ASATASHTLCGIPATSSSTTNKAIAPSSA---RFLAKTPLRRLGFAGAAADSLFTNHVAA  58

Query  268  QLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  447
            +LRSLK S+KPVRGV SMAKKSVGDLTAA+LKGKKVFVRADLNVPLDD+Q ITDDTRIRA
Sbjct  59   KLRSLKGSSKPVRGVASMAKKSVGDLTAAELKGKKVFVRADLNVPLDDSQNITDDTRIRA  118

Query  448  AIPTIKHLISNGAKVILSSHLG  513
            A+PTIKHL++NGAKVILSSHLG
Sbjct  119  AVPTIKHLMANGAKVILSSHLG  140



>gb|AAC26785.1| phosphoglycerate kinase precursor [Solanum tuberosum]
Length=482

 Score =   199 bits (506),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 125/142 (88%), Gaps = 2/142 (1%)
 Frame = +1

Query  88   AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  267
            A A+AS+TFCGIPTTSSS+ ++ S++  +   RFL +TPLR LGFA A ADP F++HVAT
Sbjct  2    ASATASHTFCGIPTTSSSSTTNRSTTHSS--ARFLLKTPLRRLGFAGAVADPLFTNHVAT  59

Query  268  QLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  447
            +LRSLKAS+ PVR VVSMAKKSVGDL+++DLKGKKVFVRADLNVPLDD Q ITDDTRIRA
Sbjct  60   KLRSLKASSNPVRAVVSMAKKSVGDLSSSDLKGKKVFVRADLNVPLDDAQNITDDTRIRA  119

Query  448  AIPTIKHLISNGAKVILSSHLG  513
            AIPTIKHLI+NGAKVILSSHLG
Sbjct  120  AIPTIKHLIANGAKVILSSHLG  141



>ref|XP_011086346.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Sesamum indicum]
Length=481

 Score =   199 bits (506),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 121/143 (85%), Gaps = 4/143 (3%)
 Frame = +1

Query  88   AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  267
            A ++AS  FCGIP  S++AA +S +   A  TRFL +TPLR LGFAAAAADP  SHHVAT
Sbjct  2    ASSAASPAFCGIPKASTAAARASLT---APTTRFLSKTPLRRLGFAAAAADPLLSHHVAT  58

Query  268  QLRSLK-ASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIR  444
            +L S K ASAKPVRGV SMAKKSVGDL+ ADLKGKKVFVRADLNVPLDD+Q ITDDTRIR
Sbjct  59   KLVSFKNASAKPVRGVASMAKKSVGDLSGADLKGKKVFVRADLNVPLDDSQNITDDTRIR  118

Query  445  AAIPTIKHLISNGAKVILSSHLG  513
            AA+PTIKHLISNGAKVILSSHLG
Sbjct  119  AAVPTIKHLISNGAKVILSSHLG  141



>gb|ABB86255.1| phosphoglycerate kinase precursor-like [Solanum tuberosum]
Length=482

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 123/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  88   AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  267
            A A+AS+TFCGIPT SSS+ ++ S++  +   RFL +TPLR LGFA A ADP F+ HVAT
Sbjct  2    ASATASHTFCGIPTKSSSSTTNRSTTPSS--ARFLLKTPLRRLGFAGAVADPLFTSHVAT  59

Query  268  QLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  447
            +LRSLKAS+ PVR VVSMAKKSVGDL++ADLKGKKVFVRADLNVPLDD Q ITDDTRIRA
Sbjct  60   KLRSLKASSNPVRAVVSMAKKSVGDLSSADLKGKKVFVRADLNVPLDDAQNITDDTRIRA  119

Query  448  AIPTIKHLISNGAKVILSSHLG  513
            AIPTIKHLI+NGAKVILS+HLG
Sbjct  120  AIPTIKHLIANGAKVILSTHLG  141



>ref|NP_001275227.1| phosphoglycerate kinase, chloroplastic-like [Solanum tuberosum]
 gb|ABB72817.1| phosphoglycerate kinase precursor-like protein [Solanum tuberosum]
Length=482

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 125/142 (88%), Gaps = 2/142 (1%)
 Frame = +1

Query  88   AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  267
            A A+AS+TFCGIPTTSSS+ ++ S++  +   RFL +TPLR LGFA A ADP F++HVAT
Sbjct  2    ASATASHTFCGIPTTSSSSTTNRSTTHSS--ARFLLKTPLRRLGFAGAVADPLFTNHVAT  59

Query  268  QLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  447
            +LRSLKAS+ PVR VVSMAKKSVGDL+++DLKGKKVFVRADLNVPLDD Q ITDDTRIRA
Sbjct  60   KLRSLKASSNPVRAVVSMAKKSVGDLSSSDLKGKKVFVRADLNVPLDDAQNITDDTRIRA  119

Query  448  AIPTIKHLISNGAKVILSSHLG  513
            AIPTIKHLI+NGAKVILS+HLG
Sbjct  120  AIPTIKHLIANGAKVILSTHLG  141



>ref|XP_011095719.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Sesamum indicum]
Length=481

 Score =   197 bits (500),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 119/145 (82%), Gaps = 8/145 (6%)
 Frame = +1

Query  88   AMASASYTFCGIPTTsssaassssssKRAVI--TRFLPRTPLRSLGFAAAAADPFFSHHV  261
            A  +AS  FCGIP  S+S +++     RA I  TRFL + PLR LGF+AAAA+P  SHHV
Sbjct  2    ASTAASPAFCGIPKASTSTSAA-----RASIPATRFLAKNPLRGLGFSAAAAEPLLSHHV  56

Query  262  ATQLRSL-KASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTR  438
            AT+LRS   +SAKPVRGV SMAKKSVGDLTAADLKGKKVFVRADLNVPLDD Q ITDDTR
Sbjct  57   ATKLRSFGSSSAKPVRGVASMAKKSVGDLTAADLKGKKVFVRADLNVPLDDNQNITDDTR  116

Query  439  IRAAIPTIKHLISNGAKVILSSHLG  513
            IRAA+PTIKHLISNGAKVILS+HLG
Sbjct  117  IRAAVPTIKHLISNGAKVILSTHLG  141



>gb|ADR71054.1| phosphoglycerate kinase [Nicotiana benthamiana]
Length=481

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 119/142 (84%), Gaps = 3/142 (2%)
 Frame = +1

Query  88   AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  267
            A A+AS++ CGIP TSSS  + S +   A   RFL +TP R LGFA AAAD  F++HVAT
Sbjct  2    ASATASHSLCGIPATSSSTTNKSIAPSSA---RFLAKTPPRGLGFAGAAADSLFTNHVAT  58

Query  268  QLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  447
            +LRSLK+S+KPVRGV SMAKKSVGDLTAA+LKGK VFVRADLNVPLDD Q ITDDTRIRA
Sbjct  59   KLRSLKSSSKPVRGVASMAKKSVGDLTAAELKGKNVFVRADLNVPLDDNQNITDDTRIRA  118

Query  448  AIPTIKHLISNGAKVILSSHLG  513
            A+PTIKHL++NGAKVILS+HLG
Sbjct  119  AVPTIKHLMANGAKVILSTHLG  140



>ref|XP_004243968.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Solanum lycopersicum]
Length=482

 Score =   194 bits (494),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  88   AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  267
            A A+AS+T CGIPTTSSS+ ++ S++  +   RFL +TPLR LGFA   ADP F++HVAT
Sbjct  2    ASATASHTLCGIPTTSSSSTTNKSTTYSS--ARFLLKTPLRRLGFAGTVADPLFTNHVAT  59

Query  268  QLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  447
            +LRS+KAS+ PVR VVSMAKKSVGDL+++DLKGKKVFVRADLNVPLDD+Q ITDDTRIRA
Sbjct  60   KLRSVKASSNPVRAVVSMAKKSVGDLSSSDLKGKKVFVRADLNVPLDDSQNITDDTRIRA  119

Query  448  AIPTIKHLISNGAKVILSSHLG  513
            AIPTIKHLI+NGAKVILSSHLG
Sbjct  120  AIPTIKHLIANGAKVILSSHLG  141



>ref|XP_006359791.1| PREDICTED: uncharacterized protein LOC102577647 [Solanum tuberosum]
Length=1046

 Score =   196 bits (498),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 107/142 (75%), Positives = 125/142 (88%), Gaps = 2/142 (1%)
 Frame = +1

Query  88   AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  267
            A A+AS+TFCGIPTTSSS+ ++ S++  +   RFL +TPLR LGFA A ADP F++HVAT
Sbjct  2    ASATASHTFCGIPTTSSSSTTNRSTTHSS--ARFLLKTPLRRLGFAGAVADPLFTNHVAT  59

Query  268  QLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  447
            +LRSLKAS+ PVR VVSMAKKSVGDL+++DLKGKKVFVRADLNVPLDD Q ITDDTRIRA
Sbjct  60   KLRSLKASSNPVRAVVSMAKKSVGDLSSSDLKGKKVFVRADLNVPLDDAQNITDDTRIRA  119

Query  448  AIPTIKHLISNGAKVILSSHLG  513
            AIPTIKHLI+NGAKVILS+HLG
Sbjct  120  AIPTIKHLIANGAKVILSTHLG  141



>gb|EYU33792.1| hypothetical protein MIMGU_mgv1a005422mg [Erythranthe guttata]
Length=484

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 110/135 (81%), Gaps = 3/135 (2%)
 Frame = +1

Query  112  FCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLK-A  288
            FCGIP  S++ A+ +S   +   TRFL +TP R LGFAAAAADP  S HVA ++ SLK  
Sbjct  12   FCGIPKASTATAARASL--KTPTTRFLSKTPTRGLGFAAAAADPLLSRHVAVKMASLKRG  69

Query  289  SAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKH  468
            S+  VRGV SM KKSVGDLTAA+LKGK+VFVRADLNVPLDD+Q ITDDTRIRAAIPTIKH
Sbjct  70   SSAAVRGVASMVKKSVGDLTAAELKGKRVFVRADLNVPLDDSQNITDDTRIRAAIPTIKH  129

Query  469  LISNGAKVILSSHLG  513
            LISNGAKV+LSSHLG
Sbjct  130  LISNGAKVLLSSHLG  144



>gb|EPS66037.1| phosphoglycerate kinase, chloroplastic [Genlisea aurea]
Length=487

 Score =   179 bits (453),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 114/143 (80%), Gaps = 3/143 (2%)
 Frame = +1

Query  94   ASASYTFCGIPTTsssaassssssKRAV-ITRFLPRTPLRSLGFAAAAADPFFSHHVATQ  270
            A+AS   CG+P  S+  A+SS S+   V  +RFL RTPLR LGF+AAA DP  +HHVA +
Sbjct  5    AAASPALCGVPKASTGGAASSRSASPCVPGSRFLGRTPLRRLGFSAAAVDPILAHHVAAR  64

Query  271  LRSLKASA--KPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIR  444
              S   SA  KP RGVVSMAKKSVGDL+AADLKG++VFVRADLNVPLDD Q ITDDTRIR
Sbjct  65   SASFIRSAGKKPARGVVSMAKKSVGDLSAADLKGRRVFVRADLNVPLDDNQNITDDTRIR  124

Query  445  AAIPTIKHLISNGAKVILSSHLG  513
            AA+PTIKHLI+NGAKVILSSHLG
Sbjct  125  AAVPTIKHLINNGAKVILSSHLG  147



>ref|XP_009402843.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=480

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +1

Query  196  RTPLRSLGFAAAAADPFFSHHVATQLRSLKA-SAKPVRGVVSMAKKSVGDLTAADLKGKK  372
            R+PLR LGFA AAADP  + HVA ++RS+   S K  RGV SMAKKSVGDLTAADLKGKK
Sbjct  34   RSPLRRLGFAGAAADPLLAAHVAAKIRSVAGRSGKGSRGVASMAKKSVGDLTAADLKGKK  93

Query  373  VFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            VFVRADLNVPLD+ + ITDDTRIRAA+PTIKHLISNGAKVILSSHLG
Sbjct  94   VFVRADLNVPLDENRNITDDTRIRAAVPTIKHLISNGAKVILSSHLG  140



>ref|XP_002513353.1| phosphoglycerate kinase, putative [Ricinus communis]
 gb|EEF48756.1| phosphoglycerate kinase, putative [Ricinus communis]
Length=479

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 91/105 (87%), Gaps = 3/105 (3%)
 Frame = +1

Query  199  TPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVF  378
            T LR LGFAAA  DP FSHHVA+++RS   S K  R VVSMAKKSVGDLTAADLKGKKVF
Sbjct  38   TTLRRLGFAAA--DPAFSHHVASKIRSF-GSGKASRAVVSMAKKSVGDLTAADLKGKKVF  94

Query  379  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            VRADLNVPLDD QKITDDTRIRAAIPT+KHLI NGAKVILSSHLG
Sbjct  95   VRADLNVPLDDNQKITDDTRIRAAIPTVKHLIQNGAKVILSSHLG  139



>ref|XP_011013857.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Populus euphratica]
Length=481

 Score =   165 bits (418),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 93/113 (82%), Gaps = 2/113 (2%)
 Frame = +1

Query  175  VITRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAA  354
            V T  L  T LR LGF+AA  D  FS HV +++RS K++ K  R VVSMAKKSVGDLTAA
Sbjct  31   VSTSGLRTTSLRGLGFSAA--DTLFSSHVVSKIRSFKSNGKAPRAVVSMAKKSVGDLTAA  88

Query  355  DLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DLKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIKHLISNGAKVILSSHLG
Sbjct  89   DLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKHLISNGAKVILSSHLG  141



>ref|XP_011016496.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Populus euphratica]
Length=481

 Score =   165 bits (417),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 95/113 (84%), Gaps = 2/113 (2%)
 Frame = +1

Query  175  VITRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAA  354
            V T  L  T LR LGF+AA  DP FS HV +++RS K++ +  R VVSMAKKSVGDLTAA
Sbjct  31   VSTSGLRTTSLRGLGFSAA--DPLFSSHVVSKIRSFKSNGRAPRAVVSMAKKSVGDLTAA  88

Query  355  DLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DLKGKKVFVRADLNVPLD+ QKITDDTRIRAA+PTIK+LISNGAKVILSSHLG
Sbjct  89   DLKGKKVFVRADLNVPLDENQKITDDTRIRAAVPTIKYLISNGAKVILSSHLG  141



>ref|XP_004488763.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Cicer 
arietinum]
Length=479

 Score =   165 bits (417),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 111/142 (78%), Gaps = 4/142 (3%)
 Frame = +1

Query  88   AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  267
            A A+A  T   +PTT SS+ S+S SS R  ++ FL   PLR LGFAAA  DP  +  VA+
Sbjct  2    ASATAPTTLSLLPTTKSSSPSASPSSSRVHLSSFLGARPLRRLGFAAA--DPLLAVQVAS  59

Query  268  QLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  447
            +LR++  S +  RGVVSMAKKSVGDL+AA+LKGKKVFVRADLNVPLDD Q ITDDTRIRA
Sbjct  60   KLRTV--SGRGARGVVSMAKKSVGDLSAAELKGKKVFVRADLNVPLDDNQNITDDTRIRA  117

Query  448  AIPTIKHLISNGAKVILSSHLG  513
            AIPTIKHLI NGAKVILSSHLG
Sbjct  118  AIPTIKHLIQNGAKVILSSHLG  139



>ref|XP_002315066.1| PHOSPHOGLYCERATE KINASE 1 family protein [Populus trichocarpa]
 gb|EEF01237.1| PHOSPHOGLYCERATE KINASE 1 family protein [Populus trichocarpa]
Length=481

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 93/113 (82%), Gaps = 2/113 (2%)
 Frame = +1

Query  175  VITRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAA  354
            V T  L  T LR LGF+AA  D  FS HV +++RS K++ K  R VVSMAKKSVGDLTAA
Sbjct  31   VSTSGLRTTSLRGLGFSAA--DTLFSSHVVSKIRSFKSNGKAPRAVVSMAKKSVGDLTAA  88

Query  355  DLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DLKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIK+LISNGAKVILSSHLG
Sbjct  89   DLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKYLISNGAKVILSSHLG  141



>ref|XP_002263796.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Vitis vinifera]
 emb|CAN81990.1| hypothetical protein VITISV_000725 [Vitis vinifera]
Length=478

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 89/108 (82%), Gaps = 2/108 (2%)
 Frame = +1

Query  190  LPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGK  369
            LP  PLR LGFA AAAD   + HVA++ RS +  A   RGVVSMAKKSVGDLT ADLKGK
Sbjct  33   LPTLPLRRLGFAGAAADSLLTLHVASRTRSFRGKAS--RGVVSMAKKSVGDLTGADLKGK  90

Query  370  KVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            KVFVR DLNVPLDD QKITDDTR+RAAIPTIK+LI NGAKVILSSHLG
Sbjct  91   KVFVRVDLNVPLDDNQKITDDTRVRAAIPTIKYLIDNGAKVILSSHLG  138



>ref|XP_002312238.1| hypothetical protein POPTR_0008s08410g [Populus trichocarpa]
 dbj|BAA33803.1| chloroplast phosphoglycerate kinase [Populus nigra]
 gb|EEE89605.1| hypothetical protein POPTR_0008s08410g [Populus trichocarpa]
Length=481

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +1

Query  175  VITRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAA  354
            V T  L  T LR LGF+AA  DP FS HV +++RS K++ +  R VVSMAKKSVGDLTAA
Sbjct  31   VSTSGLRTTSLRGLGFSAA--DPLFSSHVVSKIRSFKSNGRAPRAVVSMAKKSVGDLTAA  88

Query  355  DLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DLKGKKVFVRADLNVPLD+ QKITDDTRIRAA+PTIK+LIS GAKVILSSHLG
Sbjct  89   DLKGKKVFVRADLNVPLDENQKITDDTRIRAAVPTIKYLISKGAKVILSSHLG  141



>gb|ABK96267.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96531.1| unknown [Populus trichocarpa x Populus deltoides]
Length=481

 Score =   162 bits (410),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +1

Query  175  VITRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAA  354
            V T  L  T LR LGF+AA  DP FS HV +++RS K++ +  R VVSMAKKSVGDLTAA
Sbjct  31   VSTSGLRTTSLRGLGFSAA--DPLFSSHVVSKIRSFKSNGRAPRAVVSMAKKSVGDLTAA  88

Query  355  DLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DLKGKKVFVRADLNVPLD+ QKITDDTRIRAA+PTIK+LIS GAKVILSSHLG
Sbjct  89   DLKGKKVFVRADLNVPLDENQKITDDTRIRAAVPTIKYLISKGAKVILSSHLG  141



>ref|XP_010923458.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Elaeis 
guineensis]
Length=492

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +1

Query  196  RTPLRSLGFAAAAADPFFSHHVATQLRSLKA-SAKPVRGVVSMAKKSVGDLTAADLKGKK  372
            R+P R LGFA AAADP  + HVA ++R++   S +  RGV  MAKKSVGDLTAADLKGK+
Sbjct  46   RSPFRRLGFAGAAADPLLALHVAARIRAVAGRSGRGPRGVAVMAKKSVGDLTAADLKGKR  105

Query  373  VFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            VFVRADLNVPLD+ Q ITDDTRIRAA+PTIKHLI NGAKVILSSHLG
Sbjct  106  VFVRADLNVPLDENQNITDDTRIRAAVPTIKHLIGNGAKVILSSHLG  152



>ref|XP_010269369.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Nelumbo 
nucifera]
Length=486

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 89/106 (84%), Gaps = 4/106 (4%)
 Frame = +1

Query  196  RTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKV  375
            R PLR LGF+A   DP  S HVA ++R++  + K VRGVVSMAKKSVGDLTAADLKGKKV
Sbjct  45   RAPLRRLGFSAV--DPLLSLHVAAKVRAV--NGKGVRGVVSMAKKSVGDLTAADLKGKKV  100

Query  376  FVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            FVRADLNVPLD  Q ITDDTR+RAA+PTIKHLI NGAKVILSSHLG
Sbjct  101  FVRADLNVPLDGNQNITDDTRVRAAVPTIKHLIGNGAKVILSSHLG  146



>gb|ADV16381.1| chloroplast phosphoglycerate kinase 3 [Helianthus annuus]
Length=481

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 92/111 (83%), Gaps = 3/111 (3%)
 Frame = +1

Query  181  TRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADL  360
            +RFL R+PLR LGFAAA  D  FS HVA++LRS   S KP+   V  AKKSVGDL+ A+L
Sbjct  33   SRFL-RSPLRGLGFAAA--DTAFSAHVASKLRSCSTSVKPISRGVFAAKKSVGDLSPAEL  89

Query  361  KGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            KGKKVFVRADLNVPLDD Q ITDDTRIRAA+PTIKHLISNGAKVILSSHLG
Sbjct  90   KGKKVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLISNGAKVILSSHLG  140



>gb|KJB14025.1| hypothetical protein B456_002G107300 [Gossypium raimondii]
Length=491

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 94/112 (84%), Gaps = 4/112 (4%)
 Frame = +1

Query  184  RFLPRTPL-RSLGFAAAAA-DPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAAD  357
            R L  +PL  SLGF++AA+ D   S HV++++RS K   K  RGVVSMAKKSVGDLTAAD
Sbjct  39   RHLKSSPLIHSLGFSSAASGDSLLSLHVSSKVRSFKG--KGSRGVVSMAKKSVGDLTAAD  96

Query  358  LKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            LKGKKVFVRADLNVPLDD+Q ITDDTRIRAAIPTIKHLI NGAKVILSSHLG
Sbjct  97   LKGKKVFVRADLNVPLDDSQNITDDTRIRAAIPTIKHLIQNGAKVILSSHLG  148



>ref|XP_008372155.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Malus 
domestica]
Length=396

 Score =   155 bits (393),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 90/105 (86%), Gaps = 3/105 (3%)
 Frame = +1

Query  199  TPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVF  378
            T LR LGF+AA  DP  +  VA+++RS   S K VRGVV+MAKKSVGDL+AA+LKGKKVF
Sbjct  39   TALRRLGFSAA--DPLLALQVASKVRSF-GSGKGVRGVVAMAKKSVGDLSAAELKGKKVF  95

Query  379  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            VRADLNVPLDD+Q ITDDTRIRAAIPTIKHLI NGAKVILSSHLG
Sbjct  96   VRADLNVPLDDSQNITDDTRIRAAIPTIKHLIENGAKVILSSHLG  140



>gb|KJB14026.1| hypothetical protein B456_002G107300 [Gossypium raimondii]
Length=488

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 94/112 (84%), Gaps = 4/112 (4%)
 Frame = +1

Query  184  RFLPRTPL-RSLGFAAAAA-DPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAAD  357
            R L  +PL  SLGF++AA+ D   S HV++++RS K   K  RGVVSMAKKSVGDLTAAD
Sbjct  39   RHLKSSPLIHSLGFSSAASGDSLLSLHVSSKVRSFKG--KGSRGVVSMAKKSVGDLTAAD  96

Query  358  LKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            LKGKKVFVRADLNVPLDD+Q ITDDTRIRAAIPTIKHLI NGAKVILSSHLG
Sbjct  97   LKGKKVFVRADLNVPLDDSQNITDDTRIRAAIPTIKHLIQNGAKVILSSHLG  148



>ref|XP_003596091.1| Phosphoglycerate kinase [Medicago truncatula]
 gb|AES66342.1| phosphoglycerate kinase-like protein [Medicago truncatula]
Length=479

 Score =   156 bits (395),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 94/115 (82%), Gaps = 4/115 (3%)
 Frame = +1

Query  169  RAVITRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLT  348
            R  ++ FL   PLR LGFAAA  DP  +  VA+++R++  S + VRGVVSMAKKSVGDL+
Sbjct  29   RIHLSSFLGARPLRRLGFAAA--DPLLAVQVASKVRTV--SGRGVRGVVSMAKKSVGDLS  84

Query  349  AADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
             A+LKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILSSHLG
Sbjct  85   GAELKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKYLIQNGAKVILSSHLG  139



>ref|XP_008226130.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Prunus mume]
Length=480

 Score =   156 bits (395),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 90/105 (86%), Gaps = 3/105 (3%)
 Frame = +1

Query  199  TPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVF  378
            T LR LGF+AA  DP F+  VA+++RS   S K VRGVVSMAK+SVGDL+AADLKGK+VF
Sbjct  39   TTLRRLGFSAA--DPLFALQVASKIRSF-GSGKAVRGVVSMAKRSVGDLSAADLKGKRVF  95

Query  379  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            VRADLNVPLDD+Q ITDDTRIRAAIPTIKHLI  GAKVILSSHLG
Sbjct  96   VRADLNVPLDDSQNITDDTRIRAAIPTIKHLIEKGAKVILSSHLG  140



>ref|XP_008371996.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Malus 
domestica]
Length=480

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 90/105 (86%), Gaps = 3/105 (3%)
 Frame = +1

Query  199  TPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVF  378
            T LR LGF+AA  DP  +  VA+++RS   S K VRGVV+MAKKSVGDL+AA+LKGKKVF
Sbjct  39   TALRRLGFSAA--DPLLALQVASKVRSF-GSGKGVRGVVAMAKKSVGDLSAAELKGKKVF  95

Query  379  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            VRADLNVPLDD+Q ITDDTRIRAAIPTIKHLI NGAKVILSSHLG
Sbjct  96   VRADLNVPLDDSQNITDDTRIRAAIPTIKHLIENGAKVILSSHLG  140



>ref|XP_008346077.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Malus domestica]
Length=480

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 90/105 (86%), Gaps = 3/105 (3%)
 Frame = +1

Query  199  TPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVF  378
            T LR LGF+AA  DP  +  VA+++RS   S K VRGVV+MAKKSVGDL+AA+LKGKKVF
Sbjct  39   TALRRLGFSAA--DPLLALQVASKVRSF-GSGKGVRGVVAMAKKSVGDLSAAELKGKKVF  95

Query  379  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            VRADLNVPLDD+Q ITDDTRIRAAIPTIKHLI NGAKVILSSHLG
Sbjct  96   VRADLNVPLDDSQNITDDTRIRAAIPTIKHLIENGAKVILSSHLG  140



>ref|XP_008805983.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Phoenix dactylifera]
 ref|XP_008776889.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Phoenix dactylifera]
Length=488

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +1

Query  196  RTPLRSLGFAAAAADPFFSHHVATQLRSLKA-SAKPVRGVVSMAKKSVGDLTAADLKGKK  372
            R+PL  LGFA AAADP  + HVA ++ ++   S +  RGV +MAKKSVGDLTAADLKGK+
Sbjct  42   RSPLHRLGFAGAAADPLLAVHVAERIWAVAGRSGRGPRGVATMAKKSVGDLTAADLKGKR  101

Query  373  VFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            VFVRADLNVPLD+ Q ITDDTRIRAA+PTIKHL+ NGAKVILSSHLG
Sbjct  102  VFVRADLNVPLDENQNITDDTRIRAAVPTIKHLMGNGAKVILSSHLG  148



>ref|XP_009397212.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
 gb|ABF70168.1| phosphoglycerate kinase, chloroplast, putative [Musa acuminata]
Length=479

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 90/112 (80%), Gaps = 1/112 (1%)
 Frame = +1

Query  181  TRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKA-SAKPVRGVVSMAKKSVGDLTAAD  357
            +R   R+P R LGFA  AAD   + HVA ++R++   S K  RGV  MAKKSVGDLTAAD
Sbjct  28   SRLTLRSPSRRLGFAGVAADSLLAAHVAAKIRTVAGRSGKGPRGVAVMAKKSVGDLTAAD  87

Query  358  LKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            LKGKKVFVRADLNVPLD+ + ITDDTRIRAA+PTIKHLISNGAKVILSSHLG
Sbjct  88   LKGKKVFVRADLNVPLDEDRNITDDTRIRAAVPTIKHLISNGAKVILSSHLG  139



>gb|KHG01489.1| hypothetical protein F383_22605 [Gossypium arboreum]
Length=488

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 90/104 (87%), Gaps = 3/104 (3%)
 Frame = +1

Query  205  LRSLGFAAAAA-DPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFV  381
            + SLGF++AA+ D   S HV++++RS K   K  RGVVSMAKKSVGDLTAADLKGKKVFV
Sbjct  47   IHSLGFSSAASGDSLLSLHVSSKVRSFKG--KGSRGVVSMAKKSVGDLTAADLKGKKVFV  104

Query  382  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            RADLNVPLDD+Q ITDDTRIRAAIPTIKHLI NGAKVILSSHLG
Sbjct  105  RADLNVPLDDSQNITDDTRIRAAIPTIKHLIQNGAKVILSSHLG  148



>ref|XP_007213965.1| hypothetical protein PRUPE_ppa005031mg [Prunus persica]
 gb|EMJ15164.1| hypothetical protein PRUPE_ppa005031mg [Prunus persica]
Length=480

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 89/103 (86%), Gaps = 3/103 (3%)
 Frame = +1

Query  205  LRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVR  384
            LR LGF+AA  DP F+  VA+++RS   S K VRGVVSMAK+SVGDL+AADLKGK+VFVR
Sbjct  41   LRRLGFSAA--DPLFALQVASKVRSF-GSGKAVRGVVSMAKRSVGDLSAADLKGKRVFVR  97

Query  385  ADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            ADLNVPLDD+Q ITDDTRIRAAIPTIKHLI  GAKVILSSHLG
Sbjct  98   ADLNVPLDDSQNITDDTRIRAAIPTIKHLIEKGAKVILSSHLG  140



>ref|XP_008349091.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Malus 
domestica]
Length=480

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 89/105 (85%), Gaps = 3/105 (3%)
 Frame = +1

Query  199  TPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVF  378
            T LR LGF+AA  DP  +  VA+++RS   S K VRGVV+MAKKSVGDLTAA+LKGKKVF
Sbjct  39   TALRRLGFSAA--DPLLALQVASKVRSF-GSGKGVRGVVAMAKKSVGDLTAAELKGKKVF  95

Query  379  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            VRADLNVPLDD+Q ITDDTRIRAAIPTIKHLI  GAKVILSSHLG
Sbjct  96   VRADLNVPLDDSQNITDDTRIRAAIPTIKHLIEKGAKVILSSHLG  140



>ref|XP_008383150.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Malus 
domestica]
Length=480

 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 89/105 (85%), Gaps = 3/105 (3%)
 Frame = +1

Query  199  TPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVF  378
            T LR LGF+AA  DP  +  VA+++RS   S K VRGVV+MAKKSVGDLTAA+LKGKKVF
Sbjct  39   TALRRLGFSAA--DPLLALQVASKVRSF-GSGKGVRGVVAMAKKSVGDLTAAELKGKKVF  95

Query  379  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            VRADLNVPLDD+Q ITDDTRIRAAIPTIKHLI  GAKVILSSHLG
Sbjct  96   VRADLNVPLDDSQNITDDTRIRAAIPTIKHLIEKGAKVILSSHLG  140



>gb|KDP25067.1| hypothetical protein JCGZ_22602 [Jatropha curcas]
Length=487

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 84/100 (84%), Gaps = 3/100 (3%)
 Frame = +1

Query  214  LGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADL  393
            LGFA A  DP FSHHVA+++RS     K  R VVSMAKKSVGDLT ADLKGK+VFVRADL
Sbjct  51   LGFAPA--DPLFSHHVASKIRSF-GFGKASRAVVSMAKKSVGDLTGADLKGKRVFVRADL  107

Query  394  NVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            NVPLDD Q ITDDTRIRAAIPTIKHLI NGAKVILS+HLG
Sbjct  108  NVPLDDNQNITDDTRIRAAIPTIKHLIQNGAKVILSTHLG  147



>ref|XP_008456300.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Cucumis melo]
Length=485

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 84/100 (84%), Gaps = 4/100 (4%)
 Frame = +1

Query  214  LGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADL  393
            LGFAAA  DP FS HVA+++RS     K  RGVVSMAKKSVGDLTAADLKGKKVFVRADL
Sbjct  50   LGFAAA--DPLFSLHVASKIRSF--GGKASRGVVSMAKKSVGDLTAADLKGKKVFVRADL  105

Query  394  NVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            NVPLDD Q ITDDTRIRAAIPTIKHL   GAKVILSSHLG
Sbjct  106  NVPLDDNQNITDDTRIRAAIPTIKHLTEKGAKVILSSHLG  145



>ref|XP_008786111.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Phoenix dactylifera]
Length=491

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +1

Query  196  RTPLRSLGFAAAAADPFFSHHVATQLRSLKA-SAKPVRGVVSMAKKSVGDLTAADLKGKK  372
            R+P R LGF  AAADP  + HVA ++R++   S +  RGV +MAKKSVGDLTA+DLKGK+
Sbjct  45   RSPFRRLGFTGAAADPLLALHVAAKIRAVAGRSGRGPRGVAAMAKKSVGDLTASDLKGKR  104

Query  373  VFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            VFVRADLNVPLD+ Q ITDDTRIRAA+PTIKHL+  GAKVILSSHLG
Sbjct  105  VFVRADLNVPLDENQNITDDTRIRAAVPTIKHLMGKGAKVILSSHLG  151



>gb|KDO61595.1| hypothetical protein CISIN_1g011942mg [Citrus sinensis]
 gb|KDO61596.1| hypothetical protein CISIN_1g011942mg [Citrus sinensis]
Length=360

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 88/108 (81%), Gaps = 4/108 (4%)
 Frame = +1

Query  190  LPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGK  369
            +P +  R LGF+AA  DP  + HVA++L S+K   K  R VVSMAKKSVG+L+ ADLKGK
Sbjct  31   MPTSASRRLGFSAA--DPLLTCHVASRLSSIKT--KGTRAVVSMAKKSVGELSGADLKGK  86

Query  370  KVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            KVFVRADLNVPLDD Q ITDDTRIRAA+PTIKHLI NGAKVILSSHLG
Sbjct  87   KVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLIQNGAKVILSSHLG  134



>ref|XP_010060861.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Eucalyptus 
grandis]
 gb|KCW67742.1| hypothetical protein EUGRSUZ_F01476 [Eucalyptus grandis]
Length=484

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 89/108 (82%), Gaps = 4/108 (4%)
 Frame = +1

Query  190  LPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGK  369
            L  + LR LGFAAA  DPF + HVA++LRSL+   K  RGVVSMAKKSVGDLT   LKGK
Sbjct  41   LRSSGLRRLGFAAA--DPFLAAHVASKLRSLRG--KGSRGVVSMAKKSVGDLTGPALKGK  96

Query  370  KVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            KVFVRADLNVPLDD Q ITDDTR+RAA+PTIK+LI NGA+VILSSHLG
Sbjct  97   KVFVRADLNVPLDDNQNITDDTRVRAAVPTIKYLIQNGARVILSSHLG  144



>ref|XP_004139904.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004154567.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN46797.1| hypothetical protein Csa_6G136020 [Cucumis sativus]
Length=485

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 84/100 (84%), Gaps = 4/100 (4%)
 Frame = +1

Query  214  LGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADL  393
            LGFAAA  DP FS HVA+++RS     K  RGVVSMAKKSVGDL+AADLKGKKVFVRADL
Sbjct  50   LGFAAA--DPLFSLHVASKIRSF--GGKASRGVVSMAKKSVGDLSAADLKGKKVFVRADL  105

Query  394  NVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            NVPLDD Q ITDDTRIRAAIPTIKHL   GAKVILSSHLG
Sbjct  106  NVPLDDNQNITDDTRIRAAIPTIKHLTEKGAKVILSSHLG  145



>ref|XP_007022578.1| Phosphoglycerate kinase 1 [Theobroma cacao]
 gb|EOY14103.1| Phosphoglycerate kinase 1 [Theobroma cacao]
Length=491

 Score =   151 bits (382),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 87/103 (84%), Gaps = 3/103 (3%)
 Frame = +1

Query  208  RSLGFAAAAA-DPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVR  384
            +SLGF+AAA+ D   S HV++++RS K   K  RGVVSMAKKSVGDL+ ADLKGKKVFVR
Sbjct  48   QSLGFSAAASGDSLLSLHVSSKVRSFKG--KGSRGVVSMAKKSVGDLSGADLKGKKVFVR  105

Query  385  ADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            AD NVPLDD Q ITDDTR+RAAIPTIKHLI NGAKVILSSHLG
Sbjct  106  ADFNVPLDDNQNITDDTRVRAAIPTIKHLIQNGAKVILSSHLG  148



>ref|XP_004306579.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Fragaria 
vesca subsp. vesca]
Length=480

 Score =   151 bits (381),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 87/102 (85%), Gaps = 3/102 (3%)
 Frame = +1

Query  208  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  387
            R LGFA A  DP  + HVA ++RS   SAKPVRGVV+MAKKSVGDL+ ADLKGKKVFVRA
Sbjct  42   RRLGFAPA--DPLLALHVAAKVRSF-GSAKPVRGVVAMAKKSVGDLSEADLKGKKVFVRA  98

Query  388  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DLNVPLDD+Q ITDDTRIRAA+PTIK+L+  GAKVILSSHLG
Sbjct  99   DLNVPLDDSQNITDDTRIRAAVPTIKYLMDKGAKVILSSHLG  140



>ref|XP_010936574.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Elaeis guineensis]
Length=490

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +1

Query  196  RTPLRSLGFAAAAADPFFSHHVATQLRSLKA-SAKPVRGVVSMAKKSVGDLTAADLKGKK  372
            R+ +  LGFA AAADP  + HVA ++R++   S +  RGV +MAKKSVGDLTAADLKGK+
Sbjct  44   RSAVHRLGFAGAAADPLLAIHVAAKIRAVTGQSGRGPRGVAAMAKKSVGDLTAADLKGKR  103

Query  373  VFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            VFVRADLNVPLD+ Q ITDDTRIRAA+PTIKHL+  GAKVILSSHLG
Sbjct  104  VFVRADLNVPLDENQNITDDTRIRAAVPTIKHLMGKGAKVILSSHLG  150



>ref|XP_006422251.1| hypothetical protein CICLE_v10004891mg [Citrus clementina]
 ref|XP_006493789.1| PREDICTED: phosphoglycerate kinase 2, chloroplastic-like [Citrus 
sinensis]
 gb|ESR35491.1| hypothetical protein CICLE_v10004891mg [Citrus clementina]
Length=474

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 88/108 (81%), Gaps = 4/108 (4%)
 Frame = +1

Query  190  LPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGK  369
            +P +  R LGF+AA  DP  + HVA++L S+K   K  R VVSMAKKSVG+L+ ADLKGK
Sbjct  31   MPTSASRRLGFSAA--DPLLTCHVASRLSSIKT--KGTRAVVSMAKKSVGELSGADLKGK  86

Query  370  KVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            KVFVRADLNVPLDD Q ITDDTRIRAA+PTIKHLI NGAKVILSSHLG
Sbjct  87   KVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLIQNGAKVILSSHLG  134



>gb|KDO61594.1| hypothetical protein CISIN_1g011942mg [Citrus sinensis]
Length=474

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 88/108 (81%), Gaps = 4/108 (4%)
 Frame = +1

Query  190  LPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGK  369
            +P +  R LGF+AA  DP  + HVA++L S+K   K  R VVSMAKKSVG+L+ ADLKGK
Sbjct  31   MPTSASRRLGFSAA--DPLLTCHVASRLSSIKT--KGTRAVVSMAKKSVGELSGADLKGK  86

Query  370  KVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            KVFVRADLNVPLDD Q ITDDTRIRAA+PTIKHLI NGAKVILSSHLG
Sbjct  87   KVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLIQNGAKVILSSHLG  134



>ref|XP_003531482.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Glycine 
max]
Length=485

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 91/115 (79%), Gaps = 2/115 (2%)
 Frame = +1

Query  169  RAVITRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLT  348
            R  +T  L   PLR LGFAAA  DP  +  VA ++ +++   K  RGVVSMAKKSVGDL+
Sbjct  33   RVQLTSSLRARPLRRLGFAAA--DPLLAASVAARVAAVRGGGKGARGVVSMAKKSVGDLS  90

Query  349  AADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            AADLKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIKHLI NGAKVILSSHLG
Sbjct  91   AADLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKHLIQNGAKVILSSHLG  145



>sp|P29409.2|PGKH_SPIOL RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor, partial [Spinacia oleracea]
 emb|CAA48479.1| phosphoglycerate kinase [Spinacia oleracea]
Length=433

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 82/90 (91%), Gaps = 1/90 (1%)
 Frame = +1

Query  247  FSHHVATQLRSLKA-SAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKI  423
            FS HV +++ S K+ S KP+RGV SMAKKSVGDLT+ADLKGKKVFVRADLNVPLDD+Q I
Sbjct  4    FSLHVLSKINSYKSQSTKPIRGVASMAKKSVGDLTSADLKGKKVFVRADLNVPLDDSQNI  63

Query  424  TDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            TDDTRIRAAIPTIKHLI+NGAKVILSSHLG
Sbjct  64   TDDTRIRAAIPTIKHLINNGAKVILSSHLG  93



>ref|XP_010669994.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=482

 Score =   148 bits (374),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 86/109 (79%), Gaps = 3/109 (3%)
 Frame = +1

Query  196  RTPLRSLGFAAAAADPFFSHHVATQLRSLKASAK---PVRGVVSMAKKSVGDLTAADLKG  366
            R PLR LGFA   AD   S HV  ++ S   S     P+RGV +M KKSVGDLT+A+LKG
Sbjct  34   RPPLRRLGFAGVVADSALSQHVNYKIHSSFKSLSSSKPIRGVATMVKKSVGDLTSAELKG  93

Query  367  KKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            K+VFVRADLNVPLDD+Q ITDDTRIRAAIPTIKHL++NGAKVILSSHLG
Sbjct  94   KRVFVRADLNVPLDDSQNITDDTRIRAAIPTIKHLMNNGAKVILSSHLG  142



>ref|NP_187884.1| phosphoglycerate kinase 1 [Arabidopsis thaliana]
 sp|Q9LD57.1|PGKH1_ARATH RecName: Full=Phosphoglycerate kinase 1, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF70258.1|AF247558_1 phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAK25944.1|AF360234_1 putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAL16186.1|AF428418_1 AT3g12780/MBK21_14 [Arabidopsis thaliana]
 dbj|BAB02423.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAK73981.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 gb|AAL24323.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAL33785.1| putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAM16259.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 gb|AAM47957.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAM83218.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 dbj|BAE99262.1| phosphoglycerate kinase like protein [Arabidopsis thaliana]
 dbj|BAH19627.1| AT3G12780 [Arabidopsis thaliana]
 gb|AEE75246.1| phosphoglycerate kinase 1 [Arabidopsis thaliana]
Length=481

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 85/102 (83%), Gaps = 2/102 (2%)
 Frame = +1

Query  208  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  387
            R LGF+A      FS HVA+++ S++   K  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  42   RPLGFSATLDSRRFSLHVASKVESVRG--KGSRGVVSMAKKSVGDLTSADLKGKKVFVRA  99

Query  388  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLG
Sbjct  100  DLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILSTHLG  141



>ref|XP_010094703.1| Phosphoglycerate kinase [Morus notabilis]
 gb|EXB56749.1| Phosphoglycerate kinase [Morus notabilis]
Length=478

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 85/105 (81%), Gaps = 3/105 (3%)
 Frame = +1

Query  199  TPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVF  378
            T LR LGF+AA  DP  +  V +++RS     K VRGVVSMAKKS GDLTAADLKGKKVF
Sbjct  37   TVLRRLGFSAA--DPLLALTVNSRVRSF-GGKKAVRGVVSMAKKSGGDLTAADLKGKKVF  93

Query  379  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            VRADLNVPL D Q ITDDTR+RAA+PTIKHLI NGAKVILSSHLG
Sbjct  94   VRADLNVPLGDNQNITDDTRVRAAVPTIKHLIQNGAKVILSSHLG  138



>ref|XP_006407295.1| hypothetical protein EUTSA_v10020621mg [Eutrema salsugineum]
 gb|ESQ48748.1| hypothetical protein EUTSA_v10020621mg [Eutrema salsugineum]
Length=481

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 86/102 (84%), Gaps = 2/102 (2%)
 Frame = +1

Query  208  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  387
            R LGF+A      FS HVA++++S++   K  RGVVSMAKKSVGDL++ADLKGKKVFVRA
Sbjct  42   RPLGFSAVLESRRFSLHVASKVQSVRG--KGSRGVVSMAKKSVGDLSSADLKGKKVFVRA  99

Query  388  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLG
Sbjct  100  DLNVPLDDNQTITDDTRIRAAIPTIKYLIDNGAKVILSTHLG  141



>emb|CDY43401.1| BnaA01g30320D [Brassica napus]
Length=480

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 86/102 (84%), Gaps = 3/102 (3%)
 Frame = +1

Query  208  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  387
            R LGF+A   D  F+ HVA++++S +   K  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  42   RPLGFSAVL-DSRFTVHVASKVQSFRG--KGTRGVVSMAKKSVGDLTSADLKGKKVFVRA  98

Query  388  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLG
Sbjct  99   DLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILSTHLG  140



>emb|CDX73803.1| BnaA03g32440D [Brassica napus]
Length=484

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 89/115 (77%), Gaps = 8/115 (7%)
 Frame = +1

Query  187  FLPRTPL------RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLT  348
             LP TP       R LGF+A      FS HVA+++ S++   +  RGVVSMAKKSVGDLT
Sbjct  32   LLPITPSSKSISPRPLGFSAVLDSHRFSLHVASKVHSVRG--RGTRGVVSMAKKSVGDLT  89

Query  349  AADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            +ADLKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLG
Sbjct  90   SADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILSTHLG  144



>ref|XP_009124670.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Brassica 
rapa]
Length=480

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 86/102 (84%), Gaps = 3/102 (3%)
 Frame = +1

Query  208  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  387
            R LGF+A   D  F+ HVA++++S +   K  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  42   RPLGFSAVL-DSRFTVHVASKVQSFRG--KGTRGVVSMAKKSVGDLTSADLKGKKVFVRA  98

Query  388  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLG
Sbjct  99   DLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILSTHLG  140



>ref|XP_010487004.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Camelina 
sativa]
Length=481

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 85/102 (83%), Gaps = 2/102 (2%)
 Frame = +1

Query  208  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  387
            R LGF+A      FS HVA+++ S++   K  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  42   RPLGFSATLDARRFSLHVASKVESVRG--KGSRGVVSMAKKSVGDLTSADLKGKKVFVRA  99

Query  388  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLG
Sbjct  100  DLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILSTHLG  141



>ref|XP_010499471.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic [Camelina 
sativa]
Length=481

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 85/102 (83%), Gaps = 2/102 (2%)
 Frame = +1

Query  208  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  387
            R LGF+A      FS HVA+++ S++   K  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  42   RPLGFSATLDARRFSLHVASKVESVRG--KGSRGVVSMAKKSVGDLTSADLKGKKVFVRA  99

Query  388  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLG
Sbjct  100  DLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILSTHLG  141



>emb|CDY24247.1| BnaC01g38270D [Brassica napus]
Length=481

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 86/102 (84%), Gaps = 3/102 (3%)
 Frame = +1

Query  208  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  387
            R LGF+A   D  F+ HVA++++S +   K  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  43   RPLGFSAVL-DSRFTVHVASKVQSFRG--KGTRGVVSMAKKSVGDLTSADLKGKKVFVRA  99

Query  388  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLG
Sbjct  100  DLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILSTHLG  141



>ref|XP_009146585.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic [Brassica 
rapa]
Length=477

 Score =   145 bits (367),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 86/102 (84%), Gaps = 3/102 (3%)
 Frame = +1

Query  208  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  387
            R LGF+A   D  F+ HVA++++S +   K  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  44   RPLGFSAVL-DSRFTVHVASKVQSFRG--KGTRGVVSMAKKSVGDLTSADLKGKKVFVRA  100

Query  388  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLG
Sbjct  101  DLNVPLDDNQTITDDTRIRAAIPTIKYLIDNGAKVILSTHLG  142



>ref|XP_010465058.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Camelina 
sativa]
Length=481

 Score =   145 bits (366),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 85/102 (83%), Gaps = 2/102 (2%)
 Frame = +1

Query  208  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  387
            R LGF+A      FS HVA+++ S++   K  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  42   RPLGFSATLDARRFSLHVASKVESVRG--KGSRGVVSMAKKSVGDLTSADLKGKKVFVRA  99

Query  388  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLG
Sbjct  100  DLNVPLDDNQTITDDTRIRAAIPTIKYLIDNGAKVILSTHLG  141



>ref|XP_009135249.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic [Brassica 
rapa]
Length=484

 Score =   145 bits (366),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 88/115 (77%), Gaps = 8/115 (7%)
 Frame = +1

Query  187  FLPRTPL------RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLT  348
             LP TP       R LGF+A      FS HVA+++ S++      RGVVSMAKKSVGDLT
Sbjct  32   LLPITPSPKSTSPRPLGFSAVLDSHRFSLHVASKVHSVRGRGS--RGVVSMAKKSVGDLT  89

Query  349  AADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            +ADLKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLG
Sbjct  90   SADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILSTHLG  144



>ref|XP_006297559.1| hypothetical protein CARUB_v10013582mg [Capsella rubella]
 gb|EOA30457.1| hypothetical protein CARUB_v10013582mg [Capsella rubella]
Length=481

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 85/102 (83%), Gaps = 2/102 (2%)
 Frame = +1

Query  208  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  387
            R LGF+A      FS HVA+++ S++   K  +GVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  42   RPLGFSATLDSRRFSLHVASKVESVRG--KGSKGVVSMAKKSVGDLTSADLKGKKVFVRA  99

Query  388  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLG
Sbjct  100  DLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILSTHLG  141



>ref|XP_002884926.1| hypothetical protein ARALYDRAFT_478641 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61185.1| hypothetical protein ARALYDRAFT_478641 [Arabidopsis lyrata subsp. 
lyrata]
Length=481

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 85/102 (83%), Gaps = 2/102 (2%)
 Frame = +1

Query  208  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  387
            R LGF+A      F+ HVA+++ S++   K  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  42   RPLGFSATLDSRRFTLHVASKVESVRG--KGSRGVVSMAKKSVGDLTSADLKGKKVFVRA  99

Query  388  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLG
Sbjct  100  DLNVPLDDNQTITDDTRIRAAIPTIKYLIDNGAKVILSTHLG  141



>emb|CDY00798.1| BnaC03g37820D [Brassica napus]
Length=482

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 85/102 (83%), Gaps = 2/102 (2%)
 Frame = +1

Query  208  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  387
            R LGF+A      FS HV+++++S++      RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  43   RPLGFSAVLDSRRFSLHVSSKVQSVRGRGS--RGVVSMAKKSVGDLTSADLKGKKVFVRA  100

Query  388  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DLNVPLDD Q ITDDTRIRAA+PTIK+LI NGAKVILS+HLG
Sbjct  101  DLNVPLDDNQTITDDTRIRAAVPTIKYLIENGAKVILSTHLG  142



>ref|XP_002891879.1| hypothetical protein ARALYDRAFT_474689 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68138.1| hypothetical protein ARALYDRAFT_474689 [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 86/102 (84%), Gaps = 3/102 (3%)
 Frame = +1

Query  208  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  387
            R LGF+A   D  FS HVA++++S++   K  RGV++MAKKSVGDLT+ADLKGKKVFVRA
Sbjct  40   RRLGFSAFV-DSRFSVHVASKVQSVRG--KGTRGVITMAKKSVGDLTSADLKGKKVFVRA  96

Query  388  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DLNVPLDD Q ITDDTRIRAAIPTIK LI NGAKVILS+HLG
Sbjct  97   DLNVPLDDNQNITDDTRIRAAIPTIKFLIENGAKVILSTHLG  138



>tpg|DAA57248.1| TPA: hypothetical protein ZEAMMB73_321071 [Zea mays]
Length=199

 Score =   138 bits (347),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 87/117 (74%), Gaps = 4/117 (3%)
 Frame = +1

Query  166  KRAVITRFLPRTPLRSLGFAA--AAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVG  339
            +RA +    P  P RSLG     A ADP  + HVA + RS  ++ +  R   +M KKSVG
Sbjct  33   RRAGLATVCP--PERSLGSDCLRAGADPRLAIHVALRCRSASSTGRGTRAAATMTKKSVG  90

Query  340  DLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHL  510
            DLTAADL+GK+V VRADLNVPLDD+Q ITDDTR+RAAIPTIKHLISNGA+VIL+SHL
Sbjct  91   DLTAADLEGKRVLVRADLNVPLDDSQNITDDTRVRAAIPTIKHLISNGARVILTSHL  147



>gb|AAF02830.1|AC009894_1 phosphoglycerate kinase [Arabidopsis thaliana]
Length=320

 Score =   140 bits (354),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 83/102 (81%), Gaps = 3/102 (3%)
 Frame = +1

Query  208  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  387
            R LGF+A   D  FS HVA+++ S++   K  RGV++MAKKSVGDL + DLKGKKVFVRA
Sbjct  40   RRLGFSAVV-DSRFSVHVASKVHSVRG--KGARGVITMAKKSVGDLNSVDLKGKKVFVRA  96

Query  388  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DLNVPLDD Q ITDDTRIRAAIPTIK LI NGAKVILS+HLG
Sbjct  97   DLNVPLDDNQNITDDTRIRAAIPTIKFLIENGAKVILSTHLG  138



>emb|CDY52872.1| BnaCnng23600D [Brassica napus]
Length=797

 Score =   145 bits (366),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 86/102 (84%), Gaps = 3/102 (3%)
 Frame = +1

Query  208  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  387
            R LGF+A   D  F+ HVA++++S +   K  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  397  RPLGFSAVL-DSRFTVHVASKVQSFRG--KGTRGVVSMAKKSVGDLTSADLKGKKVFVRA  453

Query  388  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLG
Sbjct  454  DLNVPLDDNQTITDDTRIRAAIPTIKYLIDNGAKVILSTHLG  495



>ref|NP_176015.1| phosphoglycerate kinase [Arabidopsis thaliana]
 sp|P50318.3|PGKH2_ARATH RecName: Full=Phosphoglycerate kinase 2, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG50920.1|AC069159_21 phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gb|AAL07140.1| putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAM20449.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gb|AAN15569.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gb|AEE33356.1| phosphoglycerate kinase [Arabidopsis thaliana]
Length=478

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 83/102 (81%), Gaps = 3/102 (3%)
 Frame = +1

Query  208  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  387
            R LGF+A   D  FS HVA+++ S++   K  RGV++MAKKSVGDL + DLKGKKVFVRA
Sbjct  40   RRLGFSAVV-DSRFSVHVASKVHSVRG--KGARGVITMAKKSVGDLNSVDLKGKKVFVRA  96

Query  388  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DLNVPLDD Q ITDDTRIRAAIPTIK LI NGAKVILS+HLG
Sbjct  97   DLNVPLDDNQNITDDTRIRAAIPTIKFLIENGAKVILSTHLG  138



>ref|XP_003546820.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Glycine max]
Length=483

 Score =   140 bits (353),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 90/116 (78%), Gaps = 4/116 (3%)
 Frame = +1

Query  169  RAVITRFLPRTPL-RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDL  345
            R  ++  L   PL R LGFAAA  DP  + +VA ++ +     K  RGVVSMAKKSVG+L
Sbjct  31   RVQLSSSLRSRPLARRLGFAAA--DPLLAANVAARVAA-VRGGKGARGVVSMAKKSVGEL  87

Query  346  TAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            +AADLKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIKHLI NGAKVILSSHLG
Sbjct  88   SAADLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKHLIQNGAKVILSSHLG  143



>ref|NP_001167912.1| phosphoglycerate kinase [Zea mays]
 gb|ACN26497.1| unknown [Zea mays]
 tpg|DAA57247.1| TPA: phosphoglycerate kinase [Zea mays]
Length=371

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 87/117 (74%), Gaps = 4/117 (3%)
 Frame = +1

Query  166  KRAVITRFLPRTPLRSLGFAA--AAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVG  339
            +RA +    P  P RSLG     A ADP  + HVA + RS  ++ +  R   +M KKSVG
Sbjct  33   RRAGLATVCP--PERSLGSDCLRAGADPRLAIHVALRCRSASSTGRGTRAAATMTKKSVG  90

Query  340  DLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHL  510
            DLTAADL+GK+V VRADLNVPLDD+Q ITDDTR+RAAIPTIKHLISNGA+VIL+SHL
Sbjct  91   DLTAADLEGKRVLVRADLNVPLDDSQNITDDTRVRAAIPTIKHLISNGARVILTSHL  147



>ref|XP_003568189.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Brachypodium 
distachyon]
Length=482

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 86/105 (82%), Gaps = 2/105 (2%)
 Frame = +1

Query  202  PLRSLGFAAAA-ADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVF  378
            P RSL FAA   ADP  + HVA++ R+  +SA+  R V +MAKKSVGDL  ADL+GK+V 
Sbjct  36   PARSLAFAAGGGADPRLAIHVASRCRA-ASSARGTRAVATMAKKSVGDLGPADLEGKRVL  94

Query  379  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            VRADLNVPLDD+Q ITDDTRIRAAIPTIK+L+SNGAKVIL+SHLG
Sbjct  95   VRADLNVPLDDSQNITDDTRIRAAIPTIKYLLSNGAKVILTSHLG  139



>ref|XP_002456487.1| hypothetical protein SORBIDRAFT_03g037165 [Sorghum bicolor]
 gb|EES01607.1| hypothetical protein SORBIDRAFT_03g037165 [Sorghum bicolor]
Length=177

 Score =   131 bits (330),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 83/106 (78%), Gaps = 3/106 (3%)
 Frame = +1

Query  202  PLRSLGFAA--AAADPFFSHHVATQLRSLKASAKPVRGVVSMAKK-SVGDLTAADLKGKK  372
            P RSLG  +  A ADP  + HVA++ RS  ++ +  R   +MAKK SVGDL AADL+GK+
Sbjct  41   PERSLGSVSLGAGADPRLAVHVASRRRSAPSAGRGTRAAATMAKKKSVGDLAAADLEGKR  100

Query  373  VFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHL  510
            V VRADLNVPLDD+Q ITDDTR+RAAIPTIKHLI+NGA+VIL SHL
Sbjct  101  VLVRADLNVPLDDSQNITDDTRVRAAIPTIKHLINNGARVILVSHL  146



>gb|AFW82396.1| hypothetical protein ZEAMMB73_945417 [Zea mays]
Length=477

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 83/106 (78%), Gaps = 3/106 (3%)
 Frame = +1

Query  196  RTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKV  375
            R P RSL FAA   D   + HVA++ R   +SA+  R + +MAKKSVGDLT ADLKGK+V
Sbjct  35   RQPARSLAFAAG--DARLAVHVASRCRQ-ASSARGTRAMATMAKKSVGDLTEADLKGKRV  91

Query  376  FVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            FVRADLNVPLD+ Q ITDDTRIRAAIPTI++L+  GAKVILSSHLG
Sbjct  92   FVRADLNVPLDENQNITDDTRIRAAIPTIQYLLGKGAKVILSSHLG  137



>gb|AAT07576.1| putative chloroplast phosphoglycerate kinase [Oryza sativa Japonica 
Group]
Length=310

 Score =   132 bits (332),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 86/104 (83%), Gaps = 2/104 (2%)
 Frame = +1

Query  202  PLRSLGFAAAAADPFFSHHVATQLR-SLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVF  378
            P RSL   AAAADP  + HVA++ R +  +S++  R V +MAKKSVGDLTAADL+GK+VF
Sbjct  88   PARSL-AFAAAADPRLATHVASRCRQAASSSSRGTRAVATMAKKSVGDLTAADLEGKRVF  146

Query  379  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHL  510
            VRADLNVPLDD Q ITDDTR+RAAIPTI++LI NGAKVILSSHL
Sbjct  147  VRADLNVPLDDNQNITDDTRVRAAIPTIQYLIKNGAKVILSSHL  190



>ref|XP_007149208.1| hypothetical protein PHAVU_005G050700g [Phaseolus vulgaris]
 gb|ESW21202.1| hypothetical protein PHAVU_005G050700g [Phaseolus vulgaris]
Length=477

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 83/102 (81%), Gaps = 3/102 (3%)
 Frame = +1

Query  208  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  387
            R LGF AA  DP  + +VA ++ +     +  RGVVSMAKKSVGDL+AADLKGKKVFVRA
Sbjct  39   RRLGFTAA--DPLLAANVAARVAA-VKVGRGRRGVVSMAKKSVGDLSAADLKGKKVFVRA  95

Query  388  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILSSHLG
Sbjct  96   DLNVPLDDNQNITDDTRIRAAIPTIKYLIQNGAKVILSSHLG  137



>ref|XP_002441313.1| hypothetical protein SORBIDRAFT_09g024340 [Sorghum bicolor]
 gb|EES19743.1| hypothetical protein SORBIDRAFT_09g024340 [Sorghum bicolor]
Length=483

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 83/104 (80%), Gaps = 3/104 (3%)
 Frame = +1

Query  202  PLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFV  381
            P RSL FAA   D   + HVA++ R   +SA+  R + +MAKKSVGDLT ADL+GK+VFV
Sbjct  43   PARSLAFAAG--DARLAVHVASRCRQ-ASSARGTRAMATMAKKSVGDLTEADLEGKRVFV  99

Query  382  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            RADLNVPLD+ Q ITDDTRIRAA+PTI++LIS GAKVILSSHLG
Sbjct  100  RADLNVPLDENQNITDDTRIRAAVPTIQYLISKGAKVILSSHLG  143



>gb|AGV54662.1| phosphoglycerate kinase chloroplastic-like protein [Phaseolus 
vulgaris]
Length=477

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 83/102 (81%), Gaps = 3/102 (3%)
 Frame = +1

Query  208  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  387
            R LGF AA  DP  + +VA ++ +     +  RGVVSMAKKSVGDL+AADLKGKKVFVRA
Sbjct  39   RRLGFTAA--DPLLAANVAARVAA-VKVGRGRRGVVSMAKKSVGDLSAADLKGKKVFVRA  95

Query  388  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILSSHLG
Sbjct  96   DLNVPLDDNQNITDDTRIRAAIPTIKYLIQNGAKVILSSHLG  137



>ref|XP_008656415.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Zea mays]
Length=627

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 83/106 (78%), Gaps = 3/106 (3%)
 Frame = +1

Query  196  RTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKV  375
            R P RSL FAA   D   + HVA++ R   +SA+  R + +MAKKSVGDLT ADLKGK+V
Sbjct  185  RQPARSLAFAAG--DARLAVHVASRCRQ-ASSARGTRAMATMAKKSVGDLTEADLKGKRV  241

Query  376  FVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            FVRADLNVPLD+ Q ITDDTRIRAAIPTI++L+  GAKVILSSHLG
Sbjct  242  FVRADLNVPLDENQNITDDTRIRAAIPTIQYLLGKGAKVILSSHLG  287



>ref|XP_010544343.1| PREDICTED: LOW QUALITY PROTEIN: phosphoglycerate kinase 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=480

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 82/102 (80%), Gaps = 8/102 (8%)
 Frame = +1

Query  208  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  387
            R LGF++   D  FS HVA+++RS++   K  RGVVS      GDLT+ADLKGKKVFVRA
Sbjct  45   RRLGFSSVV-DSRFSVHVASKVRSVRG--KGTRGVVSX-----GDLTSADLKGKKVFVRA  96

Query  388  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DLNVPLDD+Q ITDDTRIRAAIPTIK+LI NGAKVILSSHLG
Sbjct  97   DLNVPLDDSQNITDDTRIRAAIPTIKYLIENGAKVILSSHLG  138



>ref|XP_004961633.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Setaria 
italica]
Length=480

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 82/104 (79%), Gaps = 3/104 (3%)
 Frame = +1

Query  202  PLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFV  381
            P RSL FAA   D   + HVA++ R   +SA+  R V +MAKKSVGDLT ADL+GK+VFV
Sbjct  41   PARSLAFAAG--DARLAVHVASRCRQ-ASSARGTRAVATMAKKSVGDLTEADLEGKRVFV  97

Query  382  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            RADLNVPLD+ Q ITDDTR+RAA+PTI++LI  GAKVILSSHLG
Sbjct  98   RADLNVPLDENQNITDDTRVRAAVPTIQYLIGKGAKVILSSHLG  141



>sp|P12782.1|PGKH_WHEAT RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor [Triticum aestivum]
 emb|CAA33303.1| unnamed protein product [Triticum aestivum]
 emb|CAA51931.1| phosphoglycerate kinase [Triticum aestivum]
Length=480

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 85/104 (82%), Gaps = 2/104 (2%)
 Frame = +1

Query  202  PLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFV  381
            P RSL FAA A DP  + HVA++ R+  A+    R V +MAKKSVGDLTAADL+GK+V V
Sbjct  36   PARSLAFAAGA-DPRLAVHVASRCRAASAARG-TRAVATMAKKSVGDLTAADLEGKRVLV  93

Query  382  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            RADLNVPLDD Q ITDDTRIRAAIPTIK+L+SNGAKVIL+SHLG
Sbjct  94   RADLNVPLDDNQNITDDTRIRAAIPTIKYLLSNGAKVILTSHLG  137



>ref|XP_006858226.1| hypothetical protein AMTR_s00062p00189550 [Amborella trichopoda]
 gb|ERN19693.1| hypothetical protein AMTR_s00062p00189550 [Amborella trichopoda]
Length=481

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 84/116 (72%), Gaps = 17/116 (15%)
 Frame = +1

Query  196  RTPL--RSLGFAAAAADPFFSHHVATQLRSLKASA--------KPVRGVVSMAKKSVGDL  345
            R PL  R LGF+   A       +A+Q R LKA          +  RGVVSM KKSVGDL
Sbjct  33   RMPLDARRLGFSGNGA------SIASQ-RLLKACEMVCGGRRGRGPRGVVSMVKKSVGDL  85

Query  346  TAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            TA+DLKGKKVFVRADLNVPLDD Q ITDDTRIRAA+PTIKHLI NGAKVILSSHLG
Sbjct  86   TASDLKGKKVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLIGNGAKVILSSHLG  141



>gb|EEC71648.1| hypothetical protein OsI_04088 [Oryza sativa Indica Group]
Length=449

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 82/104 (79%), Gaps = 2/104 (2%)
 Frame = +1

Query  208  RSLGFAAAAADPFFSHHVATQLRSLKASAKPV--RGVVSMAKKSVGDLTAADLKGKKVFV  381
            RSLGFAA   DP  + HV+++ R+  ASA     R V +MAKKSVGDL AADL+GK+V +
Sbjct  44   RSLGFAARGTDPRLAIHVSSRRRAASASAGSRLARAVATMAKKSVGDLAAADLEGKRVLL  103

Query  382  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            RADLNVPLD +Q ITDDTR+RAAIPTIKHLI NGAKVIL SHLG
Sbjct  104  RADLNVPLDASQNITDDTRVRAAIPTIKHLIGNGAKVILCSHLG  147



>gb|AFW78532.1| phosphoglycerate kinase [Zea mays]
Length=480

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 81/104 (78%), Gaps = 3/104 (3%)
 Frame = +1

Query  202  PLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFV  381
            P RSL FAA   D   + HVA++ R    S +  R + +MAKKSVG+LT ADL+GK+VFV
Sbjct  40   PARSLAFAAG--DARLAVHVASRCRQ-AFSGRGTRAMATMAKKSVGELTEADLEGKRVFV  96

Query  382  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            RADLNVPLD+ Q ITDDTRIRAAIPTI++++S GAKVILSSHLG
Sbjct  97   RADLNVPLDENQNITDDTRIRAAIPTIQYILSKGAKVILSSHLG  140



>gb|AFW78533.1| phosphoglycerate kinase [Zea mays]
Length=483

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 81/104 (78%), Gaps = 3/104 (3%)
 Frame = +1

Query  202  PLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFV  381
            P RSL FAA   D   + HVA++ R    S +  R + +MAKKSVG+LT ADL+GK+VFV
Sbjct  40   PARSLAFAAG--DARLAVHVASRCRQ-AFSGRGTRAMATMAKKSVGELTEADLEGKRVFV  96

Query  382  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            RADLNVPLD+ Q ITDDTRIRAAIPTI++++S GAKVILSSHLG
Sbjct  97   RADLNVPLDENQNITDDTRIRAAIPTIQYILSKGAKVILSSHLG  140



>ref|XP_004970258.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like isoform 
X1 [Setaria italica]
Length=485

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 79/106 (75%), Gaps = 2/106 (2%)
 Frame = +1

Query  202  PLRSLG-FAAA-AADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKV  375
            P RSLG F+    AD     HV  + RS  ++ +  R   +MAKKSVGDL AADL+GK+V
Sbjct  44   PARSLGSFSLGDGADRRLPIHVPPRCRSESSAGREARAAATMAKKSVGDLAAADLEGKRV  103

Query  376  FVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
             VRADLNVPLDD Q ITDDTR+RAAIPTIKHL++NGAKVIL SHLG
Sbjct  104  LVRADLNVPLDDRQNITDDTRVRAAIPTIKHLVTNGAKVILCSHLG  149



>emb|CBL95264.1| phosphoglycerate kinase 1 [Pinus pinaster]
Length=507

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 77/104 (74%), Gaps = 7/104 (7%)
 Frame = +1

Query  220  FAAAAADPFFSHH------VATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFV  381
            F   AA   F+        VA Q+     + +  RGVVSMAK+SVGDL  +DLKGKKVFV
Sbjct  65   FGLGAASNLFASENDLASAVAAQVGGAN-NGRGCRGVVSMAKRSVGDLKESDLKGKKVFV  123

Query  382  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            RADLNVPLD+ Q ITDDTRIRAA+PTIK+LISNGAKVIL+SHLG
Sbjct  124  RADLNVPLDENQNITDDTRIRAAVPTIKYLISNGAKVILTSHLG  167



>ref|XP_004970259.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like isoform 
X2 [Setaria italica]
Length=484

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 79/106 (75%), Gaps = 2/106 (2%)
 Frame = +1

Query  202  PLRSLG-FAAA-AADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKV  375
            P RSLG F+    AD     HV  + RS  ++ +  R   +MAKKSVGDL AADL+GK+V
Sbjct  44   PARSLGSFSLGDGADRRLPIHVPPRCRSESSAGREARAAATMAKKSVGDLAAADLEGKRV  103

Query  376  FVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
             VRADLNVPLDD Q ITDDTR+RAAIPTIKHL++NGAKVIL SHLG
Sbjct  104  LVRADLNVPLDDRQNITDDTRVRAAIPTIKHLVTNGAKVILCSHLG  149



>gb|AIZ74346.1| phosphoglycerate kinase 1 [Pinus massoniana]
Length=507

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 77/104 (74%), Gaps = 7/104 (7%)
 Frame = +1

Query  220  FAAAAADPFFSHH------VATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFV  381
            F   AA   F+        VA Q+     + +  RGVVSMAK+SVGDL  +DLKGKKVFV
Sbjct  65   FGLGAASNLFASENDLASAVAAQVGGAN-NGRGCRGVVSMAKRSVGDLKESDLKGKKVFV  123

Query  382  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            RADLNVPLD+ Q ITDDTRIRAA+PTIK+LISNGAKVIL+SHLG
Sbjct  124  RADLNVPLDENQNITDDTRIRAAVPTIKYLISNGAKVILTSHLG  167



>ref|NP_001172606.1| Os01g0800266 [Oryza sativa Japonica Group]
 dbj|BAH91336.1| Os01g0800266 [Oryza sativa Japonica Group]
Length=385

 Score =   125 bits (314),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 81/104 (78%), Gaps = 2/104 (2%)
 Frame = +1

Query  208  RSLGFAAAAADPFFSHHVATQLRSLKASAKPV--RGVVSMAKKSVGDLTAADLKGKKVFV  381
            RSLGFAA   DP  + HV+++ R+  ASA     R V +MAKKSVGDL AADL+GK+V +
Sbjct  33   RSLGFAARGTDPRLAIHVSSRRRAASASAGSRLARAVATMAKKSVGDLAAADLEGKRVLL  92

Query  382  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            RADLNVPLD +Q ITDDTR+ AAIPTIKHLI NGAKVIL SHLG
Sbjct  93   RADLNVPLDASQNITDDTRVIAAIPTIKHLIGNGAKVILCSHLG  136



>ref|NP_001147628.1| phosphoglycerate kinase [Zea mays]
 gb|ACG28158.1| phosphoglycerate kinase [Zea mays]
 gb|ACG28313.1| phosphoglycerate kinase [Zea mays]
Length=480

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 80/104 (77%), Gaps = 3/104 (3%)
 Frame = +1

Query  202  PLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFV  381
            P  SL FAA   D   + HVA++ R    S +  R + +MAKKSVG+LT ADL+GK+VFV
Sbjct  40   PAWSLAFAAG--DARLAVHVASRCRQ-AFSGRGTRAMATMAKKSVGELTEADLEGKRVFV  96

Query  382  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            RADLNVPLD+ Q ITDDTRIRAAIPTI++++S GAKVILSSHLG
Sbjct  97   RADLNVPLDENQNITDDTRIRAAIPTIQYILSKGAKVILSSHLG  140



>gb|EEE55536.1| hypothetical protein OsJ_03768 [Oryza sativa Japonica Group]
Length=429

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 81/104 (78%), Gaps = 2/104 (2%)
 Frame = +1

Query  208  RSLGFAAAAADPFFSHHVATQLRSLKASAKPV--RGVVSMAKKSVGDLTAADLKGKKVFV  381
            RSLGFAA   DP  + HV+++ R+  ASA     R V +MAKKSVGDL AADL+GK+V +
Sbjct  77   RSLGFAARGTDPRLAIHVSSRRRAASASAGSRLARAVATMAKKSVGDLAAADLEGKRVLL  136

Query  382  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            RADLNVPLD +Q ITDDTR+ AAIPTIKHLI NGAKVIL SHLG
Sbjct  137  RADLNVPLDASQNITDDTRVIAAIPTIKHLIGNGAKVILCSHLG  180



>gb|AGT16255.1| phosphoglycerate kinase [Saccharum hybrid cultivar R570]
Length=489

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 88/126 (70%), Gaps = 12/126 (10%)
 Frame = +1

Query  166  KRAVITRFLPRTPLRSLGF--AAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVG  339
            +RA +    P  P R LG    +A ADP  + HVA++ RS  ++ +  R   +MAKKSVG
Sbjct  31   RRAGLAAAFP--PERLLGSDSLSAGADPRLAIHVASRCRSASSAGRGTRAAATMAKKSVG  88

Query  340  DLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIK--------HLISNGAKVI  495
            DL AA+L+GK+V VRAD NVPLDD+Q ITDDTR+RAAIPTIK        HLI+NGA+VI
Sbjct  89   DLAAAELEGKRVLVRADRNVPLDDSQNITDDTRVRAAIPTIKHLINNGARHLINNGARVI  148

Query  496  LSSHLG  513
            L+SHLG
Sbjct  149  LTSHLG  154



>gb|ABR16231.1| unknown [Picea sitchensis]
Length=472

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +1

Query  304  RGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  483
            RGVVSMAKKSVGDL  +DLKGK+VFVRADLNVPLD+ Q ITDDTRIRAA+PTIK+LI NG
Sbjct  98   RGVVSMAKKSVGDLKESDLKGKRVFVRADLNVPLDENQNITDDTRIRAAVPTIKYLIGNG  157

Query  484  AKVILSSHLG  513
            AKVIL+SHLG
Sbjct  158  AKVILASHLG  167



>gb|ABK24564.1| unknown [Picea sitchensis]
Length=507

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +1

Query  292  AKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHL  471
             +  RGVVSMAKKSVGDL  +DLKGK+VFVRADLNVPLD+ Q ITDDTRIRAA+PTIK+L
Sbjct  94   GRGCRGVVSMAKKSVGDLKESDLKGKRVFVRADLNVPLDENQNITDDTRIRAAVPTIKYL  153

Query  472  ISNGAKVILSSHLG  513
            I NGAKVIL+SHLG
Sbjct  154  IGNGAKVILASHLG  167



>emb|CBI24182.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            MAKKSVGDLT ADLKGKKVFVR DLNVPLDD QKITDDTR+RAAIPTIK+LI NGAKVIL
Sbjct  1    MAKKSVGDLTGADLKGKKVFVRVDLNVPLDDNQKITDDTRVRAAIPTIKYLIDNGAKVIL  60

Query  499  SSHLG  513
            SSHLG
Sbjct  61   SSHLG  65



>ref|XP_002971814.1| hypothetical protein SELMODRAFT_267533 [Selaginella moellendorffii]
 gb|EFJ26731.1| hypothetical protein SELMODRAFT_267533 [Selaginella moellendorffii]
Length=472

 Score =   123 bits (308),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +1

Query  304  RGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  483
            RGVV MAKKSVGDL  ADLKGK+VFVRADLNVPLD   KITDDTRIRAA+PTIK+LISNG
Sbjct  56   RGVVCMAKKSVGDLKEADLKGKRVFVRADLNVPLDGDLKITDDTRIRAAVPTIKYLISNG  115

Query  484  AKVILSSHLG  513
            AKVILSSHLG
Sbjct  116  AKVILSSHLG  125



>emb|CDP13574.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            MAKKSVGDL AADLKGK VFVRAD NVPLDD Q ITDDTRIRAAIPTIKHLISNGAKV+L
Sbjct  1    MAKKSVGDLAAADLKGKNVFVRADFNVPLDDNQNITDDTRIRAAIPTIKHLISNGAKVVL  60

Query  499  SSHLG  513
            SSHLG
Sbjct  61   SSHLG  65



>gb|EAY98560.1| hypothetical protein OsI_20474 [Oryza sativa Indica Group]
Length=284

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            MAKKSVGDLTAADL+GK+VFVRADLNVPLDD Q ITDDTR+RAAIPTI++LI NGAKVIL
Sbjct  1    MAKKSVGDLTAADLEGKRVFVRADLNVPLDDNQNITDDTRVRAAIPTIQYLIKNGAKVIL  60

Query  499  SSHLG  513
            SSHLG
Sbjct  61   SSHLG  65



>ref|XP_006654593.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Oryza 
brachyantha]
Length=405

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            MAKKSVGDLTAADL+GK+VFVRADLNVPLD+ Q ITDDTR+RAAIPTI++LI NGAKVIL
Sbjct  1    MAKKSVGDLTAADLEGKRVFVRADLNVPLDENQNITDDTRVRAAIPTIQYLIKNGAKVIL  60

Query  499  SSHLG  513
            SSHLG
Sbjct  61   SSHLG  65



>gb|EMS54865.1| Phosphoglycerate kinase, chloroplastic [Triticum urartu]
Length=460

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            MAKKSVGDLTAADL+GK+V VRADLNVPLDD Q ITDDTRIRAAIPTIK+L+SNGAKVIL
Sbjct  1    MAKKSVGDLTAADLEGKRVLVRADLNVPLDDNQNITDDTRIRAAIPTIKYLLSNGAKVIL  60

Query  499  SSHLG  513
            +SHLG
Sbjct  61   TSHLG  65



>ref|NP_001117503.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AEE33357.1| phosphoglycerate kinase [Arabidopsis thaliana]
Length=405

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            MAKKSVGDL + DLKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIK LI NGAKVIL
Sbjct  1    MAKKSVGDLNSVDLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKFLIENGAKVIL  60

Query  499  SSHLG  513
            S+HLG
Sbjct  61   STHLG  65



>ref|XP_002972334.1| hypothetical protein SELMODRAFT_231942 [Selaginella moellendorffii]
 gb|EFJ26420.1| hypothetical protein SELMODRAFT_231942 [Selaginella moellendorffii]
Length=412

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            MAKKSVGDL  ADLKGK+VFVRADLNVPLD   KITDDTRIRAA+PTIK+LISNGAKVIL
Sbjct  1    MAKKSVGDLKEADLKGKRVFVRADLNVPLDGDLKITDDTRIRAAVPTIKYLISNGAKVIL  60

Query  499  SSHLG  513
            SSHLG
Sbjct  61   SSHLG  65



>gb|ACN32155.1| unknown [Zea mays]
Length=411

 Score =   114 bits (285),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +1

Query  316  SMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVI  495
            +MAKKSVG+LT ADL+GK+VFVRADLNVPLD+ Q ITDDTRIRAAIPTI++++S GAKVI
Sbjct  3    TMAKKSVGELTEADLEGKRVFVRADLNVPLDENQNITDDTRIRAAIPTIQYILSKGAKVI  62

Query  496  LSSHLG  513
            LSSHLG
Sbjct  63   LSSHLG  68



>ref|XP_006858233.1| hypothetical protein AMTR_s00062p00191350 [Amborella trichopoda]
 gb|ERN19700.1| hypothetical protein AMTR_s00062p00191350 [Amborella trichopoda]
Length=401

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSVGDL+ +DLKGK+VFVR DLNVPLDD QKITDDTRIRAA+PTIK+L+ NGAKVIL+S
Sbjct  4    KKSVGDLSPSDLKGKRVFVRVDLNVPLDDNQKITDDTRIRAAVPTIKYLMENGAKVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>gb|AAB60303.1| phosphoglycerate kinase, partial [Arabidopsis thaliana]
Length=399

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +1

Query  337  GDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            GDLT+ADLKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLG
Sbjct  1    GDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILSTHLG  59



>gb|ADV16380.1| cytosolic phosphoglycerate kinase 2 [Helianthus annuus]
Length=400

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSV  L  ADLKGK+VFVRADLNVPLDDT KITDDTRIRAA+PTIK+L+SNGA+VILSS
Sbjct  4    KKSVSSLKEADLKGKRVFVRADLNVPLDDTFKITDDTRIRAAVPTIKYLMSNGARVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>gb|AFW70285.1| hypothetical protein ZEAMMB73_319281 [Zea mays]
Length=186

 Score =   106 bits (264),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGKKVFVRADLNVPLDD QKITDDTRIRA++PTIK L+  GAKVIL+S
Sbjct  4    KRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASVPTIKFLLEKGAKVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>gb|AIZ68220.1| phosphoglycerate kinase [Ornithogalum saundersiae]
Length=401

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSVG L AADLKGKKVFVR DLNVPLDD QKITDDTRIRAA+PTIK+L+ +GA++IL+S
Sbjct  4    KKSVGSLKAADLKGKKVFVRVDLNVPLDDNQKITDDTRIRAAVPTIKYLMEHGARIILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>sp|P12783.1|PGKY_WHEAT RecName: Full=Phosphoglycerate kinase, cytosolic [Triticum aestivum]
 emb|CAA33302.1| unnamed protein product [Triticum aestivum]
Length=401

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGKKVFVRADLNVPLDD QKITDDTRIRA+IPTIK+L+  GAKVIL+S
Sbjct  4    KRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASIPTIKYLLEKGAKVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>gb|ABH10990.1| phosphoglycerate kinase [Polytomella parva]
Length=259

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 1/69 (1%)
 Frame = +1

Query  310  VVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDD-TQKITDDTRIRAAIPTIKHLISNGA  486
            V + AKKSVGDL+ ADLKGKKVFVRADLNVPLD  T K+TDDTRIRAA PT+K+L+ NGA
Sbjct  33   VKTEAKKSVGDLSIADLKGKKVFVRADLNVPLDKKTNKVTDDTRIRAAAPTLKYLLKNGA  92

Query  487  KVILSSHLG  513
            KVIL+SHLG
Sbjct  93   KVILTSHLG  101



>gb|AAW79325.1| phosphoglycerate kinase [Isochrysis galbana]
Length=436

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 66/85 (78%), Gaps = 6/85 (7%)
 Frame = +1

Query  274  RSLKASAKPVRGV-----VSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTR  438
             +L+  A P+R       + MAKKSVGDLT ADL+GK+V VR DLNVPLD  + ITDDTR
Sbjct  17   EALRIGAAPMRSTSRTCTIEMAKKSVGDLTKADLEGKRVLVRCDLNVPLD-GKTITDDTR  75

Query  439  IRAAIPTIKHLISNGAKVILSSHLG  513
            IRA+IPTIK+LI NGAKV+LSSHLG
Sbjct  76   IRASIPTIKYLIDNGAKVLLSSHLG  100



>gb|EMS46092.1| Phosphoglycerate kinase, cytosolic [Triticum urartu]
Length=429

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGKKVFVRADLNVPLDD QKITDDTRIRA+IPTIK+L+  GAKVIL+S
Sbjct  4    KRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASIPTIKYLLEKGAKVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>gb|AIN39803.1| hypothetical protein, partial [Zoysia matrella]
Length=290

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGKKVFVRADLNVPLDD QKITDDTRIRA++PTIK L+  GAKV+L+S
Sbjct  4    KRSVGSLGEADLKGKKVFVRADLNVPLDDNQKITDDTRIRASVPTIKFLLEKGAKVVLAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>gb|EMT29203.1| Phosphoglycerate kinase, cytosolic [Aegilops tauschii]
Length=494

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGKKVFVRADLNVPLDD QKITDDTRIRA+IPTIK+L+  GAKVIL+S
Sbjct  4    KRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASIPTIKYLLEKGAKVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_005646469.1| phosphoglycerate kinase precursor [Coccomyxa subellipsoidea C-169]
 gb|EIE21925.1| phosphoglycerate kinase precursor [Coccomyxa subellipsoidea C-169]
Length=442

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = +1

Query  250  SHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITD  429
            S H     R    S +  R VV MAKKSVGDLT +DL+GK V VRADLNVPL+   +ITD
Sbjct  18   SLHAFVAARVNGVSGRRSRLVVQMAKKSVGDLTKSDLEGKTVLVRADLNVPLNKDLEITD  77

Query  430  DTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DTRIRAAIPT+K+L  NGAKV+L+SHLG
Sbjct  78   DTRIRAAIPTLKYLTDNGAKVLLTSHLG  105



>gb|ACJ11718.1| phosphoglycerate kinase [Gossypium hirsutum]
 gb|KHG14087.1| Phosphoglycerate kinase, cytosolic [Gossypium arboreum]
Length=401

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSVGDL  ADLKGKKVFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +G+KVILSS
Sbjct  4    KKSVGDLKEADLKGKKVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHGSKVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>gb|KJB14019.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14021.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14022.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14023.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14024.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
Length=401

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSVGDL  ADLKGKKVFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +G+KVILSS
Sbjct  4    KKSVGDLKEADLKGKKVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHGSKVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|NP_001058317.1| Os06g0668200 [Oryza sativa Japonica Group]
 dbj|BAD45436.1| putative cytosolic phosphoglycerate kinase 1 [Oryza sativa Japonica 
Group]
 dbj|BAD45421.1| putative cytosolic phosphoglycerate kinase 1 [Oryza sativa Japonica 
Group]
 dbj|BAF20231.1| Os06g0668200 [Oryza sativa Japonica Group]
 gb|EAZ02017.1| hypothetical protein OsI_24050 [Oryza sativa Indica Group]
 gb|EAZ37949.1| hypothetical protein OsJ_22300 [Oryza sativa Japonica Group]
 dbj|BAG95158.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92099.1| unnamed protein product [Oryza sativa Japonica Group]
Length=401

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  322  AKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILS  501
            +K+SVG LT +DLKGKKVF+RADLNVPLDD+QKITDDTRIRA++PTIK L+  GAKVIL+
Sbjct  3    SKRSVGTLTESDLKGKKVFLRADLNVPLDDSQKITDDTRIRASVPTIKFLMGKGAKVILA  62

Query  502  SHLG  513
            SHLG
Sbjct  63   SHLG  66



>ref|NP_001142404.1| uncharacterized protein LOC100274579 [Zea mays]
 ref|XP_008681565.1| PREDICTED: uncharacterized protein LOC100274579 isoform X1 [Zea 
mays]
 ref|XP_008681566.1| PREDICTED: uncharacterized protein LOC100274579 isoform X1 [Zea 
mays]
 gb|ACF87897.1| unknown [Zea mays]
 gb|ACF88413.1| unknown [Zea mays]
 gb|ACG36709.1| phosphoglycerate kinase, cytosolic [Zea mays]
 gb|AFW70282.1| phosphoglycerate kinase isoform 1 [Zea mays]
 gb|AFW70283.1| phosphoglycerate kinase isoform 2 [Zea mays]
 gb|AFW70284.1| phosphoglycerate kinase isoform 3 [Zea mays]
Length=402

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGKKVFVRADLNVPLDD QKITDDTRIRA++PTIK L+  GAKVIL+S
Sbjct  4    KRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASVPTIKFLLEKGAKVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>gb|KIY97385.1| phosphoglycerate kinase [Monoraphidium neglectum]
Length=229

 Score =   104 bits (259),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +1

Query  295  KPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLD-DTQKITDDTRIRAAIPTIKHL  471
            +P + VV  AKKSVGDLT  DL+GK+VFVRADLNVPLD  T  ITDDTRIRAA+PT+K+L
Sbjct  26   RPRKLVVLSAKKSVGDLTKDDLEGKRVFVRADLNVPLDKQTLAITDDTRIRAAVPTLKYL  85

Query  472  ISNGAKVILSSHLG  513
            + NGAKV+L+SHLG
Sbjct  86   LDNGAKVLLTSHLG  99



>ref|XP_003570108.1| PREDICTED: phosphoglycerate kinase, cytosolic [Brachypodium distachyon]
Length=401

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGKKVFVRADLNVPLDD QKITDDTRIRA++PTIK L+  GAKVIL+S
Sbjct  4    KRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASVPTIKFLLEKGAKVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_005757596.1| phosphoglycerate kinase [Emiliania huxleyi CCMP1516]
 gb|EOD05167.1| phosphoglycerate kinase [Emiliania huxleyi CCMP1516]
Length=192

 Score =   103 bits (257),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 65/85 (76%), Gaps = 6/85 (7%)
 Frame = +1

Query  274  RSLKASAKPVRGV-----VSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTR  438
             +L   A P+R +     + MAKKSVGDL+ ADLKGKKV VR DLNVPLD  + ITDDTR
Sbjct  17   EALTIGAAPMRSISRSCNIEMAKKSVGDLSEADLKGKKVLVRCDLNVPLDG-KTITDDTR  75

Query  439  IRAAIPTIKHLISNGAKVILSSHLG  513
            IRA++PT+K+L+  GAKV+LSSHLG
Sbjct  76   IRASVPTVKYLVEKGAKVLLSSHLG  100



>ref|XP_011086347.1| PREDICTED: phosphoglycerate kinase, cytosolic [Sesamum indicum]
Length=401

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSVG L  ADLKGK+VFVR DLNVPLDDT  ITDDTRIRAA+PTIK+LI +GAKVILSS
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDTFHITDDTRIRAAVPTIKYLIDHGAKVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>emb|CBY84995.1| phosphoglycerate kinase, partial [Polytomella sp. Pringsheim 
198.80]
Length=422

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 1/69 (1%)
 Frame = +1

Query  310  VVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDD-TQKITDDTRIRAAIPTIKHLISNGA  486
            V + AKKSVGDL+ ADLKGKKVFVRADLNVPLD  T K+TDDTRIRAA PT+K+L+ NGA
Sbjct  37   VKTEAKKSVGDLSIADLKGKKVFVRADLNVPLDKKTNKVTDDTRIRAAAPTLKYLLKNGA  96

Query  487  KVILSSHLG  513
            KVIL+SHLG
Sbjct  97   KVILTSHLG  105



>ref|XP_010324204.1| PREDICTED: phosphoglycerate kinase, cytosolic [Solanum lycopersicum]
 ref|XP_010324205.1| PREDICTED: phosphoglycerate kinase, cytosolic [Solanum lycopersicum]
Length=401

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSVG L  ADLKGK+VFVR DLNVPLDD  KITDDTRIRAA+PTIK+L+ NGA+VIL+S
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDNFKITDDTRIRAAVPTIKYLMQNGARVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>gb|ABI18157.1| cytosolic phosphoglycerate kinase [Helianthus annuus]
Length=401

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSV  LT  DLKGK+VFVR DLNVPLDDT KITDDTRIRAA+PTIK+L+S+GA+VILSS
Sbjct  4    KKSVSSLTEGDLKGKRVFVRVDLNVPLDDTFKITDDTRIRAAVPTIKYLMSHGARVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>gb|EWM26407.1| phosphoglycerate kinase [Nannochloropsis gaditana]
Length=486

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 70/96 (73%), Gaps = 7/96 (7%)
 Frame = +1

Query  244  FFSHHVATQLRSLKASAKPV------RGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPL  405
            FF    A  +    A A+PV      RGV++MAKKSVG L  ADLKGK+VFVR DLNVPL
Sbjct  57   FFKAPSAGAMTGSAAVAEPVCPSTSRRGVMTMAKKSVGSLADADLKGKRVFVRCDLNVPL  116

Query  406  DDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            D  + ITDDTRIRA++PTI++L S GAKV+L+SHLG
Sbjct  117  DG-KTITDDTRIRASVPTIEYLASKGAKVLLTSHLG  151



>ref|XP_005791258.1| phosphoglycerate kinase, partial [Emiliania huxleyi CCMP1516]
 gb|EOD38829.1| phosphoglycerate kinase, partial [Emiliania huxleyi CCMP1516]
Length=269

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 65/85 (76%), Gaps = 6/85 (7%)
 Frame = +1

Query  274  RSLKASAKPVRGV-----VSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTR  438
             +L   A P+R +     + MAKKSVGDL+ ADLKGKKV VR DLNVPLD  + ITDDTR
Sbjct  17   EALTIGAAPMRSISRSCNIEMAKKSVGDLSEADLKGKKVLVRCDLNVPLD-GKTITDDTR  75

Query  439  IRAAIPTIKHLISNGAKVILSSHLG  513
            IRA++PT+K+L+  GAKV+LSSHLG
Sbjct  76   IRASVPTVKYLVEKGAKVLLSSHLG  100



>gb|EYU33791.1| hypothetical protein MIMGU_mgv1a006853mg [Erythranthe guttata]
Length=429

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+LI N AKVILSS
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLIGNAAKVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>emb|CDP16886.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+LI +GAKVILSS
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLIGHGAKVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|NP_001046020.1| Os02g0169300 [Oryza sativa Japonica Group]
 dbj|BAD25722.1| putative phosphoglycerate kinase, cytosolic [Oryza sativa Japonica 
Group]
 dbj|BAF07934.1| Os02g0169300 [Oryza sativa Japonica Group]
 gb|ABL74575.1| phosphoglycerate kinase [Oryza sativa Japonica Group]
 gb|EEC72574.1| hypothetical protein OsI_06015 [Oryza sativa Indica Group]
 gb|EEE56393.1| hypothetical protein OsJ_05543 [Oryza sativa Japonica Group]
Length=402

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADL+GKKVFVRADLNVPLDD QKITDDTRIRA++PT+K L+  GAKVIL+S
Sbjct  4    KRSVGTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>gb|ABI74567.1| phosphoglycerate kinase [Oryza sativa Indica Group]
Length=402

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADL+GKKVFVRADLNVPLDD QKITDDTRIRA++PT+K L+  GAKVIL+S
Sbjct  4    KRSVGTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_005851391.1| hypothetical protein CHLNCDRAFT_48457 [Chlorella variabilis]
 gb|EFN59289.1| hypothetical protein CHLNCDRAFT_48457 [Chlorella variabilis]
Length=399

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 59/65 (91%), Gaps = 1/65 (2%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            MAKKSVGDL+ ADL+GK VFVRADLNVPLD   KITDDTRIRAA+PT+K+L+ NGAKV+L
Sbjct  1    MAKKSVGDLSKADLEGKVVFVRADLNVPLD-GDKITDDTRIRAAVPTLKYLVDNGAKVLL  59

Query  499  SSHLG  513
            +SHLG
Sbjct  60   TSHLG  64



>ref|XP_004966316.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Setaria italica]
Length=401

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L+ ADLKGKKVF+RADLNVPLDD QKITDD RIRA++PTIK L+  GAKVIL+S
Sbjct  4    KRSVGTLSEADLKGKKVFLRADLNVPLDDNQKITDDNRIRASVPTIKFLMEKGAKVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_004951776.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Setaria italica]
Length=402

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADL+GKKVFVRADLNVPLDD QKITDDTRIRA++PT+K L+  GAKVIL+S
Sbjct  4    KRSVGTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_008798227.1| PREDICTED: phosphoglycerate kinase, cytosolic [Phoenix dactylifera]
Length=401

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SV  LT ADLKGKKVFVR DLNVPLDD  KITDDTR+RAA+PTIK+L+ +GAKVILSS
Sbjct  4    KRSVSTLTGADLKGKKVFVRVDLNVPLDDNLKITDDTRVRAAVPTIKYLMQHGAKVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_009417722.1| PREDICTED: phosphoglycerate kinase, cytosolic [Musa acuminata 
subsp. malaccensis]
 ref|XP_009417729.1| PREDICTED: phosphoglycerate kinase, cytosolic [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVGDL   DLKGK+VFVR DLNVPLDD+QKITDDTR+RAA+PTIK L+ +GA+VIL S
Sbjct  4    KRSVGDLKEDDLKGKRVFVRVDLNVPLDDSQKITDDTRVRAAVPTIKSLMEHGARVILCS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_002263950.1| PREDICTED: phosphoglycerate kinase, cytosolic [Vitis vinifera]
 emb|CAN81988.1| hypothetical protein VITISV_000723 [Vitis vinifera]
Length=401

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVGDL  ADLKGK+VFVR DLNVPLD++ KITDDTR+RAA+PTIK+L+ +GAKVIL+S
Sbjct  4    KRSVGDLKEADLKGKRVFVRVDLNVPLDESLKITDDTRVRAAVPTIKYLMGHGAKVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_006646936.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Oryza brachyantha]
Length=402

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADL+GKKVFVRADLNVPLDD QKITDDTRIRA++PT+K L+  GAKV+L+S
Sbjct  4    KRSVGTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVVLAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_009399252.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSVG LT ADLKGKKVFVR DLNVPLD+T K+TDDTRIRA++PTIK+L+  GA++IL+S
Sbjct  4    KKSVGALTEADLKGKKVFVRVDLNVPLDETLKVTDDTRIRASVPTIKYLMERGARIILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>gb|ABB86242.1| phosphoglycerate kinase-like [Solanum tuberosum]
Length=402

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NGA+VIL+S
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMQNGARVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>gb|AFW70281.1| phosphoglycerate kinase [Zea mays]
Length=572

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGKKVFVRADLNVPLDD QKITDDTRIRA++PTIK L+  GAKVIL+S
Sbjct  174  KRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASVPTIKFLLEKGAKVILAS  233

Query  505  HLG  513
            HLG
Sbjct  234  HLG  236



>ref|NP_001275451.1| phosphoglycerate kinase, cytosolic-like [Solanum tuberosum]
 gb|ABB87110.1| unknown [Solanum tuberosum]
Length=401

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NGA+VIL+S
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDIFNITDDTRIRAAVPTIKYLMQNGARVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_006656354.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Oryza brachyantha]
Length=401

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SV  L  +DLKGKKVFVRADLNVPLDD QKITDDTRIRA++PTIK+L+  GAKVIL+S
Sbjct  4    KRSVSTLAESDLKGKKVFVRADLNVPLDDGQKITDDTRIRASVPTIKYLMEKGAKVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_001699523.1| phosphoglycerate kinase [Chlamydomonas reinhardtii]
 gb|EDO98586.1| phosphoglycerate kinase [Chlamydomonas reinhardtii]
Length=462

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 68/90 (76%), Gaps = 5/90 (6%)
 Frame = +1

Query  247  FSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDD-TQKI  423
            F+  V+  +R +  S    R VV   KKSVGDL  ADL+GK+VFVRADLNVPLD  T  I
Sbjct  41   FAAEVSVDIRRVGRS----RIVVEAVKKSVGDLHKADLEGKRVFVRADLNVPLDKATLAI  96

Query  424  TDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            TDDTRIRAA+PT+K+L+ NGAKV+L+SHLG
Sbjct  97   TDDTRIRAAVPTLKYLLDNGAKVLLTSHLG  126



>ref|XP_011396717.1| Phosphoglycerate kinase, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM23839.1| Phosphoglycerate kinase, chloroplastic [Auxenochlorella protothecoides]
Length=454

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +1

Query  313  VSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKV  492
            V  AKKSV DL+ +DL+GK VFVRADLNVPLD TQ ITDDTRIRAA+PT+++LI NGA++
Sbjct  54   VEAAKKSVSDLSKSDLEGKVVFVRADLNVPLDGTQNITDDTRIRAAVPTLEYLIKNGARI  113

Query  493  ILSSHLG  513
            +L+SHLG
Sbjct  114  LLASHLG  120



>ref|XP_010275944.1| PREDICTED: phosphoglycerate kinase, cytosolic [Nelumbo nucifera]
Length=402

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVGDL  ADLKGKKVFVR DLNVPLD+  KITDDTR+RAA+PTIK+L+ + AKVILSS
Sbjct  4    KRSVGDLKEADLKGKKVFVRVDLNVPLDENLKITDDTRVRAAVPTIKYLMGHKAKVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_004139837.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Cucumis sativus]
 ref|XP_004159164.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Cucumis sativus]
 gb|KGN44288.1| hypothetical protein Csa_7G239010 [Cucumis sativus]
Length=401

 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTI++L+S+GA+VILSS
Sbjct  4    KKSVGTLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIQYLLSHGARVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_010941661.1| PREDICTED: phosphoglycerate kinase, cytosolic isoform X2 [Elaeis 
guineensis]
Length=401

 Score =   103 bits (256),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SV  LT ADLKGKKVFVR DLNVPLDD  KITDDTR+RAA+PTIK+L+ +GAKVIL S
Sbjct  4    KRSVSTLTGADLKGKKVFVRVDLNVPLDDNLKITDDTRVRAAVPTIKYLMEHGAKVILCS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_010941660.1| PREDICTED: phosphoglycerate kinase, cytosolic isoform X1 [Elaeis 
guineensis]
Length=409

 Score =   102 bits (255),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SV  LT ADLKGKKVFVR DLNVPLDD  KITDDTR+RAA+PTIK+L+ +GAKVIL S
Sbjct  12   KRSVSTLTGADLKGKKVFVRVDLNVPLDDNLKITDDTRVRAAVPTIKYLMEHGAKVILCS  71

Query  505  HLG  513
            HLG
Sbjct  72   HLG  74



>gb|ABF69999.1| phosphoglycerate kinase, putative [Musa acuminata]
Length=401

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSVG LT ADLKGKKVFVR DLNVPLD+  K+TDDTRIRA++PTIK+L+  GA++IL+S
Sbjct  4    KKSVGALTEADLKGKKVFVRVDLNVPLDENLKVTDDTRIRASVPTIKYLMERGARIILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_009414502.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVGDL   DLKGK+VFVR DLNVPLDD  KITDDTR+RAA+PTIK+L+ +GA+VIL S
Sbjct  4    KRSVGDLKGDDLKGKRVFVRVDLNVPLDDNLKITDDTRVRAAVPTIKYLLEHGARVILCS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_010544342.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Tarenaya 
hassleriana]
Length=401

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGK+VFVR DLNVPLD++  ITDDTRIRAA+PTI +LI NGA+VILSS
Sbjct  4    KRSVGTLKEADLKGKRVFVRVDLNVPLDESFNITDDTRIRAAVPTINYLIQNGARVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_002951648.1| phosphoglycerate kinase [Volvox carteri f. nagariensis]
 sp|Q9SBN4.1|PGKH_VOLCA RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor [Volvox carteri]
 gb|AAD55564.1|AF110782_1 phosphoglycerate kinase precursor [Volvox carteri f. nagariensis]
 gb|EFJ47459.1| phosphoglycerate kinase [Volvox carteri f. nagariensis]
Length=462

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = +1

Query  304  RGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDD-TQKITDDTRIRAAIPTIKHLISN  480
            R VV   KKSVGDL  ADL+GK+VFVRADLNVPLD  T  ITDDTRIRAA+PT+K+L+ N
Sbjct  56   RIVVEAVKKSVGDLGKADLEGKRVFVRADLNVPLDKKTLAITDDTRIRAAVPTLKYLLDN  115

Query  481  GAKVILSSHLG  513
            GAKV+L+SHLG
Sbjct  116  GAKVLLTSHLG  126



>ref|XP_010557291.1| PREDICTED: phosphoglycerate kinase, cytosolic [Tarenaya hassleriana]
Length=432

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 67/92 (73%), Gaps = 1/92 (1%)
 Frame = +1

Query  241  PFFSHHVATQLRSLKASAKPVRGVVSMA-KKSVGDLTAADLKGKKVFVRADLNVPLDDTQ  417
            P   + + +Q+  L  S+     + +MA K+SVG L  ADLKGK+VFVR DLNVPLDD  
Sbjct  6    PIPRNSIRSQISHLPLSSDLPFALAAMATKRSVGTLKEADLKGKRVFVRVDLNVPLDDNF  65

Query  418  KITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
             ITDDTRIRAA+PTI +L+ NGA+VILSSHLG
Sbjct  66   NITDDTRIRAAVPTISYLMQNGARVILSSHLG  97



>ref|XP_007022579.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 ref|XP_007022580.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 ref|XP_007022581.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 gb|EOY14104.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 gb|EOY14105.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 gb|EOY14106.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
Length=401

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +G+KVILSS
Sbjct  4    KKSVGALKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHGSKVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>gb|ABI74568.1| phosphoglycerate kinase [Oryza sativa Indica Group]
Length=402

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SV  L  ADL+GKKVFVRADLNVPLDD QKITDDTRIRA++PT+K L+  GAKVIL+S
Sbjct  4    KRSVWTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_008447095.1| PREDICTED: phosphoglycerate kinase, cytosolic [Cucumis melo]
Length=401

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTI++L+S+GA+VILSS
Sbjct  4    KRSVGTLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIQYLLSHGARVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>sp|P41758.1|PGKH_CHLRE RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor [Chlamydomonas reinhardtii]
 gb|AAA70082.1| phosphoglycerate kinase precursor [Chlamydomonas reinhardtii]
 gb|AAQ14241.1| phosphoglycerate kinase [Chlamydomonas reinhardtii]
Length=461

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 65/84 (77%), Gaps = 3/84 (4%)
 Frame = +1

Query  271  LRSLKASAK--PVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDD-TQKITDDTRI  441
            LR L  SA    +  VV   KKSVGDL  ADL+GK+VFVRADLNVPLD  T  ITDDTRI
Sbjct  42   LRCLWTSAAWAALASVVEAVKKSVGDLHKADLEGKRVFVRADLNVPLDKATLAITDDTRI  101

Query  442  RAAIPTIKHLISNGAKVILSSHLG  513
            RAA+PT+K+L+ NGAKV+L+SHLG
Sbjct  102  RAAVPTLKYLLDNGAKVLLTSHLG  125



>gb|ACU18322.1| unknown [Glycine max]
Length=233

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L   DLKGK+VFVR DLNVPLDD   ITDDTR+RAA+PTIK+L  +GAKVILSS
Sbjct  4    KRSVGTLKEGDLKGKRVFVRVDLNVPLDDNLNITDDTRVRAAVPTIKYLTGHGAKVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>gb|AAF85975.1|AF275639_1 cytosolic phosphoglycerate kinase [Pisum sativum]
Length=401

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAAIPTIK+L   GAKVILSS
Sbjct  4    KRSVGTLKEADLKGKRVFVRVDLNVPLDDNLNITDDTRIRAAIPTIKYLTGYGAKVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_011095716.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Sesamum indicum]
 ref|XP_011095717.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Sesamum indicum]
 ref|XP_011095718.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Sesamum indicum]
Length=401

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSVG L  ADLKGK+V VR DLNVPLDD  KITDDTRIRAA+PTIK+L+ +GAKVIL++
Sbjct  4    KKSVGSLKEADLKGKRVLVRVDLNVPLDDNLKITDDTRIRAAVPTIKYLMEHGAKVILTT  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>gb|KCW71392.1| hypothetical protein EUGRSUZ_F04463 [Eucalyptus grandis]
Length=304

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTR+RAA+PTIK+L+S+GA VIL+S
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDSFHITDDTRVRAAVPTIKYLMSHGAIVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_002312237.1| hypothetical protein POPTR_0008s08400g [Populus trichocarpa]
 gb|EEE89604.1| hypothetical protein POPTR_0008s08400g [Populus trichocarpa]
Length=401

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSV  L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+S+GA+VILSS
Sbjct  4    KKSVSSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMSHGARVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>gb|ABK92531.1| unknown [Populus trichocarpa]
Length=401

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSV  L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+S+GA+VILSS
Sbjct  4    KKSVSSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMSHGARVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>gb|ACJ84593.1| unknown [Medicago truncatula]
Length=226

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  A+LKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L   GAKVILSS
Sbjct  4    KRSVGTLKEAELKGKRVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLTGYGAKVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_009106677.1| PREDICTED: phosphoglycerate kinase, cytosolic [Brassica rapa]
 ref|XP_009106678.1| PREDICTED: phosphoglycerate kinase, cytosolic [Brassica rapa]
Length=401

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAAIPTIK+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAIPTIKYLMENGSRVVLCS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_010936568.1| PREDICTED: phosphoglycerate kinase, cytosolic [Elaeis guineensis]
Length=401

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SV  LT ADLKGK+VFVR DLNVPLDD  KITDDTRIRAA+PTI++L+  GA+VILSS
Sbjct  4    KRSVSTLTEADLKGKRVFVRVDLNVPLDDNLKITDDTRIRAAVPTIEYLMDRGARVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_002500825.1| phosphoglycerate kinase [Micromonas sp. RCC299]
 gb|ACO62083.1| phosphoglycerate kinase [Micromonas sp. RCC299]
Length=437

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +1

Query  313  VSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKV  492
            V   KKSVGDL  ADL+GK VFVR DLNVPLD   KITDDTRIRAAIPT+++L+ NGAKV
Sbjct  38   VEAKKKSVGDLKKADLEGKTVFVRCDLNVPLDKDLKITDDTRIRAAIPTLEYLVENGAKV  97

Query  493  ILSSHLG  513
            +++SHLG
Sbjct  98   LVTSHLG  104



>ref|XP_010417621.1| PREDICTED: phosphoglycerate kinase, cytosolic [Camelina sativa]
 ref|XP_010429848.1| PREDICTED: phosphoglycerate kinase, cytosolic [Camelina sativa]
 ref|XP_010429849.1| PREDICTED: phosphoglycerate kinase, cytosolic [Camelina sativa]
Length=401

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>gb|KIY97218.1| Phosphoglycerate kinase [Monoraphidium neglectum]
Length=596

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 1/70 (1%)
 Frame = +1

Query  304  RGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLD-DTQKITDDTRIRAAIPTIKHLISN  480
            R VV   KKSVGDLT ADL+GK+VFVRADLNVPLD  T  ITDDTRIRAA+PT+K+L+ N
Sbjct  473  RLVVKAVKKSVGDLTKADLEGKRVFVRADLNVPLDKQTLAITDDTRIRAAVPTLKYLLDN  532

Query  481  GAKVILSSHL  510
            GAKV+L+SHL
Sbjct  533  GAKVLLTSHL  542



>ref|XP_010472814.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Camelina 
sativa]
Length=401

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>emb|CDY49746.1| BnaA02g19260D [Brassica napus]
Length=388

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG++V+L S
Sbjct  40   KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCS  99

Query  505  HLG  513
            HLG
Sbjct  100  HLG  102



>ref|XP_002889253.1| hypothetical protein ARALYDRAFT_477124 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65512.1| hypothetical protein ARALYDRAFT_477124 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_006300323.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
 ref|XP_006300324.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
 gb|EOA33221.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
 gb|EOA33222.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
Length=401

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_010064085.1| PREDICTED: phosphoglycerate kinase, cytosolic [Eucalyptus grandis]
 gb|KCW71390.1| hypothetical protein EUGRSUZ_F04463 [Eucalyptus grandis]
Length=401

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTR+RAA+PTIK+L+S+GA VIL+S
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDSFHITDDTRVRAAVPTIKYLMSHGAIVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>gb|AAM61185.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
Length=401

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>emb|CDY70232.1| BnaC02g46710D [Brassica napus]
Length=401

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>gb|KCW71391.1| hypothetical protein EUGRSUZ_F04463 [Eucalyptus grandis]
Length=378

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTR+RAA+PTIK+L+S+GA VIL+S
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDSFHITDDTRVRAAVPTIKYLMSHGAIVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_009128369.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Brassica 
rapa]
Length=401

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|NP_178073.1| phosphoglycerate kinase [Arabidopsis thaliana]
 ref|NP_849907.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAD30221.1|AC007202_3 Is a member of the PF|00162 Phosphoglycerate kinase family. ESTs 
gb|N38721, gb|T22178, gb|R90345, gb|R90715, gb|T21140, gb|T46295, 
gb|H37082, gb|T46076, gb|N37132, gb|AA597649, gb|AI100648 
and gb|Z48462 come from this gene [Arabidopsis thaliana]
 gb|AAF70260.1|AF247560_1 cytosolic phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAK15553.1|AF348582_1 putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAL32941.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP37845.1| At1g79550 [Arabidopsis thaliana]
 gb|AEE36262.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AEE36263.1| phosphoglycerate kinase [Arabidopsis thaliana]
Length=401

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>emb|CDX88547.1| BnaC06g39910D [Brassica napus]
Length=352

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_011468861.1| PREDICTED: phosphoglycerate kinase, cytosolic [Fragaria vesca 
subsp. vesca]
Length=401

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SV  L  ADLKGK+VFVR DLNVPLD++ KITDDTRIRAA+PTIK+L  NGAKVIL+S
Sbjct  4    KRSVSTLKEADLKGKRVFVRVDLNVPLDESCKITDDTRIRAAVPTIKYLQGNGAKVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_006389877.1| hypothetical protein EUTSA_v10018657mg [Eutrema salsugineum]
 gb|ESQ27163.1| hypothetical protein EUTSA_v10018657mg [Eutrema salsugineum]
Length=401

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>emb|CDX87375.1| BnaA07g34980D [Brassica napus]
Length=401

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_003531483.1| PREDICTED: phosphoglycerate kinase, cytosolic [Glycine max]
 gb|KHN21385.1| Phosphoglycerate kinase, cytosolic [Glycine soja]
Length=401

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L   DLKGK+VFVR DLNVPLDD   ITDDTR+RAA+PTIK+L  +GAKVILSS
Sbjct  4    KRSVGTLKEGDLKGKRVFVRVDLNVPLDDNLNITDDTRVRAAVPTIKYLTGHGAKVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>emb|CDX67989.1| BnaA07g20290D [Brassica napus]
Length=348

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PT+K+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTVKYLMENGSRVVLCS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>gb|AAO63774.1| 3-phosphoglycerate kinase [Populus tremuloides]
Length=401

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSV  L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +GA+VILSS
Sbjct  4    KKSVSSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHGARVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_009104523.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Brassica 
rapa]
Length=401

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PT+K+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTVKYLMENGSRVVLCS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|WP_016924803.1| phosphoglycerate kinase [Prochlorothrix hollandica]
Length=401

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            MAKKSV  LTA D+ GK+V VRAD NVPLDD  +ITDDTRIRAA+PTI+ L+S GAKVIL
Sbjct  1    MAKKSVAQLTAQDVAGKRVLVRADFNVPLDDAGQITDDTRIRAALPTIQDLVSKGAKVIL  60

Query  499  SSHLG  513
            SSH G
Sbjct  61   SSHFG  65



>ref|XP_011016588.1| PREDICTED: phosphoglycerate kinase, cytosolic [Populus euphratica]
Length=401

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSV  L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +GA+VILSS
Sbjct  4    KKSVSSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHGARVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_003059407.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56539.1| predicted protein [Micromonas pusilla CCMP1545]
Length=406

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = +1

Query  313  VSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKV  492
            V  AKKSVGDL  ADLKGK VF+R DLNVPLD   KITDDTRIRAAIPT+++L+ NGAKV
Sbjct  8    VEAAKKSVGDLKEADLKGKTVFIRCDLNVPLD-GAKITDDTRIRAAIPTLEYLVKNGAKV  66

Query  493  ILSSHLG  513
            +++SHLG
Sbjct  67   LVTSHLG  73



>ref|XP_007149209.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
 ref|XP_007149210.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
 gb|ESW21203.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
 gb|ESW21204.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
Length=401

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L   DLKGK+VFVR DLNVPLDD   ITDDTR+RAA+PTIK+L   GAKVILSS
Sbjct  4    KRSVGTLKEGDLKGKRVFVRVDLNVPLDDNLNITDDTRVRAAVPTIKYLTGYGAKVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|WP_006515662.1| phosphoglycerate kinase [Leptolyngbya sp. PCC 7375]
 gb|EKV01261.1| 3-phosphoglycerate kinase [Leptolyngbya sp. PCC 7375]
Length=402

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            MAKKSV DL+AADL GK+V +RAD NVPLDD  KITDDTRIRAA+PTI+ L S GAKVIL
Sbjct  1    MAKKSVTDLSAADLSGKRVLMRADFNVPLDDQGKITDDTRIRAALPTIQALTSKGAKVIL  60

Query  499  SSHLG  513
             SH G
Sbjct  61   CSHFG  65



>ref|XP_003546821.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Glycine max]
 gb|KHN48876.1| Phosphoglycerate kinase, cytosolic [Glycine soja]
Length=401

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L   DLKGK+VFVR DLNVPLDD   ITDDTR+RAA+PTIK+L   GAKVILSS
Sbjct  4    KRSVGTLKEGDLKGKRVFVRVDLNVPLDDNLNITDDTRVRAAVPTIKYLTGYGAKVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>gb|KDO61597.1| hypothetical protein CISIN_1g040813mg [Citrus sinensis]
Length=401

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  322  AKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILS  501
            AKKSV  L  ADLKGK+VFVR DLNVPLDD   ITDD R+RAA+PTIK+L+ +GAKVILS
Sbjct  3    AKKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILS  62

Query  502  SHLG  513
            SHLG
Sbjct  63   SHLG  66



>ref|XP_009791377.1| PREDICTED: phosphoglycerate kinase, cytosolic [Nicotiana sylvestris]
Length=401

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +G+ VIL+S
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMQHGSHVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_006422250.1| hypothetical protein CICLE_v10005101mg [Citrus clementina]
 ref|XP_006493790.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Citrus sinensis]
 gb|ESR35490.1| hypothetical protein CICLE_v10005101mg [Citrus clementina]
Length=401

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  322  AKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILS  501
            AKKSV  L  ADLKGK+VFVR DLNVPLDD   ITDD R+RAA+PTIK+L+ +GAKVILS
Sbjct  3    AKKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILS  62

Query  502  SHLG  513
            SHLG
Sbjct  63   SHLG  66



>emb|CDX79326.1| BnaC06g19770D [Brassica napus]
Length=353

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K++VG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG++V+L S
Sbjct  4    KRNVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_009777860.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Nicotiana 
sylvestris]
Length=401

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +G+ VIL+S
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMQHGSHVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_009384174.1| PREDICTED: phosphoglycerate kinase, cytosolic [Musa acuminata 
subsp. malaccensis]
Length=401

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVGDL  AD+KGK+VFVR DLNVPLD+  K+TDDTRIRA +PTIK+L+  GA++IL+S
Sbjct  4    KRSVGDLKEADVKGKRVFVRVDLNVPLDENLKVTDDTRIRATVPTIKYLMERGARIILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_008383158.1| PREDICTED: phosphoglycerate kinase, cytosolic [Malus domestica]
Length=401

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSV  L  A+LKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +GAKVIL+S
Sbjct  4    KKSVSTLKEAELKGKRVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLLGHGAKVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_004488762.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Cicer arietinum]
Length=401

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L   DLKGKKVFVR DLNVPLDD   ITDDTRIRAA+PTIK+L   GAKVILSS
Sbjct  4    KRSVGTLKEGDLKGKKVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLSGFGAKVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>gb|AFK46712.1| unknown [Medicago truncatula]
Length=401

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  A+LKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L   GAKVILSS
Sbjct  4    KRSVGTLKEAELKGKRVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLTGYGAKVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_003596092.1| Phosphoglycerate kinase [Medicago truncatula]
 gb|AES66343.1| phosphoglycerate kinase-like protein [Medicago truncatula]
Length=401

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  A+LKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L   GAKVILSS
Sbjct  4    KRSVGTLKEAELKGKRVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLTGYGAKVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_009618219.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Nicotiana 
tomentosiformis]
Length=401

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSVG L   DLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +G++VIL+S
Sbjct  4    KKSVGSLKEGDLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMQHGSRVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>dbj|BAA33801.1| cytosolic phosphoglycerate kinase 1 [Populus nigra]
Length=401

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSV  L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +GA+VILSS
Sbjct  4    KKSVSSLKEADLKGKSVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHGARVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_002977295.1| hypothetical protein SELMODRAFT_107116 [Selaginella moellendorffii]
 gb|EFJ21299.1| hypothetical protein SELMODRAFT_107116 [Selaginella moellendorffii]
Length=402

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +1

Query  313  VSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKV  492
            +++ KKSVGDLTAAD+KGK+VF+RADLNVPLD    ITDDTR+RA++PTI+HL   GAK+
Sbjct  1    MAVTKKSVGDLTAADVKGKRVFLRADLNVPLDAEFNITDDTRLRASVPTIQHLRRLGAKI  60

Query  493  ILSSHLG  513
            IL+SHLG
Sbjct  61   ILASHLG  67



>ref|WP_023076270.1| phosphoglycerate kinase [Leptolyngbya sp. Heron Island J]
 gb|ESA32821.1| phosphoglycerate kinase [Leptolyngbya sp. Heron Island J]
Length=401

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            MAKKSV DL+AADL GK+V +RAD NVPLDD   ITDDTRIRAA+PTI+ L S GAKVIL
Sbjct  1    MAKKSVADLSAADLSGKRVLMRADFNVPLDDQGNITDDTRIRAALPTIQALTSKGAKVIL  60

Query  499  SSHLG  513
             SH G
Sbjct  61   CSHFG  65



>emb|CDP13576.1| unnamed protein product [Coffea canephora]
Length=401

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSVG L  ADLKGKKVFVR DLNVPLDD   ITDDTRIRAA+PTI +LI   AK+IL+S
Sbjct  4    KKSVGSLKEADLKGKKVFVRVDLNVPLDDNFNITDDTRIRAAVPTINYLIGCSAKIILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_005855869.1| phosphoglycerate kinase, partial [Nannochloropsis gaditana CCMP526]
 gb|EKU20494.1| phosphoglycerate kinase, partial [Nannochloropsis gaditana CCMP526]
Length=197

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            MAKKSVG L  ADLKGK+VFVR DLNVPLD  + ITDDTRIRA++PTI++L S GAKV+L
Sbjct  1    MAKKSVGSLADADLKGKRVFVRCDLNVPLD-GKTITDDTRIRASVPTIEYLASKGAKVLL  59

Query  499  SSHLG  513
            +SHLG
Sbjct  60   TSHLG  64



>ref|XP_010537804.1| PREDICTED: phosphoglycerate kinase, cytosolic [Tarenaya hassleriana]
 ref|XP_010537805.1| PREDICTED: phosphoglycerate kinase, cytosolic [Tarenaya hassleriana]
Length=401

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  331  SVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHL  510
            SV  L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+SNGA+VIL SHL
Sbjct  6    SVSTLKEADLKGKRVFVRVDLNVPLDDHSNITDDTRIRAAVPTIKYLMSNGARVILCSHL  65

Query  511  G  513
            G
Sbjct  66   G  66



>ref|XP_003596093.1| Phosphoglycerate kinase [Medicago truncatula]
 gb|AES66344.1| phosphoglycerate kinase-like protein [Medicago truncatula]
Length=401

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L   +LKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L   GAKVILSS
Sbjct  4    KRSVGTLKEGELKGKRVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLTGYGAKVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|WP_012626442.1| phosphoglycerate kinase [Cyanothece sp. PCC 7425]
 sp|B8HXQ5.1|PGK_CYAP4 RecName: Full=Phosphoglycerate kinase [Cyanothece sp. PCC 7425]
 gb|ACL43344.1| Phosphoglycerate kinase [Cyanothece sp. PCC 7425]
Length=406

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            M+KK+V +L+AADL GK+V VR D NVPLDD  KITDDTRIRAA+PTI+ L S GAKVIL
Sbjct  1    MSKKTVANLSAADLAGKRVLVRVDFNVPLDDQGKITDDTRIRAALPTIQDLTSKGAKVIL  60

Query  499  SSHLG  513
            SSH G
Sbjct  61   SSHFG  65



>ref|XP_009607754.1| PREDICTED: phosphoglycerate kinase, cytosolic [Nicotiana tomentosiformis]
 sp|Q42962.1|PGKY_TOBAC RecName: Full=Phosphoglycerate kinase, cytosolic [Nicotiana tabacum]
 emb|CAA88840.1| phosphoglycerate kinase (PGK) [Nicotiana tabacum]
Length=401

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSVG L  ADLKGK+VFVR DLNVPLD+   ITDDTRIRAA+PTIK+L+ +G+ VIL+S
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDENFNITDDTRIRAAVPTIKYLMQHGSHVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>emb|CAL85629.1| phosphoglycerate kinase [Guillardia theta]
Length=221

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 63/88 (72%), Gaps = 14/88 (16%)
 Frame = +1

Query  289  SAKPVRGV-------------VSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITD  429
            SA P+ GV             +S  KKSV DLT A+LKGKKV +R DLNVPLD  +KITD
Sbjct  45   SAAPIHGVEVARAGRMASSITMSAKKKSVKDLTPAELKGKKVLIRCDLNVPLDG-KKITD  103

Query  430  DTRIRAAIPTIKHLISNGAKVILSSHLG  513
            DTRIRA++PTIK+L+ NGA+V +SSHLG
Sbjct  104  DTRIRASVPTIKYLLDNGARVAISSHLG  131



>ref|WP_040940054.1| phosphoglycerate kinase [Prochloron didemni]
Length=401

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            M+KK+V +L AADL GK+V VR D NVPLDD  KITDDTRIRAA+PTIK LI  GAKVIL
Sbjct  1    MSKKTVANLAAADLTGKRVLVRVDFNVPLDDAGKITDDTRIRAALPTIKDLIKKGAKVIL  60

Query  499  SSHLG  513
             SH+G
Sbjct  61   CSHMG  65



>ref|WP_040931032.1| phosphoglycerate kinase [Prochloron didemni]
Length=401

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            M+KK+V +L AADL GK+V VR D NVPLDD  KITDDTRIRAA+PTIK LI  GAKVIL
Sbjct  1    MSKKTVANLAAADLTGKRVLVRVDFNVPLDDAGKITDDTRIRAALPTIKDLIKKGAKVIL  60

Query  499  SSHLG  513
             SH+G
Sbjct  61   CSHMG  65



>ref|XP_008226131.1| PREDICTED: phosphoglycerate kinase, cytosolic [Prunus mume]
Length=401

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SV  L  A+LKGK+VFVR DLNVPLDD  KITDDTR+RAA+PTIK+L  +GAKVIL+S
Sbjct  4    KRSVSTLKEAELKGKRVFVRVDLNVPLDDNSKITDDTRVRAAVPTIKYLQGHGAKVILAS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>gb|EPS64076.1| phosphoglycerate kinase [Genlisea aurea]
Length=401

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSVG L  ADLKGK+V VR DLNVPLDD   ITDDTRIRAA+PTI +LI +GA+VIL++
Sbjct  4    KKSVGSLKEADLKGKRVLVRVDLNVPLDDNFNITDDTRIRAAVPTINYLIGHGARVILTT  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_010094705.1| Phosphoglycerate kinase [Morus notabilis]
 gb|EXB56751.1| Phosphoglycerate kinase [Morus notabilis]
Length=401

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  A+LKGK+VFVR DLNVPLDD   ITDDTRIR A+PTI++LI  GAKVIL S
Sbjct  4    KRSVGTLKEAELKGKRVFVRVDLNVPLDDNLNITDDTRIRGALPTIQYLIGYGAKVILCS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|WP_030007016.1| phosphoglycerate kinase [Synechococcus sp. NKBG042902]
Length=398

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            MAKKSV +LT ADL GK+VFVR D NVPL+++  ITDDTRIRAA+PTIK+L   GAKVIL
Sbjct  1    MAKKSVANLTEADLNGKRVFVRVDFNVPLNESGVITDDTRIRAALPTIKYLTEKGAKVIL  60

Query  499  SSHLG  513
             SH+G
Sbjct  61   GSHMG  65



>emb|CBN79775.1| Phosphoglycerate kinase [Ectocarpus siliculosus]
Length=485

 Score = 98.2 bits (243),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 66/98 (67%), Gaps = 3/98 (3%)
 Frame = +1

Query  226  AAAADPFFSHHVATQLRSLKASAKPVRGVVSMAK--KSVGDLTAADLKGKKVFVRADLNV  399
            AA  +P+F    A  L  L    +     +S  K  KSVGDLT+ DLKGK+V VR DLNV
Sbjct  54   AAVEEPWFDEAKANVLLDLDELERASDMTLSSDKPKKSVGDLTSEDLKGKRVLVRCDLNV  113

Query  400  PLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLG  513
            PLD +  ITDDTRIRA+IPT+K L+  GAKV+LSSHLG
Sbjct  114  PLDGST-ITDDTRIRASIPTVKFLVDKGAKVLLSSHLG  150



>ref|XP_008805982.1| PREDICTED: phosphoglycerate kinase, cytosolic [Phoenix dactylifera]
 ref|XP_008776888.1| PREDICTED: phosphoglycerate kinase, cytosolic [Phoenix dactylifera]
Length=400

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SV  L  ADLKGK+VFVR DLNVPLDD+  ITDD RIRAA+PTIK+L+ +GA+VILSS
Sbjct  4    KRSVSTLKEADLKGKRVFVRVDLNVPLDDSLNITDDNRIRAAVPTIKYLMDHGARVILSS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|WP_028953033.1| phosphoglycerate kinase [Synechococcus sp. CC9616]
Length=402

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            MAK+S+  L A DLKGK+V VR D NVPLDD+  ITDDTRIRAA+PTI+ LIS GAKVIL
Sbjct  1    MAKRSLASLNAGDLKGKRVLVRVDFNVPLDDSGAITDDTRIRAALPTIQDLISKGAKVIL  60

Query  499  SSHLG  513
            S+H G
Sbjct  61   SAHFG  65



>ref|WP_012307199.1| phosphoglycerate kinase [Synechococcus sp. PCC 7002]
 sp|B1XNQ1.1|PGK_SYNP2 RecName: Full=Phosphoglycerate kinase [Synechococcus sp. PCC 
7002]
 gb|ACA99576.1| phosphoglycerate kinase [Synechococcus sp. PCC 7002]
Length=398

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            MAKKSV +LT ADL GK+VFVR D NVPL+++  ITDDTRIRAA+PTIK+L   GAKVIL
Sbjct  1    MAKKSVANLTEADLSGKRVFVRVDFNVPLNESGVITDDTRIRAALPTIKYLTEKGAKVIL  60

Query  499  SSHLG  513
             SH+G
Sbjct  61   GSHMG  65



>ref|WP_038547249.1| phosphoglycerate kinase [Synechococcus sp. KORDI-100]
 gb|AII44688.1| phosphoglycerate kinase [Synechococcus sp. KORDI-100]
Length=402

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            MAK+S+  L A DLKGK+V VR D NVPLDD+  ITDDTRIRAA+PTI+ LIS GAKVIL
Sbjct  1    MAKRSLASLNAGDLKGKRVLVRVDFNVPLDDSGAITDDTRIRAALPTIQDLISKGAKVIL  60

Query  499  SSHLG  513
            S+H G
Sbjct  61   SAHFG  65



>ref|XP_002513352.1| phosphoglycerate kinase, putative [Ricinus communis]
 gb|EEF48755.1| phosphoglycerate kinase, putative [Ricinus communis]
Length=401

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSV  L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +GA+VIL +
Sbjct  4    KKSVSSLKEADLKGKRVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLMDHGARVILCT  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|WP_024545807.1| phosphoglycerate kinase [Synechococcus sp. NKBG15041c]
Length=398

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            MAKKSV +LT ADL GK+VFVR D NVPL+++  ITDDTRIRAA+PTI++L   GAKVIL
Sbjct  1    MAKKSVANLTEADLSGKRVFVRVDFNVPLNESGAITDDTRIRAALPTIQYLTGKGAKVIL  60

Query  499  SSHLG  513
             SH+G
Sbjct  61   GSHMG  65



>ref|XP_007213914.1| hypothetical protein PRUPE_ppa005669mg [Prunus persica]
 gb|EMJ15113.1| hypothetical protein PRUPE_ppa005669mg [Prunus persica]
Length=449

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +1

Query  313  VSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKV  492
            V   K+SV  L  A+LKGK+VFVR DLNVPLDD  KITDDTR+RAA+PTIK+L  +GAKV
Sbjct  48   VMATKRSVSTLKEAELKGKRVFVRVDLNVPLDDNSKITDDTRVRAAVPTIKYLQGHGAKV  107

Query  493  ILSSHLG  513
            IL+SHLG
Sbjct  108  ILASHLG  114



>ref|WP_015193656.1| phosphoglycerate kinase [Stanieria cyanosphaera]
 gb|AFZ35988.1| phosphoglycerate kinase [Stanieria cyanosphaera PCC 7437]
Length=399

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            M+KKSV  LT AD+ GK+V VRAD NVPLDD+  ITDDTRIRAA+PT+K LIS G KVIL
Sbjct  1    MSKKSVASLTEADVAGKRVLVRADFNVPLDDSGNITDDTRIRAALPTVKDLISKGGKVIL  60

Query  499  SSHLG  513
             SH+G
Sbjct  61   CSHMG  65



>ref|WP_015124821.1| phosphoglycerate kinase [Synechococcus sp. PCC 6312]
 gb|AFY61278.1| 3-phosphoglycerate kinase [Synechococcus sp. PCC 6312]
Length=400

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            M+KK++ DLTAADL GK+V VRAD NVPLD T  ITDDTRIRAA+PTI++L S GAKVIL
Sbjct  1    MSKKTLADLTAADLDGKRVLVRADFNVPLDGTGAITDDTRIRAALPTIQNLTSKGAKVIL  60

Query  499  SSHLG  513
             SH G
Sbjct  61   VSHFG  65



>ref|XP_001418373.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96666.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=435

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  310  VVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAK  489
            VV   KKSVGDL  +DLKG+ VFVR DLNVP+D    ITDDTRIRAAIPT+++L  NGAK
Sbjct  35   VVEAKKKSVGDLAESDLKGQTVFVRCDLNVPMDADLNITDDTRIRAAIPTLEYLAKNGAK  94

Query  490  VILSSHLG  513
            V+++SHLG
Sbjct  95   VLVTSHLG  102



>ref|WP_041765481.1| phosphoglycerate kinase [Leptolyngbya sp. PCC 7376]
Length=398

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            MAKK+V +LT +DL+GKKVFVR D NVPL D+  ITDDTRIRAA+PTIK+L   GAKV+L
Sbjct  1    MAKKTVANLTQSDLEGKKVFVRVDFNVPLTDSGVITDDTRIRAALPTIKYLTEKGAKVVL  60

Query  499  SSHLG  513
             SH+G
Sbjct  61   GSHMG  65



>ref|WP_006528046.1| phosphoglycerate kinase [Gloeocapsa sp. PCC 73106]
 gb|ELR99128.1| 3-phosphoglycerate kinase [Gloeocapsa sp. PCC 73106]
Length=401

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            M+KK++ +L+ ADL GKKV VRAD NVPLDD ++ITDDTRIRAA+PTI++L   GAKVIL
Sbjct  1    MSKKTIANLSEADLAGKKVLVRADFNVPLDDNRQITDDTRIRAALPTIEYLREKGAKVIL  60

Query  499  SSHLG  513
             SH G
Sbjct  61   CSHFG  65



>ref|XP_011013882.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X2 
[Populus euphratica]
Length=401

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSV  L   DLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +GA+VIL S
Sbjct  4    KKSVSSLKETDLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMDHGARVILCS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_002315067.1| cytosolic phosphoglycerate kinase family protein [Populus trichocarpa]
 gb|EEF01238.1| cytosolic phosphoglycerate kinase family protein [Populus trichocarpa]
Length=401

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSV  L   DLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +GA+VIL S
Sbjct  4    KKSVSSLKETDLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMDHGARVILCS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_002972143.1| hypothetical protein SELMODRAFT_96742 [Selaginella moellendorffii]
 gb|EFJ27060.1| hypothetical protein SELMODRAFT_96742 [Selaginella moellendorffii]
Length=402

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +1

Query  313  VSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKV  492
            +++ KKSVGDLT AD+KGK+VF+RADLNVPLD    ITDDTR+RAA+PTI++L   GAK+
Sbjct  1    MAVTKKSVGDLTEADVKGKRVFLRADLNVPLDAEFNITDDTRLRAAVPTIQYLRRLGAKI  60

Query  493  ILSSHLG  513
            IL+SHLG
Sbjct  61   ILASHLG  67



>ref|WP_026097925.1| phosphoglycerate kinase [Geitlerinema sp. PCC 7105]
Length=401

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            M KK+V +L+A+DL GK+V VRAD NVPLDD+ KITDDTRIRAA+PTI+ L   GAKV+L
Sbjct  1    MPKKTVANLSASDLSGKRVLVRADFNVPLDDSGKITDDTRIRAALPTIRDLTEKGAKVLL  60

Query  499  SSHLG  513
            SSHLG
Sbjct  61   SSHLG  65



>ref|XP_011013868.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Populus euphratica]
 ref|XP_011013875.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Populus euphratica]
Length=429

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSV  L   DLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +GA+VIL S
Sbjct  4    KKSVSSLKETDLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMDHGARVILCS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|WP_009769345.1| phosphoglycerate kinase [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ67091.1| 3-phosphoglycerate kinase [Oscillatoriales cyanobacterium JSC-12]
Length=410

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            M+KK+V +L+AADL GK+VFVR D NVP D+   ITDDTRIRAA+PTI+ L S GAKVIL
Sbjct  1    MSKKTVANLSAADLTGKRVFVRVDFNVPFDEQGNITDDTRIRAALPTIQDLTSKGAKVIL  60

Query  499  SSHLG  513
            +SHLG
Sbjct  61   ASHLG  65



>emb|CDX79325.1| BnaC06g19780D [Brassica napus]
Length=334

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SVG L  ADLKGK VFV  DL+VPLDD   ITDDTRIRAA+PTIK+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVSVDLSVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVLLCS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>dbj|BAA33802.1| cytosolic phosphoglycerate kinase 1 [Populus nigra]
Length=401

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            KKSV  L   DLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PT+K+L+ +GA+VIL S
Sbjct  4    KKSVSSLKETDLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTVKYLMDHGARVILCS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|XP_010669985.1| PREDICTED: phosphoglycerate kinase, cytosolic [Beta vulgaris 
subsp. vulgaris]
Length=401

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  504
            K+SV  L  +DLKGK+VFVR DLNVPLDD   ITDDTRIRAAIPTIK+L   GAKVIL S
Sbjct  4    KRSVSTLQESDLKGKRVFVRVDLNVPLDDNCNITDDTRIRAAIPTIKYLSGYGAKVILCS  63

Query  505  HLG  513
            HLG
Sbjct  64   HLG  66



>ref|WP_036005350.1| phosphoglycerate kinase [Leptolyngbya sp. JSC-1]
Length=401

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +1

Query  319  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  498
            MAKKSV +L+AADL GK+V VR D NVPLD+   ITDDTRIRAA+PTI+ L S GAKVIL
Sbjct  1    MAKKSVANLSAADLSGKRVLVRVDFNVPLDEQGNITDDTRIRAALPTIQDLTSKGAKVIL  60

Query  499  SSHLG  513
            +SH G
Sbjct  61   TSHFG  65



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554939364720