BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF011N15

Length=501
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009761597.1|  PREDICTED: putative glycosyltransferase 7          205   3e-60   Nicotiana sylvestris
ref|XP_009624871.1|  PREDICTED: putative glycosyltransferase 7          203   1e-59   Nicotiana tomentosiformis
emb|CDP02616.1|  unnamed protein product                                194   2e-56   Coffea canephora [robusta coffee]
gb|ACE60602.1|  putative galactomannan galactosyl transferase           194   3e-56   Coffea arabica [arabica coffee]
ref|XP_004231937.1|  PREDICTED: putative glycosyltransferase 7          193   6e-56   Solanum lycopersicum
ref|XP_006363812.1|  PREDICTED: putative glycosyltransferase 7-li...    192   2e-55   Solanum tuberosum [potatoes]
ref|XP_010273069.1|  PREDICTED: putative glycosyltransferase 7          191   6e-55   Nelumbo nucifera [Indian lotus]
emb|CAI79403.1|  galactomannan galactosyltransferase                    184   1e-52   Senna occidentalis [antbush]
ref|XP_010646814.1|  PREDICTED: LOW QUALITY PROTEIN: putative gly...    182   6e-52   
ref|XP_009777953.1|  PREDICTED: putative glycosyltransferase 7 is...    181   2e-51   Nicotiana sylvestris
ref|XP_002525290.1|  transferase, putative                              181   3e-51   Ricinus communis
emb|CAN80825.1|  hypothetical protein VITISV_015452                     181   3e-51   Vitis vinifera
ref|XP_006363813.1|  PREDICTED: putative glycosyltransferase 7-li...    179   7e-51   Solanum tuberosum [potatoes]
ref|XP_007047569.1|  Galactosyl transferase GMA12/MNN10 family pr...    179   2e-50   
ref|XP_011099399.1|  PREDICTED: glycosyltransferase 6-like              177   1e-49   Sesamum indicum [beniseed]
gb|KJB18050.1|  hypothetical protein B456_003G031400                    176   2e-49   Gossypium raimondii
gb|KJB46680.1|  hypothetical protein B456_008G0841002                   175   3e-49   Gossypium raimondii
gb|EYU44510.1|  hypothetical protein MIMGU_mgv1a018855mg                175   5e-49   Erythranthe guttata [common monkey flower]
ref|XP_009618872.1|  PREDICTED: putative glycosyltransferase 7          175   5e-49   Nicotiana tomentosiformis
gb|KJB46678.1|  hypothetical protein B456_008G0841002                   175   6e-49   Gossypium raimondii
gb|KHG22229.1|  Putative glycosyltransferase 7 -like protein            174   1e-48   Gossypium arboreum [tree cotton]
gb|KHG22205.1|  Putative glycosyltransferase 7 -like protein            174   1e-48   Gossypium arboreum [tree cotton]
emb|CDX76887.1|  BnaC08g34730D                                          174   2e-48   
ref|XP_010419274.1|  PREDICTED: putative glycosyltransferase 7          167   2e-48   
gb|EYU41378.1|  hypothetical protein MIMGU_mgv1a006348mg                173   3e-48   Erythranthe guttata [common monkey flower]
ref|XP_002320005.2|  alpha galactosyltransferase family protein         173   3e-48   Populus trichocarpa [western balsam poplar]
ref|XP_009117319.1|  PREDICTED: putative glycosyltransferase 7          172   9e-48   Brassica rapa
gb|EPS69883.1|  hypothetical protein M569_04879                         171   1e-47   Genlisea aurea
ref|XP_011007841.1|  PREDICTED: putative glycosyltransferase 7          172   1e-47   Populus euphratica
emb|CDY49440.1|  BnaA09g42270D                                          171   1e-47   Brassica napus [oilseed rape]
ref|XP_010429224.1|  PREDICTED: putative glycosyltransferase 7          171   2e-47   Camelina sativa [gold-of-pleasure]
gb|KFK30380.1|  hypothetical protein AALP_AA7G253700                    170   4e-47   Arabis alpina [alpine rockcress]
ref|XP_010531308.1|  PREDICTED: putative glycosyltransferase 7          170   4e-47   Tarenaya hassleriana [spider flower]
ref|XP_010472288.1|  PREDICTED: putative glycosyltransferase 7          169   7e-47   Camelina sativa [gold-of-pleasure]
ref|XP_006411860.1|  hypothetical protein EUTSA_v10027092mg             168   2e-46   
ref|NP_565544.1|  putative glycosyltransferase 7                        167   4e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004141854.1|  PREDICTED: galactomannan galactosyltransfera...    167   7e-46   Cucumis sativus [cucumbers]
ref|XP_008440417.1|  PREDICTED: galactomannan galactosyltransfera...    166   1e-45   Cucumis melo [Oriental melon]
ref|XP_006404757.1|  hypothetical protein EUTSA_v10000162mg             166   2e-45   Eutrema salsugineum [saltwater cress]
gb|KDP32091.1|  hypothetical protein JCGZ_12552                         166   2e-45   Jatropha curcas
ref|XP_010417049.1|  PREDICTED: putative glycosyltransferase 7          166   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_002880469.1|  galactosyl transferase GMA12/MNN10 family pr...    164   4e-45   
ref|XP_011031309.1|  PREDICTED: putative glycosyltransferase 7          163   2e-44   Populus euphratica
emb|CAD98924.1|  galactomannan galactosyltransferase                    162   3e-44   Lotus japonicus
ref|XP_010106924.1|  Galactomannan galactosyltransferase 1              162   4e-44   Morus notabilis
ref|XP_004231939.1|  PREDICTED: glycosyltransferase 6-like              161   5e-44   Solanum lycopersicum
ref|XP_003611556.1|  Galactomannan galactosyltransferase                161   6e-44   Medicago truncatula
ref|XP_006294199.1|  hypothetical protein CARUB_v10023195mg             161   6e-44   Capsella rubella
ref|XP_009138524.1|  PREDICTED: glycosyltransferase 6                   160   9e-44   Brassica rapa
emb|CDY29577.1|  BnaA03g54220D                                          160   9e-44   Brassica napus [oilseed rape]
emb|CDX72649.1|  BnaC07g46710D                                          160   9e-44   
ref|XP_006363811.1|  PREDICTED: putative glycosyltransferase 7-like     160   1e-43   
ref|XP_009761596.1|  PREDICTED: glycosyltransferase 6-like              160   2e-43   Nicotiana sylvestris
ref|XP_009607432.1|  PREDICTED: glycosyltransferase 6-like              160   2e-43   Nicotiana tomentosiformis
ref|XP_002310890.2|  alpha galactosyltransferase family protein         160   3e-43   
gb|KHN36310.1|  Galactomannan galactosyltransferase 1                   159   3e-43   Glycine soja [wild soybean]
gb|KDO78929.1|  hypothetical protein CISIN_1g045999mg                   159   3e-43   Citrus sinensis [apfelsine]
ref|XP_006466460.1|  PREDICTED: putative glycosyltransferase 7-like     159   5e-43   Citrus sinensis [apfelsine]
ref|XP_006426098.1|  hypothetical protein CICLE_v10025585mg             159   5e-43   Citrus clementina [clementine]
ref|XP_007156700.1|  hypothetical protein PHAVU_002G009900g             159   6e-43   Phaseolus vulgaris [French bean]
ref|XP_003517354.1|  PREDICTED: galactomannan galactosyltransfera...    158   8e-43   Glycine max [soybeans]
ref|XP_010432039.1|  PREDICTED: glycosyltransferase 6                   157   1e-42   Camelina sativa [gold-of-pleasure]
emb|CAI11454.1|  alpha-6-galactosyltransferase                          157   2e-42   Medicago truncatula
gb|KJB43940.1|  hypothetical protein B456_007G224800                    157   2e-42   Gossypium raimondii
emb|CAI11452.1|  alpha-6-galactosyltransferase                          157   2e-42   Solanum tuberosum [potatoes]
ref|XP_010446636.1|  PREDICTED: LOW QUALITY PROTEIN: glycosyltran...    157   2e-42   Camelina sativa [gold-of-pleasure]
ref|NP_680773.1|  glycosyltransferase 6                                 157   3e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003608541.1|  Alpha-6-galactosyltransferase                      157   3e-42   
ref|XP_004234713.2|  PREDICTED: glycosyltransferase 6-like              156   6e-42   
ref|XP_003539263.1|  PREDICTED: galactomannan galactosyltransfera...    156   6e-42   Glycine max [soybeans]
ref|XP_002868971.1|  galactosyl transferase GMA12/MNN10 family pr...    155   1e-41   Arabidopsis lyrata subsp. lyrata
emb|CAB52246.1|  alpha galactosyltransferase                            155   1e-41   Trigonella foenum-graecum [fenugreek]
emb|CAI11453.1|  alpha-6-galactosyltransferase                          155   1e-41   Nicotiana benthamiana
sp|Q564G7.1|GMGT1_CYATE  RecName: Full=Galactomannan galactosyltr...    155   1e-41   Cyamopsis tetragonoloba [cluster bean]
ref|XP_007205195.1|  hypothetical protein PRUPE_ppa005681mg             154   2e-41   Prunus persica
ref|XP_010274411.1|  PREDICTED: galactomannan galactosyltransfera...    154   4e-41   Nelumbo nucifera [Indian lotus]
ref|XP_008238162.1|  PREDICTED: glycosyltransferase 6-like              153   6e-41   Prunus mume [ume]
ref|XP_008363062.1|  PREDICTED: glycosyltransferase 6-like              152   3e-40   
ref|XP_009361779.1|  PREDICTED: glycosyltransferase 6-like              152   3e-40   
ref|NP_001281283.1|  putative glycosyltransferase 7                     151   3e-40   Malus domestica [apple tree]
ref|XP_004288265.1|  PREDICTED: galactomannan galactosyltransfera...    151   5e-40   Fragaria vesca subsp. vesca
ref|NP_195544.1|  galactosyl transferase GMA12/MNN10 family protein     142   6e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009345079.1|  PREDICTED: putative glycosyltransferase 7          150   7e-40   Pyrus x bretschneideri [bai li]
ref|XP_011073681.1|  PREDICTED: glycosyltransferase 6                   150   8e-40   Sesamum indicum [beniseed]
ref|XP_010437192.1|  PREDICTED: glycosyltransferase 6-like              150   9e-40   Camelina sativa [gold-of-pleasure]
gb|ACF33172.1|  putative galactosyl transferase                         145   9e-40   Coffea canephora [robusta coffee]
ref|XP_006857127.1|  hypothetical protein AMTR_s00065p00144450          150   1e-39   Amborella trichopoda
gb|EYU44512.1|  hypothetical protein MIMGU_mgv1a0180271mg               142   1e-39   Erythranthe guttata [common monkey flower]
ref|XP_010028081.1|  PREDICTED: putative glycosyltransferase 7          149   2e-39   Eucalyptus grandis [rose gum]
ref|XP_008392336.1|  PREDICTED: putative glycosyltransferase 7          149   2e-39   
ref|XP_006350640.1|  PREDICTED: putative glycosyltransferase 7-like     147   5e-39   Solanum tuberosum [potatoes]
ref|XP_008237711.1|  PREDICTED: galactomannan galactosyltransfera...    148   6e-39   Prunus mume [ume]
ref|XP_009362595.1|  PREDICTED: LOW QUALITY PROTEIN: galactomanna...    148   6e-39   Pyrus x bretschneideri [bai li]
ref|XP_007208181.1|  hypothetical protein PRUPE_ppa017391mg             145   1e-38   
ref|XP_004294205.1|  PREDICTED: galactomannan galactosyltransfera...    147   2e-38   Fragaria vesca subsp. vesca
ref|XP_008347885.1|  PREDICTED: galactomannan galactosyltransfera...    147   2e-38   
gb|ADL36661.1|  CAMTA domain class transcription factor                 147   2e-38   Malus domestica [apple tree]
ref|XP_002513422.1|  transferase, putative                              145   5e-38   
ref|XP_004511818.1|  PREDICTED: galactomannan galactosyltransfera...    145   5e-38   
gb|ACF33173.1|  putative galactomannan galactosyl transferase           145   1e-37   Coffea canephora [robusta coffee]
emb|CDP02617.1|  unnamed protein product                                144   1e-37   Coffea canephora [robusta coffee]
emb|CDP02619.1|  unnamed protein product                                144   2e-37   Coffea canephora [robusta coffee]
emb|CDP02618.1|  unnamed protein product                                144   3e-37   Coffea canephora [robusta coffee]
ref|XP_009777954.1|  PREDICTED: putative glycosyltransferase 7 is...    142   9e-37   Nicotiana sylvestris
ref|XP_009362594.1|  PREDICTED: glycosyltransferase 6-like              142   9e-37   Pyrus x bretschneideri [bai li]
ref|XP_008226081.1|  PREDICTED: putative glycosyltransferase 7          142   1e-36   Prunus mume [ume]
gb|KDP25125.1|  hypothetical protein JCGZ_22660                         141   1e-36   Jatropha curcas
gb|ACH58908.1|  galactosyl transferase                                  139   7e-36   Coffea canephora [robusta coffee]
ref|XP_003608540.1|  Galactomannan galactosyltransferase                139   1e-35   Medicago truncatula
ref|XP_010679659.1|  PREDICTED: putative glycosyltransferase 7          138   2e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011099400.1|  PREDICTED: glycosyltransferase 6-like              138   2e-35   Sesamum indicum [beniseed]
ref|XP_008362135.1|  PREDICTED: galactomannan galactosyltransfera...    138   4e-35   
gb|ADL36663.1|  CAMTA domain class transcription factor                 136   1e-34   Malus domestica [apple tree]
ref|XP_003525869.1|  PREDICTED: galactomannan galactosyltransfera...    136   1e-34   Glycine max [soybeans]
tpg|DAA64593.1|  TPA: putative galacto(gluco)mannan alpha-1,6-gal...    130   7e-34   Pinus taeda
ref|XP_009394361.1|  PREDICTED: galactomannan galactosyltransfera...    134   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADE76992.1|  unknown                                                 133   2e-33   Picea sitchensis
ref|XP_007211970.1|  hypothetical protein PRUPE_ppa006622mg             132   2e-33   
ref|XP_010939020.1|  PREDICTED: LOW QUALITY PROTEIN: galactomanna...    121   2e-29   Elaeis guineensis
ref|XP_008363070.1|  PREDICTED: LOW QUALITY PROTEIN: galactomanna...    120   3e-29   
gb|ABK25085.1|  unknown                                                 119   2e-28   Picea sitchensis
ref|XP_010109205.1|  Galactomannan galactosyltransferase 1              119   2e-28   Morus notabilis
ref|XP_009406736.1|  PREDICTED: galactomannan galactosyltransfera...    118   5e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010943187.1|  PREDICTED: galactomannan galactosyltransfera...    118   6e-28   Elaeis guineensis
ref|XP_009394626.1|  PREDICTED: galactomannan galactosyltransfera...    115   4e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008806204.1|  PREDICTED: galactomannan galactosyltransfera...    114   8e-27   Phoenix dactylifera
gb|AHC98115.1|  putative galacto(gluco)mannan alpha-1,6-galactosy...    114   1e-26   Pinus radiata
ref|XP_008795673.1|  PREDICTED: glycosyltransferase 6-like              114   2e-26   
tpg|DAA64590.1|  TPA: putative galacto(gluco)mannan alpha-1,6-gal...    112   4e-26   Pinus taeda
dbj|BAK05879.1|  predicted protein                                      112   4e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001105164.1|  alpha-6-galactosyltransferase                      112   6e-26   Zea mays [maize]
ref|XP_002454367.1|  hypothetical protein SORBIDRAFT_04g029500          112   6e-26   Sorghum bicolor [broomcorn]
ref|XP_008784727.1|  PREDICTED: putative glycosyltransferase 7          109   5e-25   Phoenix dactylifera
gb|EAY87343.1|  hypothetical protein OsI_08746                          108   7e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_004953741.1|  PREDICTED: galactomannan galactosyltransfera...    108   9e-25   Setaria italica
ref|NP_001047970.1|  Os02g0723200                                       108   9e-25   
ref|XP_003570475.1|  PREDICTED: galactomannan galactosyltransfera...    104   2e-23   Brachypodium distachyon [annual false brome]
ref|XP_010919073.1|  PREDICTED: galactomannan galactosyltransfera...    100   5e-22   Elaeis guineensis
ref|XP_007138911.1|  hypothetical protein PHAVU_009G248100g           98.2    6e-21   Phaseolus vulgaris [French bean]
ref|XP_010922270.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  97.8    9e-21   Elaeis guineensis
ref|XP_003558085.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...  97.4    1e-20   Brachypodium distachyon [annual false brome]
ref|XP_008679453.1|  PREDICTED: galactomannan galactosyltransfera...  96.7    2e-20   Zea mays [maize]
ref|XP_008790864.1|  PREDICTED: putative glycosyltransferase 2        96.3    3e-20   Phoenix dactylifera
ref|XP_006841140.1|  hypothetical protein AMTR_s00086p00128700        95.9    3e-20   Amborella trichopoda
ref|XP_002455150.1|  hypothetical protein SORBIDRAFT_03g005110        95.9    5e-20   Sorghum bicolor [broomcorn]
gb|EAY89696.1|  hypothetical protein OsI_11232                        95.5    5e-20   Oryza sativa Indica Group [Indian rice]
gb|ABF95527.1|  Glycosyltransferase 3, putative                       95.5    6e-20   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001173389.1|  Os03g0306100                                     95.5    6e-20   
ref|XP_010938345.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  95.1    9e-20   Elaeis guineensis
ref|XP_002449649.1|  hypothetical protein SORBIDRAFT_05g020911        91.7    1e-19   
ref|XP_003533377.1|  PREDICTED: putative glycosyltransferase 2-li...  94.4    2e-19   Glycine max [soybeans]
ref|XP_002449648.1|  hypothetical protein SORBIDRAFT_05g020910        94.4    2e-19   Sorghum bicolor [broomcorn]
ref|XP_003575986.2|  PREDICTED: galactomannan galactosyltransfera...  94.0    2e-19   
emb|CBI36830.3|  unnamed protein product                              92.8    3e-19   Vitis vinifera
gb|AFW64907.1|  glycosyltransferase 6                                 94.0    3e-19   
ref|XP_010230173.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...  93.2    4e-19   
ref|XP_008795804.1|  PREDICTED: putative glycosyltransferase 2        93.2    4e-19   Phoenix dactylifera
dbj|BAK08324.1|  predicted protein                                    92.8    5e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAY89653.1|  hypothetical protein OsI_11184                        92.4    6e-19   Oryza sativa Indica Group [Indian rice]
gb|ABF95475.1|  Glycosyltransferase 5, putative, expressed            92.4    7e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006649941.1|  PREDICTED: putative glycosyltransferase 2-like   92.4    7e-19   Oryza brachyantha
ref|XP_008367147.1|  PREDICTED: putative glycosyltransferase 2        92.4    9e-19   
gb|ABK24302.1|  unknown                                               92.0    1e-18   Picea sitchensis
ref|XP_010666578.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     92.0    1e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009600562.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     92.0    1e-18   Nicotiana tomentosiformis
ref|XP_006838788.1|  hypothetical protein AMTR_s00002p00259350        91.7    1e-18   
gb|AFW88652.1|  glycosyltransferase 5                                 91.7    1e-18   
ref|NP_001150077.1|  glycosyltransferase 5                            91.7    1e-18   
ref|XP_010498276.1|  PREDICTED: putative glycosyltransferase 5        91.7    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_008360279.1|  PREDICTED: putative glycosyltransferase 2        91.7    2e-18   
ref|XP_008368989.1|  PREDICTED: putative glycosyltransferase 2        91.3    2e-18   Malus domestica [apple tree]
ref|XP_004987030.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  91.3    2e-18   Setaria italica
gb|KJB19373.1|  hypothetical protein B456_003G098400                  91.3    2e-18   Gossypium raimondii
ref|NP_001152534.1|  glycosyltransferase 6                            91.7    2e-18   
ref|XP_009352257.1|  PREDICTED: putative glycosyltransferase 2        91.3    2e-18   Pyrus x bretschneideri [bai li]
ref|XP_002465400.1|  hypothetical protein SORBIDRAFT_01g038000        91.3    2e-18   Sorghum bicolor [broomcorn]
ref|XP_002465378.1|  hypothetical protein SORBIDRAFT_01g037530        90.9    2e-18   Sorghum bicolor [broomcorn]
ref|XP_009416128.1|  PREDICTED: putative glycosyltransferase 2        90.9    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA53369.1|  TPA: hypothetical protein ZEAMMB73_022473            90.5    2e-18   
ref|XP_009780568.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  91.3    2e-18   Nicotiana sylvestris
ref|XP_010652172.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     90.9    3e-18   Vitis vinifera
ref|XP_008239899.1|  PREDICTED: putative glycosyltransferase 5        91.3    3e-18   Prunus mume [ume]
ref|XP_010258249.1|  PREDICTED: putative glycosyltransferase 5        90.9    3e-18   Nelumbo nucifera [Indian lotus]
ref|XP_004987031.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  90.9    3e-18   Setaria italica
ref|XP_009342118.1|  PREDICTED: putative glycosyltransferase 2        90.9    3e-18   Pyrus x bretschneideri [bai li]
ref|XP_008235045.1|  PREDICTED: putative glycosyltransferase 2        90.9    3e-18   Prunus mume [ume]
ref|XP_007037433.1|  Galactosyl transferase GMA12/MNN10 family pr...  90.9    3e-18   
ref|XP_009414141.1|  PREDICTED: putative glycosyltransferase 2        90.5    4e-18   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU45549.1|  hypothetical protein MIMGU_mgv1a027105mg              90.5    4e-18   Erythranthe guttata [common monkey flower]
ref|XP_010537379.1|  PREDICTED: putative glycosyltransferase 5        90.5    4e-18   Tarenaya hassleriana [spider flower]
gb|EAY81250.1|  hypothetical protein OsI_36429                        90.5    4e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_006356974.1|  PREDICTED: putative glycosyltransferase 2-like   90.5    5e-18   Solanum tuberosum [potatoes]
ref|XP_002514720.1|  Xyloglucan 6-xylosyltransferase, putative        90.5    5e-18   Ricinus communis
ref|XP_003609672.1|  Xyloglucan 6-xylosyltransferase                  90.1    5e-18   Medicago truncatula
ref|XP_010452740.1|  PREDICTED: putative glycosyltransferase 3        90.1    5e-18   Camelina sativa [gold-of-pleasure]
ref|XP_004508217.1|  PREDICTED: putative glycosyltransferase 2-like   90.1    5e-18   Cicer arietinum [garbanzo]
ref|XP_010477058.1|  PREDICTED: putative glycosyltransferase 4        90.1    6e-18   
emb|CDO98874.1|  unnamed protein product                              90.1    6e-18   Coffea canephora [robusta coffee]
ref|XP_007224307.1|  hypothetical protein PRUPE_ppa019851mg           89.7    6e-18   
gb|ACE95677.1|  putative xylosyl transferase                          90.1    6e-18   Coffea canephora [robusta coffee]
emb|CAI11450.1|  alpha-1,6-xylosyltransferase                         89.7    6e-18   Pinus taeda
ref|XP_008386651.1|  PREDICTED: putative glycosyltransferase 2        89.7    6e-18   Malus domestica [apple tree]
ref|XP_010108713.1|  Putative glycosyltransferase 3                   89.7    7e-18   Morus notabilis
emb|CAI11451.1|  alpha-1,6-xylosyltransferase                         89.4    7e-18   Gossypium raimondii
ref|XP_004984900.1|  PREDICTED: putative glycosyltransferase 2-like   89.7    7e-18   Setaria italica
ref|XP_008466919.1|  PREDICTED: putative glycosyltransferase 5        87.8    7e-18   Cucumis melo [Oriental melon]
emb|CDX90935.1|  BnaA03g26150D                                        89.7    7e-18   
gb|EPS71488.1|  hypothetical protein M569_03267                       89.7    8e-18   Genlisea aurea
ref|XP_006396461.1|  hypothetical protein EUTSA_v10028641mg           89.7    8e-18   Eutrema salsugineum [saltwater cress]
dbj|BAK06777.1|  predicted protein                                    89.7    9e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AEN82384.1|  AT4G02500-like protein                                86.3    9e-18   Capsella rubella
ref|XP_010491391.1|  PREDICTED: putative glycosyltransferase 3        89.7    9e-18   Camelina sativa [gold-of-pleasure]
ref|NP_001288054.1|  calmodulin binding transcription activator 1     89.7    9e-18   Malus domestica [apple tree]
gb|EMT04084.1|  Xyloglucan 6-xylosyltransferase                       89.4    1e-17   
ref|XP_007209124.1|  hypothetical protein PRUPE_ppa005479mg           89.4    1e-17   Prunus persica
ref|XP_007201035.1|  hypothetical protein PRUPE_ppa005690mg           89.4    1e-17   
ref|XP_004229187.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     89.4    1e-17   Solanum lycopersicum
gb|ADG38703.1|  AT4G02500-like protein                                85.9    1e-17   Capsella grandiflora
dbj|BAJ96459.1|  predicted protein                                    89.4    1e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB22531.1|  hypothetical protein B456_004G052700                  89.4    1e-17   Gossypium raimondii
emb|CDY70090.1|  BnaCnng66640D                                        87.8    1e-17   Brassica napus [oilseed rape]
ref|XP_004987032.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  89.0    1e-17   Setaria italica
ref|XP_002874911.1|  hypothetical protein ARALYDRAFT_490316           89.4    1e-17   
ref|NP_567241.1|  UDP-xylosyltransferase 2                            89.4    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010523024.1|  PREDICTED: putative glycosyltransferase 3        89.0    1e-17   Tarenaya hassleriana [spider flower]
ref|XP_008235042.1|  PREDICTED: putative glycosyltransferase 2        89.0    1e-17   Prunus mume [ume]
ref|XP_006287708.1|  hypothetical protein CARUB_v10000915mg           89.0    1e-17   
ref|NP_196389.1|  xyloglucan 6-xylosyltransferase                     89.0    1e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KJB84424.1|  hypothetical protein B456_N024600                     89.0    1e-17   Gossypium raimondii
gb|AAC78266.1|  putative glycosyltransferase                          89.0    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010456020.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     89.0    1e-17   
ref|XP_010258549.1|  PREDICTED: putative glycosyltransferase 5 is...  89.0    1e-17   
ref|XP_010422579.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  89.0    1e-17   Camelina sativa [gold-of-pleasure]
ref|NP_191831.1|  xyloglucan 6-xylosyltransferase                     89.0    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010429788.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  89.0    1e-17   Camelina sativa [gold-of-pleasure]
ref|NP_001068066.1|  Os11g0546500                                     89.0    2e-17   
ref|XP_011071657.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  89.0    2e-17   
ref|XP_010258542.1|  PREDICTED: putative glycosyltransferase 5 is...  89.0    2e-17   
gb|KHG26935.1|  Putative glycosyltransferase 2 -like protein          89.0    2e-17   Gossypium arboreum [tree cotton]
ref|XP_006374450.1|  hypothetical protein POPTR_0015s07290g           89.0    2e-17   Populus trichocarpa [western balsam poplar]
ref|XP_004290777.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     88.6    2e-17   Fragaria vesca subsp. vesca
emb|CDX93965.1|  BnaC04g21240D                                        89.0    2e-17   
gb|KJB50959.1|  hypothetical protein B456_008G195000                  88.6    2e-17   Gossypium raimondii
gb|ADG38709.1|  AT4G02500-like protein                                85.1    2e-17   Neslia paniculata [ball mustard]
gb|KDP31286.1|  hypothetical protein JCGZ_11662                       88.2    2e-17   Jatropha curcas
ref|XP_010269507.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     88.6    2e-17   Nelumbo nucifera [Indian lotus]
dbj|BAK06850.1|  predicted protein                                    88.2    2e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010423175.1|  PREDICTED: putative glycosyltransferase 3        88.6    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_004136173.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  87.8    2e-17   Cucumis sativus [cucumbers]
ref|XP_006402349.1|  hypothetical protein EUTSA_v10005949mg           88.6    2e-17   Eutrema salsugineum [saltwater cress]
ref|XP_009134428.1|  PREDICTED: putative glycosyltransferase 2        88.6    2e-17   Brassica rapa
ref|XP_009138722.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  88.2    3e-17   Brassica rapa
ref|XP_010943718.1|  PREDICTED: putative glycosyltransferase 5        88.2    3e-17   Elaeis guineensis
ref|XP_009111280.1|  PREDICTED: putative glycosyltransferase 2        88.2    3e-17   Brassica rapa
emb|CDY50378.1|  BnaCnng19100D                                        88.2    3e-17   Brassica napus [oilseed rape]
ref|XP_011087267.1|  PREDICTED: putative glycosyltransferase 5        88.2    3e-17   Sesamum indicum [beniseed]
ref|XP_004138179.1|  PREDICTED: putative glycosyltransferase 3-like   88.2    3e-17   Cucumis sativus [cucumbers]
ref|XP_010459505.1|  PREDICTED: putative glycosyltransferase 4        88.2    3e-17   
emb|CBI26079.3|  unnamed protein product                              87.8    3e-17   Vitis vinifera
emb|CAN77730.1|  hypothetical protein VITISV_027412                   87.8    3e-17   Vitis vinifera
ref|XP_009144556.1|  PREDICTED: putative glycosyltransferase 2        88.2    3e-17   Brassica rapa
ref|XP_011006778.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  88.2    3e-17   Populus euphratica
ref|XP_004138178.1|  PREDICTED: putative glycosyltransferase 5-like   88.2    3e-17   Cucumis sativus [cucumbers]
ref|XP_009338860.1|  PREDICTED: putative glycosyltransferase 5        88.2    3e-17   Pyrus x bretschneideri [bai li]
ref|XP_011090963.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  87.8    3e-17   Sesamum indicum [beniseed]
ref|XP_011000519.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  87.8    3e-17   Populus euphratica
ref|XP_006419581.1|  hypothetical protein CICLE_v10004948mg           87.8    4e-17   Citrus clementina [clementine]
ref|XP_009116931.1|  PREDICTED: xyloglucan 6-xylosyltransferase       87.8    4e-17   Brassica rapa
ref|XP_006489090.1|  PREDICTED: putative glycosyltransferase 2-like   87.8    4e-17   Citrus sinensis [apfelsine]
ref|XP_004154959.1|  PREDICTED: putative glycosyltransferase 3-like   87.8    4e-17   
gb|KJB41948.1|  hypothetical protein B456_007G128800                  87.8    4e-17   Gossypium raimondii
ref|XP_011047184.1|  PREDICTED: putative glycosyltransferase 5        87.8    4e-17   Populus euphratica
ref|NP_001049853.1|  Os03g0300000                                     86.7    4e-17   
ref|XP_008374566.1|  PREDICTED: putative glycosyltransferase 5        87.8    4e-17   Malus domestica [apple tree]
ref|XP_002516919.1|  Xyloglucan 6-xylosyltransferase, putative        87.8    5e-17   Ricinus communis
ref|XP_008451599.1|  PREDICTED: xyloglucan 6-xylosyltransferase       87.0    5e-17   Cucumis melo [Oriental melon]
gb|EYU43946.1|  hypothetical protein MIMGU_mgv1a027073mg              87.4    5e-17   Erythranthe guttata [common monkey flower]
ref|XP_006389383.1|  glycosyltransferase 2 family protein             87.4    5e-17   Populus trichocarpa [western balsam poplar]
gb|KDP27794.1|  hypothetical protein JCGZ_18874                       87.4    6e-17   Jatropha curcas
ref|XP_010259619.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     87.0    6e-17   
ref|XP_006390433.1|  hypothetical protein EUTSA_v10018522mg           87.0    6e-17   
ref|XP_002314448.2|  glycosyltransferase 2 family protein             87.0    6e-17   
ref|XP_001767750.1|  predicted protein                                86.7    6e-17   
ref|XP_004296837.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  87.0    6e-17   
ref|XP_008393187.1|  PREDICTED: putative glycosyltransferase 5        87.0    7e-17   
ref|XP_002871288.1|  galactosyl transferase GMA12/MNN10 family pr...  87.0    7e-17   
ref|XP_002465379.1|  hypothetical protein SORBIDRAFT_01g037540        87.0    8e-17   
ref|XP_009339134.1|  PREDICTED: putative glycosyltransferase 5        86.7    9e-17   
ref|XP_010037455.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  86.7    1e-16   
emb|CAN80739.1|  hypothetical protein VITISV_027037                   86.3    1e-16   
ref|XP_008679454.1|  PREDICTED: galactomannan galactosyltransfera...  86.7    1e-16   
ref|XP_002284667.1|  PREDICTED: putative glycosyltransferase 5        86.3    1e-16   
ref|XP_006287623.1|  hypothetical protein CARUB_v10000835mg           86.7    1e-16   
emb|CDY70418.1|  BnaA04g27220D                                        86.3    1e-16   
emb|CAJ57380.1|  alpha-1,6-xylosyltransferase                         86.3    1e-16   
ref|XP_010098280.1|  Xyloglucan 6-xylosyltransferase                  86.3    1e-16   
ref|XP_002876686.1|  hypothetical protein ARALYDRAFT_907847           86.3    1e-16   
ref|XP_006479923.1|  PREDICTED: putative glycosyltransferase 2-li...  86.3    1e-16   
gb|KJB28609.1|  hypothetical protein B456_005G060400                  86.3    1e-16   
ref|XP_006444290.1|  hypothetical protein CICLE_v10020012mg           86.3    1e-16   
ref|XP_006479922.1|  PREDICTED: putative glycosyltransferase 2-li...  86.3    1e-16   
ref|XP_008654833.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  86.3    1e-16   
ref|XP_006399253.1|  hypothetical protein EUTSA_v10013509mg           86.3    1e-16   
ref|XP_002315554.2|  glycosyltransferase 2 family protein             86.3    1e-16   
ref|XP_001776727.1|  predicted protein                                86.3    1e-16   
gb|KEH31956.1|  xyloglucan xylosyltransferase                         85.9    1e-16   
gb|EPS64541.1|  hypothetical protein M569_10236                       85.5    2e-16   
ref|XP_011000518.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  85.9    2e-16   
ref|XP_003558113.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  85.9    2e-16   
ref|XP_010523942.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  85.9    2e-16   
ref|XP_007163097.1|  hypothetical protein PHAVU_001G206000g           85.9    2e-16   
ref|XP_006479921.1|  PREDICTED: putative glycosyltransferase 2-li...  86.3    2e-16   
emb|CDP21247.1|  unnamed protein product                              85.9    2e-16   
ref|XP_006291070.1|  hypothetical protein CARUB_v10017185mg           85.9    2e-16   
ref|XP_002318600.2|  hypothetical protein POPTR_0012s07020g           85.9    2e-16   
ref|XP_004154960.1|  PREDICTED: putative glycosyltransferase 5-like   85.9    2e-16   
ref|NP_001268156.1|  alpha-1,6-xylosyltransferase                     85.5    2e-16   
ref|XP_008662460.1|  PREDICTED: putative glycosyltransferase 3        85.5    2e-16   
ref|XP_004508717.1|  PREDICTED: putative glycosyltransferase 5-like   85.5    3e-16   
ref|XP_010468926.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1     85.5    3e-16   
ref|XP_008662468.1|  PREDICTED: putative glycosyltransferase 3        85.1    3e-16   
ref|XP_010512668.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...  85.5    3e-16   
gb|ACN29046.1|  unknown                                               85.1    3e-16   
ref|XP_010416293.1|  PREDICTED: putative glycosyltransferase 5        85.1    4e-16   
ref|XP_010471529.1|  PREDICTED: putative glycosyltransferase 5        85.1    4e-16   
ref|XP_002887538.1|  galactosyl transferase GMA12/MNN10 family pr...  85.1    4e-16   
emb|CDX99024.1|  BnaC09g48110D                                        84.7    4e-16   
gb|AFW63176.1|  hypothetical protein ZEAMMB73_999507                  84.0    4e-16   
ref|XP_004301136.1|  PREDICTED: putative glycosyltransferase 5        84.7    4e-16   
emb|CAJ57381.1|  alpha-1,6-xylosyltransferase                         84.3    5e-16   
emb|CDY22055.1|  BnaA09g00840D                                        84.7    5e-16   
ref|NP_177578.1|  xyloglucan xylosyltransferase 5                     84.7    5e-16   
ref|XP_010413252.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...  84.7    5e-16   
ref|XP_002967572.1|  glycosyltransferase, CAZy family GT34-like p...  84.3    5e-16   
ref|XP_004494368.1|  PREDICTED: putative glycosyltransferase 2-like   84.7    5e-16   
ref|XP_007035584.1|  CAMTA domain class transcription factor          84.3    6e-16   
ref|XP_006300466.1|  hypothetical protein CARUB_v10020269mg           84.3    6e-16   
ref|XP_010428421.1|  PREDICTED: putative glycosyltransferase 5 is...  84.3    6e-16   
ref|XP_001759108.1|  predicted protein                                84.0    6e-16   
gb|KFK30846.1|  hypothetical protein AALP_AA6G033100                  85.9    7e-16   
ref|XP_010678459.1|  PREDICTED: putative glycosyltransferase 5        84.0    7e-16   
ref|XP_010907157.1|  PREDICTED: putative glycosyltransferase 5        84.0    8e-16   
ref|XP_008678871.1|  PREDICTED: LOW QUALITY PROTEIN: putative gly...  83.6    8e-16   
gb|KEH24376.1|  xyloglucan xylosyltransferase                         84.0    8e-16   
ref|XP_004134208.1|  PREDICTED: putative glycosyltransferase 2-like   84.0    8e-16   
gb|EMS58373.1|  Putative glycosyltransferase 2                        83.2    9e-16   
ref|NP_001049886.1|  Os03g0305800                                     84.0    9e-16   
ref|NP_001151451.1|  glycosyltransferase 5                            83.6    1e-15   
ref|XP_007050874.1|  Alpha-1,6-xylosyltransferase isoform 2           84.0    1e-15   
ref|XP_009385087.1|  PREDICTED: putative glycosyltransferase 5        84.0    1e-15   
gb|KEH19400.1|  xyloglucan xylosyltransferase                         84.0    1e-15   
ref|XP_007050873.1|  Alpha-1,6-xylosyltransferase isoform 1           83.6    1e-15   
gb|AFW88602.1|  hypothetical protein ZEAMMB73_854435                  83.2    1e-15   
ref|XP_010683109.1|  PREDICTED: putative glycosyltransferase 5        83.6    1e-15   
ref|XP_010089891.1|  Putative glycosyltransferase 5                   83.6    1e-15   
ref|XP_004980588.1|  PREDICTED: galactomannan galactosyltransfera...  82.4    1e-15   
ref|XP_008660215.1|  PREDICTED: xyloglucan 6-xylosyltransferase-l...  83.2    1e-15   
ref|XP_003549688.1|  PREDICTED: putative glycosyltransferase 5-like   83.2    1e-15   
ref|XP_009764347.1|  PREDICTED: putative glycosyltransferase 5        83.2    1e-15   
ref|XP_006365321.1|  PREDICTED: putative glycosyltransferase 5-li...  83.2    2e-15   
ref|XP_004980586.1|  PREDICTED: galactomannan galactosyltransfera...  83.2    2e-15   
ref|XP_008438884.1|  PREDICTED: putative glycosyltransferase 2        83.2    2e-15   
ref|XP_004980587.1|  PREDICTED: galactomannan galactosyltransfera...  83.2    2e-15   
ref|XP_010522780.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     83.2    2e-15   
gb|EYU35800.1|  hypothetical protein MIMGU_mgv1a006038mg              82.8    2e-15   
gb|KFK41883.1|  hypothetical protein AALP_AA2G184600                  82.8    2e-15   
gb|EPS66800.1|  hypothetical protein M569_07974                       82.8    2e-15   
emb|CAI11457.1|  putative glycosyltransferase                         82.8    2e-15   
ref|XP_008788330.1|  PREDICTED: putative glycosyltransferase 5        82.8    2e-15   
ref|XP_008783986.1|  PREDICTED: LOW QUALITY PROTEIN: putative gly...  82.8    3e-15   
ref|XP_003628458.1|  Alpha-1 6-xylosyltransferase                     83.6    3e-15   
emb|CAI11456.1|  putative glycosyltransferase                         82.4    3e-15   
gb|AHC98117.1|  putative xyloglucan alpha-1,6-xylosyltransferase      82.4    3e-15   
ref|XP_009106103.1|  PREDICTED: putative glycosyltransferase 5        82.4    3e-15   
ref|XP_009790055.1|  PREDICTED: putative glycosyltransferase 5        82.8    3e-15   
ref|XP_010912249.1|  PREDICTED: putative glycosyltransferase 5        82.4    3e-15   
gb|KFK25153.1|  hypothetical protein AALP_AA8G072800                  82.4    3e-15   
emb|CDY19235.1|  BnaC05g14360D                                        82.4    3e-15   
gb|EPS63631.1|  hypothetical protein M569_11153                       80.9    3e-15   
ref|XP_006416577.1|  hypothetical protein EUTSA_v10007657mg           82.0    3e-15   
ref|XP_009606203.1|  PREDICTED: putative glycosyltransferase 3        82.4    4e-15   
ref|XP_003554517.1|  PREDICTED: putative glycosyltransferase 2-like   82.0    4e-15   
gb|EYU23497.1|  hypothetical protein MIMGU_mgv1a006132mg              82.0    4e-15   
ref|XP_009379786.1|  PREDICTED: putative glycosyltransferase 5        82.4    4e-15   
ref|XP_010235491.1|  PREDICTED: putative glycosyltransferase 3        82.4    4e-15   
ref|XP_009149356.1|  PREDICTED: putative glycosyltransferase 4        82.0    5e-15   
ref|NP_001047014.1|  Os02g0529600                                     82.0    5e-15   
ref|XP_006307492.1|  hypothetical protein CARUB_v10009116mg           81.6    6e-15   
ref|XP_002442801.1|  hypothetical protein SORBIDRAFT_08g003090        81.6    7e-15   
gb|KHN43518.1|  Xyloglucan 6-xylosyltransferase                       81.3    7e-15   
emb|CDY26738.1|  BnaA06g12840D                                        81.6    7e-15   
emb|CDX69995.1|  BnaA10g23440D                                        81.3    8e-15   
ref|XP_009122397.1|  PREDICTED: putative glycosyltransferase 3        81.3    8e-15   
ref|XP_007155288.1|  hypothetical protein PHAVU_003G188200g           81.3    8e-15   
ref|XP_006647332.1|  PREDICTED: putative glycosyltransferase 5-like   81.3    9e-15   
ref|XP_010030248.1|  PREDICTED: putative glycosyltransferase 5        80.9    1e-14   
dbj|BAD43079.1|  hypothetical protein                                 81.3    1e-14   
ref|NP_173304.2|  putative glycosyltransferase 4                      81.3    1e-14   
ref|XP_004980167.1|  PREDICTED: putative glycosyltransferase 5-like   80.9    1e-14   
ref|XP_004977544.1|  PREDICTED: putative glycosyltransferase 5-like   80.5    1e-14   
gb|AFW71661.1|  putative glycosyltransferase                          80.5    2e-14   
ref|NP_001105849.1|  putative glycosyltransferase                     80.5    2e-14   
gb|EMS45714.1|  Putative glycosyltransferase 3                        80.9    2e-14   
ref|XP_002990826.1|  xyloglucan xylosyltransferase-like protein       79.7    2e-14   
ref|XP_004500012.1|  PREDICTED: putative glycosyltransferase 5-like   79.7    3e-14   
ref|XP_002974473.1|  xyloglucan xylosyltransferase-like protein       79.3    3e-14   
ref|XP_009420521.1|  PREDICTED: putative glycosyltransferase 5        79.3    3e-14   
ref|XP_009104763.1|  PREDICTED: putative glycosyltransferase 5        79.3    3e-14   
ref|XP_001777149.1|  predicted protein                                79.0    4e-14   
emb|CAI11458.1|  putative glycosyltransferase                         79.0    4e-14   
ref|XP_009617169.1|  PREDICTED: putative glycosyltransferase 5        79.0    5e-14   
ref|XP_002453927.1|  hypothetical protein SORBIDRAFT_04g021570        79.0    6e-14   
ref|XP_003524717.1|  PREDICTED: putative glycosyltransferase 5-like   78.6    6e-14   
ref|XP_009761185.1|  PREDICTED: putative glycosyltransferase 5        78.6    6e-14   
ref|XP_002890293.1|  hypothetical protein ARALYDRAFT_312817           79.0    8e-14   
gb|KHN07948.1|  Galactomannan galactosyltransferase 1                 75.5    8e-14   
dbj|BAK03947.1|  predicted protein                                    78.6    8e-14   
ref|XP_010318819.1|  PREDICTED: putative glycosyltransferase 5        78.2    9e-14   
gb|AFK30383.1|  galactosyltransferase B1                              78.2    1e-13   
ref|XP_006348817.1|  PREDICTED: putative glycosyltransferase 3-like   78.2    1e-13   
gb|ADE59448.1|  galactosyltransferase                                 78.2    1e-13   
ref|XP_006494985.1|  PREDICTED: putative glycosyltransferase 3-like   77.8    1e-13   
ref|XP_006440652.1|  hypothetical protein CICLE_v10020086mg           77.8    1e-13   
ref|XP_011072798.1|  PREDICTED: putative glycosyltransferase 5        77.8    1e-13   
ref|XP_011075649.1|  PREDICTED: putative glycosyltransferase 5        77.0    2e-13   
gb|EMT32465.1|  Putative glycosyltransferase 3                        77.0    2e-13   
gb|EMT05890.1|  Putative glycosyltransferase 3                        77.8    2e-13   
gb|AFK30382.1|  galactosyltransferase A                               77.0    2e-13   
gb|KEH33442.1|  xyloglucan xylosyltransferase                         76.6    3e-13   
gb|EMS48021.1|  Putative glycosyltransferase 3                        76.3    3e-13   
gb|KGN48623.1|  hypothetical protein Csa_6G495770                     73.9    3e-13   
ref|XP_009393375.1|  PREDICTED: putative glycosyltransferase 5        76.6    4e-13   
ref|XP_004952632.1|  PREDICTED: putative glycosyltransferase 5-like   75.9    5e-13   
ref|XP_004239475.1|  PREDICTED: putative glycosyltransferase 3        75.9    6e-13   
dbj|BAK00169.1|  predicted protein                                    75.9    6e-13   
gb|EYU28806.1|  hypothetical protein MIMGU_mgv1a003740mg              75.9    8e-13   
emb|CBX25402.1|  hypothetical_protein                                 75.1    9e-13   
dbj|BAJ93852.1|  predicted protein                                    72.0    2e-12   
gb|EAY82266.1|  hypothetical protein OsI_37474                        74.3    2e-12   
ref|NP_001066160.1|  Os12g0149300                                     74.3    2e-12   
emb|CBX24469.1|  hypothetical_protein                                 73.9    2e-12   
ref|XP_002990216.1|  glycosyltransferase CAZy family GT34-like pr...  73.9    2e-12   
ref|XP_001771886.1|  predicted protein                                73.2    4e-12   
ref|XP_001769838.1|  predicted protein                                72.8    6e-12   
ref|XP_002980080.1|  glycosyltransferase CAZy family GT34-like pr...  70.9    2e-11   
emb|CDY11441.1|  BnaA09g40070D                                        68.9    2e-11   
ref|XP_010238722.1|  PREDICTED: putative glycosyltransferase 5        71.2    2e-11   
tpg|DAA57044.1|  TPA: hypothetical protein ZEAMMB73_619966            71.2    3e-11   
gb|ABC87290.1|  putative galactosyl transferase                       70.5    3e-11   
ref|XP_001755467.1|  predicted protein                                70.9    3e-11   
ref|XP_006651307.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  69.7    6e-11   
ref|XP_008663804.1|  PREDICTED: putative glycosyltransferase 3        70.1    6e-11   
ref|XP_002441834.1|  hypothetical protein SORBIDRAFT_08g003080        70.1    7e-11   
gb|KHN26556.1|  Putative glycosyltransferase 2                        68.6    8e-11   
gb|KHN14624.1|  Putative glycosyltransferase 2                        68.6    8e-11   
ref|XP_004980166.1|  PREDICTED: putative glycosyltransferase 5-like   69.7    9e-11   
ref|XP_004955161.1|  PREDICTED: galactomannan galactosyltransfera...  66.6    9e-11   
ref|XP_004978367.1|  PREDICTED: putative glycosyltransferase 5-like   69.3    1e-10   
gb|KDO71643.1|  hypothetical protein CISIN_1g047753mg                 68.9    1e-10   
gb|AFW56047.1|  hypothetical protein ZEAMMB73_697365                  69.7    1e-10   
ref|XP_001772519.1|  predicted protein                                67.8    3e-10   
ref|XP_001768129.1|  predicted protein                                66.2    1e-09   
ref|XP_006665210.1|  PREDICTED: putative glycosyltransferase 3-like   63.2    2e-09   
ref|XP_001775066.1|  predicted protein                                65.1    2e-09   
ref|XP_002972516.1|  glycosyltransferase CAZy family GT34-like pr...  65.1    2e-09   
ref|XP_002992573.1|  glycosyltransferase CAZy family GT34-like pr...  65.1    2e-09   
ref|XP_001765298.1|  predicted protein                                64.3    3e-09   
ref|XP_001773763.1|  predicted protein                                65.1    3e-09   
ref|XP_006663818.1|  PREDICTED: putative glycosyltransferase 3-like   64.7    3e-09   
ref|XP_001761988.1|  predicted protein                                64.3    4e-09   
ref|XP_010094459.1|  Xyloglucan 6-xylosyltransferase                  59.7    1e-08   
ref|XP_006663513.1|  PREDICTED: putative glycosyltransferase 7-like   62.8    1e-08   
ref|XP_001755939.1|  predicted protein                                63.2    1e-08   
ref|XP_001781241.1|  predicted protein                                62.4    1e-08   
ref|XP_001764909.1|  predicted protein                                62.8    2e-08   
ref|XP_001767288.1|  predicted protein                                62.0    2e-08   
ref|XP_001755245.1|  predicted protein                                61.6    4e-08   
ref|XP_002987473.1|  glycosyltransferase-like protein                 60.8    4e-08   
ref|XP_002980077.1|  glycosyltransferase-like protein                 60.8    5e-08   
ref|XP_001756042.1|  predicted protein                                60.8    7e-08   
gb|AFW88603.1|  hypothetical protein ZEAMMB73_745866                  58.9    1e-07   
dbj|BAO02547.1|  (1-6)-alpha-D-xylosyltransferase ortholog            55.5    3e-06   
ref|XP_006651308.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  55.1    5e-06   
ref|XP_002450906.1|  hypothetical protein SORBIDRAFT_05g020930        53.5    2e-05   
ref|XP_002978152.1|  glycosyltransferase CAZy family GT34-like pr...  52.0    5e-05   
ref|XP_002966412.1|  glycosyltransferase CAZy family GT34-like pr...  52.0    5e-05   
ref|XP_008661171.1|  PREDICTED: uncharacterized protein LOC103640350  50.4    2e-04   
gb|EMS66637.1|  hypothetical protein TRIUR3_04264                     50.1    2e-04   
ref|XP_009609259.1|  PREDICTED: putative glycosyltransferase 3        49.7    2e-04   
ref|XP_010246957.1|  PREDICTED: uncharacterized protein LOC104590119  48.1    6e-04   



>ref|XP_009761597.1| PREDICTED: putative glycosyltransferase 7 [Nicotiana sylvestris]
Length=456

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 124/170 (73%), Gaps = 6/170 (4%)
 Frame = +1

Query  4    MASSMSKSRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGF-PSLAGKISG-  177
            MA   +     +++F D FLC GG++VA ++VW  W+F++ +P+ +  F  S  GK S  
Sbjct  16   MAPKQNCKSKVSSLFSDGFLCAGGSIVALLVVWAFWSFMSTSPNTDPSFFTSSVGKKSAL  75

Query  178  --GGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAA  351
               GE  S   GF+L  DPP+  FYDDPD+RYTIEKPVKNWDEKR+ WL+ HPSF+PG  
Sbjct  76   ETPGEPTS--PGFDLRYDPPDPTFYDDPDVRYTIEKPVKNWDEKRRQWLKLHPSFVPGVE  133

Query  352  NRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            NRVL+V+GSQ+T CKN IGDHLLLR FKNKVDYCR+HGYDIFY  +LLQP
Sbjct  134  NRVLMVSGSQSTPCKNPIGDHLLLRFFKNKVDYCRIHGYDIFYNNILLQP  183



>ref|XP_009624871.1| PREDICTED: putative glycosyltransferase 7 [Nicotiana tomentosiformis]
Length=456

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 122/170 (72%), Gaps = 6/170 (4%)
 Frame = +1

Query  4    MASSMSKSRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAG----KI  171
            MA   +     T++F D FLC GG++VA ++VW  W+F++ +P+ +  F S +      +
Sbjct  16   MAPKQNCKSKVTSLFSDGFLCAGGSIVALLVVWAFWSFMSTSPNTDPSFFSTSAAKKSTL  75

Query  172  SGGGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAA  351
               GE  S   GF+L  DPP+  FYDDPD+ YTIEKPVKNWDEKR+ WL+ HPSF+PG  
Sbjct  76   ETPGELTS--PGFDLRYDPPDPTFYDDPDVSYTIEKPVKNWDEKRRQWLKLHPSFVPGVE  133

Query  352  NRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            NRVL+V+GSQ+T CKN IGDHLLLR FKNKVDYCR+HGYDIFY  +LLQP
Sbjct  134  NRVLMVSGSQSTPCKNPIGDHLLLRFFKNKVDYCRIHGYDIFYNNILLQP  183



>emb|CDP02616.1| unnamed protein product [Coffea canephora]
Length=448

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 115/172 (67%), Gaps = 11/172 (6%)
 Frame = +1

Query  4    MASSMSKSRGKTAVFFDA-FLCTGGTLVAFVLVWGVWAFVA-----PNPSFNGGFPSLAG  165
            M    S  R KT+ FF + FL   GT  +F+L W  W+F +      NPSF+ G  S A 
Sbjct  1    MPKHNSLLRTKTSSFFSSCFLYAAGTSASFLLAWAFWSFFSSPAPSANPSFSRGLASEAA  60

Query  166  KISGGGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPG  345
                 G     K G N   DPP+  FYDDP+L YTIEK +KNWDEKR+ WLE+HPSF  G
Sbjct  61   LSCPAG-----KAGHNRSYDPPDPTFYDDPELSYTIEKTIKNWDEKRREWLEKHPSFAAG  115

Query  346  AANRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            AA+R+L+VTGSQAT CKN IGDHLLLR FKNK DYCR+HGYDIFY TVLLQP
Sbjct  116  AADRILMVTGSQATPCKNPIGDHLLLRFFKNKADYCRIHGYDIFYNTVLLQP  167



>gb|ACE60602.1| putative galactomannan galactosyl transferase [Coffea arabica]
Length=448

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 115/172 (67%), Gaps = 11/172 (6%)
 Frame = +1

Query  4    MASSMSKSRGKTAVFFDA-FLCTGGTLVAFVLVWGVWAFVA-----PNPSFNGGFPSLAG  165
            M    S  R KT+ FF + FL   GT  +F+L W  W+F +      NPSF+ G  S A 
Sbjct  1    MPKHNSLLRTKTSSFFSSCFLYAAGTSASFLLAWAFWSFFSSPAPSANPSFSRGLASEAA  60

Query  166  KISGGGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPG  345
                 G     K G N   DPP+  FYDDP+L YTIEK +KNWDEKR+ WLE+HPSF  G
Sbjct  61   LSCPAG-----KAGHNRSYDPPDPTFYDDPELSYTIEKTIKNWDEKRREWLEKHPSFAAG  115

Query  346  AANRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            AA+R+L+VTGSQAT CKN IGDHLLLR FKNK DYCR+HGYDIFY TVLLQP
Sbjct  116  AADRILMVTGSQATPCKNPIGDHLLLRFFKNKADYCRIHGYDIFYNTVLLQP  167



>ref|XP_004231937.1| PREDICTED: putative glycosyltransferase 7 [Solanum lycopersicum]
Length=455

 Score =   193 bits (491),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 119/169 (70%), Gaps = 5/169 (3%)
 Frame = +1

Query  10   SSMSKSRGKT---AVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGG  180
            +SM+K   ++   ++F D FL  G ++VA +++W  W+F++ +P+ +  F + +   +  
Sbjct  14   TSMAKQNCRSKISSIFSDGFLFAGASIVALLVIWAFWSFMSTSPNADPSFLTTSADQNSA  73

Query  181  --GEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAAN  354
               +      GFNL  DPP+  FYDDPDL YT+EKP+K WDEKR+ WL  HPSFIPGA  
Sbjct  74   LKTQVDPVSLGFNLRYDPPDPTFYDDPDLSYTMEKPIKKWDEKRRQWLNLHPSFIPGAEE  133

Query  355  RVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            R+L+V+GSQ+T CKN IGDHLLLR FKNKVDYCR+HGYDIFY  VLLQP
Sbjct  134  RILMVSGSQSTPCKNPIGDHLLLRFFKNKVDYCRIHGYDIFYNNVLLQP  182



>ref|XP_006363812.1| PREDICTED: putative glycosyltransferase 7-like isoform X1 [Solanum 
tuberosum]
Length=455

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 114/162 (70%), Gaps = 12/162 (7%)
 Frame = +1

Query  37   TAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYKQ----  204
            +++F D FL  G ++VA ++VW  W+F++ +P+ +  F      I+   +  + K     
Sbjct  26   SSIFSDGFLFAGASIVALLVVWAFWSFMSTSPNADPSF-----LITSADQNSALKTPVDP  80

Query  205  ---GFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTG  375
               GFNL  DPP+  FYD PDL YT+EKP+KNWDEKR+ WL  HPSFIPGA  R+L+V+G
Sbjct  81   VSLGFNLRYDPPDPTFYDHPDLSYTMEKPIKNWDEKRRQWLNLHPSFIPGAEERILMVSG  140

Query  376  SQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            SQ+T CKN IGDHLLLR FKNKVDYCR+HGYDIFY  +LLQP
Sbjct  141  SQSTPCKNPIGDHLLLRFFKNKVDYCRIHGYDIFYNNILLQP  182



>ref|XP_010273069.1| PREDICTED: putative glycosyltransferase 7 [Nelumbo nucifera]
Length=460

 Score =   191 bits (485),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 120/179 (67%), Gaps = 13/179 (7%)
 Frame = +1

Query  4    MASSMSKS--RGKTAVFF-DAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGF------PS  156
            + + M+K+  R KT+ F  DA L  GG +VA +LVW +W+FV P P+ +  F      P+
Sbjct  9    LHTGMAKTPFRTKTSSFLTDAILFVGGAMVALLLVWSLWSFVEPTPNSSPNFSSPVTQPN  68

Query  157  LAGKISGGGEECS----YKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQ  324
             A   +   E+C+       G NL  D P   FYDDP L YTI+KP+KNWDEKR+ WL+ 
Sbjct  69   AAVSEAFSAEDCAEIAASGSGVNLRHDTPAPTFYDDPYLSYTIDKPMKNWDEKRREWLKH  128

Query  325  HPSFIPGAANRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            HPSFIPGA+ RVL+V+GSQ + C+N IGDHLLLR FKNKVDYCR+HGYDIFY  VL  P
Sbjct  129  HPSFIPGASERVLLVSGSQPSPCRNPIGDHLLLRFFKNKVDYCRIHGYDIFYNNVLFHP  187



>emb|CAI79403.1| galactomannan galactosyltransferase [Senna occidentalis]
Length=449

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 116/177 (66%), Gaps = 15/177 (8%)
 Frame = +1

Query  16   MSKS-RGKTAVFF-DAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEE  189
            M+KS R K++++F D  L  GG   A +LVWG W+F+AP P  +  F S++ K+      
Sbjct  1    MAKSVRNKSSLWFSDGCLFLGGAFSALLLVWGFWSFIAPIPITDPNFDSVSTKLKTLKNP  60

Query  190  --------CSYKQGF-----NLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP  330
                    CS          NL  DPPE  FYDDP+  YT++KP+KNWDEKR+ WL +HP
Sbjct  61   RTVPSTVICSTSAAETTTVPNLRHDPPEATFYDDPETSYTLDKPMKNWDEKRQEWLNRHP  120

Query  331  SFIPGAANRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            SF  GA +R+L+VTGSQ T CKN IGDHLLLR FKNKVDYCRLHGYDIFY   LLQP
Sbjct  121  SFSAGAKSRILLVTGSQPTPCKNPIGDHLLLRFFKNKVDYCRLHGYDIFYNNALLQP  177



>ref|XP_010646814.1| PREDICTED: LOW QUALITY PROTEIN: putative glycosyltransferase 
7 [Vitis vinifera]
Length=403

 Score =   182 bits (461),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 115/176 (65%), Gaps = 11/176 (6%)
 Frame = +1

Query  7    ASSMSKS--RGKTA-VFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPS-----LA  162
             S M+KS  RGK A VF +  L  GG LVAF+LVWG+W+  +P  + +  F       L+
Sbjct  11   TSPMAKSLVRGKAASVFSEGVLFVGGALVAFLLVWGIWSMASPASTPSPNFERVVSDPLS  70

Query  163  GKISG--GGEECSYK-QGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPS  333
              +S      +C+   QG NL  DPP+  FYD+P   Y I  PVKNWDEKR+ WL+ HPS
Sbjct  71   TSVSDEIDSSDCAVDGQGVNLRHDPPDPTFYDNPKTSYKIGTPVKNWDEKRREWLKLHPS  130

Query  334  FIPGAANRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            F  GA  R+L++TGSQ T CKN IGDH LLR FKNKVDYCR+HGYDIFY  VLLQP
Sbjct  131  FAAGAGERILMLTGSQPTPCKNPIGDHFLLRFFKNKVDYCRIHGYDIFYNNVLLQP  186



>ref|XP_009777953.1| PREDICTED: putative glycosyltransferase 7 isoform X1 [Nicotiana 
sylvestris]
Length=431

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 108/159 (68%), Gaps = 7/159 (4%)
 Frame = +1

Query  28   RGKTAVFF-DAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYKQ  204
            R K A FF D F+  GGTLVA ++   +W+F++PNPSF+    S +  ++      S   
Sbjct  7    RTKVASFFSDGFVFVGGTLVAVLVFLAIWSFISPNPSFSTIMMSKSNTLN------SKSA  60

Query  205  GFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQA  384
             FNL  D  E  FYDD DL Y IEKP+KNWDEKR  WL+ HP+F  G   R+LVV+GSQ+
Sbjct  61   VFNLNQDSQEPTFYDDQDLNYGIEKPIKNWDEKRSKWLKLHPTFNHGVKERILVVSGSQS  120

Query  385  TQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
              CKN +GDHLLLR +KNKVDYCR+HGYDIFY  VLLQP
Sbjct  121  MPCKNPMGDHLLLRFYKNKVDYCRIHGYDIFYNNVLLQP  159



>ref|XP_002525290.1| transferase, putative [Ricinus communis]
 gb|EEF37118.1| transferase, putative [Ricinus communis]
Length=446

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 111/164 (68%), Gaps = 4/164 (2%)
 Frame = +1

Query  10   SSMSKSRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEE  189
            S  S    + + F D FL  GG L++F+++W +W++ APN + +    S   K +   + 
Sbjct  9    SQYSPMAKRKSCFSDTFLYLGGALLSFLIIWSLWSYTAPNINLSDSSSSNLRKQTCVQQN  68

Query  190  CSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVV  369
             S     +LG DPP+  FYDDPDL Y+IEKP+KNWDEKRK WLE+HPSF   A +RV++V
Sbjct  69   PSP----DLGYDPPDTTFYDDPDLSYSIEKPIKNWDEKRKRWLEKHPSFSAPARDRVVMV  124

Query  370  TGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            TGSQ   CKN IGDH LLR FKNKVDYCR+HGYDIFY  VLL P
Sbjct  125  TGSQTKPCKNPIGDHFLLRFFKNKVDYCRIHGYDIFYNNVLLHP  168



>emb|CAN80825.1| hypothetical protein VITISV_015452 [Vitis vinifera]
Length=446

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 114/173 (66%), Gaps = 11/173 (6%)
 Frame = +1

Query  16   MSKS--RGKTA-VFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPS-----LAGKI  171
            M+KS  RGK A VF +  L  GG LVAF+LVWG+W+  +P  + +  F       L+  +
Sbjct  1    MAKSLVRGKAASVFSEGVLFVGGALVAFLLVWGIWSMASPASTPSPNFERVVSDPLSTSV  60

Query  172  SG--GGEECSYK-QGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIP  342
            S      +C+   QG NL  DPP+  FYD+P   Y I  PVKNWDEKR+ WL+ HPSF  
Sbjct  61   SXEIDSSDCAVDGQGVNLRHDPPDPTFYDNPKTSYKIGTPVKNWDEKRREWLKLHPSFAA  120

Query  343  GAANRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            GA  R+L++TGSQ T CKN IGDH LLR FKNKVDYCR+HGYDIFY  VLLQP
Sbjct  121  GAGERILMLTGSQPTPCKNPIGDHFLLRFFKNKVDYCRIHGYDIFYNNVLLQP  173



>ref|XP_006363813.1| PREDICTED: putative glycosyltransferase 7-like isoform X2 [Solanum 
tuberosum]
Length=423

 Score =   179 bits (455),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 105/148 (71%), Gaps = 12/148 (8%)
 Frame = +1

Query  79   LVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYKQ-------GFNLGDDPPEK  237
            +VA ++VW  W+F++ +P+ +  F      I+   +  + K        GFNL  DPP+ 
Sbjct  8    IVALLVVWAFWSFMSTSPNADPSF-----LITSADQNSALKTPVDPVSLGFNLRYDPPDP  62

Query  238  NFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQCKNQIGDHL  417
             FYD PDL YT+EKP+KNWDEKR+ WL  HPSFIPGA  R+L+V+GSQ+T CKN IGDHL
Sbjct  63   TFYDHPDLSYTMEKPIKNWDEKRRQWLNLHPSFIPGAEERILMVSGSQSTPCKNPIGDHL  122

Query  418  LLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            LLR FKNKVDYCR+HGYDIFY  +LLQP
Sbjct  123  LLRFFKNKVDYCRIHGYDIFYNNILLQP  150



>ref|XP_007047569.1| Galactosyl transferase GMA12/MNN10 family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007047570.1| Galactosyl transferase GMA12/MNN10 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91726.1| Galactosyl transferase GMA12/MNN10 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91727.1| Galactosyl transferase GMA12/MNN10 family protein isoform 1 [Theobroma 
cacao]
Length=455

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 107/167 (64%), Gaps = 2/167 (1%)
 Frame = +1

Query  7    ASSMSKSRGKT-AVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGG  183
            +S M+K R +      D FL  GG  +A +LVW  W+F  P P+F         K+    
Sbjct  11   SSPMAKPRNRPFWCLSDGFLYFGGACLALLLVWSFWSFFTPIPNFEPTMTEPPSKLRKNP  70

Query  184  EECSYKQ-GFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRV  360
             +C     G NL  DP +  FYDDP++ Y++EKPVK+WDEKRK WL+ HPSF  GA  R+
Sbjct  71   VDCMESGFGVNLKSDPKDPTFYDDPEMSYSLEKPVKDWDEKRKEWLKHHPSFAAGARERI  130

Query  361  LVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            ++VTGSQ   CKN IGDHLLLR FKNKVDYCR+HGYDIFY  +LL P
Sbjct  131  VLVTGSQPKPCKNPIGDHLLLRFFKNKVDYCRIHGYDIFYNNLLLHP  177



>ref|XP_011099399.1| PREDICTED: glycosyltransferase 6-like [Sesamum indicum]
Length=462

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 116/170 (68%), Gaps = 12/170 (7%)
 Frame = +1

Query  28   RGKTAVFF-DAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGF----------PSLAGKIS  174
            R K A FF D FL  GG LVAF++V  +W+F +P+PS    F            ++   +
Sbjct  20   RSKAAAFFADGFLFVGGVLVAFLVVCAIWSFFSPSPSPAPSFSTSVVSSRESSDISAAAA  79

Query  175  GGGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEK-PVKNWDEKRKAWLEQHPSFIPGAA  351
                 C    G NLG DPPE+NFYDDP+L Y+I+  PVKNWDEKR+AWL+QHPSF  GA 
Sbjct  80   NPAVSCGDDSGPNLGHDPPEQNFYDDPELSYSIDALPVKNWDEKRRAWLKQHPSFSAGAE  139

Query  352  NRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            NR+L+VTGSQA  CKN IGD+LLL+LFKNKVDYCR HG DIFY  VLLQP
Sbjct  140  NRILMVTGSQAKPCKNPIGDYLLLKLFKNKVDYCRRHGIDIFYNNVLLQP  189



>gb|KJB18050.1| hypothetical protein B456_003G031400 [Gossypium raimondii]
Length=450

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 109/165 (66%), Gaps = 5/165 (3%)
 Frame = +1

Query  10   SSMSKSRGKT-AVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGE  186
            S M+K R ++     D+FL  GG  +A +LV   W+F  P  +F+      +  +S   +
Sbjct  12   SPMAKPRNRSFWCLSDSFLYCGGVFLAILLVCSFWSFFTPTLNFSSAITDPSSAVSC--K  69

Query  187  ECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLV  366
            E  +  G NL  DP +  FYDDP+L Y+IEKPVKNWDEKRK WL  HPSF  GA+ R++V
Sbjct  70   ESGF--GVNLKSDPKDLTFYDDPELSYSIEKPVKNWDEKRKQWLNHHPSFAAGASERIVV  127

Query  367  VTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            VTGSQ   CKN IGDHLLLR FKNKVDYCR+HGYDIFY  +LL P
Sbjct  128  VTGSQPKPCKNPIGDHLLLRSFKNKVDYCRIHGYDIFYNNLLLHP  172



>gb|KJB46680.1| hypothetical protein B456_008G0841002 [Gossypium raimondii]
Length=424

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 108/167 (65%), Gaps = 2/167 (1%)
 Frame = +1

Query  7    ASSMSKSRGKTA-VFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGG  183
            +S M+K R ++     DAFL  G   +A +LV   W+F  P P+F         K+S   
Sbjct  12   SSPMAKPRNRSFWCLPDAFLVFGVAFLALLLVASFWSFFTPTPNFEPTVTDPPSKLSMNP  71

Query  184  EECSYKQ-GFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRV  360
             +CS    G NL  DP +  FYDDP++ Y++EKPVK+WD+KR  WL+ HPSF  GA  R+
Sbjct  72   VDCSESGFGVNLKSDPKDPTFYDDPEMSYSLEKPVKDWDQKRAEWLKHHPSFAAGARERI  131

Query  361  LVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            ++VTGSQ   CKN IGDHLLLR FKNKVDYCR+HGYDIFY  +LL P
Sbjct  132  VLVTGSQPKPCKNPIGDHLLLRFFKNKVDYCRIHGYDIFYNNLLLHP  178



>gb|EYU44510.1| hypothetical protein MIMGU_mgv1a018855mg [Erythranthe guttata]
Length=438

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 109/167 (65%), Gaps = 9/167 (5%)
 Frame = +1

Query  28   RGKTAVFF-DAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYKQ  204
            R K A F  D FL   G +VAF  VW  W+F AP+PS       L+G   G     S   
Sbjct  7    RSKAASFLSDGFLFVAGAMVAFFFVWAFWSFFAPDPSPAFTTSPLSGMKHGSDNTPSLNC  66

Query  205  GF-------NLGDDPPEKNFYDDPDLRYTIEKP-VKNWDEKRKAWLEQHPSFIPGAANRV  360
            G        NL  DPPE+ FYDDP+L+YTI+ P V++WD KR+ WL+QHP+F  GA +R+
Sbjct  67   GGGGVGSGPNLRQDPPEQTFYDDPELKYTIDAPAVQDWDGKRREWLKQHPTFAAGAEDRI  126

Query  361  LVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
             +VTGSQAT CKN IGD+LLL+LFKNKVDYCR HG DIFY  VLLQP
Sbjct  127  FMVTGSQATPCKNPIGDYLLLKLFKNKVDYCRRHGIDIFYNNVLLQP  173



>ref|XP_009618872.1| PREDICTED: putative glycosyltransferase 7 [Nicotiana tomentosiformis]
Length=443

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 112/160 (70%), Gaps = 13/160 (8%)
 Frame = +1

Query  28   RGKTAVFF-DAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYKQ  204
            R K + FF D F+  GGTLVA +++  +W+F++PNPSF+    S +  +           
Sbjct  23   RTKVSSFFSDWFVFVGGTLVALLVLLALWSFISPNPSFSTIIISKSNTLD----------  72

Query  205  GFNLGDDPPEK-NFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQ  381
             FNL  D  E  +FYDDPDL Y+IEKP+KNWDEKR  WL+ HP+F PG   R+LVV+GSQ
Sbjct  73   -FNLNQDSQEAASFYDDPDLNYSIEKPIKNWDEKRNKWLKLHPTFNPGIKERILVVSGSQ  131

Query  382  ATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            +T CKN IGDHLLLR FKNKVDYCR+HGYDIFY  VLLQP
Sbjct  132  STPCKNPIGDHLLLRFFKNKVDYCRIHGYDIFYNNVLLQP  171



>gb|KJB46678.1| hypothetical protein B456_008G0841002 [Gossypium raimondii]
 gb|KJB46679.1| hypothetical protein B456_008G0841002 [Gossypium raimondii]
 gb|KJB46681.1| hypothetical protein B456_008G0841002 [Gossypium raimondii]
 gb|KJB46682.1| hypothetical protein B456_008G0841002 [Gossypium raimondii]
Length=456

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 108/167 (65%), Gaps = 2/167 (1%)
 Frame = +1

Query  7    ASSMSKSRGKT-AVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGG  183
            +S M+K R ++     DAFL  G   +A +LV   W+F  P P+F         K+S   
Sbjct  12   SSPMAKPRNRSFWCLPDAFLVFGVAFLALLLVASFWSFFTPTPNFEPTVTDPPSKLSMNP  71

Query  184  EECSYKQ-GFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRV  360
             +CS    G NL  DP +  FYDDP++ Y++EKPVK+WD+KR  WL+ HPSF  GA  R+
Sbjct  72   VDCSESGFGVNLKSDPKDPTFYDDPEMSYSLEKPVKDWDQKRAEWLKHHPSFAAGARERI  131

Query  361  LVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            ++VTGSQ   CKN IGDHLLLR FKNKVDYCR+HGYDIFY  +LL P
Sbjct  132  VLVTGSQPKPCKNPIGDHLLLRFFKNKVDYCRIHGYDIFYNNLLLHP  178



>gb|KHG22229.1| Putative glycosyltransferase 7 -like protein [Gossypium arboreum]
Length=456

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 108/167 (65%), Gaps = 2/167 (1%)
 Frame = +1

Query  7    ASSMSKSRGKT-AVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGG  183
            +S M+K R ++     DAFL  G   +A +LV   W+F  P P+F         K++   
Sbjct  12   SSPMAKPRNRSFWCLPDAFLVFGVAFLALLLVASFWSFFTPTPNFEPTVTDPPSKLNMNP  71

Query  184  EECSYKQ-GFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRV  360
             +CS    G NL  DP    FYDDP++ Y++EKPVK+WD+KR  WL+QHPSF  GA  R+
Sbjct  72   VDCSESGFGVNLKSDPKNPTFYDDPEMSYSLEKPVKDWDKKRAEWLKQHPSFAAGARERI  131

Query  361  LVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            ++VTGSQ   CKN IGDHLLLR FKNKVDYCR+HGYDIFY  +LL P
Sbjct  132  VLVTGSQPKPCKNPIGDHLLLRFFKNKVDYCRIHGYDIFYNNLLLHP  178



>gb|KHG22205.1| Putative glycosyltransferase 7 -like protein [Gossypium arboreum]
Length=452

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 109/165 (66%), Gaps = 5/165 (3%)
 Frame = +1

Query  10   SSMSKSRGKTA-VFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGE  186
            S M+K R ++     D+FL  GG  +A +LV   W+F  P  +F+      +  +S   +
Sbjct  12   SPMAKPRNRSFWCLSDSFLYCGGVFLAILLVCSFWSFFTPTLNFSSAITDPSSAVSC--K  69

Query  187  ECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLV  366
            E  +  G NL  DP +  FYDDP+L Y+IEKPVKNWD+KRK WL  HPSF  GA+ R++V
Sbjct  70   ESGF--GVNLKSDPKDLTFYDDPELSYSIEKPVKNWDKKRKQWLNHHPSFAAGASERIVV  127

Query  367  VTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            VTGSQ   CKN IGDHLLLR FKNKVDYCR+HGYDIFY  +LL P
Sbjct  128  VTGSQPKPCKNPIGDHLLLRSFKNKVDYCRIHGYDIFYNNLLLHP  172



>emb|CDX76887.1| BnaC08g34730D [Brassica napus]
Length=448

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 112/170 (66%), Gaps = 14/170 (8%)
 Frame = +1

Query  7    ASSMSKSRGKTA----VFFDAFLCTGGTLVAFVLVWGVWAFV-APNPSFNGGFPSLAGKI  171
            +S M+K  G  A     F D  L  GG  ++ +LVW  ++F  +PN +F       +   
Sbjct  11   SSPMAKYAGARARPVICFNDVVLFLGGAFMSLILVWSFFSFSNSPNLTF-------SADK  63

Query  172  SGGGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAA  351
            +    +C+  +G ++  DP +  FYDDPDL YTIEKPVKNWDEKRK WLE HPSFIPG+ 
Sbjct  64   TDASTKCT--RGIDMRYDPTDPVFYDDPDLSYTIEKPVKNWDEKRKRWLELHPSFIPGSE  121

Query  352  NRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            NR +++TGSQ+  CKN IGDHLLLR FKNKVDYCR+HG+DIFY   LL P
Sbjct  122  NRTVMITGSQSGPCKNPIGDHLLLRFFKNKVDYCRIHGHDIFYSNALLHP  171



>ref|XP_010419274.1| PREDICTED: putative glycosyltransferase 7 [Camelina sativa]
Length=224

 Score =   167 bits (424),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 111/171 (65%), Gaps = 8/171 (5%)
 Frame = +1

Query  1    KMASSMSK---SRGKTAVFF-DAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGK  168
            K +S M+K   +R K  + F D  L  GG  ++ +LVW  ++F + +P  N    +    
Sbjct  23   KTSSPMAKYAGTRTKPVICFSDVVLFLGGAFMSLILVWSFFSFSSISP--NLTVKTDDSS  80

Query  169  ISGGGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGA  348
             S    +C   QG +   DP +  +YDDPDL YTIEKPVKNWDEKR+ WL  HPSFIPGA
Sbjct  81   SSSTSTKCY--QGIDTNHDPTDPVYYDDPDLSYTIEKPVKNWDEKRRRWLNLHPSFIPGA  138

Query  349  ANRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
             NR ++VTGSQ+  CKN IGDHLLLR FKNKVDYCR+HG+DIFY   LL P
Sbjct  139  ENRTVMVTGSQSAPCKNPIGDHLLLRFFKNKVDYCRIHGHDIFYSNALLHP  189



>gb|EYU41378.1| hypothetical protein MIMGU_mgv1a006348mg [Erythranthe guttata]
Length=447

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 107/167 (64%), Gaps = 9/167 (5%)
 Frame = +1

Query  28   RGKTAVFF-DAFLCTGGTLVAFVLVWGVWAFVA---PNPSFNGGFPSLAGKISGGGEECS  195
            R K A FF D F   GG LVAF+LVW +W+F A             S +   +   E C 
Sbjct  7    RSKAASFFSDGFFFVGGGLVAFLLVWALWSFFALSPSPTPTPTPSFSTSSFSAAVPESCD  66

Query  196  YK----QGFNLGDDPPEKNFYDDPDLRYTIEKP-VKNWDEKRKAWLEQHPSFIPGAANRV  360
                   G NL  DPPEKNFYDDP L YTI+ P VKNWDEKR+ WL+QHPSF  GA  R+
Sbjct  67   GGGGGVSGPNLRYDPPEKNFYDDPKLSYTIDTPPVKNWDEKRREWLKQHPSFAAGADRRI  126

Query  361  LVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            L+VTGSQ T CKN IGD+LLL+LFKNKVDYCR HG DIFY  VLL P
Sbjct  127  LLVTGSQPTPCKNPIGDYLLLKLFKNKVDYCRRHGIDIFYNNVLLHP  173



>ref|XP_002320005.2| alpha galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE98320.2| alpha galactosyltransferase family protein [Populus trichocarpa]
Length=458

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 118/168 (70%), Gaps = 5/168 (3%)
 Frame = +1

Query  10   SSMSKSRGKT---AVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGG  180
            S M+KS  +    + F D FL  GG L+AF+LVW +W++  P+ SF     + +      
Sbjct  14   SPMAKSSVRNKPFSCFSDGFLYLGGALLAFLLVWSLWSYTVPH-SFEPRGSTKSATNDAR  72

Query  181  GEECSYKQ-GFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANR  357
             ++C  +    NLG DPP++ FYDD +L Y+IE+P+KNWDEKRK WL++HPSF PGA +R
Sbjct  73   TQQCVQENPAVNLGYDPPDQTFYDDQELSYSIERPMKNWDEKRKEWLKRHPSFAPGARDR  132

Query  358  VLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            V++VTGSQ+  CKN IGDHLLLR FKNKVDYCR+HGYDIFY  VLL P
Sbjct  133  VVLVTGSQSKPCKNPIGDHLLLRFFKNKVDYCRIHGYDIFYNNVLLHP  180



>ref|XP_009117319.1| PREDICTED: putative glycosyltransferase 7 [Brassica rapa]
Length=448

 Score =   172 bits (435),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 111/170 (65%), Gaps = 14/170 (8%)
 Frame = +1

Query  7    ASSMSKSRGKTA----VFFDAFLCTGGTLVAFVLVWGVWAFV-APNPSFNGGFPSLAGKI  171
            +S M+K  G        F D  L  GG  ++ +LVW  ++F  +PN +F       +   
Sbjct  11   SSPMAKYTGARTRPVICFNDVVLFLGGAFMSLILVWSFFSFSNSPNLTF-------SPDK  63

Query  172  SGGGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAA  351
            +    +C+  +G ++  DP +  FYDDPDL YTIEKPVKNWDEKRK WLE HPSFIPG+ 
Sbjct  64   TDASTKCT--RGIDMRYDPTDPVFYDDPDLSYTIEKPVKNWDEKRKRWLELHPSFIPGSE  121

Query  352  NRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            NR +++TGSQ+  CKN IGDHLLLR FKNKVDYCR+HG+DIFY   LL P
Sbjct  122  NRTVMITGSQSGPCKNPIGDHLLLRFFKNKVDYCRIHGHDIFYSNALLHP  171



>gb|EPS69883.1| hypothetical protein M569_04879, partial [Genlisea aurea]
Length=420

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 106/160 (66%), Gaps = 15/160 (9%)
 Frame = +1

Query  28   RGKTAVFF-DAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYKQ  204
            R + A++F D FL   G L + ++VW VW FV+   +    FP L         +  Y  
Sbjct  2    RSRAALYFSDGFLFITGVLASVLVVWTVWCFVSAT-TVPLHFPEL--------RDFEYAD  52

Query  205  GFNLGDDPPEKNFYDDPDLRYTIEKPV-KNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQ  381
            G++L    PE NFYDDPDL YTIE PV + WDEKR AWL QHPSF  GA  RVL+VTGSQ
Sbjct  53   GYDL----PELNFYDDPDLNYTIEAPVVEKWDEKRAAWLRQHPSFAAGARKRVLMVTGSQ  108

Query  382  ATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            AT CKN +GDHLLL+LFKNKVDYCR HG DIFY  VLLQP
Sbjct  109  ATPCKNPVGDHLLLKLFKNKVDYCRRHGIDIFYNDVLLQP  148



>ref|XP_011007841.1| PREDICTED: putative glycosyltransferase 7 [Populus euphratica]
 ref|XP_011007842.1| PREDICTED: putative glycosyltransferase 7 [Populus euphratica]
Length=458

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 117/168 (70%), Gaps = 5/168 (3%)
 Frame = +1

Query  10   SSMSKSRGKT---AVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGG  180
            S M+KS  +    + F D FL  GG L+AF+LVW +W++  P+ SF     + +      
Sbjct  14   SPMAKSSVRNKPFSCFSDGFLYLGGALLAFLLVWSLWSYTVPH-SFEPNGSTKSATNDPQ  72

Query  181  GEECSYKQ-GFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANR  357
              +C  +    NLG DPP++ FYDD ++ Y+IE+P+KNWDEKRK WL++HPSF PGA +R
Sbjct  73   THQCVQENPAVNLGYDPPDQTFYDDQEMSYSIERPMKNWDEKRKEWLKRHPSFAPGARDR  132

Query  358  VLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            V++VTGSQ+  CKN IGDHLLLR FKNKVDYCR+HGYDIFY  VLL P
Sbjct  133  VVLVTGSQSKPCKNPIGDHLLLRFFKNKVDYCRIHGYDIFYNNVLLHP  180



>emb|CDY49440.1| BnaA09g42270D [Brassica napus]
Length=448

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 111/170 (65%), Gaps = 14/170 (8%)
 Frame = +1

Query  7    ASSMSKSRGKTA----VFFDAFLCTGGTLVAFVLVWGVWAFV-APNPSFNGGFPSLAGKI  171
            +S M+K  G        F D  L  GG  ++ +LVW  ++F  +PN +F       +   
Sbjct  11   SSPMAKYAGARTRPVICFNDVVLFLGGAFMSLILVWSFFSFSNSPNLTF-------SPDK  63

Query  172  SGGGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAA  351
            +    +C+  +G ++  DP +  FYDDPDL YTIEKPVKNWDEKRK WLE HPSFIPG+ 
Sbjct  64   TDASTKCT--RGIDMRYDPTDPVFYDDPDLSYTIEKPVKNWDEKRKRWLELHPSFIPGSE  121

Query  352  NRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            NR +++TGSQ+  CKN IGDHLLLR FKNKVDYCR+HG+DIFY   LL P
Sbjct  122  NRTVMITGSQSGPCKNPIGDHLLLRFFKNKVDYCRIHGHDIFYSNALLHP  171



>ref|XP_010429224.1| PREDICTED: putative glycosyltransferase 7 [Camelina sativa]
Length=455

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 108/171 (63%), Gaps = 11/171 (6%)
 Frame = +1

Query  1    KMASSMSK---SRGKTAV-FFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGK  168
            K +S M+K   +R K  + F D  L  GG  ++ +LVW          SF+   P+L  K
Sbjct  15   KTSSPMAKYAGTRTKPVICFSDVVLFLGGAFMSLILVWSF-------FSFSSISPNLTVK  67

Query  169  ISGGGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGA  348
                       QG +   DP +  +YDDPDL YTIEKPVKNWDEKR+ WL  HPSFIPGA
Sbjct  68   TDDSSSSTKCYQGIDTNHDPTDPVYYDDPDLSYTIEKPVKNWDEKRRRWLNLHPSFIPGA  127

Query  349  ANRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
             NR ++VTGSQ++ CKN IGDHLLLR FKNKVDYCR+HG+DIFY   LL P
Sbjct  128  ENRTVMVTGSQSSPCKNPIGDHLLLRFFKNKVDYCRIHGHDIFYSNALLHP  178



>gb|KFK30380.1| hypothetical protein AALP_AA7G253700 [Arabis alpina]
Length=439

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 103/155 (66%), Gaps = 4/155 (3%)
 Frame = +1

Query  37   TAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYKQGFNL  216
            T  F +  +   G  ++ +LVW  ++  +P+ +F      L   I+    +CS   G NL
Sbjct  12   TVCFSNIIIFLTGAFMSLILVWSYFSIFSPSSNFTI-LTGLRKTINNEPTQCS---GSNL  67

Query  217  GDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQCK  396
              DP E  FYDDPDL YTIE P+KNWDEKRK WLE HPSF PG++NR+++VTGSQ+  CK
Sbjct  68   QFDPNEPGFYDDPDLTYTIETPIKNWDEKRKQWLESHPSFKPGSSNRIVMVTGSQSKPCK  127

Query  397  NQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            N IGDHLLLR FKNKVDYCR+H +DIFY   LL P
Sbjct  128  NPIGDHLLLRFFKNKVDYCRIHNHDIFYSNSLLDP  162



>ref|XP_010531308.1| PREDICTED: putative glycosyltransferase 7 [Tarenaya hassleriana]
Length=449

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 98/132 (74%), Gaps = 4/132 (3%)
 Frame = +1

Query  106  VWAFVAPNPSFNGGFPSLAGKISGGGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPV  285
            VW+F + +PS N G  S    +   G  CS  +G +L  DPP+  FYDDPDL Y+IE+PV
Sbjct  45   VWSFFSFSPSPNIGVKSDDDTLKCSG--CS--RGVDLRYDPPDPVFYDDPDLSYSIERPV  100

Query  286  KNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHG  465
            K WDEKR+ WLE HPSF PGAANRV++VTGSQ+T CKN IGDHLLLR FKNKVDYCR+HG
Sbjct  101  KGWDEKRRQWLELHPSFKPGAANRVVMVTGSQSTPCKNPIGDHLLLRFFKNKVDYCRIHG  160

Query  466  YDIFYXTVLLQP  501
            YDIFY   LL P
Sbjct  161  YDIFYSNSLLHP  172



>ref|XP_010472288.1| PREDICTED: putative glycosyltransferase 7 [Camelina sativa]
Length=455

 Score =   169 bits (429),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 108/171 (63%), Gaps = 11/171 (6%)
 Frame = +1

Query  1    KMASSMSK---SRGKTAV-FFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGK  168
            K +S M+K   +R K  + F D  L  GG  ++ +LVW          SF+   P+L  K
Sbjct  15   KTSSPMAKYAGTRTKPVICFSDVVLFLGGAFMSLILVWSF-------FSFSSISPNLTVK  67

Query  169  ISGGGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGA  348
                       QG +   DP +  +YDDPDL YTI+KPVKNWDEKR+ WL  HPSFIPGA
Sbjct  68   TDDSSSSTKCYQGIDTNHDPTDPVYYDDPDLSYTIDKPVKNWDEKRRRWLNLHPSFIPGA  127

Query  349  ANRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
             NR ++VTGSQ++ CKN IGDHLLLR FKNKVDYCR+HG+DIFY   LL P
Sbjct  128  ENRTVMVTGSQSSPCKNPIGDHLLLRFFKNKVDYCRIHGHDIFYSNALLHP  178



>ref|XP_006411860.1| hypothetical protein EUTSA_v10027092mg, partial [Eutrema salsugineum]
 gb|ESQ53313.1| hypothetical protein EUTSA_v10027092mg, partial [Eutrema salsugineum]
Length=440

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 109/168 (65%), Gaps = 13/168 (8%)
 Frame = +1

Query  13   SMSKSRG----KTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAG-KISG  177
            SM K  G     T    D  +   G  ++ +LVW  ++  +P+ ++     SL G +  G
Sbjct  4    SMGKHGGAKTKTTVCLSDGVIFLAGAFMSLILVWSYFSIFSPSSNY-----SLTGLRGDG  58

Query  178  GGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANR  357
            G  +CS   G ++  DPP+  FYDDPDL Y+IEK V  WDEKRK WLE HPSF PG+ NR
Sbjct  59   GPIKCS---GLDMQFDPPDSGFYDDPDLSYSIEKSVTGWDEKRKRWLELHPSFKPGSENR  115

Query  358  VLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            +++VTGSQ+T CKN IGDHLLLR FKNKVDYCR+HG+DIFY   LL P
Sbjct  116  IVMVTGSQSTPCKNPIGDHLLLRCFKNKVDYCRIHGHDIFYSNSLLHP  163



>ref|NP_565544.1| putative glycosyltransferase 7 [Arabidopsis thaliana]
 sp|O81007.1|GT7_ARATH RecName: Full=Putative glycosyltransferase 7; Short=AtGT7 [Arabidopsis 
thaliana]
 gb|AAC32437.1| Expressed protein [Arabidopsis thaliana]
 emb|CAC01675.1| putative golgi glycosyltransferase [Arabidopsis thaliana]
 gb|AAK59529.1| unknown protein [Arabidopsis thaliana]
 gb|AAL15201.1| unknown protein [Arabidopsis thaliana]
 gb|AEC07370.1| putative glycosyltransferase 7 [Arabidopsis thaliana]
 gb|AHL38845.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=449

 Score =   167 bits (423),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 13/169 (8%)
 Frame = +1

Query  7    ASSMSKSRGK----TAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKIS  174
            +S M+K  G          D  L  GG  ++ +LVW          SF+   P+L  K  
Sbjct  13   SSPMAKYAGTRTRPVVCISDVVLFLGGAFMSLILVWSF-------FSFSSISPNLTVKNE  65

Query  175  GGGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAAN  354
                +CS   G ++  DP +  +YDDPDL YTIEKPVKNWDEKR+ WL  HPSFIPGA N
Sbjct  66   ESSNKCS--SGIDMSQDPTDPVYYDDPDLTYTIEKPVKNWDEKRRRWLNLHPSFIPGAEN  123

Query  355  RVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            R ++VTGSQ+  CKN IGDHLLLR FKNKVDYCR+HG+DIFY   LL P
Sbjct  124  RTVMVTGSQSAPCKNPIGDHLLLRFFKNKVDYCRIHGHDIFYSNALLHP  172



>ref|XP_004141854.1| PREDICTED: galactomannan galactosyltransferase 1-like [Cucumis 
sativus]
 ref|XP_004167675.1| PREDICTED: galactomannan galactosyltransferase 1-like [Cucumis 
sativus]
 gb|KGN48624.1| hypothetical protein Csa_6G495780 [Cucumis sativus]
Length=444

 Score =   167 bits (422),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 104/166 (63%), Gaps = 4/166 (2%)
 Frame = +1

Query  4    MASSMSKSRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGG  183
            MA    + R  +A   D F    G+ +A +L+W   +F+ P+ S    F SL        
Sbjct  11   MAKPTLRHRA-SACLADVFRFLVGSFLALLLLWTFSSFLIPSSS---NFDSLHPPDFASS  66

Query  184  EECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVL  363
               S  Q  +L  DPP+  FYDDP L Y+I+KP+KNWDEKR+ WL+ HPSF  GA+ RVL
Sbjct  67   SRNSQNQYPSLAYDPPDITFYDDPKLSYSIQKPIKNWDEKRRHWLKHHPSFAAGASERVL  126

Query  364  VVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            ++T SQ   C+N IGDHLLLR FKNKVDYCR+HGYDIFY   LLQP
Sbjct  127  LITASQPKPCRNPIGDHLLLRFFKNKVDYCRIHGYDIFYNNALLQP  172



>ref|XP_008440417.1| PREDICTED: galactomannan galactosyltransferase 1-like [Cucumis 
melo]
Length=445

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 105/167 (63%), Gaps = 5/167 (3%)
 Frame = +1

Query  4    MASSMSKSRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPS-FNGGFPSLAGKISGG  180
            MA    + R  +A   D F    G+ +A +L+W   +F  P+PS F+   P      S  
Sbjct  11   MAKPTLRHRA-SACLADVFRFLVGSFLALLLLWTFSSFFTPSPSNFDTLHPPSDFASSSH  69

Query  181  GEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRV  360
              +  Y    +L  DPP+  FYDDP L Y+I+KP+KNWDEKR+ WL+ HPSF  GA+ RV
Sbjct  70   NSQNQYP---SLAYDPPDITFYDDPKLSYSIQKPIKNWDEKRRHWLKHHPSFSAGASERV  126

Query  361  LVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            L++T SQ   C+N IGDHLLLR FKNKVDYCR+HGYDIFY   LLQP
Sbjct  127  LLITASQPKPCRNPIGDHLLLRFFKNKVDYCRIHGYDIFYNNALLQP  173



>ref|XP_006404757.1| hypothetical protein EUTSA_v10000162mg [Eutrema salsugineum]
 gb|ESQ46210.1| hypothetical protein EUTSA_v10000162mg [Eutrema salsugineum]
Length=449

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 110/169 (65%), Gaps = 11/169 (7%)
 Frame = +1

Query  7    ASSMSKSRGKTA----VFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKIS  174
            +S M+K  G        F D  L  GG  ++ +LVW  ++F + +P+      S +   +
Sbjct  11   SSPMAKYAGARTRPVFCFSDVVLFLGGAFMSLILVWSFFSFSSISPNL-----SFSAVKT  65

Query  175  GGGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAAN  354
                +CS  +G ++  DP +  FYDDPDL YTIEKPVK WDEKR+ WLE HPSFIPG+ N
Sbjct  66   DESTKCS--RGIDMRYDPTDPVFYDDPDLSYTIEKPVKGWDEKRRRWLELHPSFIPGSEN  123

Query  355  RVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            R +++TGSQ+  CKN IGDHLLLR FKNKVDYCR+HG+DIFY   LL P
Sbjct  124  RTVMITGSQSGPCKNPIGDHLLLRFFKNKVDYCRIHGHDIFYSNALLHP  172



>gb|KDP32091.1| hypothetical protein JCGZ_12552 [Jatropha curcas]
Length=453

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 114/168 (68%), Gaps = 8/168 (5%)
 Frame = +1

Query  4    MASSMSKSRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPN--PSFNGGFPSLAGKISG  177
            MA S S+++  ++ F D F   GG L+AF+LVW +W++  P+   SF         K+S 
Sbjct  14   MAKSGSRNK-PSSCFTDIFRYLGGGLLAFLLVWSLWSYAGPDISSSFEPIITDYRSKVSL  72

Query  178  GGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANR  357
              E        NL  DPP++ FYDDP+LRY+IE  VK+WDEKRK WL+ HPSF  GA +R
Sbjct  73   QEE-----PAVNLRYDPPDRTFYDDPELRYSIESKVKDWDEKRKEWLKHHPSFAAGARDR  127

Query  358  VLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            V++VTGSQ++ CKN IGDH LLR FKNKVDYCR+HGYDIFY  +LL P
Sbjct  128  VVMVTGSQSSPCKNPIGDHFLLRFFKNKVDYCRIHGYDIFYNNLLLHP  175



>ref|XP_010417049.1| PREDICTED: putative glycosyltransferase 7 [Camelina sativa]
Length=466

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 111/171 (65%), Gaps = 8/171 (5%)
 Frame = +1

Query  1    KMASSMSK---SRGKTAVFF-DAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGK  168
            K +S M+K   +R K  + F D  L  GG  ++ +LVW  ++F + +P  N    +    
Sbjct  23   KTSSPMAKYAGTRTKPVICFSDVVLFLGGAFMSLILVWSFFSFSSISP--NLTVKTDDSS  80

Query  169  ISGGGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGA  348
             S    +C   QG +   DP +  +YDDPDL YTIEKPVKNWDEKR+ WL  HPSFIPGA
Sbjct  81   SSSTSTKCY--QGIDTNHDPTDPVYYDDPDLSYTIEKPVKNWDEKRRRWLNLHPSFIPGA  138

Query  349  ANRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
             NR ++VTGSQ+  CKN IGDHLLLR FKNKVDYCR+HG+DIFY   LL P
Sbjct  139  ENRTVMVTGSQSAPCKNPIGDHLLLRFFKNKVDYCRIHGHDIFYSNALLHP  189



>ref|XP_002880469.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH56728.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=434

 Score =   164 bits (415),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 103/166 (62%), Gaps = 9/166 (5%)
 Frame = +1

Query  4    MASSMSKSRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGG  183
            MA            F D  L  GG  ++ +LVW  ++F + +P+       L  K +   
Sbjct  1    MAKYAGARTRPVICFSDVVLFLGGAFMSLILVWSFFSFYSISPN-------LTVKTNETS  53

Query  184  EECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVL  363
             +CS     ++  DP +  +YD+PDL YTIEKPVKNWDEKR+ WL  HPSFI GA NR +
Sbjct  54   AKCS--PEIDMKYDPTDPVYYDEPDLTYTIEKPVKNWDEKRRRWLNLHPSFIIGAENRTV  111

Query  364  VVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            +VTGSQ+  CKN IGDHLLLR FKNKVDYCR+HG+DIFY   LL P
Sbjct  112  MVTGSQSAPCKNPIGDHLLLRFFKNKVDYCRIHGHDIFYSNALLHP  157



>ref|XP_011031309.1| PREDICTED: putative glycosyltransferase 7 [Populus euphratica]
 ref|XP_011016265.1| PREDICTED: putative glycosyltransferase 7 [Populus euphratica]
Length=457

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 113/167 (68%), Gaps = 4/167 (2%)
 Frame = +1

Query  10   SSMSKSRGKT---AVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGG  180
            S M+KS  +T   + F D  L  G  L+AF+LVW +W++ A + +F+    + +   +  
Sbjct  14   SPMAKSSVRTKPSSCFSDGSLYLGAALLAFLLVWSLWSY-ALSHNFDPKTSAKSVANTHA  72

Query  181  GEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRV  360
             E        NL  DPP++ FYDD +L Y+IEKP+KNWDEKRK WL+ HPSF PGA +RV
Sbjct  73   HECVQENPEVNLHYDPPDQTFYDDQELSYSIEKPIKNWDEKRKEWLKHHPSFAPGARDRV  132

Query  361  LVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            ++VTGSQ   CKN IGDHLLLR FKNKVDYCR+HGYDIFY  VLL P
Sbjct  133  VLVTGSQPKPCKNPIGDHLLLRFFKNKVDYCRIHGYDIFYNNVLLHP  179



>emb|CAD98924.1| galactomannan galactosyltransferase [Lotus japonicus]
Length=437

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 104/163 (64%), Gaps = 4/163 (2%)
 Frame = +1

Query  25   SRGKTAVFFDAFLC-TGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGG---EEC  192
            SR K++++     C   G L A +LVWG+ +F+ P P+ +    S+A K+        + 
Sbjct  6    SRNKSSLWLSDGCCFLTGALSALLLVWGLCSFIIPFPNTDPKLNSVAAKLKSLNLPRNQI  65

Query  193  SYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVT  372
            +     +L  D PE  FYDDP++ YT++KPV NWDEKR+ WL  HPSF  GA++R+L+VT
Sbjct  66   TTSSAQDLLYDSPETTFYDDPEMSYTMDKPVTNWDEKRRQWLLHHPSFAAGASDRILLVT  125

Query  373  GSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            GSQ  +C N IGDHLLLR FKNKVDYCR+H  DI Y   LL P
Sbjct  126  GSQPKRCHNPIGDHLLLRFFKNKVDYCRIHDIDIIYNNALLHP  168



>ref|XP_010106924.1| Galactomannan galactosyltransferase 1 [Morus notabilis]
 gb|EXC12640.1| Galactomannan galactosyltransferase 1 [Morus notabilis]
Length=459

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 111/175 (63%), Gaps = 10/175 (6%)
 Frame = +1

Query  7    ASSMSKS--RGKTAVFF-DAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGF--PSLAGK-  168
            +S M+K   R K +++  D  L  GG  +A +L+W +W+  +P+P+    F  P L  + 
Sbjct  13   SSPMAKPSLRNKASLWISDGILFLGGAFIAILLIWSLWSIASPSPNPTSDFLRPELKPRE  72

Query  169  --ISGGGEECSY--KQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSF  336
              +      C+     G NL  D PE+ FYD P+L Y+I  PV +WDEKR+ WL ++PSF
Sbjct  73   KEVMPRVINCAEGEAHGANLRCDSPERTFYDSPELNYSIGSPVMDWDEKRRCWLRKNPSF  132

Query  337  IPGAANRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
             PGA+ R+L++TGSQ + CKN IGDHLLLR FKNKVDY R+HGYDIFY   LL P
Sbjct  133  APGASERILMLTGSQPSACKNPIGDHLLLRFFKNKVDYSRIHGYDIFYNNALLHP  187



>ref|XP_004231939.1| PREDICTED: glycosyltransferase 6-like [Solanum lycopersicum]
Length=443

 Score =   161 bits (408),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 107/167 (64%), Gaps = 5/167 (3%)
 Frame = +1

Query  4    MASSMSKSRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGG  183
            MA ++ +++ +++   D  L     +VA +LV  +W+F  P P+ +G    L  +     
Sbjct  1    MAHNVFRAKQQSSSPRDKSLF-AAVIVAVLLVCAIWSFTDPLPNLSG---LLYNQNISSP  56

Query  184  EECSY-KQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRV  360
            E C   ++  +   DPPEK FY+DP+L YTI+KP+KNWDEKR  WL+ HPSF  G  NRV
Sbjct  57   EYCPPGREAVDRSSDPPEKTFYNDPELSYTIDKPIKNWDEKRVQWLQLHPSFAAGRVNRV  116

Query  361  LVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            L+++GSQ T CKN  GDHLLLR FKNKVDYCR+HGYDIFY      P
Sbjct  117  LLLSGSQPTPCKNPRGDHLLLRFFKNKVDYCRIHGYDIFYGNTFFHP  163



>ref|XP_003611556.1| Galactomannan galactosyltransferase [Medicago truncatula]
 gb|AES94514.1| galactosyl transferase GMA12/MNN10 family protein [Medicago truncatula]
Length=446

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 103/166 (62%), Gaps = 7/166 (4%)
 Frame = +1

Query  4    MASSMSKSRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGG  183
            MA  + +++  +    D FL  GG   A +LVWG  +F  P P+ N    S    +    
Sbjct  15   MAKPIPRNKSSSIFLSDGFLFLGGAFSALLLVWGFSSFTNPIPNDNLTLKSHKNNV----  70

Query  184  EECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVL  363
               SY    +L  DPP++ FYDDP++ YT+   +++WDEKR+ WL+ HPSF  GA  RVL
Sbjct  71   --VSYSTP-DLRFDPPDQTFYDDPEMEYTMSVKLEDWDEKREEWLKHHPSFSAGAKERVL  127

Query  364  VVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            +VTGSQ + CKN IGDHLLLR FKNKVDY R+HGYDIFY   LL P
Sbjct  128  MVTGSQPSPCKNPIGDHLLLRFFKNKVDYSRIHGYDIFYNNALLHP  173



>ref|XP_006294199.1| hypothetical protein CARUB_v10023195mg [Capsella rubella]
 gb|EOA27097.1| hypothetical protein CARUB_v10023195mg [Capsella rubella]
Length=452

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 103/170 (61%), Gaps = 12/170 (7%)
 Frame = +1

Query  7    ASSMSKSRGKTA----VFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKIS  174
            +S M+K  G        F D  L  GG  ++ +LVW          SF+   P+L  K  
Sbjct  13   SSPMAKYAGTRTRPVICFSDVVLFLGGAFMSLILVWSF-------FSFSSISPNLTVKTD  65

Query  175  GGGEECSY-KQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAA  351
            G     +    G +   DP +  +YDD DL YTIEKPVKNWDEKR+ W   HPSFIPGA 
Sbjct  66   GSSSSSTKCYHGIDTNHDPTDPVYYDDSDLSYTIEKPVKNWDEKRRRWFNLHPSFIPGAE  125

Query  352  NRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            NR ++VTGSQ++ CKN IGDHLLLR FKNKVDYCR+HG+DIFY   LL P
Sbjct  126  NRTVMVTGSQSSPCKNPIGDHLLLRFFKNKVDYCRIHGHDIFYSNALLHP  175



>ref|XP_009138524.1| PREDICTED: glycosyltransferase 6 [Brassica rapa]
Length=438

 Score =   160 bits (406),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 108/161 (67%), Gaps = 9/161 (6%)
 Frame = +1

Query  25   SRGKTAVFF-DAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYK  201
            ++ +TAV F D  +   G  ++ +LVW  ++  +P+ +F     +L G     G E +  
Sbjct  7    AKTRTAVCFSDGVIFFAGAFMSLILVWSYFSIFSPSSNF-----TLIG--FRRGTEPAKC  59

Query  202  QGFNLGDDPPEK-NFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGS  378
             GF++  DP +  +FYDDPDL Y+IE+P+  WDEKRK WLE HPSF PG+ NR+++VTGS
Sbjct  60   SGFDMQFDPEDPGSFYDDPDLSYSIERPITGWDEKRKQWLESHPSFKPGSENRIVMVTGS  119

Query  379  QATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            Q   CKN IGDHLLLR FKNKVDYCR+HG+DIFY   LL P
Sbjct  120  QPAPCKNPIGDHLLLRCFKNKVDYCRIHGHDIFYSNSLLHP  160



>emb|CDY29577.1| BnaA03g54220D [Brassica napus]
Length=438

 Score =   160 bits (406),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 108/161 (67%), Gaps = 9/161 (6%)
 Frame = +1

Query  25   SRGKTAVFF-DAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYK  201
            ++ +TAV F D  +   G  ++ +LVW  ++  +P+ +F     +L G     G E +  
Sbjct  7    AKTRTAVCFSDGVIFFAGAFMSLILVWSYFSIFSPSSNF-----TLIG--FRRGTEPAKC  59

Query  202  QGFNLGDDPPEK-NFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGS  378
             GF++  DP +  +FYDDPDL Y+IE+P+  WDEKRK WLE HPSF PG+ NR+++VTGS
Sbjct  60   SGFDMQFDPEDPGSFYDDPDLSYSIERPIAGWDEKRKQWLESHPSFKPGSENRIVMVTGS  119

Query  379  QATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            Q   CKN IGDHLLLR FKNKVDYCR+HG+DIFY   LL P
Sbjct  120  QPAPCKNPIGDHLLLRCFKNKVDYCRIHGHDIFYSNSLLHP  160



>emb|CDX72649.1| BnaC07g46710D [Brassica napus]
Length=438

 Score =   160 bits (406),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 108/161 (67%), Gaps = 9/161 (6%)
 Frame = +1

Query  25   SRGKTAVFF-DAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYK  201
            ++ +TAV F D  +   G  ++ +LVW  ++  +P+ +F     +L G     G E +  
Sbjct  7    AKTRTAVCFRDGVIFFAGAFMSLILVWSYFSIFSPSSNF-----TLIG--FRRGTEPAKC  59

Query  202  QGFNLGDDPPEK-NFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGS  378
             GF++  DP +  +FYDDPDL Y+IE+P+  WDEKRK WLE HPSF PG+ NR+++VTGS
Sbjct  60   SGFDMQFDPEDPGSFYDDPDLSYSIERPITGWDEKRKQWLESHPSFKPGSENRIVMVTGS  119

Query  379  QATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            Q   CKN IGDHLLLR FKNKVDYCR+HG+DIFY   LL P
Sbjct  120  QPAPCKNPIGDHLLLRCFKNKVDYCRIHGHDIFYSNSLLHP  160



>ref|XP_006363811.1| PREDICTED: putative glycosyltransferase 7-like [Solanum tuberosum]
Length=443

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 106/166 (64%), Gaps = 3/166 (2%)
 Frame = +1

Query  4    MASSMSKSRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGG  183
            MA ++ +++ +++   D  L     +VA +LV  +W+F  P P+ +G   S +  IS   
Sbjct  1    MAHNVFRAKQQSSSPRDKSLFAAA-IVAVLLVCAIWSFTDPLPNLSGLLYSQS--ISSPD  57

Query  184  EECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVL  363
                 ++  +   DPPEK FYD+P+L YTI KP+KNWDEKR  WL+ HPSF  G  NRVL
Sbjct  58   YCPPGREAVDRSSDPPEKTFYDEPELSYTINKPIKNWDEKRVQWLKLHPSFAAGRVNRVL  117

Query  364  VVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            +++GSQ T CKN  GDHLLLR FKNKVDYCR+HGYDIFY      P
Sbjct  118  LLSGSQPTPCKNPRGDHLLLRFFKNKVDYCRIHGYDIFYGNTFFHP  163



>ref|XP_009761596.1| PREDICTED: glycosyltransferase 6-like [Nicotiana sylvestris]
Length=443

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 108/167 (65%), Gaps = 5/167 (3%)
 Frame = +1

Query  4    MASSMSKSRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGG  183
            MA ++ +++ +++   D  L     +VA +LV  +W+F  P P+F+     L+ +     
Sbjct  1    MAHNVFRAKQQSSSSRDKSLFLAA-IVALLLVCAIWSFTDPFPNFSNF---LSKQNVTSP  56

Query  184  EECS-YKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRV  360
            E C   ++  +   DPPEK FYDDP+L YTI KP+KNWD+KR  WL+ HP+F  G ANRV
Sbjct  57   EYCPPDREAVDRRYDPPEKTFYDDPELSYTINKPIKNWDDKRIQWLKLHPTFAAGRANRV  116

Query  361  LVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            L++TGSQ T CK   GDHLLLR FKNKVDYCR+HGYDIFY    L P
Sbjct  117  LLLTGSQPTPCKYPKGDHLLLRFFKNKVDYCRIHGYDIFYGNTFLHP  163



>ref|XP_009607432.1| PREDICTED: glycosyltransferase 6-like [Nicotiana tomentosiformis]
Length=443

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 107/167 (64%), Gaps = 5/167 (3%)
 Frame = +1

Query  4    MASSMSKSRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGG  183
            MA ++ +++ +++   D  L     +VA +LV  +W+F  P P+F+     L+ +     
Sbjct  1    MAHTVFRAKQQSSSSRDKSLFLAA-IVALLLVCAIWSFTDPFPNFSNF---LSKQNVTSP  56

Query  184  EECS-YKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRV  360
            E C   ++  +   DPPEK FYDDP+L YTI KP+KNWDEKR  WL+ HPSF  G ANRV
Sbjct  57   EYCPPDREAVDRRYDPPEKTFYDDPELSYTINKPIKNWDEKRIQWLKFHPSFAAGRANRV  116

Query  361  LVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            L++TGSQ T CK   GDHLLLR FKNKVDYCR+H YDIFY    L P
Sbjct  117  LLLTGSQPTPCKYPKGDHLLLRFFKNKVDYCRIHSYDIFYGNTFLHP  163



>ref|XP_002310890.2| alpha galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE91340.2| alpha galactosyltransferase family protein [Populus trichocarpa]
Length=457

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 113/167 (68%), Gaps = 4/167 (2%)
 Frame = +1

Query  10   SSMSKSRGKT---AVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGG  180
            S M+KS  +T   + F D  L  G  L+AF+LVW +W++ A + +F+    + +   +  
Sbjct  14   SPMAKSGVRTKPSSCFSDGSLYLGAALLAFLLVWSLWSY-ALSRNFDPKTSAKSVANTHA  72

Query  181  GEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRV  360
             E        +L  DPP++ FYDD +L Y+IEKP+KNWDEKRK WL+ HPSF PGA +RV
Sbjct  73   HECVQENPEVSLHYDPPDQTFYDDQELSYSIEKPIKNWDEKRKEWLKHHPSFAPGARDRV  132

Query  361  LVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            ++VTGSQ   CKN IGDHLLLR FKNKVDYCR+HGYDIFY  VLL P
Sbjct  133  VLVTGSQPKPCKNPIGDHLLLRFFKNKVDYCRIHGYDIFYNNVLLHP  179



>gb|KHN36310.1| Galactomannan galactosyltransferase 1 [Glycine soja]
Length=417

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 99/160 (62%), Gaps = 7/160 (4%)
 Frame = +1

Query  28   RGKTAVFF--DAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYK  201
            R K++  F  D  L  GG   A +LVWG  +F    P+    F SL+       +  S+ 
Sbjct  25   RNKSSSLFLSDGCLFLGGAFSALILVWGFSSFTTTIPNDTPNFESLSK-----NDAASHH  79

Query  202  QGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQ  381
               +   DPP++ FYDDP + YT++K V+NWDEKR+ WL+ HPSF  GA  RV +VTGSQ
Sbjct  80   IAPDFNFDPPDRTFYDDPQMGYTMDKKVRNWDEKREEWLKLHPSFAAGARERVFMVTGSQ  139

Query  382  ATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
               C+N  GDHLLLR FKNKVDYCRLHG DIFY   LL+P
Sbjct  140  PKPCRNPTGDHLLLRFFKNKVDYCRLHGCDIFYNNALLEP  179



>gb|KDO78929.1| hypothetical protein CISIN_1g045999mg [Citrus sinensis]
Length=438

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 104/167 (62%), Gaps = 6/167 (4%)
 Frame = +1

Query  10   SSMSKS--RGKT-AVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGG  180
            S M+K   R KT     D FL  GG   A ++VW   + +   P F+    S A   S  
Sbjct  11   SPMAKPHVRNKTHPCLTDGFLFLGGAFFALLIVWSFSSLLNSAPRFDSTPLSEAKATS--  68

Query  181  GEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRV  360
             E  S     NL  DPP++ FYDD +L Y+IEK +++WDEKRK WL+ HPSF  GA  RV
Sbjct  69   -EARSPGCAANLRYDPPDETFYDDQELSYSIEKKIEDWDEKRKRWLKLHPSFAAGARERV  127

Query  361  LVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            ++VTGSQ   CKN IGDHLLLR FKNKVDYCR+HGYDIFY  VLL P
Sbjct  128  VLVTGSQPKPCKNPIGDHLLLRFFKNKVDYCRIHGYDIFYNNVLLNP  174



>ref|XP_006466460.1| PREDICTED: putative glycosyltransferase 7-like [Citrus sinensis]
Length=452

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 104/167 (62%), Gaps = 6/167 (4%)
 Frame = +1

Query  10   SSMSKS--RGKT-AVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGG  180
            S M+K   R KT     D FL  GG   A ++VW   + +   P F+    S A   S  
Sbjct  11   SPMAKPHVRNKTHPCLTDGFLFLGGAFFALLIVWSFSSLLNSAPRFDSTPLSEAKATS--  68

Query  181  GEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRV  360
             E  S     NL  DPP++ FYDD +L Y+IEK +++WDEKRK WL+ HPSF  GA  RV
Sbjct  69   -EARSPGCAANLRYDPPDETFYDDQELSYSIEKKIEDWDEKRKRWLKLHPSFAAGARERV  127

Query  361  LVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            ++VTGSQ   CKN IGDHLLLR FKNKVDYCR+HGYDIFY  VLL P
Sbjct  128  VLVTGSQPKPCKNPIGDHLLLRFFKNKVDYCRIHGYDIFYNNVLLNP  174



>ref|XP_006426098.1| hypothetical protein CICLE_v10025585mg [Citrus clementina]
 gb|ESR39338.1| hypothetical protein CICLE_v10025585mg [Citrus clementina]
Length=452

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 104/167 (62%), Gaps = 6/167 (4%)
 Frame = +1

Query  10   SSMSKS--RGKT-AVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGG  180
            S M+K   R KT     D FL  GG   A ++VW   + +   P F+    S A   S  
Sbjct  11   SPMAKPHVRNKTHPCLTDGFLFLGGAFFALLIVWSFSSLLNSAPRFDSTPLSEAKATS--  68

Query  181  GEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRV  360
             E  S     NL  DPP++ FYDD +L Y+IEK +++WDEKRK WL+ HPSF  GA  RV
Sbjct  69   -EARSPGCAANLRYDPPDETFYDDQELSYSIEKKIEDWDEKRKRWLKLHPSFAAGARERV  127

Query  361  LVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            ++VTGSQ   CKN IGDHLLLR FKNKVDYCR+HGYDIFY  VLL P
Sbjct  128  VLVTGSQPKPCKNPIGDHLLLRFFKNKVDYCRIHGYDIFYNNVLLNP  174



>ref|XP_007156700.1| hypothetical protein PHAVU_002G009900g [Phaseolus vulgaris]
 gb|ESW28694.1| hypothetical protein PHAVU_002G009900g [Phaseolus vulgaris]
Length=450

 Score =   159 bits (402),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 101/167 (60%), Gaps = 9/167 (5%)
 Frame = +1

Query  4    MASSMSKSRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVA-PNPSFNGGFPSLAGKISGG  180
            MA   S+++  +    D  L  GG   A +LVWG  +F   PN + N    S     S  
Sbjct  22   MAKPNSRNKTSSIFLSDGCLFLGGAFSALILVWGFSSFTTFPNDTLNLETLSQNDAASPR  81

Query  181  GEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRV  360
              + ++        DPP+K F+DDP + YTI+K V+NWDEKR+ WL+ HPSF  GA  RV
Sbjct  82   TPDLTF--------DPPDKTFFDDPQMGYTIDKKVRNWDEKREEWLKLHPSFSAGAKERV  133

Query  361  LVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            L++TGSQ   C+N IGDHLLLR FKNKVDYCRLHGYDI Y   LL P
Sbjct  134  LMITGSQPEPCRNPIGDHLLLRFFKNKVDYCRLHGYDILYNNALLDP  180



>ref|XP_003517354.1| PREDICTED: galactomannan galactosyltransferase 1-like [Glycine 
max]
Length=449

 Score =   158 bits (400),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 99/160 (62%), Gaps = 7/160 (4%)
 Frame = +1

Query  28   RGKTAVFF--DAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYK  201
            R K++  F  D  L  GG   A +LVWG  +F    P+    F SL+       +  S+ 
Sbjct  25   RNKSSSLFLSDGCLFLGGAFSALILVWGFSSFTTTIPNDTPNFESLSK-----NDAASHH  79

Query  202  QGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQ  381
               +   DPP++ FYDDP + YT++K V+NWDEKR+ WL+ HPSF  GA  RV +VTGSQ
Sbjct  80   IAPDFNFDPPDRTFYDDPQMGYTMDKKVRNWDEKREEWLKLHPSFAAGARERVFMVTGSQ  139

Query  382  ATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
               C+N  GDHLLLR FKNKVDYCRLHG DIFY   LL+P
Sbjct  140  PKPCRNPTGDHLLLRFFKNKVDYCRLHGCDIFYNNALLEP  179



>ref|XP_010432039.1| PREDICTED: glycosyltransferase 6 [Camelina sativa]
Length=429

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 103/159 (65%), Gaps = 10/159 (6%)
 Frame = +1

Query  31   GKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGG--EECSYKQ  204
            GK +   ++ +   G L +  L+W  + F +P+ +F     ++ G +      ++CS   
Sbjct  2    GKYSGTKNSVIFFAGALTSLTLIWSYFLFFSPSSNF-----TITGLLHDKEPVKKCS---  53

Query  205  GFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQA  384
            G N+  DPPE   YDDPDL Y+I+K + NWDEKR  WLE HPSF PG  NR+++VTGSQ+
Sbjct  54   GLNMQFDPPEPGLYDDPDLSYSIDKSITNWDEKRHQWLESHPSFKPGLENRIVMVTGSQS  113

Query  385  TQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            + CKN IGDHLLLR FKNKVDY R+HG+DIFY   LL P
Sbjct  114  SPCKNPIGDHLLLRCFKNKVDYARIHGHDIFYSNALLHP  152



>emb|CAI11454.1| alpha-6-galactosyltransferase [Medicago truncatula]
 gb|AES90738.2| galactosyl transferase GMA12/MNN10 family protein [Medicago truncatula]
Length=438

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 95/144 (66%), Gaps = 1/144 (1%)
 Frame = +1

Query  73   GTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYK-QGFNLGDDPPEKNFYD  249
            G + A + +WG+ +F+ P  + N  F S+  K+       +    G +   DP +K FYD
Sbjct  24   GAMAALLFIWGLSSFITPISNTNPKFNSITTKLKSFNFTTNTDFAGPDFLHDPSDKTFYD  83

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQCKNQIGDHLLLRL  429
            DP   YT++KPVKNWDEKRK WL  HPSF+ GA+ ++LV+TGSQ T+C N IGDHLLLR 
Sbjct  84   DPQTCYTMDKPVKNWDEKRKEWLLHHPSFVVGASEKILVITGSQPTKCDNPIGDHLLLRF  143

Query  430  FKNKVDYCRLHGYDIFYXTVLLQP  501
            FKNKVDYCR+H +DI Y   LL P
Sbjct  144  FKNKVDYCRIHNHDIIYNNALLDP  167



>gb|KJB43940.1| hypothetical protein B456_007G224800 [Gossypium raimondii]
Length=456

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 108/167 (65%), Gaps = 4/167 (2%)
 Frame = +1

Query  7    ASSMSKSRGKT--AVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGG  180
            +S+M+K R ++  +   DAFL      +A VLVW  W++  P P+F   F   +      
Sbjct  10   SSAMAKLRSRSFWSHLSDAFLFFAAAFLALVLVWSFWSYFTPTPNFLPTFTHPSSNSKNN  69

Query  181  GEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRV  360
              E  +  G NL  DP +  FYDDP++ Y+IEKPVK+WD KRK WL+ HPSF  GA  R+
Sbjct  70   PVESGF--GVNLKSDPKDPTFYDDPEMSYSIEKPVKDWDGKRKEWLKHHPSFTAGARERI  127

Query  361  LVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            ++VTGSQ   CKN +GDHLLLRLFKNKVDYCR+HG D+FY  +LL P
Sbjct  128  VLVTGSQPKPCKNPVGDHLLLRLFKNKVDYCRIHGCDVFYNNLLLHP  174



>emb|CAI11452.1| alpha-6-galactosyltransferase [Solanum tuberosum]
Length=443

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 105/166 (63%), Gaps = 3/166 (2%)
 Frame = +1

Query  4    MASSMSKSRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGG  183
            MA ++ +++ +++   D  L     +VA +LV  +W+F  P P+ +G   S +  IS   
Sbjct  1    MAHNVFRAKQQSSSPRDKSLFAAA-IVAVLLVCAIWSFTDPLPNLSGLLYSQS--ISSPD  57

Query  184  EECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVL  363
                 ++  +   DP EK FYD+P+L YTI KP+KNWDEKR  WL+ HPSF  G  NRVL
Sbjct  58   YCPPGREAVDRSSDPLEKTFYDEPELSYTINKPIKNWDEKRVQWLKLHPSFAAGRVNRVL  117

Query  364  VVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            +++GSQ T CKN  GDHLLLR FKNKVDYCR+HGYDIFY      P
Sbjct  118  LLSGSQPTPCKNARGDHLLLRFFKNKVDYCRIHGYDIFYGNTFFHP  163



>ref|XP_010446636.1| PREDICTED: LOW QUALITY PROTEIN: glycosyltransferase 6 [Camelina 
sativa]
Length=428

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 103/159 (65%), Gaps = 10/159 (6%)
 Frame = +1

Query  31   GKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGG--EECSYKQ  204
            GK +   ++ +   G L +  L+W  +   +P+ +F     ++ G +      ++CS   
Sbjct  2    GKYSGTKNSIIFFAGALTSLTLLWSYFLIFSPSSNF-----TITGLLHDKQPVKKCS---  53

Query  205  GFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQA  384
            G ++  DPPE  FYDDPDL Y+IE+ + NWDEKR  WLE HPSF PG  NR+++VTGSQ+
Sbjct  54   GLDMQFDPPEPGFYDDPDLSYSIERSITNWDEKRHQWLESHPSFKPGLENRIVIVTGSQS  113

Query  385  TQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            + CKN IGDHLLLR FKNKVDY R+HG+DIFY   LL P
Sbjct  114  SPCKNPIGDHLLLRCFKNKVDYARIHGHDIFYSNALLHP  152



>ref|NP_680773.1| glycosyltransferase 6 [Arabidopsis thaliana]
 sp|Q9SZG1.1|GT6_ARATH RecName: Full=Glycosyltransferase 6; Short=AtGT6 [Arabidopsis 
thaliana]
 emb|CAB38308.1| putative protein [Arabidopsis thaliana]
 emb|CAB80434.1| putative protein [Arabidopsis thaliana]
 gb|ABH04623.1| At4g37690 [Arabidopsis thaliana]
 gb|AEE86828.1| glycosyltransferase 6 [Arabidopsis thaliana]
 gb|AHL38658.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=432

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 102/160 (64%), Gaps = 12/160 (8%)
 Frame = +1

Query  25   SRGKTAVFF-DAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYK  201
            ++ +TAV   D      G  ++  LVW  ++  +P+      F SL  +  G   +CS  
Sbjct  7    AKTRTAVCLSDGVFFLAGAFMSLTLVWSYFSIFSPS------FTSL--RHDGKPVQCS--  56

Query  202  QGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQ  381
             G ++  DP E  FYDDPDL Y+IEKP+  WDEKR  W E HPSF PG+ NR+++VTGSQ
Sbjct  57   -GLDMQFDPSEPGFYDDPDLSYSIEKPITKWDEKRNQWFESHPSFKPGSENRIVMVTGSQ  115

Query  382  ATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            ++ CKN IGDHLLLR FKNKVDY R+HG+DIFY   LL P
Sbjct  116  SSPCKNPIGDHLLLRCFKNKVDYARIHGHDIFYSNSLLHP  155



>ref|XP_003608541.1| Alpha-6-galactosyltransferase [Medicago truncatula]
Length=462

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 95/144 (66%), Gaps = 1/144 (1%)
 Frame = +1

Query  73   GTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYK-QGFNLGDDPPEKNFYD  249
            G + A + +WG+ +F+ P  + N  F S+  K+       +    G +   DP +K FYD
Sbjct  24   GAMAALLFIWGLSSFITPISNTNPKFNSITTKLKSFNFTTNTDFAGPDFLHDPSDKTFYD  83

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQCKNQIGDHLLLRL  429
            DP   YT++KPVKNWDEKRK WL  HPSF+ GA+ ++LV+TGSQ T+C N IGDHLLLR 
Sbjct  84   DPQTCYTMDKPVKNWDEKRKEWLLHHPSFVVGASEKILVITGSQPTKCDNPIGDHLLLRF  143

Query  430  FKNKVDYCRLHGYDIFYXTVLLQP  501
            FKNKVDYCR+H +DI Y   LL P
Sbjct  144  FKNKVDYCRIHNHDIIYNNALLDP  167



>ref|XP_004234713.2| PREDICTED: glycosyltransferase 6-like [Solanum lycopersicum]
Length=446

 Score =   156 bits (394),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 104/161 (65%), Gaps = 19/161 (12%)
 Frame = +1

Query  25   SRGKTAVFF-DAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYK  201
            S  K + FF + F+  GGTLV   ++  +W+F++P       +P  +          +  
Sbjct  32   SMTKVSSFFSNVFMFVGGTLVTLSIILALWSFISPK------YPKFS----------TIN  75

Query  202  QGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSF-IPGAANRVLVVTGS  378
              FNL D     NFYD+P+L YTIEKP++NWD+KR+ W   HPSF + G  +RVL+V+GS
Sbjct  76   LDFNL-DQEGSTNFYDEPNLSYTIEKPIQNWDDKRRQWFNLHPSFKLEGEKDRVLIVSGS  134

Query  379  QATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            Q+T CKN IGDHLLLR FKNKVDY R+HGYDIFY  VLL+P
Sbjct  135  QSTPCKNPIGDHLLLRFFKNKVDYSRIHGYDIFYNNVLLEP  175



>ref|XP_003539263.1| PREDICTED: galactomannan galactosyltransferase 1-like isoformX1 
[Glycine max]
 ref|XP_006590622.1| PREDICTED: galactomannan galactosyltransferase 1-like isoform 
X2 [Glycine max]
Length=452

 Score =   156 bits (394),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 96/160 (60%), Gaps = 7/160 (4%)
 Frame = +1

Query  28   RGKTAVFF--DAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYK  201
            R KT+  F  D  L  GG   A +LVWG  +F    P     F SL        +   + 
Sbjct  22   RNKTSSVFLSDGSLFLGGAFSALILVWGFSSFTTTIPKETPNFESLTK-----NDAVPHH  76

Query  202  QGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQ  381
               +   DPP++ FYDDP + YT++K V+NWDEKR+ WL+ HPSF  GA  RV +VTGSQ
Sbjct  77   GTPDFNFDPPDRTFYDDPQMGYTMDKKVRNWDEKREEWLKLHPSFAAGARERVFMVTGSQ  136

Query  382  ATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
               C+N IGDHLLLR FKNKVDYCRLHG D+FY   LL P
Sbjct  137  PKPCRNPIGDHLLLRFFKNKVDYCRLHGCDVFYNNALLDP  176



>ref|XP_002868971.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH45230.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=436

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 99/157 (63%), Gaps = 11/157 (7%)
 Frame = +1

Query  37   TAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGE--ECSYKQGF  210
            T    D  +   G  ++  LVW  ++  +P  SF   F  L      GGE  +CS   G 
Sbjct  12   TVCLSDGAIFLAGAFMSLTLVWSYFSIFSP--SFTFTFTGL----RHGGEPVQCS---GL  62

Query  211  NLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQ  390
            N+  DP E  FYDDP+L Y+IEK + NWDEKR  W + HPSF PG+ NR+L+VTGSQ++ 
Sbjct  63   NMQLDPREPGFYDDPELSYSIEKSITNWDEKRHQWFKSHPSFKPGSENRILMVTGSQSSP  122

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            CKN IGDHLLLR FKNKVDY R+HG++IFY   LL P
Sbjct  123  CKNPIGDHLLLRCFKNKVDYARIHGHEIFYSNALLHP  159



>emb|CAB52246.1| alpha galactosyltransferase [Trigonella foenum-graecum]
Length=438

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 97/145 (67%), Gaps = 2/145 (1%)
 Frame = +1

Query  73   GTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYK-QGFNLGDDPPEKNFYD  249
            G + A +++WG+ +F+AP P+ N  F S   K+       +    G +L  DP +K FYD
Sbjct  23   GAMSALLMIWGLNSFIAPIPNSNPKFNSFTTKLKSLNFTTNTNFAGPDLLHDPSDKTFYD  82

Query  250  DPDLRYTI-EKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQCKNQIGDHLLLR  426
            DP+  YT+ +KP+KNWDEKRK WL  HPSF  GA  ++LV+TGSQ T+C N IGDHLLLR
Sbjct  83   DPETCYTMMDKPMKNWDEKRKEWLFHHPSFAAGATEKILVITGSQPTKCDNPIGDHLLLR  142

Query  427  LFKNKVDYCRLHGYDIFYXTVLLQP  501
             +KNKVDYCR+H +DI Y   LL P
Sbjct  143  FYKNKVDYCRIHNHDIIYNNALLHP  167



>emb|CAI11453.1| alpha-6-galactosyltransferase [Nicotiana benthamiana]
Length=443

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 91/133 (68%), Gaps = 4/133 (3%)
 Frame = +1

Query  106  VWAFVAPNPSFNGGFPSLAGKISGGGEECS-YKQGFNLGDDPPEKNFYDDPDLRYTIEKP  282
            +W+F  P P+F+     L+ +     E C   ++  +   DPPEK FYDDPDL YTI KP
Sbjct  34   IWSFTDPFPNFSN---LLSKQNVTSPEYCPPDREAVDRIYDPPEKTFYDDPDLSYTINKP  90

Query  283  VKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLH  462
            +KNW+EKR  WL+ HPSF  G A RVL++TGSQ T CK  IGDHLLLR FKNKVDYCR+H
Sbjct  91   IKNWEEKRIEWLKLHPSFAAGRAKRVLLLTGSQPTPCKYPIGDHLLLRFFKNKVDYCRIH  150

Query  463  GYDIFYXTVLLQP  501
            GYDIFY   LL P
Sbjct  151  GYDIFYGNTLLHP  163



>sp|Q564G7.1|GMGT1_CYATE RecName: Full=Galactomannan galactosyltransferase 1 [Cyamopsis 
tetragonoloba]
 emb|CAI79402.1| galactomannan galactosyltransferase [Cyamopsis tetragonoloba]
Length=435

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = +1

Query  25   SRGKTAVFFDAFLC-TGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGG--EECS  195
            SR K+  +     C   G   A +L+WG+ +F+ P P+ +    S+A  +      +  +
Sbjct  6    SRNKSPKWISNGCCFLLGAFTALLLLWGLCSFIIPIPNTDPKLNSVATSLRSLNFPKNPA  65

Query  196  YKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTG  375
                 NL  DPP+  FYDDP+  YT++KP+KNWDEKRK WL  HPSF   A +++L+VTG
Sbjct  66   ATLPPNLQHDPPDTTFYDDPETSYTMDKPMKNWDEKRKEWLLHHPSFGAAARDKILLVTG  125

Query  376  SQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            SQ  +C N IGDHLLLR FKNKVDYCRLH YDI Y   LL P
Sbjct  126  SQPKRCHNPIGDHLLLRFFKNKVDYCRLHNYDIIYNNALLHP  167



>ref|XP_007205195.1| hypothetical protein PRUPE_ppa005681mg [Prunus persica]
 gb|EMJ06394.1| hypothetical protein PRUPE_ppa005681mg [Prunus persica]
Length=448

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 104/165 (63%), Gaps = 5/165 (3%)
 Frame = +1

Query  16   MSKSRGKT---AVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGE  186
            MSK   +T   +   D+ L   G  +A ++++  ++FV+   S N G    +   +   +
Sbjct  9    MSKPSPRTKPSSWLADSLLFLSGAFLALLVLFTFYSFVSTYSSPNFGRTVTSPPPTAEPD  68

Query  187  ECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLV  366
            +C+     NL  DPP+  FYDD ++RYT+  PV+NWDEKR+ WL  HPS  PGA  R+L+
Sbjct  69   QCA--DDANLRRDPPDPTFYDDREVRYTLGDPVQNWDEKRRQWLLLHPSLAPGAGERILM  126

Query  367  VTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            VTGSQ   C+N IGDHLLLR FKNKVDYCRLHG++IFY   LL P
Sbjct  127  VTGSQPAACRNPIGDHLLLRFFKNKVDYCRLHGHEIFYNNALLHP  171



>ref|XP_010274411.1| PREDICTED: galactomannan galactosyltransferase 1-like [Nelumbo 
nucifera]
Length=467

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 96/161 (60%), Gaps = 11/161 (7%)
 Frame = +1

Query  52   DAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGK---------ISGGGEECSYKQ  204
            DA L  GG +VA +L   +W+ + P P+    F S   +          S    +     
Sbjct  32   DAILFVGGVMVALLLFCALWSSIMPVPNPTPTFSSAVTRPKPSVSEVFASDDCAQVVVSM  91

Query  205  GFNLGDDPPEKNFYDDPDLRYTIEK--PVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGS  378
              N   DP    FYDDP+L Y ++K  P+KNWD+KR+ WL+ HP F PG   R+L+V+GS
Sbjct  92   RVNRSHDPSSPTFYDDPNLSYYVDKDKPIKNWDKKRREWLKHHPYFSPGIQERILLVSGS  151

Query  379  QATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            Q + C+N IGDHLLLR FKNKVDYCR+HGYDIFY  VLL P
Sbjct  152  QPSPCQNPIGDHLLLRFFKNKVDYCRIHGYDIFYNNVLLHP  192



>ref|XP_008238162.1| PREDICTED: glycosyltransferase 6-like [Prunus mume]
Length=417

 Score =   153 bits (386),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 94/162 (58%), Gaps = 8/162 (5%)
 Frame = +1

Query  16   MSKSRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECS  195
            M+KS  +T    D F    G        W +       P F  GF   + K S  G E  
Sbjct  1    MAKSIHQTKPCADGFCFLAGLFFGLFCFWSL-TLYHYKPHF--GFIPFSAKASDYGAEAP  57

Query  196  YKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTG  375
                  L  DPP + FYDDP+L Y IEKPV NWD+KR+ WL+ HPSF  G+ +RVL+VTG
Sbjct  58   I-----LHSDPPHETFYDDPELSYFIEKPVNNWDQKRRVWLDLHPSFTAGSRDRVLLVTG  112

Query  376  SQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            SQ + CKN IGDHLLLR FKNK DYCRLHG+DIFY    L P
Sbjct  113  SQPSVCKNPIGDHLLLRFFKNKADYCRLHGHDIFYNDAYLHP  154



>ref|XP_008363062.1| PREDICTED: glycosyltransferase 6-like [Malus domestica]
Length=442

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 96/156 (62%), Gaps = 12/156 (8%)
 Frame = +1

Query  40   AVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYKQGFNLG  219
            ++  D FL  GG  +A  +VW +  F+ P       F      I+     C    G +L 
Sbjct  23   SLIADGFLFVGGASLALSVVWALLTFINPTTISFDNF------IAWNAGPC----GPDLR  72

Query  220  DDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAA--NRVLVVTGSQATQC  393
             DPPE  FYDD +L Y   +PVK+WD KRK WL+ HPSF  GAA  NRVL+VTGSQ T C
Sbjct  73   SDPPETTFYDDENLSYAFGEPVKDWDSKRKEWLKLHPSFAAGAAVDNRVLLVTGSQPTVC  132

Query  394  KNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            KN +GDHL +RLFKNKVDYCR+HG DIFY  VLL P
Sbjct  133  KNPVGDHLQMRLFKNKVDYCRIHGLDIFYNNVLLDP  168



>ref|XP_009361779.1| PREDICTED: glycosyltransferase 6-like [Pyrus x bretschneideri]
Length=442

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 96/156 (62%), Gaps = 12/156 (8%)
 Frame = +1

Query  40   AVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYKQGFNLG  219
            ++  D FL  GG  +A  +VW +  F+ P         S    I+     C    G +L 
Sbjct  23   SLIADGFLFVGGASLALSVVWALLTFINPTTI------SFDNIITWNAGPC----GPDLR  72

Query  220  DDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAA--NRVLVVTGSQATQC  393
             DPPE  FYDD +L Y   +PVK+WD KR+ WL+ HPSF  GAA  NRVL+VTGSQ T C
Sbjct  73   SDPPEPTFYDDENLSYAFGEPVKDWDSKRREWLKLHPSFAAGAAVDNRVLLVTGSQPTVC  132

Query  394  KNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            KN +GDHL LRLFKNKVDYCR+HG DIFY  VLL P
Sbjct  133  KNPVGDHLQLRLFKNKVDYCRIHGLDIFYNNVLLDP  168



>ref|NP_001281283.1| putative glycosyltransferase 7 [Malus domestica]
 gb|ADL36662.1| CAMTA domain class transcription factor [Malus domestica]
Length=442

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 97/156 (62%), Gaps = 12/156 (8%)
 Frame = +1

Query  40   AVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYKQGFNLG  219
            ++  D FL  GG  +A  +VW +  F+ P         SL   I+     C    G +L 
Sbjct  23   SLIADGFLFVGGASLALSVVWALLTFINPTTI------SLDSIIAWNAGPC----GPDLS  72

Query  220  DDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAA--NRVLVVTGSQATQC  393
             D PE  FYDD +L Y   +PVK+WD KR+ WL+ HPSF  GAA  NRVL+VTGSQ T C
Sbjct  73   SDSPEPTFYDDENLSYAFGEPVKDWDSKRREWLKLHPSFAAGAAADNRVLLVTGSQPTVC  132

Query  394  KNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            KN +GDHL LR FKNKVDYCR+HG+DIFY +VLL P
Sbjct  133  KNPVGDHLQLRFFKNKVDYCRIHGHDIFYNSVLLDP  168



>ref|XP_004288265.1| PREDICTED: galactomannan galactosyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=457

 Score =   151 bits (381),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 91/133 (68%), Gaps = 3/133 (2%)
 Frame = +1

Query  106  VWAFVAPNPSFNGGF-PSLAGKISGGGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKP  282
            +++F+ P+PS +  F  ++   IS  G       G +L  DPP++ FYDDP+L YTI  P
Sbjct  46   IYSFINPSPSSSPNFGRAVTPPISNPGRHSD--PGPDLMSDPPDRTFYDDPELTYTIGSP  103

Query  283  VKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLH  462
            VKNWDEKR+ WL  HPSF  GAA R+L+VTGSQ + CKN IGDHLLLR FKNKVDY R+H
Sbjct  104  VKNWDEKRRQWLMYHPSFGAGAAERILMVTGSQPSACKNHIGDHLLLRFFKNKVDYSRIH  163

Query  463  GYDIFYXTVLLQP  501
            G D+FY    + P
Sbjct  164  GIDLFYNNAFMHP  176



>ref|NP_195544.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
thaliana]
 emb|CAB37487.1| putative protein [Arabidopsis thaliana]
 emb|CAB80496.1| putative protein [Arabidopsis thaliana]
 gb|ABJ98587.1| At4g38310 [Arabidopsis thaliana]
 gb|AEE86912.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
thaliana]
 gb|AHL38653.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=120

 Score =   142 bits (359),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = +1

Query  223  DPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQCKNQ  402
            DPPE  FYDDPDL Y+IEK + NWDEKR  W + HPSF PG+ NR+L+VTGSQ++ CKN 
Sbjct  4    DPPEPGFYDDPDLSYSIEKSITNWDEKRHEWFKSHPSFKPGSENRILMVTGSQSSPCKNP  63

Query  403  IGDH-LLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            IGDH LLLR FKNKVDY R+HG+DIFY   LL P
Sbjct  64   IGDHLLLLRCFKNKVDYARIHGHDIFYSNSLLHP  97



>ref|XP_009345079.1| PREDICTED: putative glycosyltransferase 7 [Pyrus x bretschneideri]
Length=442

 Score =   150 bits (380),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 96/157 (61%), Gaps = 14/157 (9%)
 Frame = +1

Query  40   AVFFDAFLCTGGTLVAFVLVWGVWAFVAPNP-SFNGGFPSLAGKISGGGEECSYKQGFNL  216
            ++  D FL  GG  +A  +VW    F+ P   SF+      AG             G +L
Sbjct  23   SLIADGFLFVGGASLALSVVWAFLTFINPTTISFDSILAWNAGPC-----------GPDL  71

Query  217  GDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAA--NRVLVVTGSQATQ  390
              DPPE  FYDD +L Y   +PVK+WD KR+ WL+ HPSF  GA   NRVL+VTGSQ T 
Sbjct  72   SSDPPEPTFYDDENLSYAFGEPVKDWDSKRREWLKLHPSFAAGAEADNRVLLVTGSQPTA  131

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            CKN +GDHL LR FKNKVDYCR+HG+DIFY +VLL P
Sbjct  132  CKNPVGDHLQLRFFKNKVDYCRIHGHDIFYNSVLLDP  168



>ref|XP_011073681.1| PREDICTED: glycosyltransferase 6 [Sesamum indicum]
Length=466

 Score =   150 bits (380),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 111/181 (61%), Gaps = 18/181 (10%)
 Frame = +1

Query  13   SMSKSRGKT---AVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGG  183
            SM+K+ G++       D  +  GG LVAF++VW  W+F +P+PS    F + + K+  G 
Sbjct  13   SMAKNNGRSKPRGFLSDGVIFCGGALVAFLVVWAFWSFFSPSPSPTPSFSTSSFKLPHGS  72

Query  184  EE-------------CSYK-QGFNLGDDPPEKNFYDDPDLRYTIEKPV-KNWDEKRKAWL  318
            E              C+Y     N   D PE NFYDDP L Y I+ PV KNWDEKR+ WL
Sbjct  73   ETSSSSSPSAAASSTCAYNVSSPNPLHDLPEPNFYDDPGLSYRIDAPVVKNWDEKRREWL  132

Query  319  EQHPSFIPGAANRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQ  498
            +QHP+   GA NRVL+VTGSQA  CKN IGD+LLL+ FKNKVDY R HG DIFY  VL Q
Sbjct  133  KQHPALAAGAENRVLMVTGSQAKPCKNPIGDYLLLKFFKNKVDYSRRHGIDIFYNNVLFQ  192

Query  499  P  501
            P
Sbjct  193  P  193



>ref|XP_010437192.1| PREDICTED: glycosyltransferase 6-like [Camelina sativa]
Length=429

 Score =   150 bits (378),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 101/158 (64%), Gaps = 10/158 (6%)
 Frame = +1

Query  31   GKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGG--EECSYKQ  204
            GK +   ++ +   G   +  L+W  + F + + +F     ++ G +      ++CS   
Sbjct  2    GKYSGTKNSVIFFAGAFTSLTLIWSYFLFFSASSNF-----AITGLLHDKEPVKKCS---  53

Query  205  GFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQA  384
            G ++  DPPE  FYDDPDL Y+IE+ + NWDEKR  W+E HPSF PG  NR+++VTGSQ+
Sbjct  54   GLDMQFDPPEPGFYDDPDLSYSIERSITNWDEKRYQWIESHPSFKPGLENRIVMVTGSQS  113

Query  385  TQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQ  498
            + CKN IGDHLLLR FKNKVDY R+HG+DIFY   LL 
Sbjct  114  SPCKNPIGDHLLLRCFKNKVDYARIHGHDIFYSNALLH  151



>gb|ACF33172.1| putative galactosyl transferase [Coffea canephora]
Length=232

 Score =   145 bits (366),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 94/161 (58%), Gaps = 3/161 (2%)
 Frame = +1

Query  22   KSRGKTAVFF-DAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSY  198
            K   K   FF D        LVA +L + +W+F     ++     S     +      S 
Sbjct  5    KVHTKAPTFFRDCRSFILAVLVAILLFYALWSFT--ETAWTNLSVSTIFSNTTTDHCTSQ  62

Query  199  KQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGS  378
             Q  N   DPPE  FYDDP+L YT++KP+ NWD+KRK+WL+ HPSF     +R+L++TGS
Sbjct  63   PQSLNRTHDPPEPTFYDDPELCYTLDKPIDNWDDKRKSWLKLHPSFADNIQDRILLLTGS  122

Query  379  QATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            Q + CK+ IGDHLLLR FKNK DYCR+HGYDIFY      P
Sbjct  123  QPSPCKSPIGDHLLLRGFKNKADYCRIHGYDIFYSNACFDP  163



>ref|XP_006857127.1| hypothetical protein AMTR_s00065p00144450 [Amborella trichopoda]
 gb|ERN18594.1| hypothetical protein AMTR_s00065p00144450 [Amborella trichopoda]
Length=478

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 98/162 (60%), Gaps = 4/162 (2%)
 Frame = +1

Query  22   KSRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGG--GEECS  195
            K R K     D  + TGG + A +L++ +++   P       F  +  +        +C 
Sbjct  43   KCRLKPDHLTDTLIFTGGAMAALLLIYAIYSLCNPTAITTTSFSEVKPQNPNPPLAHDCH  102

Query  196  YKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTG  375
            + +  N     P   FYDDP+L Y +EKP+KNWD+ R+ W+EQ+PS    +  +VL+VTG
Sbjct  103  HPKLQNPFSTIP--TFYDDPNLSYRVEKPIKNWDQNRRQWMEQNPSLSLNSEEKVLLVTG  160

Query  376  SQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            SQA  C+N +GDHLLLR FKNKVDYCRLHGYDIFY T+L QP
Sbjct  161  SQAKPCRNPVGDHLLLRFFKNKVDYCRLHGYDIFYNTLLFQP  202



>gb|EYU44512.1| hypothetical protein MIMGU_mgv1a0180271mg, partial [Erythranthe 
guttata]
Length=131

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 82/133 (62%), Gaps = 7/133 (5%)
 Frame = +1

Query  82   VAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYKQGFNLGDDPPEKNFYDDPDL  261
             A +    VW F  P  +F+    +      GG          N      EK FYDDP+ 
Sbjct  3    AAILTFLAVWTFADPRATFSSLLSARNAAACGGAST-------NTSQISTEKTFYDDPET  55

Query  262  RYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQCKNQIGDHLLLRLFKNK  441
            RYTI+KP+ NWDEKRK WL  +P+F P + N V++VTGSQ + CKN +GDHLLLR FKNK
Sbjct  56   RYTIDKPMINWDEKRKHWLNHNPTFGPKSKNGVIIVTGSQPSACKNPLGDHLLLRFFKNK  115

Query  442  VDYCRLHGYDIFY  480
            +DYCR+HGY+IFY
Sbjct  116  IDYCRIHGYEIFY  128



>ref|XP_010028081.1| PREDICTED: putative glycosyltransferase 7 [Eucalyptus grandis]
 gb|KCW54740.1| hypothetical protein EUGRSUZ_I00693 [Eucalyptus grandis]
Length=460

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 106/171 (62%), Gaps = 6/171 (4%)
 Frame = +1

Query  7    ASSMSKS---RGKTAVFF-DAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKIS  174
            AS+M+K    R + ++ F DA L  GG L+A +LVW   +F  P  +      S +   +
Sbjct  6    ASTMAKHALLRNRASLCFSDACLFLGGVLMALLLVWSFSSFAYPPSASQTLAASSSSAAA  65

Query  175  GGGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAA-  351
                EC+        D     NFYDDP+L Y++E+P++ WDEKR+ WL QHPS   G   
Sbjct  66   EAPPECAAAAAAPPRDSEESDNFYDDPELSYSMERPMRGWDEKRREWLRQHPSLASGEGG  125

Query  352  -NRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
              RV++VTGSQ + CKN+IGDHLLLR FKNKVDYCRLHG D+FY  VLLQP
Sbjct  126  RERVVLVTGSQPSPCKNKIGDHLLLRFFKNKVDYCRLHGCDVFYNNVLLQP  176



>ref|XP_008392336.1| PREDICTED: putative glycosyltransferase 7 [Malus domestica]
Length=442

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 94/156 (60%), Gaps = 12/156 (8%)
 Frame = +1

Query  40   AVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYKQGFNLG  219
            ++  D FL  GG  +A  +VW +  F+ P         S    I+     C    G +L 
Sbjct  23   SLIADGFLFVGGASLALSVVWALLTFINPTTI------SFDNXIAWNAGPC----GPDLR  72

Query  220  DDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAA--NRVLVVTGSQATQC  393
             DPPE  FYDD +L Y   +PVK+WD KR  WL+ HPSF  GAA  NRVL+VTGSQ T C
Sbjct  73   SDPPEXTFYDDENLSYAFGEPVKDWDSKRXEWLKLHPSFAAGAAVDNRVLLVTGSQPTVC  132

Query  394  KNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            KN +GDHL  RLFKNKVDYCR+HG DIFY  VLL P
Sbjct  133  KNPVGDHLQXRLFKNKVDYCRIHGLDIFYNNVLLDP  168



>ref|XP_006350640.1| PREDICTED: putative glycosyltransferase 7-like [Solanum tuberosum]
Length=411

 Score =   147 bits (372),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 102/156 (65%), Gaps = 21/156 (13%)
 Frame = +1

Query  37   TAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYKQGFNL  216
            ++ F + F+  GGTLV   +V  +W+F++P       +PS +          +    FNL
Sbjct  5    SSFFSNVFMFVGGTLV---IVLALWSFMSPK------YPSFS----------TINLDFNL  45

Query  217  GDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSF-IPGAANRVLVVTGSQATQC  393
             D     NFYD+P+L YTIEKP++NW++KR+ W   HPSF + G   R+L+V+GSQ+T C
Sbjct  46   -DQEGSTNFYDEPNLSYTIEKPIQNWNDKRRQWFNLHPSFKLEGEKERILIVSGSQSTPC  104

Query  394  KNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            KN +GDHLLLR FKNKVDY R+HGYDIFY  VLL+P
Sbjct  105  KNPVGDHLLLRFFKNKVDYSRIHGYDIFYNDVLLEP  140



>ref|XP_008237711.1| PREDICTED: galactomannan galactosyltransferase 1-like [Prunus 
mume]
 ref|XP_008237720.1| PREDICTED: galactomannan galactosyltransferase 1-like [Prunus 
mume]
Length=448

 Score =   148 bits (373),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 102/165 (62%), Gaps = 5/165 (3%)
 Frame = +1

Query  16   MSKSRGKT---AVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGE  186
            MSK   +T   +   D+ L   G  +A ++++  ++FV+   S N      +   +   +
Sbjct  9    MSKPSPRTKPSSWLADSVLFFSGAFLALLVLFTFYSFVSTYSSPNFARTVTSPPPTAEPD  68

Query  187  ECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLV  366
            +C+     NL  DPP+  FYDD ++RYT+  PV+NWDEKR+ WL  HPS   GA  R+L+
Sbjct  69   QCA--DDANLRRDPPDPTFYDDREVRYTLGDPVQNWDEKRQQWLLLHPSLAAGAGERILM  126

Query  367  VTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            VTGSQ   C+N IGDHLLLR FKNKVDYCRLHG++IFY   LL P
Sbjct  127  VTGSQPAACRNPIGDHLLLRFFKNKVDYCRLHGHEIFYNNALLHP  171



>ref|XP_009362595.1| PREDICTED: LOW QUALITY PROTEIN: galactomannan galactosyltransferase 
1-like [Pyrus x bretschneideri]
Length=495

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 107/169 (63%), Gaps = 7/169 (4%)
 Frame = +1

Query  1    KMASSMSKSRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPN--PSFNGGFPSLAGKIS  174
            +M+   +++R  + V  D  L  GG  +A +L+  +W FV P+  P+FN         + 
Sbjct  54   QMSKPYARTRPSSWVA-DGLLFFGGAFIALLLLLTLWTFVTPSSIPNFNRTVAPPPTAVE  112

Query  175  GGGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAAN  354
               ++C+     +L  DP  + FYDD ++RYT+ +PV++WDEKR+ WL  HPS   GA  
Sbjct  113  T--DQCA--DDSDLRRDPRNRTFYDDREVRYTLGQPVRDWDEKRRQWLLHHPSLAVGAGE  168

Query  355  RVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            R+L+VTGSQ + CKN IGDHLLLR FKNKVDYCR+HG++IFY   LL P
Sbjct  169  RILMVTGSQPSACKNPIGDHLLLRFFKNKVDYCRIHGHEIFYNNALLHP  217



>ref|XP_007208181.1| hypothetical protein PRUPE_ppa017391mg, partial [Prunus persica]
 gb|EMJ09380.1| hypothetical protein PRUPE_ppa017391mg, partial [Prunus persica]
Length=366

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +1

Query  214  LGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQC  393
            L  DPP + FYDDP+L Y IEKPV NWD+KR  WL+ HPSF  G+ +RVL+VTGSQ + C
Sbjct  8    LHSDPPHETFYDDPELSYFIEKPVNNWDQKRHVWLDLHPSFTAGSRDRVLLVTGSQPSVC  67

Query  394  KNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            KN IGDHLLLR FKNKVDYCRLHG+DIFY    L P
Sbjct  68   KNPIGDHLLLRFFKNKVDYCRLHGHDIFYNDAYLHP  103



>ref|XP_004294205.1| PREDICTED: galactomannan galactosyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=434

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 94/154 (61%), Gaps = 14/154 (9%)
 Frame = +1

Query  40   AVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYKQGFNLG  219
            ++  D FL  GG  +A  LVW + +F+ P  +F+                 S  Q  +  
Sbjct  24   SLIADGFLFVGGAAMALSLVWALISFINPTSTFDTII------------TYSTPQAPDFT  71

Query  220  DDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQCKN  399
             DPPE  FYDDP L Y++   ++NWDEKR+ WL  HPSF  G  +RV++VTGSQ + CKN
Sbjct  72   YDPPEPTFYDDPTLSYSVGDAIQNWDEKRREWLRVHPSF--GVGDRVVLVTGSQPSVCKN  129

Query  400  QIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
             +GDHL LRLFKNKVDYCRLHG ++FY  VLL P
Sbjct  130  PVGDHLQLRLFKNKVDYCRLHGCEVFYNNVLLDP  163



>ref|XP_008347885.1| PREDICTED: galactomannan galactosyltransferase 1-like [Malus 
domestica]
Length=449

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 106/171 (62%), Gaps = 11/171 (6%)
 Frame = +1

Query  1    KMASSMSKSRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPN--PSFNGGF--PSLAGK  168
            +M+   +++R  + V  D  L  GG  +A +L+  +W FV P+  P+FN     P  A +
Sbjct  8    QMSKPYARARPSSWVA-DGLLFFGGAFIALLLLLTLWTFVTPSSIPNFNRTVAPPPTAAE  66

Query  169  ISGGGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGA  348
                 ++       +L  DP  + FYDD ++RYT+ +PV++WDEKR  WL  HPS   GA
Sbjct  67   PDQCADDA------DLRRDPRNRTFYDDREVRYTLGQPVRDWDEKRWQWLLHHPSLASGA  120

Query  349  ANRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
              R+L+VTGSQ + CKN IGDHLLLR FKNKVDYCR+HG++IFY   LL P
Sbjct  121  GERILMVTGSQPSACKNPIGDHLLLRFFKNKVDYCRIHGHEIFYNNALLHP  171



>gb|ADL36661.1| CAMTA domain class transcription factor [Malus domestica]
Length=449

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 106/171 (62%), Gaps = 11/171 (6%)
 Frame = +1

Query  1    KMASSMSKSRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPN--PSFNGGF--PSLAGK  168
            +M+   +++R  + V  D  L  GG  +A +L+  +W FV P+  P+FN     P  A +
Sbjct  8    QMSKPYARARPSSWVA-DGLLFFGGAFIALLLLLTLWTFVTPSSIPNFNRTVAPPPTAAE  66

Query  169  ISGGGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGA  348
                 ++       +L  DP  + FYDD ++RYT+ +PV++WDEKR  WL  HPS   GA
Sbjct  67   PDQCADDA------DLRRDPRNRTFYDDREVRYTLGQPVRDWDEKRWQWLLHHPSLASGA  120

Query  349  ANRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
              R+L+VTGSQ + CKN IGDHLLLR FKNKVDYCR+HG++IFY   LL P
Sbjct  121  GERILMVTGSQPSACKNPIGDHLLLRFFKNKVDYCRIHGHEIFYNNALLHP  171



>ref|XP_002513422.1| transferase, putative [Ricinus communis]
 gb|EEF48825.1| transferase, putative [Ricinus communis]
Length=424

 Score =   145 bits (366),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 96/150 (64%), Gaps = 15/150 (10%)
 Frame = +1

Query  52   DAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYKQGFNLGDDPP  231
            D FL  GG +VA  L+W +   +   PSF    P LA  +           G NL  DPP
Sbjct  24   DGFLFVGGAVVAISLLWSLLFLLNSEPSFQ---PPLAPSVD---------HGINLSYDPP  71

Query  232  EKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQCKNQIGD  411
            +  FYDDP+L Y+IE  +K+WD KR  WL+ HPSF   A+N++L+V+GSQ   CKN +GD
Sbjct  72   DPTFYDDPNLSYSIESSIKDWDAKRMEWLKHHPSF---ASNQILLVSGSQPLACKNTVGD  128

Query  412  HLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            +LLLR FKNKVDYCR+HGYDIFY  +LL P
Sbjct  129  NLLLRFFKNKVDYCRIHGYDIFYNNLLLHP  158



>ref|XP_004511818.1| PREDICTED: galactomannan galactosyltransferase 1-like [Cicer 
arietinum]
Length=458

 Score =   145 bits (367),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 100/166 (60%), Gaps = 9/166 (5%)
 Frame = +1

Query  4    MASSMSKSRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGG  183
            MA    +++  +    D  L  GG   A +LVWG  +F     S N   P+L        
Sbjct  29   MAKPTFRNKSSSIFLSDGLLFLGGAFSALLLVWGFSSFTN---SINN--PNLKLH---QN  80

Query  184  EECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVL  363
            +  SY    +L  DP +  FYD+P++ YTI+  V+NWDEKR+ WL+ HPSF  G   RVL
Sbjct  81   DVISYSTP-DLLSDPLDPTFYDEPEMGYTIDDKVQNWDEKREEWLKLHPSFSAGVKERVL  139

Query  364  VVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            +VTGSQ + C+N IGDHLLLR FKNKVDYCR+HGYDIFY   LL P
Sbjct  140  MVTGSQPSPCRNPIGDHLLLRCFKNKVDYCRIHGYDIFYNNGLLDP  185



>gb|ACF33173.1| putative galactomannan galactosyl transferase [Coffea canephora]
Length=447

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 93/161 (58%), Gaps = 2/161 (1%)
 Frame = +1

Query  25   SRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYKQ  204
            SR K      +++    +   F+ V+     V    S     PS   +IS  G +    +
Sbjct  2    SRAKAQTKQSSYISRDSSRSYFLAVFVSMVLVFVICSLTETLPSFQNRISTTGADTCNGE  61

Query  205  --GFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGS  378
                N   DP E  FYD+P+L YT+ K +K+WD+KRK+WL  HPSF  GA  R+L+VTGS
Sbjct  62   PPAVNRTHDPKEATFYDEPELTYTLGKTIKDWDKKRKSWLNLHPSFAAGADTRILIVTGS  121

Query  379  QATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            Q + CKN IGDHLLLR FKNK DY R+HGYDIFY T  L P
Sbjct  122  QPSPCKNPIGDHLLLRCFKNKADYSRIHGYDIFYNTACLDP  162



>emb|CDP02617.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 97/165 (59%), Gaps = 11/165 (7%)
 Frame = +1

Query  22   KSRGKTAVFF-DAFLCTGGTLVAFVLVWGVWAFVAP---NPSFNGGFPSLAGKISGGGEE  189
            K   K   FF D        LVA +L + +W+F      N S +  F +         + 
Sbjct  5    KVHTKAPTFFRDCRSFILAVLVAILLFYALWSFTETAWTNLSVSTIFSNTTT------DH  58

Query  190  C-SYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLV  366
            C S  Q  N   DPPE  FYDDP+L YT++KP+ NWD+KRK+WL+ HPSF     +R+L+
Sbjct  59   CTSQPQSLNRTHDPPEPTFYDDPELCYTLDKPIDNWDDKRKSWLKLHPSFADNIQDRILL  118

Query  367  VTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            +TGSQ + CK+ IGDHLLLR FKNK DYCR+HGYDIFY      P
Sbjct  119  LTGSQPSPCKSPIGDHLLLRGFKNKADYCRIHGYDIFYSNACFDP  163



>emb|CDP02619.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 90/141 (64%), Gaps = 9/141 (6%)
 Frame = +1

Query  82   VAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYKQGFNLGDDPPEKNFYDDPDL  261
            +  +LV  +W+F  P       FP+L      G    S  Q FN  DDP E  FYDDP++
Sbjct  56   ITVLLVCVIWSFTGPF----SNFPTLFSSDCSG----SPGQFFNRADDPQETTFYDDPEI  107

Query  262  RYTIE-KPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQCKNQIGDHLLLRLFKN  438
             YT++  PVKNWDEKRK WL+ HP+F  G  NR+L++TGSQ + CK+  GDHLLLR FKN
Sbjct  108  SYTVDGNPVKNWDEKRKEWLKLHPTFAAGVQNRMLLLTGSQPSPCKSPSGDHLLLRCFKN  167

Query  439  KVDYCRLHGYDIFYXTVLLQP  501
            KVDYCR+HG D+FY    L P
Sbjct  168  KVDYCRIHGCDVFYNNAYLNP  188



>emb|CDP02618.1| unnamed protein product [Coffea canephora]
Length=447

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 93/161 (58%), Gaps = 2/161 (1%)
 Frame = +1

Query  25   SRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYKQ  204
            SR K      +++    +   F+ V+     V    S     PS   +IS  G +    +
Sbjct  2    SRAKAQTKQSSYISRDSSRSYFLAVFVSMVLVFVICSLTETLPSFQNRISTTGADTCNGE  61

Query  205  --GFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGS  378
                N   DP +  FYD+P+L YT+ K +K+WD+KRK+WL  HPSF  GA  R+L+VTGS
Sbjct  62   PPAVNRTHDPKQATFYDEPELTYTLGKTIKDWDKKRKSWLNLHPSFAAGADTRILIVTGS  121

Query  379  QATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            Q + CKN IGDHLLLR FKNK DY R+HGYDIFY T  L P
Sbjct  122  QPSPCKNPIGDHLLLRCFKNKADYSRIHGYDIFYNTACLDP  162



>ref|XP_009777954.1| PREDICTED: putative glycosyltransferase 7 isoform X2 [Nicotiana 
sylvestris]
Length=412

 Score =   142 bits (357),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 7/139 (5%)
 Frame = +1

Query  28   RGKTAVFF-DAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYKQ  204
            R K A FF D F+  GGTLVA ++   +W+F++PNPSF+    S +  ++      S   
Sbjct  7    RTKVASFFSDGFVFVGGTLVAVLVFLAIWSFISPNPSFSTIMMSKSNTLN------SKSA  60

Query  205  GFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQA  384
             FNL  D  E  FYDD DL Y IEKP+KNWDEKR  WL+ HP+F  G   R+LVV+GSQ+
Sbjct  61   VFNLNQDSQEPTFYDDQDLNYGIEKPIKNWDEKRSKWLKLHPTFNHGVKERILVVSGSQS  120

Query  385  TQCKNQIGDHLLLRLFKNK  441
              CKN +GDHLLLR +KNK
Sbjct  121  MPCKNPMGDHLLLRFYKNK  139



>ref|XP_009362594.1| PREDICTED: glycosyltransferase 6-like [Pyrus x bretschneideri]
Length=422

 Score =   142 bits (357),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +1

Query  223  DPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQCKNQ  402
            DP +  FYDDP+L Y IE PVKNWD+KR+ WL+ HPS   G+ +RVL+VTGSQ ++CKN 
Sbjct  66   DPIDTTFYDDPELSYFIESPVKNWDQKRRVWLDLHPSLASGSRDRVLLVTGSQPSKCKNP  125

Query  403  IGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            IGDHLLLRLFKNKVDYCRLHG+DIFY    L P
Sbjct  126  IGDHLLLRLFKNKVDYCRLHGHDIFYNNAYLHP  158



>ref|XP_008226081.1| PREDICTED: putative glycosyltransferase 7 [Prunus mume]
Length=439

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 97/154 (63%), Gaps = 13/154 (8%)
 Frame = +1

Query  40   AVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYKQGFNLG  219
            ++  D FL  GG  +A  LVW +  F+ P+ S +          S GG  C    G +LG
Sbjct  24   SLIADGFLFVGGASMALSLVWALLTFINPSTSIDNII-----TWSTGG--C----GPDLG  72

Query  220  DDPPEKNFYDDPDLRYTI-EKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQCK  396
             DP E  FYDDP+L Y   E+P+K+WD KR+ WL+ HPSF   +  +VL+VTGSQ   CK
Sbjct  73   SDPSEPTFYDDPNLSYAFGEEPMKDWDLKRREWLKLHPSF-AASEEKVLLVTGSQPNVCK  131

Query  397  NQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQ  498
            N +GDHL LRLFKNKVDYCR+HG++IFY  VLL 
Sbjct  132  NPVGDHLQLRLFKNKVDYCRIHGHEIFYNNVLLN  165



>gb|KDP25125.1| hypothetical protein JCGZ_22660 [Jatropha curcas]
Length=432

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 76/100 (76%), Gaps = 1/100 (1%)
 Frame = +1

Query  205  GFNLGDDPPEKNFYDDPD-LRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQ  381
              N+  DPP++ FYDD D L Y+I+  VKNWD KRK WL  HPSF  G++NR+L+VTGSQ
Sbjct  67   AVNMSYDPPDRTFYDDVDFLNYSIDSSVKNWDVKRKEWLNFHPSFASGSSNRILLVTGSQ  126

Query  382  ATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
               CKN IGD+LLLR FKNKVDYCRLHGYDIFY  VLL P
Sbjct  127  PFACKNPIGDNLLLRFFKNKVDYCRLHGYDIFYNNVLLHP  166



>gb|ACH58908.1| galactosyl transferase [Coffea canephora]
Length=444

 Score =   139 bits (351),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 95/165 (58%), Gaps = 11/165 (7%)
 Frame = +1

Query  22   KSRGKTAVFF-DAFLCTGGTLVAFVLVWGVWAFVAP---NPSFNGGFPSLAGKISGGGEE  189
            K   K   FF D        LVA +L + +W+F      N S +  F +         + 
Sbjct  5    KVHTKAPTFFRDCRSFILAVLVAILLFYALWSFTETAWTNLSVSAIFSNTTT------DH  58

Query  190  C-SYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLV  366
            C S  Q  N   DPPE  FYDDP+L YT++KP+ NWD+KRK+WL+ HPSF     +R+L+
Sbjct  59   CTSQPQSLNRAHDPPEPTFYDDPELCYTLDKPIDNWDDKRKSWLKLHPSFADSIQDRILL  118

Query  367  VTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            +TGSQ + CK+ IGDHLLLR  KNK DYCR+HGY IFY      P
Sbjct  119  LTGSQPSPCKSPIGDHLLLRGSKNKADYCRIHGYGIFYSNACFDP  163



>ref|XP_003608540.1| Galactomannan galactosyltransferase [Medicago truncatula]
 gb|AES90737.1| galactosyl transferase GMA12/MNN10 family protein [Medicago truncatula]
Length=422

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +1

Query  190  CSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVV  369
            C  K       DPPEK FYDDP L Y++E+P+K WD+KR  WL+ HPSF  GA++R+LV+
Sbjct  49   CPNKTMSEAIQDPPEKTFYDDPTLSYSVEEPMKQWDKKRSHWLQLHPSFAAGASDRILVL  108

Query  370  TGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            TGSQ T CKN IGDHLLLR FKNKVDYCR+H  +++Y  + L P
Sbjct  109  TGSQPTPCKNPIGDHLLLRCFKNKVDYCRIHNCEVYYSNLHLHP  152



>ref|XP_010679659.1| PREDICTED: putative glycosyltransferase 7 [Beta vulgaris subsp. 
vulgaris]
Length=431

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 95/155 (61%), Gaps = 15/155 (10%)
 Frame = +1

Query  37   TAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYKQGFNL  216
            T++  D  +  GG LVAF+L+W +W F AP  S +   P L  +     +          
Sbjct  25   TSLSSDVVMFLGGALVAFLLIWSLWCFTAPPSSSSSFSPPLPTQTQTQVQ----------  74

Query  217  GDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQCK  396
               P    FYDDP++ YT+E PV+NWDEKRK W+ ++PS      ++V++VTGSQ   CK
Sbjct  75   ---PDPTTFYDDPEMGYTLESPVQNWDEKRKQWMGRNPSI--SGPDKVVMVTGSQPGPCK  129

Query  397  NQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            N +GDH LLR FKNKVDYCR+HGYDIFY  VLL P
Sbjct  130  NPMGDHFLLRFFKNKVDYCRIHGYDIFYNNVLLDP  164



>ref|XP_011099400.1| PREDICTED: glycosyltransferase 6-like [Sesamum indicum]
Length=430

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 100/168 (60%), Gaps = 18/168 (11%)
 Frame = +1

Query  4    MASSMSKSRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGF--PSLAGKISG  177
            M  + + SR ++       LC    + A +    +WAF  P PSF+     P++   + G
Sbjct  1    MPKTSTSSRHRS-------LCVTAAVTALLFC-ALWAFSDPLPSFSTLLSNPNIKECLQG  52

Query  178  GGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANR  357
            G       +  ++  +P  K FYDDP+++YTI+KPV  WDEKR  WL+ + + +  + NR
Sbjct  53   G-------RALDMNQEPLHKTFYDDPNIQYTIDKPVIGWDEKRSEWLKHYTTTM-FSRNR  104

Query  358  VLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            VLVVTGSQ + CKN  GDHLLLR FKNKVDY R+HGYDIFY   LL P
Sbjct  105  VLVVTGSQPSPCKNPSGDHLLLRCFKNKVDYSRIHGYDIFYNNALLDP  152



>ref|XP_008362135.1| PREDICTED: galactomannan galactosyltransferase 1-like [Malus 
domestica]
Length=504

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +1

Query  211  NLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQ  390
            NL  DP  + FYDD ++RYT+ +PV++WDEKR+ WL  HPS   GA  R+L+VTGSQ + 
Sbjct  130  NLRRDPTNQTFYDDREVRYTLGQPVQDWDEKRRQWLLHHPSLAAGAEGRILMVTGSQPSA  189

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            C+N IGDHLLLR FKNKVDYCR+HG++IFY   LL P
Sbjct  190  CRNPIGDHLLLRFFKNKVDYCRIHGHEIFYNNALLHP  226



>gb|ADL36663.1| CAMTA domain class transcription factor [Malus domestica]
Length=441

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = +1

Query  211  NLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQ  390
            NL  DP  + FYDD ++RYT+ +PV++WDEKR+ WL  HPS   GA  R+L+VTGS  + 
Sbjct  67   NLRRDPTNQTFYDDREVRYTLGQPVQDWDEKRRQWLLHHPSLAAGAEGRILMVTGSHPSS  126

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            C+N IGDHLLLR FKNKVDYCR+HG++IFY   LL P
Sbjct  127  CRNPIGDHLLLRFFKNKVDYCRIHGHEIFYNNALLHP  163



>ref|XP_003525869.1| PREDICTED: galactomannan galactosyltransferase 1-like [Glycine 
max]
Length=428

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 82/131 (63%), Gaps = 9/131 (7%)
 Frame = +1

Query  112  AFVAPNPSFNGGFPSLAGKISGGGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKN  291
            +F+ P P+ +     ++ K+S           F    D PE  FYDDP+  YT++KP+ N
Sbjct  37   SFIIPIPNSDPELNPVSTKLSS--------LQFPTNTDSPETTFYDDPETSYTMDKPMHN  88

Query  292  WDEKRKAWLEQHPSF-IPGAANRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGY  468
            WDEKRK WL  HPSF +    +++LVVTGSQ  +C N IGDHLLLR FKNKVDYCRLH Y
Sbjct  89   WDEKRKQWLLHHPSFTVTTHDSKILVVTGSQPKRCHNPIGDHLLLRFFKNKVDYCRLHNY  148

Query  469  DIFYXTVLLQP  501
            DI Y   LL P
Sbjct  149  DIIYNNALLHP  159



>tpg|DAA64593.1| TPA_inf: putative galacto(gluco)mannan alpha-1,6-galactosyltransferase, 
partial [Pinus taeda]
Length=254

 Score =   130 bits (328),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 100/177 (56%), Gaps = 12/177 (7%)
 Frame = +1

Query  4    MASSMSKSRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFN-GGFPSLAGK----  168
            +  S+ + +       D  +  GG + A +LVW  W     N S       S++ K    
Sbjct  19   LKGSLKRLKRIMESLNDGLIFMGGAVSALLLVWVFWRIGYTNSSMEMEAELSVSPKCPDQ  78

Query  169  -ISGGGEECSYKQGFNLGDDPPEK---NFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP--  330
              S G    + +   +   D  EK   NFY++P++ YTI +P+++WD KRK WL++HP  
Sbjct  79   CFSDGNSGTTGRNRVDHSVDEWEKSSENFYNNPEVTYTIGQPIRDWDRKRKLWLDRHPQV  138

Query  331  -SFIPGAANRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQ  498
             +F      RVL+V+GSQA  C+N IGDHLLLR FKNKVDYCRLHG DIFY  VLL+
Sbjct  139  KNFTDDGKPRVLMVSGSQAVPCRNPIGDHLLLRFFKNKVDYCRLHGIDIFYNNVLLE  195



>ref|XP_009394361.1| PREDICTED: galactomannan galactosyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=451

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 93/173 (54%), Gaps = 29/173 (17%)
 Frame = +1

Query  16   MSKSRGKTAVFFDAFLCTGGTLVAFVLVWGVWAF------VAPNP-----SFNGGFPSLA  162
            M++   K ++F D  +  GG  VA ++ W V  F      V P+      S +  FP L 
Sbjct  20   MTRRSSKPSLFSDGLVFAGGAGVALLVFWVVSTFFSAVTVVDPSAFPFSVSSSAAFPDLH  79

Query  163  GKISGGGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIP  342
             +                  DPP   FYDDP + YTI++P+  WD KR+ WL  HP+F  
Sbjct  80   DR------------------DPPGATFYDDPSVSYTIDRPLTGWDAKRRDWLRLHPAFGG  121

Query  343  GAANRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
                RVL+VTGSQ   C+N +GDHLLLR FKNKVDYCR HG ++FY T LL P
Sbjct  122  YGRERVLMVTGSQPGPCRNPVGDHLLLRFFKNKVDYCRRHGIELFYNTALLHP  174



>gb|ADE76992.1| unknown [Picea sitchensis]
Length=477

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 99/178 (56%), Gaps = 13/178 (7%)
 Frame = +1

Query  4    MASSMSKSRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNG----GFPSLAGK-  168
            +  SM + +       D  +  GG + A +LVW +W     N S        FP      
Sbjct  19   LKGSMKRLKQIVESLNDGLIFMGGAVSALLLVWALWRIGYSNSSMEMETELSFPQKCPDQ  78

Query  169  -ISGGGEECSYKQG-FNLGDDPPEK---NFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP-  330
             IS  G   S      + G D  EK   NFY++P++ YTI +P+++WD+KRK WL++HP 
Sbjct  79   CISSNGNRGSISSNRIDHGVDEWEKSSENFYNNPEVTYTIGQPIRDWDKKRKLWLDRHPR  138

Query  331  --SFIPGAANRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQ  498
              +F      RVL+V+GSQ   C+N  GDHLLLR FKNKVDYCRLHG D+FY  VLL+
Sbjct  139  VKNFTDDGKPRVLMVSGSQGVPCRNPFGDHLLLRFFKNKVDYCRLHGIDMFYNNVLLE  196



>ref|XP_007211970.1| hypothetical protein PRUPE_ppa006622mg [Prunus persica]
 gb|EMJ13169.1| hypothetical protein PRUPE_ppa006622mg [Prunus persica]
Length=402

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 90/140 (64%), Gaps = 13/140 (9%)
 Frame = +1

Query  82   VAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYKQGFNLGDDPPEKNFYDDPDL  261
            +A  LVW +  F+ P+ S +          S GG  C    G +LG DP E  FYDDP+L
Sbjct  1    MALSLVWALLTFINPSTSIDNII-----TWSTGG--C----GPDLGSDPSEPTFYDDPNL  49

Query  262  RYTI-EKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQCKNQIGDHLLLRLFKN  438
             Y   E+P+K+WD KR+ WL+ HPSF   +  +VL+VTGSQ   CKN +GDHL LRLFKN
Sbjct  50   SYAFGEEPMKDWDLKRREWLKLHPSF-AASEEKVLLVTGSQPNVCKNPVGDHLQLRLFKN  108

Query  439  KVDYCRLHGYDIFYXTVLLQ  498
            KVDYCR+HG++IFY  VLL 
Sbjct  109  KVDYCRIHGHEIFYNNVLLN  128



>ref|XP_010939020.1| PREDICTED: LOW QUALITY PROTEIN: galactomannan galactosyltransferase 
1-like [Elaeis guineensis]
Length=470

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 87/171 (51%), Gaps = 16/171 (9%)
 Frame = +1

Query  34   KTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECS------  195
            +  +  D+ +   G   A +L W + +F++P P     FP             S      
Sbjct  25   RPTLLADSLVFIAGAFSALLLFWILSSFLSPXPPMTS-FPHSPTYTYSSSFSPSLHFANL  83

Query  196  --YKQGFNLGD-----DPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP--SFIPGA  348
              +   FN  D     DPP+  FYDDP L YTI+  + +WD+KR+ WL  HP  S  PG 
Sbjct  84   SIHPDPFNDTDPDLLRDPPDSTFYDDPSLSYTIDHHLSDWDDKRRHWLRLHPWLSPAPGG  143

Query  349  ANRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
              R+L+++GSQ   C N +GDHLLLR  KNK+DYCR HG ++ Y   L  P
Sbjct  144  RERILMISGSQPNPCHNPVGDHLLLRFLKNKIDYCRRHGIELLYNNALQHP  194



>ref|XP_008363070.1| PREDICTED: LOW QUALITY PROTEIN: galactomannan galactosyltransferase 
1-like, partial [Malus domestica]
Length=383

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 67/98 (68%), Gaps = 0/98 (0%)
 Frame = +1

Query  196  YKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTG  375
            +  G + G DP E  FYDDP+  Y I +PV++WDEKRK WL  HPSF     +RVL+V G
Sbjct  10   FAHGLDSGYDPAEPTFYDDPNFSYLIGQPVEDWDEKRKKWLLHHPSFSASVRDRVLLVKG  69

Query  376  SQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTV  489
            SQ+    N +GDHLLLR FKNKVD+C  HGY+IFY  +
Sbjct  70   SQSXASSNPVGDHLLLRFFKNKVDHCXPHGYEIFYNNL  107



>gb|ABK25085.1| unknown [Picea sitchensis]
Length=479

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/206 (35%), Positives = 97/206 (47%), Gaps = 46/206 (22%)
 Frame = +1

Query  4    MASSMSKSRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNG-------------  144
            M+++M + R     FFD  +     +VA VL W +W   +   S+               
Sbjct  10   MSANMVQKRK----FFDFLMFWALVIVALVLCWSLWRICSSGISYRALTIEARDSSAQWD  65

Query  145  ------GFPSLAGKIS-------------------GGGEECSYKQGFNLGDDPPEKNFYD  249
                  G P++   I                       EE S  +  +  ++  + NFY 
Sbjct  66   LRIQKFGDPNVTSAIQQNQNGSSAIQQNQTNEREMNDKEEESLYRSMDQWEESSD-NFYA  124

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQHP---SFIPGAANRVLVVTGSQATQCKNQIGDHLL  420
            D D  YT+   VKNWD KR+ WL  HP   ++  G   R+LV+TGSQ   CKN IGDHLL
Sbjct  125  DSDFSYTVGSTVKNWDTKRQQWLRAHPHIKNYTEGGKPRILVLTGSQPYPCKNPIGDHLL  184

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLLQ  498
            LR FKNK DYCR+HG D+FY T+LL 
Sbjct  185  LRCFKNKQDYCRIHGLDMFYNTILLH  210



>ref|XP_010109205.1| Galactomannan galactosyltransferase 1 [Morus notabilis]
 gb|EXC21327.1| Galactomannan galactosyltransferase 1 [Morus notabilis]
Length=433

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 87/163 (53%), Gaps = 29/163 (18%)
 Frame = +1

Query  37   TAVFFDAFLCTGGTLVAFVLVWGVWAFVAPN---PSFNGGFPSLAGKISGGGEECSYKQG  207
            +++  D FL   G  +A  L+W + +F   N    SFN    +                 
Sbjct  23   SSLIADGFLFIVGASLALFLIWALLSFTNQNDVAQSFNSQLHT-----------------  65

Query  208  FNLGDDPPE--KNFYDDPDLRYTIEK--PVKNWDEKRKAWLEQHPSF-IPGAANRVLVVT  372
                D PP+    FYDD  L Y+I+   P+KNWDEKR+ WL  H  +    +  R+L+VT
Sbjct  66   ----DHPPQLISTFYDDATLSYSIQNDNPIKNWDEKRQQWLRYHYQYQTHNSKPRILLVT  121

Query  373  GSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            GS+   C N +GDHLLLRLFKNKVDYCR+HG +IFY   LL P
Sbjct  122  GSRPAVCSNPVGDHLLLRLFKNKVDYCRIHGIEIFYNNALLHP  164



>ref|XP_009406736.1| PREDICTED: galactomannan galactosyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 63/88 (72%), Gaps = 2/88 (2%)
 Frame = +1

Query  238  NFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQCKNQIGDHL  417
             FYDDP L YTI++P+ NWD KR+ WL  +PS      +RV++VTGS   +C N  GDHL
Sbjct  113  TFYDDPSLSYTIDRPITNWDSKRREWLRLNPSL--ATPDRVVMVTGSPPGRCPNPGGDHL  170

Query  418  LLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            LLR +KNK DYCRLHGYD+FY T LL P
Sbjct  171  LLRFYKNKADYCRLHGYDLFYNTALLHP  198



>ref|XP_010943187.1| PREDICTED: galactomannan galactosyltransferase 1-like [Elaeis 
guineensis]
Length=537

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 64/88 (73%), Gaps = 1/88 (1%)
 Frame = +1

Query  238  NFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQCKNQIGDHL  417
             FYDDPDL YT+++P+ +WD KR+ WL  HP F     +R+L+VTGS+  +C N  GDHL
Sbjct  171  TFYDDPDLSYTLDRPISDWDAKRRQWLRLHPWFS-ATPDRILMVTGSKPGRCSNPTGDHL  229

Query  418  LLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            LLR +KNK DYCR+HG+D+FY   LL P
Sbjct  230  LLRFYKNKADYCRIHGFDLFYNMALLHP  257



>ref|XP_009394626.1| PREDICTED: galactomannan galactosyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=429

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = +1

Query  223  DPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQCKNQ  402
            D P+  FYDD  + Y  ++ + +WD KR+ WL  HP+F      RV++VTGSQ   C+N+
Sbjct  60   DAPDATFYDDASVSYAFDRSLTDWDAKRREWLRLHPNFDGNGRERVVMVTGSQPGPCRNR  119

Query  403  IGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
             GDHLLLR FKNKVDYCR HG D+FY T LL P
Sbjct  120  EGDHLLLRFFKNKVDYCRRHGIDLFYNTALLHP  152



>ref|XP_008806204.1| PREDICTED: galactomannan galactosyltransferase 1-like [Phoenix 
dactylifera]
Length=469

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 65/99 (66%), Gaps = 2/99 (2%)
 Frame = +1

Query  211  NLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP--SFIPGAANRVLVVTGSQA  384
            +L  DPP   FYDDP L YTI++ + +WD+KR+ WL  HP  S  PG   R+L+++GSQ 
Sbjct  96   DLLRDPPNSTFYDDPSLSYTIDRHITDWDDKRRRWLRLHPWLSPAPGGRERILMISGSQP  155

Query  385  TQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
              C+N IGDHLLLR  KNKVDYCR  G ++ Y   L  P
Sbjct  156  NPCRNPIGDHLLLRFLKNKVDYCRRFGIELLYNNALQHP  194



>gb|AHC98115.1| putative galacto(gluco)mannan alpha-1,6-galactosyltransferase 
[Pinus radiata]
Length=480

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 71/114 (62%), Gaps = 5/114 (4%)
 Frame = +1

Query  163  GKISGGGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP---S  333
             ++SG  EE  Y+       +    NFY D D  YT+   VKNWD KR+ WL  HP   +
Sbjct  98   NEMSGKEEEPLYRSMDEW--EESSDNFYADSDFSYTVGNTVKNWDAKRQQWLRAHPHIKN  155

Query  334  FIPGAANRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            +  G   R+LV+TGSQ   CKN IGDHL+LR FKNK DYCR+HG D+FY T+LL
Sbjct  156  YTEGGRPRILVLTGSQPYPCKNPIGDHLILRTFKNKQDYCRIHGLDMFYNTILL  209



>ref|XP_008795673.1| PREDICTED: glycosyltransferase 6-like [Phoenix dactylifera]
Length=516

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = +1

Query  238  NFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQCKNQIGDHL  417
             FYDDPDL YT+++ + +WD KR  WL  HP F     +RVL+VTGS+  QC N  GDHL
Sbjct  157  TFYDDPDLSYTLDRSISDWDAKRHQWLRLHPWFS-ATPDRVLMVTGSKPGQCSNPTGDHL  215

Query  418  LLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            LLR +KNK DYCR+HG+++FY   LL P
Sbjct  216  LLRFYKNKADYCRIHGFELFYNMALLHP  243



>tpg|DAA64590.1| TPA_inf: putative galacto(gluco)mannan alpha-1,6-galactosyltransferase 
[Pinus taeda]
Length=480

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 62/89 (70%), Gaps = 3/89 (3%)
 Frame = +1

Query  238  NFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP---SFIPGAANRVLVVTGSQATQCKNQIG  408
            NFY D D  YT+   VKNWD KR+ WL  HP   ++  G   R+LV+TGSQ   CKN IG
Sbjct  121  NFYADSDFSYTVGNTVKNWDAKRQQWLRAHPHIKNYTEGGRPRILVLTGSQPYPCKNPIG  180

Query  409  DHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            DHL+LR FKNK DYCR+HG D+FY T+LL
Sbjct  181  DHLILRTFKNKQDYCRIHGLDMFYNTILL  209



>dbj|BAK05879.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=427

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 60/90 (67%), Gaps = 0/90 (0%)
 Frame = +1

Query  232  EKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQCKNQIGD  411
             + FYDDP++ YT+++P+  WDEKR  WL  HP        RVL+V+GSQ   C++  GD
Sbjct  52   RRTFYDDPEVTYTVDRPITGWDEKRAQWLRAHPELAGAGEGRVLMVSGSQPAPCRSPTGD  111

Query  412  HLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            HLL RL KNK DYCRL+G  + Y T LL+P
Sbjct  112  HLLTRLLKNKADYCRLNGVQLLYNTALLRP  141



>ref|NP_001105164.1| alpha-6-galactosyltransferase [Zea mays]
 emb|CAI11455.1| alpha-6-galactosyltransferase [Zea mays]
 gb|ACF82483.1| unknown [Zea mays]
 gb|AFW63649.1| hypothetical protein ZEAMMB73_992521 [Zea mays]
Length=444

 Score =   112 bits (279),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +1

Query  238  NFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAAN-RVLVVTGSQATQCKNQIGDH  414
             FYDDP L YT+++P+  WDEKR  WL  HP F  G    RVL+V+GSQ T C++  GDH
Sbjct  74   TFYDDPALAYTVDRPITGWDEKRAGWLRAHPEFAGGGEKGRVLMVSGSQPTPCRSPGGDH  133

Query  415  LLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
             L+RL KNK DYCRLHG  + Y   LL+P
Sbjct  134  TLMRLLKNKADYCRLHGVQLLYNMALLRP  162



>ref|XP_002454367.1| hypothetical protein SORBIDRAFT_04g029500 [Sorghum bicolor]
 gb|EES07343.1| hypothetical protein SORBIDRAFT_04g029500 [Sorghum bicolor]
Length=443

 Score =   112 bits (279),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +1

Query  235  KNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQCKNQIGDH  414
            + FYDDP L YT+++P+  WDEKR  WL  HP    G   RVL+V+GSQ T C++  GDH
Sbjct  68   RTFYDDPALAYTVDRPITGWDEKRAGWLRAHPELAGGGEERVLMVSGSQPTPCRSPGGDH  127

Query  415  LLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
             L+RL KNK DYCRLHG  +     LL+P
Sbjct  128  TLMRLLKNKADYCRLHGVQLLSNMALLRP  156



>ref|XP_008784727.1| PREDICTED: putative glycosyltransferase 7 [Phoenix dactylifera]
Length=436

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 63/94 (67%), Gaps = 6/94 (6%)
 Frame = +1

Query  238  NFYDDPDLRYTIEK-PVKNWDEKRKAWLEQHP-----SFIPGAANRVLVVTGSQATQCKN  399
             FYDDP L YT++   + NWD KR+ WL  HP     SFI     RVL+V+GSQ + C+N
Sbjct  55   TFYDDPSLSYTLDGGHLSNWDSKRRHWLRLHPTLSSSSFIQEKEERVLMVSGSQPSPCRN  114

Query  400  QIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
              GDHLLLR +KNK DYCR+HG+D+FY T  L P
Sbjct  115  PAGDHLLLRFYKNKSDYCRIHGHDLFYNTAHLHP  148



>gb|EAY87343.1| hypothetical protein OsI_08746 [Oryza sativa Indica Group]
 gb|EAZ24444.1| hypothetical protein OsJ_08194 [Oryza sativa Japonica Group]
Length=422

 Score =   108 bits (271),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +1

Query  235  KNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQCKNQIGDH  414
            + FYDDP + YTI++P+  WDEKR  WL  HP    G   RVL+V+GSQ   C +  GD 
Sbjct  56   RTFYDDPGVAYTIDRPIVGWDEKRAEWLRAHPELAGGGGERVLMVSGSQPEPCGSPAGDS  115

Query  415  LLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            LL RL KNK+DYCRL+G  + Y T LL+P
Sbjct  116  LLTRLLKNKLDYCRLNGVQLLYNTALLRP  144



>ref|XP_004953741.1| PREDICTED: galactomannan galactosyltransferase 1-like [Setaria 
italica]
Length=429

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 81/162 (50%), Gaps = 13/162 (8%)
 Frame = +1

Query  16   MSKSRGKTAVFFDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECS  195
            MS    K ++  DA L   G +VA VL+  +    A   +++ G  +L     GG    S
Sbjct  1    MSPRAAKPSLLTDALLFAAGAVVATVLLLALANPFAQPDAYHEGAATLHAGSGGGAGRSS  60

Query  196  YKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTG  375
                         + FYDDP L YT+++ +  WDEKR  W   HP    G    VL+V+G
Sbjct  61   -------------RTFYDDPALSYTVDRSITGWDEKRAGWARAHPEVSAGGVEGVLMVSG  107

Query  376  SQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            SQ   C    GDH LLRL KNK DYCRLHG  + Y T LL+P
Sbjct  108  SQPAPCGAPGGDHTLLRLLKNKADYCRLHGVQLLYNTALLRP  149



>ref|NP_001047970.1| Os02g0723200 [Oryza sativa Japonica Group]
 dbj|BAD13026.1| putative alpha galactosyltransferase [Oryza sativa Japonica Group]
 dbj|BAF09884.1| Os02g0723200 [Oryza sativa Japonica Group]
 dbj|BAG98296.1| unnamed protein product [Oryza sativa Japonica Group]
Length=447

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +1

Query  235  KNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQCKNQIGDH  414
            + FYDDP + YTI++P+  WDEKR  WL  HP    G   RVL+V+GSQ   C +  GD 
Sbjct  81   RTFYDDPGVAYTIDRPIVGWDEKRAEWLRAHPELAGGGGERVLMVSGSQPEPCGSPAGDS  140

Query  415  LLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            LL RL KNK+DYCRL+G  + Y T LL+P
Sbjct  141  LLTRLLKNKLDYCRLNGVQLLYNTALLRP  169



>ref|XP_003570475.1| PREDICTED: galactomannan galactosyltransferase 1-like [Brachypodium 
distachyon]
Length=417

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 5/94 (5%)
 Frame = +1

Query  235  KNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFI-----PGAANRVLVVTGSQATQCKN  399
            + FYDDP++ YT+++P+  WD KR AW+  HP  +      G   RVL+V+GSQ   C  
Sbjct  50   RTFYDDPEVSYTMDRPITGWDAKRAAWIRAHPELLHQHAARGEGERVLMVSGSQPAPCGA  109

Query  400  QIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
              GDH L RL KNK+DYCRL+G ++ Y T LL+P
Sbjct  110  PRGDHFLTRLLKNKLDYCRLNGVELLYNTALLRP  143



>ref|XP_010919073.1| PREDICTED: galactomannan galactosyltransferase 1-like [Elaeis 
guineensis]
Length=436

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +1

Query  238  NFYDDPDLRYTIEK-PVKNWDEKRKAWLEQHPSFIPGAAN---RVLVVTGSQATQCKNQI  405
             FYDDP L YT++   + +WD KR+ WL  HP+    A     R+L+V+ S  + C+N  
Sbjct  65   TFYDDPSLSYTLDGGHLSDWDAKRRHWLRLHPNPSSSAKEKDERILMVSASHPSPCRNLD  124

Query  406  GDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            GDHLLLR +KNK DYCR+HG+D+FY T LL P
Sbjct  125  GDHLLLRFYKNKADYCRIHGHDLFYNTALLHP  156



>ref|XP_007138911.1| hypothetical protein PHAVU_009G248100g [Phaseolus vulgaris]
 gb|ESW10905.1| hypothetical protein PHAVU_009G248100g [Phaseolus vulgaris]
Length=452

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 65/97 (67%), Gaps = 3/97 (3%)
 Frame = +1

Query  214  LGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLE---QHPSFIPGAANRVLVVTGSQA  384
            L D+PP ++   DP+  YT+   + +WDE+R+AWL    ++P+FI     RVL+VTGS  
Sbjct  94   LVDEPPSEDEKRDPNAPYTLGPKISDWDEQRRAWLRANPEYPNFIRPNKPRVLLVTGSSP  153

Query  385  TQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
              C+N +GDH L++  KNK+DYCR+HG +IFY   LL
Sbjct  154  KPCENPVGDHYLVKSIKNKIDYCRVHGIEIFYNMALL  190



>ref|XP_010922270.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Elaeis guineensis]
Length=454

 Score = 97.8 bits (242),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 63/96 (66%), Gaps = 8/96 (8%)
 Frame = +1

Query  217  GDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP---SFIPGAANRVLVVTGSQAT  387
            GDDPP+     DP++ YT+   + +WDE+R AWL +HP   +F      RVL+VTGS   
Sbjct  96   GDDPPQ-----DPNIPYTLGPKISDWDEQRAAWLRRHPESPNFWGPNKPRVLLVTGSSPK  150

Query  388  QCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
             C+N +GDH LL+  KNK+DYCR+HG +IFY   LL
Sbjct  151  PCENPVGDHYLLKSIKNKIDYCRVHGIEIFYNLALL  186



>ref|XP_003558085.1| PREDICTED: xyloglucan 6-xylosyltransferase 1-like [Brachypodium 
distachyon]
Length=447

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 59/96 (61%), Gaps = 7/96 (7%)
 Frame = +1

Query  226  PPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFI----PGAANRVLVVTGSQATQC  393
            PP +   D P   Y++ + +  +D +R AWL  HP F     P    RVL+VTGS  ++C
Sbjct  97   PPARQLTDPP---YSLGRTILGYDARRSAWLAAHPEFPARVPPAGRPRVLLVTGSAPSRC  153

Query  394  KNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
             +Q GDHLLLR FKNK DYCR+HG D+FY T  L P
Sbjct  154  PDQDGDHLLLRAFKNKADYCRVHGLDVFYNTAFLDP  189



>ref|XP_008679453.1| PREDICTED: galactomannan galactosyltransferase 1-like [Zea mays]
 gb|AFW64905.1| hypothetical protein ZEAMMB73_022035 [Zea mays]
Length=441

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 55/90 (61%), Gaps = 1/90 (1%)
 Frame = +1

Query  235  KNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP-SFIPGAANRVLVVTGSQATQCKNQIGD  411
            + FYDDP+L Y + + V  WD KR  WL          A  RV++VTGSQ   CK   GD
Sbjct  68   RTFYDDPELSYALGRRVTGWDAKRAQWLRSRGLGDRRNAPERVVMVTGSQPEPCKGAGGD  127

Query  412  HLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            HLLLR  KNKVDYCRLHG ++ Y   LL+P
Sbjct  128  HLLLRFLKNKVDYCRLHGIELLYNNALLEP  157



>ref|XP_008790864.1| PREDICTED: putative glycosyltransferase 2 [Phoenix dactylifera]
Length=449

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 83/163 (51%), Gaps = 20/163 (12%)
 Frame = +1

Query  55   AFLCTGGTLVAFVLVWGVWAFVAPNPSFN---------GGFP--SLAGKISGGGEECSYK  201
             FLC   T++      G   F  P   FN         G  P  +L  + +      +  
Sbjct  24   TFLCLFVTVIVLRGTIGAGKFGTPEQDFNEIRQRLRPHGSLPHRALVEQQADHSSAATAG  83

Query  202  QGF--NLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP---SFIPGAANRVLV  366
            + F  + GDD P +    DP++ Y++   + +WDE+R AWL +HP   +F      RVL+
Sbjct  84   KAFVADEGDDDPPR----DPNIPYSLGPKISDWDEQRAAWLRRHPESPNFWGPNKPRVLL  139

Query  367  VTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            VTGS    C+N +GDH LL+  KNK+DYCR+HG +IFY   LL
Sbjct  140  VTGSSPKPCENPVGDHYLLKSIKNKIDYCRVHGIEIFYNLALL  182



>ref|XP_006841140.1| hypothetical protein AMTR_s00086p00128700 [Amborella trichopoda]
 gb|ERN02815.1| hypothetical protein AMTR_s00086p00128700 [Amborella trichopoda]
Length=441

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 63/98 (64%), Gaps = 7/98 (7%)
 Frame = +1

Query  211  NLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP---SFIPGAANRVLVVTGSQ  381
            +L +D  E N    P++ YT+   + +WD+KRKAWL +HP   +F+ G   R+L+VTGSQ
Sbjct  88   DLEEDAAEIN----PNITYTLGPKILDWDQKRKAWLNEHPEFPNFLAGGRPRILLVTGSQ  143

Query  382  ATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
               C N IGDH LL+  KNK+DYCRLHG +I Y    L
Sbjct  144  PNPCDNPIGDHYLLKAAKNKIDYCRLHGIEIVYNMAHL  181



>ref|XP_002455150.1| hypothetical protein SORBIDRAFT_03g005110 [Sorghum bicolor]
 gb|EES00270.1| hypothetical protein SORBIDRAFT_03g005110 [Sorghum bicolor]
Length=453

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 62/107 (58%), Gaps = 13/107 (12%)
 Frame = +1

Query  205  GFNLGDD------PPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANR---  357
            G N  DD      PP +   D P   Y++ + + ++D +R AWL  HP F P AA R   
Sbjct  83   GSNATDDDVDSGLPPPRQLTDPP---YSLGRVILDYDARRSAWLAAHPEFQPAAAGRPRP  139

Query  358  -VLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
             VLVVTGS   +C +  GDHLLLR FKNK DYCR+HG D+FY    L
Sbjct  140  RVLVVTGSAPARCPDPDGDHLLLRAFKNKADYCRVHGLDVFYNAAFL  186



>gb|EAY89696.1| hypothetical protein OsI_11232 [Oryza sativa Indica Group]
Length=448

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 57/94 (61%), Gaps = 7/94 (7%)
 Frame = +1

Query  226  PPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSF----IPGAANRVLVVTGSQATQC  393
            PP +   D P   Y++ + +  +D +R AWL  HP F     P    RVLVVTGS   +C
Sbjct  98   PPPRQLTDPP---YSLGRTILGYDARRSAWLAAHPEFPARVAPAGRPRVLVVTGSAPARC  154

Query  394  KNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
             +  GDHLLLR FKNKVDYCR+HG D+FY T  L
Sbjct  155  PDPDGDHLLLRAFKNKVDYCRIHGLDVFYNTAFL  188



>gb|ABF95527.1| Glycosyltransferase 3, putative [Oryza sativa Japonica Group]
 gb|EAZ26652.1| hypothetical protein OsJ_10556 [Oryza sativa Japonica Group]
Length=448

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 57/94 (61%), Gaps = 7/94 (7%)
 Frame = +1

Query  226  PPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSF----IPGAANRVLVVTGSQATQC  393
            PP +   D P   Y++ + +  +D +R AWL  HP F     P    RVLVVTGS   +C
Sbjct  98   PPPRQLTDPP---YSLGRTILGYDARRSAWLAAHPEFPARVAPAGRPRVLVVTGSAPARC  154

Query  394  KNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
             +  GDHLLLR FKNKVDYCR+HG D+FY T  L
Sbjct  155  PDPDGDHLLLRAFKNKVDYCRIHGLDVFYNTAFL  188



>ref|NP_001173389.1| Os03g0306100 [Oryza sativa Japonica Group]
 dbj|BAH92117.1| Os03g0306100 [Oryza sativa Japonica Group]
Length=449

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 57/94 (61%), Gaps = 7/94 (7%)
 Frame = +1

Query  226  PPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSF----IPGAANRVLVVTGSQATQC  393
            PP +   D P   Y++ + +  +D +R AWL  HP F     P    RVLVVTGS   +C
Sbjct  99   PPPRQLTDPP---YSLGRTILGYDARRSAWLAAHPEFPARVAPAGRPRVLVVTGSAPARC  155

Query  394  KNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
             +  GDHLLLR FKNKVDYCR+HG D+FY T  L
Sbjct  156  PDPDGDHLLLRAFKNKVDYCRIHGLDVFYNTAFL  189



>ref|XP_010938345.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Elaeis guineensis]
Length=449

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 76/159 (48%), Gaps = 12/159 (8%)
 Frame = +1

Query  55   AFLCTGGTLVAFVLVWGVWAFVAPNPSFNG---------GFPSLAGKISGGGEECSYKQG  207
              LC   T++      G   F  P   FN            P  A   +  G   +   G
Sbjct  24   TLLCLFLTVIVLRGTIGAGKFGTPEQDFNEIRQRLRHHRSLPHRALVENQAGHSSATTAG  83

Query  208  FNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP---SFIPGAANRVLVVTGS  378
                 D  + +   DP++ Y++   + +WDE+R AWL +HP   +F      RVL+VTGS
Sbjct  84   KTFAADEGDDDPPRDPNIPYSLGPKISDWDEQRAAWLRRHPESPNFWGSNKPRVLLVTGS  143

Query  379  QATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
                C+N +GDH LL+  KNK+DYCR+HG +IFY   LL
Sbjct  144  SPKPCENPVGDHYLLKSIKNKIDYCRVHGIEIFYNLALL  182



>ref|XP_002449649.1| hypothetical protein SORBIDRAFT_05g020911 [Sorghum bicolor]
 gb|EES08637.1| hypothetical protein SORBIDRAFT_05g020911 [Sorghum bicolor]
Length=185

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 55/97 (57%), Gaps = 6/97 (6%)
 Frame = +1

Query  220  DDPPEKNFYDDPDLRYTIEKP---VKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQ  390
            DD P + FYDDP+L Y +  P   +  WD KR  WL         A  RV++V+GSQ   
Sbjct  81   DDGP-RTFYDDPELSYAVAAPGRRLTGWDAKRAQWLRSRGRR--NAPERVVMVSGSQPEP  137

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            C    GDHLLLR  KNK+DYCRLHG ++ Y    L P
Sbjct  138  CPGAAGDHLLLRFLKNKLDYCRLHGIELLYNREFLHP  174



>ref|XP_003533377.1| PREDICTED: putative glycosyltransferase 2-like isoform 3 [Glycine 
max]
Length=450

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 80/165 (48%), Gaps = 18/165 (11%)
 Frame = +1

Query  55   AFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSL-AGKISGGGEE--------------  189
             FLC   TLV      G   F  P   FN     L A +     EE              
Sbjct  24   TFLCLFLTLVVLRGTIGAGKFGTPEQDFNEIRHHLSAARARRVLEEVKPESLSSSESNNY  83

Query  190  CSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQ---HPSFIPGAANRV  360
             ++     L D+PP  +   +P+  YT+   + NWDE+R +WL     +P+FI     RV
Sbjct  84   ATFDLSKILVDEPPTDDEKPNPNAPYTLGPKISNWDEQRSSWLSNNPDYPNFIGPNKPRV  143

Query  361  LVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+VTGS    C+N +GDH L++  KNK+DYCR+HG +IFY   LL
Sbjct  144  LLVTGSSPKPCENPVGDHYLVKSIKNKIDYCRVHGIEIFYNMALL  188



>ref|XP_002449648.1| hypothetical protein SORBIDRAFT_05g020910 [Sorghum bicolor]
 gb|EES08636.1| hypothetical protein SORBIDRAFT_05g020910 [Sorghum bicolor]
Length=449

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = +1

Query  235  KNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP--SFIPGAANRVLVVTGSQATQCKNQIG  408
            + FYDD DL Y + + V +WD KR  WL           AA RV++V+GSQ   C+   G
Sbjct  74   RTFYDDADLSYALGRRVTDWDAKRAQWLRSRGLGRNAGPAAERVVMVSGSQPEPCRGAGG  133

Query  409  DHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            DHLLLR  KNKVDYCRLHG ++ Y   +L+P
Sbjct  134  DHLLLRFLKNKVDYCRLHGIELLYNNAVLEP  164



>ref|XP_003575986.2| PREDICTED: galactomannan galactosyltransferase 1-like [Brachypodium 
distachyon]
Length=479

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = +1

Query  232  EKNFYDDPDLRYTIE--KPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQCKNQI  405
             + FYDDP+L Y +   + +  WD KR  WL  H     G   RV++++GSQ+  CK   
Sbjct  100  RRTFYDDPELSYAVGGGRRLTGWDAKRAEWLRIHGLNNGGGQERVVMLSGSQSHPCKGAG  159

Query  406  GDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            GDH LLR  KNKVDYCRLHG  + Y T LL P
Sbjct  160  GDHALLRFLKNKVDYCRLHGIQLLYNTALLHP  191



>emb|CBI36830.3| unnamed protein product [Vitis vinifera]
Length=382

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 70/116 (60%), Gaps = 5/116 (4%)
 Frame = +1

Query  157  LAGKISGGGEECSYKQGFNLGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSF  336
            L G I G G+  + +Q F L D+  +     DP   Y++   + +WDE+R  WLEQ+P+F
Sbjct  70   LRGTI-GAGKFGTPEQDFLLVDEEDDSE-KPDPKKPYSLGPKISDWDEQRSTWLEQNPNF  127

Query  337  ---IPGAANRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
               I     RVL+VTGS    C+N +GDH LL+  KNK+DYCRLHG +IFY   LL
Sbjct  128  PNFIGPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIEIFYNMALL  183



>gb|AFW64907.1| glycosyltransferase 6 [Zea mays]
Length=479

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 59/97 (61%), Gaps = 3/97 (3%)
 Frame = +1

Query  214  LGDDPPEKNFYDDPDLRYTIE-KPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQ  390
            +G+ P  + FYDD +L Y +  + V  WD KR AWL          A RV++VTGSQ   
Sbjct  94   VGEGP--RTFYDDRELSYAVGGRRVTGWDAKRAAWLRTRGLDGAAVAGRVVMVTGSQPEP  151

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            CK   GDH LLR  KNK+DYCRLHG ++ Y T LL+P
Sbjct  152  CKGPGGDHALLRFLKNKLDYCRLHGIELLYNTALLEP  188



>ref|XP_010230173.1| PREDICTED: xyloglucan 6-xylosyltransferase 1-like [Brachypodium 
distachyon]
Length=436

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 56/93 (60%), Gaps = 6/93 (6%)
 Frame = +1

Query  226  PPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAAN---RVLVVTGSQATQCK  396
            PP +   D P   Y++   V  +D +R  WL  HP F    A    RVLVVTGS    CK
Sbjct  84   PPLRQLTDRP---YSLGPSVPGYDARRAEWLAAHPGFPASVAQGRPRVLVVTGSAPRACK  140

Query  397  NQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            +  GDHLLLR FKNKVDYCR+HG+D+FY   +L
Sbjct  141  DPTGDHLLLRAFKNKVDYCRVHGFDVFYSNAVL  173



>ref|XP_008795804.1| PREDICTED: putative glycosyltransferase 2 [Phoenix dactylifera]
Length=452

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 61/95 (64%), Gaps = 8/95 (8%)
 Frame = +1

Query  220  DDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP---SFIPGAANRVLVVTGSQATQ  390
            DDPP      DP++ Y++   + +WDE+R AWL +HP   +F      RVL+VTGS    
Sbjct  96   DDPPR-----DPNVPYSLGPKISDWDEQRAAWLRRHPESPNFWGPNKPRVLLVTGSSPKP  150

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            C+N +GDH LL+  KNK+DYCR+HG +IFY   LL
Sbjct  151  CENPVGDHYLLKSIKNKIDYCRVHGIEIFYNLALL  185



>dbj|BAK08324.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=456

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 59/93 (63%), Gaps = 6/93 (6%)
 Frame = +1

Query  226  PPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP---SFIPGAANRVLVVTGSQATQCK  396
            PP +   D P   Y++   V ++D +R AWL  HP   +F+     RVLVVTGS   +CK
Sbjct  104  PPLRQLTDRP---YSLGPNVSDYDARRAAWLAAHPRFPAFVAPGRPRVLVVTGSSPRRCK  160

Query  397  NQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            +  GDH+LLR FKNK DYCR+HG+DIFY   +L
Sbjct  161  DPEGDHVLLRAFKNKADYCRVHGFDIFYSNAVL  193



>gb|EAY89653.1| hypothetical protein OsI_11184 [Oryza sativa Indica Group]
Length=436

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 58/94 (62%), Gaps = 6/94 (6%)
 Frame = +1

Query  223  DPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPS---FIPGAANRVLVVTGSQATQC  393
            DPP +   D P   YT+   + +WDE+R AW  +HP    F+     RVL+VTGS    C
Sbjct  84   DPPPRTLRDPP---YTLGPKISDWDEQRAAWHRRHPETPPFVNDVKPRVLLVTGSSPKPC  140

Query  394  KNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            +N +GDH LL+  KNK+DYCR+HG +IFY   LL
Sbjct  141  ENPVGDHYLLKSIKNKMDYCRVHGLEIFYNMALL  174



>gb|ABF95475.1| Glycosyltransferase 5, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ43011.1| hypothetical protein OsJ_27597 [Oryza sativa Japonica Group]
Length=448

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 58/94 (62%), Gaps = 6/94 (6%)
 Frame = +1

Query  223  DPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPS---FIPGAANRVLVVTGSQATQC  393
            DPP +   D P   YT+   + +WDE+R AW  +HP    F+     RVL+VTGS    C
Sbjct  96   DPPPRTLRDPP---YTLGPKISDWDEQRAAWHRRHPETPPFVNDVKPRVLLVTGSSPKPC  152

Query  394  KNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            +N +GDH LL+  KNK+DYCR+HG +IFY   LL
Sbjct  153  ENPVGDHYLLKSIKNKMDYCRVHGLEIFYNMALL  186



>ref|XP_006649941.1| PREDICTED: putative glycosyltransferase 2-like [Oryza brachyantha]
Length=448

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 59/94 (63%), Gaps = 6/94 (6%)
 Frame = +1

Query  223  DPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPS---FIPGAANRVLVVTGSQATQC  393
            DPP ++  D P   YT+   + +WDE+R AW  +HP    F+     RVL+VTGS    C
Sbjct  96   DPPPRSLRDPP---YTLGPKISDWDEQRAAWHRRHPETPPFLNDVKPRVLLVTGSSPKPC  152

Query  394  KNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            +N +GDH LL+  KNK+DYCR+HG +IFY   LL
Sbjct  153  ENPVGDHYLLKSIKNKMDYCRVHGLEIFYNMALL  186



>ref|XP_008367147.1| PREDICTED: putative glycosyltransferase 2 [Malus domestica]
Length=460

 Score = 92.4 bits (228),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 63/97 (65%), Gaps = 3/97 (3%)
 Frame = +1

Query  214  LGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP---SFIPGAANRVLVVTGSQA  384
            L D+P  ++   DP+  Y++   + NWDE+R  WL+++P   +F+     RVL+VTGS  
Sbjct  101  LKDEPETEDXKRDPNQPYSLGPKISNWDEQRSDWLKKNPGFPNFVGPNKPRVLLVTGSSP  160

Query  385  TQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
              C+N +GDH LL+  KNK+DYCRLHG ++FY   LL
Sbjct  161  KPCENPVGDHYLLKSIKNKIDYCRLHGIEVFYNFALL  197



>gb|ABK24302.1| unknown [Picea sitchensis]
 gb|ACN41079.1| unknown [Picea sitchensis]
Length=444

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQCKNQIGDHLL  420
            DP++ Y+    + +WD++R+ WL ++P+F   +PG   R+L+VTGS    C+N +GDH L
Sbjct  101  DPNVPYSFGPKISDWDDQRREWLAENPAFPNFLPGGRPRILLVTGSAPAPCENPVGDHFL  160

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCRLHG +IFY    L
Sbjct  161  LKSIKNKIDYCRLHGIEIFYNMAHL  185



>ref|XP_010666578.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Beta vulgaris subsp. 
vulgaris]
Length=452

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 64/97 (66%), Gaps = 6/97 (6%)
 Frame = +1

Query  214  LGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQH---PSFIPGAANRVLVVTGSQA  384
            + D+P EK    DP+  Y++   + +WDE+R+ WLE++   P+F+     RVL+VTGS  
Sbjct  100  VDDEPAEKI---DPNKPYSLGPKISDWDEQRREWLEKNKEFPNFVQPNKPRVLLVTGSSP  156

Query  385  TQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
              C+N +GDH LL+  KNK+DYCR+HG +IFY   LL
Sbjct  157  KPCENPVGDHYLLKSIKNKIDYCRIHGIEIFYNLALL  193



>ref|XP_009600562.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Nicotiana tomentosiformis]
Length=464

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 62/97 (64%), Gaps = 3/97 (3%)
 Frame = +1

Query  214  LGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQH---PSFIPGAANRVLVVTGSQA  384
            + +D  E  F  DP+  Y++   + +WDE+R  WL+++   P+F+     RVL+VTGS  
Sbjct  105  VDEDDGEPEFKRDPNEPYSLGPKISDWDEQRAEWLKKNLNFPNFVGPNKPRVLLVTGSSP  164

Query  385  TQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
              C+N IGDH LL+  KNK+DYCRLHG +IFY   LL
Sbjct  165  KPCENPIGDHYLLKSIKNKIDYCRLHGIEIFYNMALL  201



>ref|XP_006838788.1| hypothetical protein AMTR_s00002p00259350 [Amborella trichopoda]
 gb|ERN01357.1| hypothetical protein AMTR_s00002p00259350 [Amborella trichopoda]
Length=439

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 79/157 (50%), Gaps = 12/157 (8%)
 Frame = +1

Query  55   AFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLA-------GKISGGGEECSYKQGFN  213
              LC   T++      G   F  P   FN     L+        ++    +  S K    
Sbjct  24   TLLCLFITVLVLRGTIGAGKFGTPEQDFNEIRSHLSFSKRSQPHRVLVEAKPDSEKLQSL  83

Query  214  LGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQA  384
            L D+ PE+    DP+  Y++   + +WD +R  WLE++PSF   I     RVL+VTGS  
Sbjct  84   LIDNEPEE--IPDPNKPYSLGPKISDWDSQRAQWLEENPSFPNFITPNKPRVLLVTGSAP  141

Query  385  TQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
              C+N +GDH LL+  KNK+DYCRLHG +IFY   LL
Sbjct  142  KACENPVGDHYLLKSIKNKIDYCRLHGIEIFYNMALL  178



>gb|AFW88652.1| glycosyltransferase 5 [Zea mays]
Length=448

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 59/94 (63%), Gaps = 6/94 (6%)
 Frame = +1

Query  223  DPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPS---FIPGAANRVLVVTGSQATQC  393
            DPP ++  D P   YT+   + +WDE+R AW  +HP    F+     RVL+VTGS    C
Sbjct  97   DPPPRSLRDPP---YTLGPKISDWDEQRAAWHRRHPETPPFLNDIKPRVLLVTGSSPKPC  153

Query  394  KNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            +N +GDH LL+  KNK+DYCR+HG ++FY   LL
Sbjct  154  ENPVGDHYLLKSIKNKMDYCRVHGIEVFYNMALL  187



>ref|NP_001150077.1| glycosyltransferase 5 [Zea mays]
 gb|ACG37718.1| glycosyltransferase 5 [Zea mays]
Length=450

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 59/94 (63%), Gaps = 6/94 (6%)
 Frame = +1

Query  223  DPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPS---FIPGAANRVLVVTGSQATQC  393
            DPP ++  D P   YT+   + +WDE+R AW  +HP    F+     RVL+VTGS    C
Sbjct  99   DPPPRSLRDPP---YTLGPKISDWDEQRAAWHRRHPETPPFLNDIKPRVLLVTGSSPKPC  155

Query  394  KNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            +N +GDH LL+  KNK+DYCR+HG ++FY   LL
Sbjct  156  ENPVGDHYLLKSIKNKMDYCRVHGIEVFYNMALL  189



>ref|XP_010498276.1| PREDICTED: putative glycosyltransferase 5 [Camelina sativa]
Length=456

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 58/94 (62%), Gaps = 4/94 (4%)
 Frame = +1

Query  223  DPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAAN---RVLVVTGSQATQC  393
            +PP+   +  P+  YT+   V NWD +RKAWL Q+P F P   N   R+L++TGS  + C
Sbjct  106  EPPKAEIFTTPNATYTLGPKVTNWDSQRKAWLNQNPEF-PSTVNGKARILLLTGSSPSPC  164

Query  394  KNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
               IGD+ LL+  KNK+DYCRLHG +I Y    L
Sbjct  165  DKPIGDYYLLKSVKNKIDYCRLHGIEIVYNMAHL  198



>ref|XP_008360279.1| PREDICTED: putative glycosyltransferase 2 [Malus domestica]
Length=460

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 63/97 (65%), Gaps = 3/97 (3%)
 Frame = +1

Query  214  LGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP---SFIPGAANRVLVVTGSQA  384
            L D+P  ++   DP+  Y++   + NWDE+R  WL+++P   +F+     RVL+VTGS  
Sbjct  101  LKDEPETEDDKRDPNQPYSLGPKISNWDEQRSDWLKKNPGFPNFVGPNKPRVLLVTGSSP  160

Query  385  TQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
              C+N +GDH LL+  KNK+DYCRLHG ++FY   LL
Sbjct  161  KPCENPVGDHYLLKSIKNKIDYCRLHGIEVFYNFALL  197



>ref|XP_008368989.1| PREDICTED: putative glycosyltransferase 2 [Malus domestica]
Length=448

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 61/97 (63%), Gaps = 11/97 (11%)
 Frame = +1

Query  217  GDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFI----PGAANRVLVVTGSQA  384
            G+D P      DP+  YT+   + NWDE+R  WL ++P+F     PG   RVL+VTGS  
Sbjct  97   GEDRP------DPNKPYTLGPKISNWDEQRSKWLRENPNFPNFVGPGKP-RVLLVTGSSP  149

Query  385  TQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
              C+N +GDH LL+  KNK+DYCRLHG ++FY   LL
Sbjct  150  KPCENPVGDHYLLKSIKNKIDYCRLHGIEVFYNMALL  186



>ref|XP_004987030.1| PREDICTED: xyloglucan 6-xylosyltransferase-like [Setaria italica]
Length=448

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 57/94 (61%), Gaps = 7/94 (7%)
 Frame = +1

Query  226  PPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSF----IPGAANRVLVVTGSQATQC  393
            PP +   D P   Y++ + + ++D +R AWL  HP F     P    RVLVVTGS   +C
Sbjct  94   PPPRQLKDPP---YSLGRTILDYDARRSAWLAAHPEFPTRVAPADRPRVLVVTGSAPVRC  150

Query  394  KNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
             +  GDHLLLR FKNK DYCR+HG ++FY T  L
Sbjct  151  PDPDGDHLLLRAFKNKADYCRVHGLEVFYNTAFL  184



>gb|KJB19373.1| hypothetical protein B456_003G098400 [Gossypium raimondii]
Length=458

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 61/95 (64%), Gaps = 6/95 (6%)
 Frame = +1

Query  220  DDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP---SFIPGAANRVLVVTGSQATQ  390
            D+PPE     +P+  YT+   + +WD++RK WL ++P   +F+ G A R+L+VTGS    
Sbjct  106  DEPPETEI--NPNTTYTLGPKISDWDQQRKVWLSENPEFPNFVNGKA-RILLVTGSPPNP  162

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            C N IGDH LL+  KNK+DYCRLHG +I Y    L
Sbjct  163  CDNAIGDHYLLKAIKNKIDYCRLHGVEIVYNMAHL  197



>ref|NP_001152534.1| glycosyltransferase 6 [Zea mays]
 gb|ACG48084.1| glycosyltransferase 6 [Zea mays]
Length=473

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  214  LGDDPPEKNFYDDPDLRYTIE-KPVKNWDEKRKAWLEQHPSFIPGAANRVLVVTGSQATQ  390
            +G+ P  + FYDD +L Y +  + V  WD KR AWL          A RV++VTGS    
Sbjct  88   VGEGP--RTFYDDRELSYAVGGQRVTGWDAKRAAWLRTRGLDGAAVAGRVVMVTGSXPEP  145

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            CK   GDH LLR  KNK+DYCRLHG ++ Y T LL+P
Sbjct  146  CKGPGGDHALLRFLKNKLDYCRLHGIELLYNTALLEP  182



>ref|XP_009352257.1| PREDICTED: putative glycosyltransferase 2 [Pyrus x bretschneideri]
Length=463

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 63/97 (65%), Gaps = 3/97 (3%)
 Frame = +1

Query  214  LGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQA  384
            L D+P  ++   DP+  Y++   + +WDE+R  WL+++PSF   +     RVL+VTGS  
Sbjct  101  LKDEPETEDEKRDPNQPYSLGPKISDWDEQRSDWLKKNPSFPNFVGPNKPRVLLVTGSSP  160

Query  385  TQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
              C+N +GDH LL+  KNK+DYCRLHG ++FY   LL
Sbjct  161  KPCENPVGDHYLLKSIKNKIDYCRLHGIEVFYNFALL  197



>ref|XP_002465400.1| hypothetical protein SORBIDRAFT_01g038000 [Sorghum bicolor]
 gb|EER92398.1| hypothetical protein SORBIDRAFT_01g038000 [Sorghum bicolor]
Length=446

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 58/94 (62%), Gaps = 6/94 (6%)
 Frame = +1

Query  223  DPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPS---FIPGAANRVLVVTGSQATQC  393
            DPP +   D P   YT+   + +WDE+R AW  +HP    F+     RVL+VTGS    C
Sbjct  95   DPPPRTLRDPP---YTLGPKISDWDEQRAAWHRRHPETPPFLNDIKPRVLLVTGSSPKPC  151

Query  394  KNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            +N +GDH LL+  KNK+DYCR+HG ++FY   LL
Sbjct  152  ENPVGDHYLLKSIKNKMDYCRVHGIEVFYNMALL  185



>ref|XP_002465378.1| hypothetical protein SORBIDRAFT_01g037530 [Sorghum bicolor]
 gb|EER92376.1| hypothetical protein SORBIDRAFT_01g037530 [Sorghum bicolor]
Length=446

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 58/93 (62%), Gaps = 6/93 (6%)
 Frame = +1

Query  226  PPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP---SFIPGAANRVLVVTGSQATQCK  396
            PP +   D P   YT+   V ++D +R  WL  +P   +F+     RVLVVTGS   +C 
Sbjct  91   PPPRQLTDPP---YTLGAAVSDYDARRARWLHDNPRFPAFVAPGRPRVLVVTGSSPRRCG  147

Query  397  NQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            N  GDH+LLR FKNKVDYCR+HG+D+FY   +L
Sbjct  148  NADGDHVLLRAFKNKVDYCRVHGFDVFYSNAVL  180



>ref|XP_009416128.1| PREDICTED: putative glycosyltransferase 2 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009416136.1| PREDICTED: putative glycosyltransferase 2 [Musa acuminata subsp. 
malaccensis]
Length=432

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 75/153 (49%), Gaps = 15/153 (10%)
 Frame = +1

Query  55   AFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFPSLAGKISGGGEECSYKQGFNLGD---D  225
              LC   T++      G   F  P    N     +  ++     E +     +L D   D
Sbjct  25   TLLCLALTVLVLRGTVGAGRFGTPEQDLN----QIRLRLRRPLVETTISSSNSLDDSEED  80

Query  226  PPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP---SFIPGAANRVLVVTGSQATQCK  396
            PP      DP   Y++   + +WDE+R  WL +HP   SF+     RVL+VTGS    C+
Sbjct  81   PPR-----DPSQPYSLGPKISDWDEQRADWLRRHPERPSFLGPNKPRVLLVTGSSPKPCE  135

Query  397  NQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            N +GDH LL+  KNK+DYCR+HG +IFY   LL
Sbjct  136  NPVGDHYLLKSIKNKIDYCRVHGIEIFYNMALL  168



>tpg|DAA53369.1| TPA: hypothetical protein ZEAMMB73_022473 [Zea mays]
Length=396

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 55/92 (60%), Gaps = 5/92 (5%)
 Frame = +1

Query  226  PPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIP--GAANRVLVVTGSQATQCKN  399
            PP +   D P   Y++ + + ++D +R AWL  HP      G   RVLVVTGS   +C +
Sbjct  94   PPPRQLTDPP---YSLGRAILDYDARRSAWLAAHPELPARVGRRPRVLVVTGSAPARCPD  150

Query  400  QIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
              GDHLLLR FKNK DYCR+HG D+FY    L
Sbjct  151  ADGDHLLLRAFKNKADYCRVHGLDVFYNAAFL  182



>ref|XP_009780568.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Nicotiana 
sylvestris]
Length=466

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 61/97 (63%), Gaps = 3/97 (3%)
 Frame = +1

Query  214  LGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQH---PSFIPGAANRVLVVTGSQA  384
            + +D  E  F  DP+  Y +   + +WDE+R  WL+++   P+F+     RVL+VTGS  
Sbjct  107  VDEDDGEPEFKRDPNEPYNLGPKISDWDEQRAEWLKKNLNFPNFVGPNKPRVLLVTGSSP  166

Query  385  TQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
              C+N IGDH LL+  KNK+DYCRLHG +IFY   LL
Sbjct  167  KPCENPIGDHYLLKSIKNKIDYCRLHGIEIFYNMALL  203



>ref|XP_010652172.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Vitis vinifera]
 emb|CAN59912.1| hypothetical protein VITISV_017033 [Vitis vinifera]
Length=452

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQCKNQIGDHLL  420
            DP   Y++   + +WDE+R  WLEQ+P+F   I     RVL+VTGS    C+N +GDH L
Sbjct  106  DPKKPYSLGPKISDWDEQRSTWLEQNPNFPNFIGPNKPRVLLVTGSSPKPCENPVGDHYL  165

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCRLHG +IFY   LL
Sbjct  166  LKSIKNKIDYCRLHGIEIFYNMALL  190



>ref|XP_008239899.1| PREDICTED: putative glycosyltransferase 5 [Prunus mume]
 ref|XP_008239903.1| PREDICTED: putative glycosyltransferase 5 [Prunus mume]
Length=459

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 61/91 (67%), Gaps = 5/91 (5%)
 Frame = +1

Query  220  DDPPEKNFYD-DPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAAN---RVLVVTGSQAT  387
            +DP E    + +P++ YT+   + NWD++RKAWL+ +P F P   N   RVL+VTGS   
Sbjct  103  NDPDELTQTEINPNITYTLGPKIANWDKERKAWLQSNPEF-PSLVNGKPRVLLVTGSPPK  161

Query  388  QCKNQIGDHLLLRLFKNKVDYCRLHGYDIFY  480
             C N IGDH LL++ KNK+DYCRLHG +I Y
Sbjct  162  PCDNPIGDHYLLKVIKNKIDYCRLHGIEIVY  192



>ref|XP_010258249.1| PREDICTED: putative glycosyltransferase 5 [Nelumbo nucifera]
Length=455

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 58/85 (68%), Gaps = 4/85 (5%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQCKNQIGDHLL  420
            +P++ YT+   + NWDE+RKAWL+++P F   I G A R+L+VTGS    C N IGDH L
Sbjct  111  NPNVTYTLGPKISNWDEERKAWLDRNPEFPNYINGKA-RILLVTGSPPNPCDNPIGDHYL  169

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCR+HG +I Y    L
Sbjct  170  LKAIKNKIDYCRIHGIEIVYNLAHL  194



>ref|XP_004987031.1| PREDICTED: xyloglucan 6-xylosyltransferase-like [Setaria italica]
Length=437

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 58/93 (62%), Gaps = 6/93 (6%)
 Frame = +1

Query  226  PPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP---SFIPGAANRVLVVTGSQATQCK  396
            PP +   D P   Y++   V ++D +R  WL  +P   +F+     RVLVVTGS   +C 
Sbjct  86   PPPRQLTDPP---YSLGAAVSDYDARRAKWLRANPRFPAFVAPGRPRVLVVTGSPPRRCG  142

Query  397  NQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            N  GDHLLLR FKNKVDYCR+HG+D+FY   +L
Sbjct  143  NADGDHLLLRAFKNKVDYCRVHGFDVFYSNAVL  175



>ref|XP_009342118.1| PREDICTED: putative glycosyltransferase 2 [Pyrus x bretschneideri]
 ref|XP_009342138.1| PREDICTED: putative glycosyltransferase 2 [Pyrus x bretschneideri]
Length=449

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 57/86 (66%), Gaps = 5/86 (6%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQHPSFI----PGAANRVLVVTGSQATQCKNQIGDHL  417
            DP+  YT+   + NWDE+R  WL ++P+F     PG   RVL+VTGS    C+N +GDH 
Sbjct  103  DPNKPYTLGPKISNWDEQRSKWLRENPNFPNFVGPGKP-RVLLVTGSSPKPCENPVGDHY  161

Query  418  LLRLFKNKVDYCRLHGYDIFYXTVLL  495
            LL+  KNK+DYCRLHG ++FY   LL
Sbjct  162  LLKSIKNKIDYCRLHGIEVFYNMALL  187



>ref|XP_008235045.1| PREDICTED: putative glycosyltransferase 2 [Prunus mume]
Length=448

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 57/85 (67%), Gaps = 3/85 (4%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQH---PSFIPGAANRVLVVTGSQATQCKNQIGDHLL  420
            DP+  YT+   + NWDE+R  WL+++   P+FI     RVL+VTGS    C+N +GDH L
Sbjct  103  DPNKPYTLGPKISNWDEQRSKWLKENTNFPNFIGPNKPRVLLVTGSSPKPCENPVGDHYL  162

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCRLHG ++FY   LL
Sbjct  163  LKSIKNKIDYCRLHGIEVFYNMALL  187



>ref|XP_007037433.1| Galactosyl transferase GMA12/MNN10 family protein [Theobroma 
cacao]
 gb|EOY21934.1| Galactosyl transferase GMA12/MNN10 family protein [Theobroma 
cacao]
Length=460

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 62/95 (65%), Gaps = 6/95 (6%)
 Frame = +1

Query  220  DDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP---SFIPGAANRVLVVTGSQATQ  390
            D+PPE     +P++ +T+   + +WD++RK W+ Q+P   +F+ G A R+L+VTGS    
Sbjct  108  DEPPETEI--NPNITFTLGPKISDWDQQRKVWISQNPEFPNFVNGKA-RILLVTGSPPNP  164

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            C N IGDH LL+  KNK+DYCRLHG +I Y    L
Sbjct  165  CDNAIGDHYLLKSIKNKIDYCRLHGIEIVYNMAHL  199



>ref|XP_009414141.1| PREDICTED: putative glycosyltransferase 2 [Musa acuminata subsp. 
malaccensis]
Length=441

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 59/95 (62%), Gaps = 8/95 (8%)
 Frame = +1

Query  220  DDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP---SFIPGAANRVLVVTGSQATQ  390
            +DPP      DP   Y++   + +WDE+R  WL +HP   +F+     RVL+VTGS    
Sbjct  88   EDPPR-----DPSKPYSLGPKISDWDEQRADWLRRHPERPNFLGSTKPRVLLVTGSSPKP  142

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            C+N +GDH LL+  KNK+DYCR+HG +IFY   LL
Sbjct  143  CENPVGDHYLLKSIKNKIDYCRVHGIEIFYNLALL  177



>gb|EYU45549.1| hypothetical protein MIMGU_mgv1a027105mg [Erythranthe guttata]
Length=460

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 58/95 (61%), Gaps = 3/95 (3%)
 Frame = +1

Query  220  DDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPS---FIPGAANRVLVVTGSQATQ  390
            DD     F  DP   Y++   + NWD +R  WL+++P+   FI     RVL+VTGS    
Sbjct  106  DDDGVDEFQRDPSQPYSLGPKISNWDSQRSQWLKKNPNSPNFIAENKPRVLLVTGSSPKP  165

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            C+N +GDH LL+  KNK+DYCRLHG +IFY   LL
Sbjct  166  CENPVGDHYLLKSIKNKIDYCRLHGIEIFYNMALL  200



>ref|XP_010537379.1| PREDICTED: putative glycosyltransferase 5 [Tarenaya hassleriana]
Length=455

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAAN---RVLVVTGSQATQCKNQIGDHLL  420
            DP++ YT+   + NWD +RK WL+Q+P F P + N   R+L++TGS    C N IGDH L
Sbjct  114  DPNVTYTLGPKITNWDSQRKVWLDQNPEF-PNSVNGKARILLLTGSPPKPCDNPIGDHYL  172

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCRLHG +I Y    L
Sbjct  173  LKSVKNKIDYCRLHGIEIVYNMAHL  197



>gb|EAY81250.1| hypothetical protein OsI_36429 [Oryza sativa Indica Group]
Length=483

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 60/97 (62%), Gaps = 8/97 (8%)
 Frame = +1

Query  235  KNFYDDPDLRYTIE----KPVKNWDEKRKAWLE-QHPSFIPGAA---NRVLVVTGSQATQ  390
            + FYDD  + Y +E      +  WD +R AW+  ++P  +   A    RV++V+GSQA  
Sbjct  104  RTFYDDSRVSYAVEVGRRGGITGWDARRAAWMRLRYPRGLNATAAGRERVVMVSGSQAPP  163

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            C+ + GDHLLLR  KNKVDYCRLHG ++ Y   LLQP
Sbjct  164  CRGEGGDHLLLRFLKNKVDYCRLHGVELLYNNALLQP  200



>ref|XP_006356974.1| PREDICTED: putative glycosyltransferase 2-like [Solanum tuberosum]
Length=464

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 61/97 (63%), Gaps = 3/97 (3%)
 Frame = +1

Query  214  LGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQA  384
            + +D  E  F  DP+  Y +   + +WDE+R  WL+++P+F   +     RVL+VTGS  
Sbjct  106  VDEDDGEPEFKRDPNQPYALGPKITDWDEQRGEWLKKNPNFPNFVGTNKPRVLLVTGSSP  165

Query  385  TQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
              C+N +GDH LL+  KNK+DYCRLHG +IFY   LL
Sbjct  166  KPCENPVGDHYLLKSIKNKIDYCRLHGMEIFYNMALL  202



>ref|XP_002514720.1| Xyloglucan 6-xylosyltransferase, putative [Ricinus communis]
 gb|EEF47826.1| Xyloglucan 6-xylosyltransferase, putative [Ricinus communis]
Length=454

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 61/95 (64%), Gaps = 6/95 (6%)
 Frame = +1

Query  220  DDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAAN---RVLVVTGSQATQ  390
            D+PPE     +P++ YT+   ++NWD++RK W  Q+P F P   N   R+L++TGS  + 
Sbjct  105  DEPPELEI--NPNVTYTLGPKIENWDQERKVWRNQNPEF-PSFVNGKPRILLLTGSPPSP  161

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            C N IGDH LL+  KNK+DYCR+HG +I Y    L
Sbjct  162  CDNPIGDHYLLKAIKNKIDYCRIHGIEIVYNMAHL  196



>ref|XP_003609672.1| Xyloglucan 6-xylosyltransferase [Medicago truncatula]
 gb|AES91869.1| xyloglucan xylosyltransferase [Medicago truncatula]
Length=454

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQ---HPSFIPGAANRVLVVTGSQATQCKNQIGDHLL  420
            DP+  YT+   + +WDE+R +WL     +P+FI     RVL+VTGS    C+N +GDH L
Sbjct  107  DPNTPYTLGPKISDWDEQRSSWLSNNPDYPNFINPNKPRVLLVTGSSPKPCENPVGDHYL  166

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCRLHG +IFY   LL
Sbjct  167  LKSIKNKIDYCRLHGIEIFYNMALL  191



>ref|XP_010452740.1| PREDICTED: putative glycosyltransferase 3 [Camelina sativa]
Length=459

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 59/90 (66%), Gaps = 6/90 (7%)
 Frame = +1

Query  220  DDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAANR---VLVVTGSQATQ  390
            ++PPE +   D ++ YT+   + NWD+KRK WL Q+P F P   NR   VL++TGS    
Sbjct  107  NEPPESDL--DLNMTYTLGLKITNWDQKRKLWLTQNPGF-PSVVNRKAKVLLLTGSPPKP  163

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFY  480
            C N IGDH LL+  KNK+DYCR+HG +I Y
Sbjct  164  CDNPIGDHYLLKSVKNKIDYCRIHGIEIVY  193



>ref|XP_004508217.1| PREDICTED: putative glycosyltransferase 2-like [Cicer arietinum]
Length=452

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 54/85 (64%), Gaps = 3/85 (4%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQ---HPSFIPGAANRVLVVTGSQATQCKNQIGDHLL  420
            DP   YT+   + +WDE+R  WL     +PSFI     RVL+VTGS    C+N +GDH L
Sbjct  105  DPKTPYTLGPKISDWDEQRSKWLRNNPDYPSFIRPNKPRVLLVTGSSPKPCENPVGDHYL  164

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCRLHG +IFY   LL
Sbjct  165  LKSIKNKIDYCRLHGIEIFYNMALL  189



>ref|XP_010477058.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477059.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477061.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477062.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477063.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
Length=456

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 56/89 (63%), Gaps = 4/89 (4%)
 Frame = +1

Query  223  DPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAAN---RVLVVTGSQATQC  393
            +PP+   +  P+  YT+   V NWD +RK WL Q+P F P   N   R+L++TGS  + C
Sbjct  106  EPPKAEIFTTPNATYTLGPKVTNWDSQRKVWLNQNPEF-PSTVNGKARILLLTGSSPSPC  164

Query  394  KNQIGDHLLLRLFKNKVDYCRLHGYDIFY  480
               IGD+ LL+  KNK+DYCRLHG +I Y
Sbjct  165  DKPIGDYYLLKSVKNKIDYCRLHGIEIVY  193



>emb|CDO98874.1| unnamed protein product [Coffea canephora]
Length=460

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 61/95 (64%), Gaps = 3/95 (3%)
 Frame = +1

Query  220  DDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQ  390
            DD  E  +  DP+  Y++   + NWD++R  WL+++P+F   +     RVL+VTGS    
Sbjct  104  DDGDEVVYKRDPNQPYSLGPKISNWDQQRAEWLKKNPNFRNFVAPNKPRVLLVTGSSPKP  163

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            C+N +GDH LL+  KNK+DYCRLHG +IFY   LL
Sbjct  164  CENPVGDHYLLKSIKNKIDYCRLHGIEIFYNFALL  198



>ref|XP_007224307.1| hypothetical protein PRUPE_ppa019851mg [Prunus persica]
 gb|EMJ25506.1| hypothetical protein PRUPE_ppa019851mg [Prunus persica]
Length=442

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 62/97 (64%), Gaps = 3/97 (3%)
 Frame = +1

Query  214  LGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQA  384
            L D+P   +   DP+  Y++   + +WDE+R  WL+++PSF   +     RVL+VTGS  
Sbjct  100  LVDEPGSDDEKRDPNTPYSLGPKISDWDEQRSDWLKKNPSFPNFLGPNKPRVLLVTGSSP  159

Query  385  TQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
              C+N +GDH LL+  KNK+DYCR+HG +IFY   LL
Sbjct  160  KPCENPVGDHYLLKSIKNKIDYCRIHGIEIFYNFALL  196



>gb|ACE95677.1| putative xylosyl transferase [Coffea canephora]
Length=460

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 61/95 (64%), Gaps = 3/95 (3%)
 Frame = +1

Query  220  DDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQ  390
            DD  E  +  DP+  Y++   + NWD++R  WL+++P+F   +     RVL+VTGS    
Sbjct  104  DDGDEVVYKRDPNQPYSLGPKISNWDQQRAEWLKKNPNFRNFVAPNKPRVLLVTGSSPKP  163

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            C+N +GDH LL+  KNK+DYCRLHG +IFY   LL
Sbjct  164  CENPVGDHYLLKSIKNKIDYCRLHGIEIFYNFALL  198



>emb|CAI11450.1| alpha-1,6-xylosyltransferase [Pinus taeda]
 gb|AHC98116.1| xyloglucan alpha-1,6-xylosyltransferase [Pinus radiata]
 tpg|DAA64591.1| TPA_inf: xyloglucan alpha-1,6-xylosyltransferase [Pinus taeda]
Length=444

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 57/85 (67%), Gaps = 3/85 (4%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQCKNQIGDHLL  420
            DP + Y+    + +WD++R  WL ++P+F   +PG   R+L+VTGS    C++ +GDHLL
Sbjct  101  DPSVPYSFGPKISDWDDQRSEWLAENPAFPNFLPGGRPRILLVTGSAPAPCESPVGDHLL  160

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCRLHG +IFY    L
Sbjct  161  LKSIKNKIDYCRLHGIEIFYNMAHL  185



>ref|XP_008386651.1| PREDICTED: putative glycosyltransferase 2 [Malus domestica]
Length=449

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 55/85 (65%), Gaps = 3/85 (4%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQCKNQIGDHLL  420
            DP+  YT+   + NWDE R  WL ++P+F   I     RVL+VTGS    C+N +GDH L
Sbjct  103  DPNKPYTLGPKISNWDELRSKWLRENPNFPNFIGPGKPRVLLVTGSSPKPCENPVGDHYL  162

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCRLHG ++FY   LL
Sbjct  163  LKSIKNKIDYCRLHGIEVFYNMALL  187



>ref|XP_010108713.1| Putative glycosyltransferase 3 [Morus notabilis]
 gb|EXC20024.1| Putative glycosyltransferase 3 [Morus notabilis]
Length=449

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 59/91 (65%), Gaps = 6/91 (7%)
 Frame = +1

Query  217  GDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQAT  387
             D+PPE     +P+  Y++   + NWD++RK WL Q+P F   I G A RVL+VTGS   
Sbjct  99   ADEPPESE--TNPNATYSLGPKISNWDQERKLWLGQNPQFPNYINGKA-RVLLVTGSPPK  155

Query  388  QCKNQIGDHLLLRLFKNKVDYCRLHGYDIFY  480
             C N IGDH LL+  KNK+DYCR+HG +I Y
Sbjct  156  PCDNPIGDHYLLKSIKNKIDYCRIHGIEIVY  186



>emb|CAI11451.1| alpha-1,6-xylosyltransferase [Gossypium raimondii]
Length=413

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 57/85 (67%), Gaps = 3/85 (4%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQ---HPSFIPGAANRVLVVTGSQATQCKNQIGDHLL  420
            DP+  Y++   + +WDE+R  WL++   +P+FI     RVL+VTGS    C+N +GDH L
Sbjct  67   DPNAPYSLGPRISDWDEQRSRWLQENPNYPNFIGPNKPRVLLVTGSSPKPCENPVGDHYL  126

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCRLHG +IFY   LL
Sbjct  127  LKSIKNKIDYCRLHGIEIFYNMALL  151



>ref|XP_004984900.1| PREDICTED: putative glycosyltransferase 2-like [Setaria italica]
Length=451

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 57/94 (61%), Gaps = 6/94 (6%)
 Frame = +1

Query  223  DPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPS---FIPGAANRVLVVTGSQATQC  393
            DPP +   D P   YT+   + +WDE+R  W  +HP    F+     RVL+V+GS    C
Sbjct  100  DPPPRTLRDPP---YTLGPKISDWDEQRANWHRRHPETPPFLNDVKPRVLLVSGSSPKPC  156

Query  394  KNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            +N +GDH LL+  KNK+DYCR+HG +IFY   LL
Sbjct  157  ENPVGDHYLLKSIKNKIDYCRVHGLEIFYNMALL  190



>ref|XP_008466919.1| PREDICTED: putative glycosyltransferase 5, partial [Cucumis melo]
Length=236

 Score = 87.8 bits (216),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 55/80 (69%), Gaps = 4/80 (5%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAAN---RVLVVTGSQATQCKNQIGDHLL  420
            +P++ YT+   + NW+++RK WL+Q+P F P   N   R+L+VTGS    C N IGDH L
Sbjct  81   NPNVTYTLGPKIVNWNQERKVWLDQNPEF-PNYVNKRARILLVTGSPPKPCDNPIGDHYL  139

Query  421  LRLFKNKVDYCRLHGYDIFY  480
            L+  KNK+DYCRLHG +I Y
Sbjct  140  LKAIKNKIDYCRLHGIEIVY  159



>emb|CDX90935.1| BnaA03g26150D [Brassica napus]
Length=449

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQCKNQIGDHLL  420
            DP+  YT+   + +WDE+R  WL ++PSF   I     RVL+VTGS    C+N +GDH L
Sbjct  100  DPNKPYTLGPKISDWDEQRSDWLSKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYL  159

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCRLHG +IFY   LL
Sbjct  160  LKSIKNKIDYCRLHGIEIFYNMALL  184



>gb|EPS71488.1| hypothetical protein M569_03267 [Genlisea aurea]
Length=450

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 56/88 (64%), Gaps = 3/88 (3%)
 Frame = +1

Query  241  FYDDPDLRYTIEKPVKNWDEKRKAWLEQHP---SFIPGAANRVLVVTGSQATQCKNQIGD  411
            F  DP   YT+   + +WD++R  WL+ +P   +FI G   RVL+VTGS    C+N IGD
Sbjct  102  FKRDPSQPYTLGPKISDWDQQRGEWLKNNPDFPNFITGNKPRVLLVTGSSPKPCENPIGD  161

Query  412  HLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            H LL+  KNK+DYCRLH  +IFY   LL
Sbjct  162  HYLLKSIKNKIDYCRLHAIEIFYNLALL  189



>ref|XP_006396461.1| hypothetical protein EUTSA_v10028641mg [Eutrema salsugineum]
 gb|ESQ37914.1| hypothetical protein EUTSA_v10028641mg [Eutrema salsugineum]
Length=464

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQCKNQIGDHLL  420
            DP+  YT+   + +WDE+R  WL ++PSF   I     RVL+VTGS    C+N +GDH L
Sbjct  116  DPNKPYTLGPKISDWDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYL  175

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCRLHG +IFY   LL
Sbjct  176  LKSIKNKIDYCRLHGIEIFYNMALL  200



>dbj|BAK06777.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=452

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 57/95 (60%), Gaps = 3/95 (3%)
 Frame = +1

Query  220  DDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPS---FIPGAANRVLVVTGSQATQ  390
            DD PE       D  YT+   + +WDE+R AW  +HP    F+     RV++VTGS    
Sbjct  96   DDEPEPQPRSLRDPPYTLGPKISDWDEQRAAWNRRHPETPPFLNDVKPRVMLVTGSSPKP  155

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            C+N +GDH LL+  KNK+DYCR+HG +IFY   LL
Sbjct  156  CENPVGDHYLLKSIKNKIDYCRIHGLEIFYNMALL  190



>gb|AEN82384.1| AT4G02500-like protein, partial [Capsella rubella]
 gb|AEN82385.1| AT4G02500-like protein, partial [Capsella rubella]
 gb|AEN82386.1| AT4G02500-like protein, partial [Capsella rubella]
 gb|AEN82387.1| AT4G02500-like protein, partial [Capsella rubella]
 gb|AEN82388.1| AT4G02500-like protein, partial [Capsella rubella]
 gb|AEN82389.1| AT4G02500-like protein, partial [Capsella rubella]
 gb|AEN82390.1| AT4G02500-like protein, partial [Capsella rubella]
 gb|AEN82391.1| AT4G02500-like protein, partial [Capsella rubella]
Length=167

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 53/80 (66%), Gaps = 3/80 (4%)
 Frame = +1

Query  265  YTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQCKNQIGDHLLLRLFK  435
            YT+   + +WDE+R  WL ++PSF   I     RVL+VTGS    C+N +GDH LL+  K
Sbjct  2    YTLGPKISDWDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYLLKSIK  61

Query  436  NKVDYCRLHGYDIFYXTVLL  495
            NK+DYCRLHG +IFY   LL
Sbjct  62   NKIDYCRLHGIEIFYNMALL  81



>ref|XP_010491391.1| PREDICTED: putative glycosyltransferase 3 [Camelina sativa]
Length=459

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 61/95 (64%), Gaps = 6/95 (6%)
 Frame = +1

Query  220  DDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAAN---RVLVVTGSQATQ  390
            ++PP+ +   D ++ YT+   + NWD+KRK WL Q+PSF P   N   +VL++TGS    
Sbjct  107  NEPPDSDL--DLNMTYTLGPKITNWDQKRKLWLTQNPSF-PSVVNGKAKVLLLTGSPPKP  163

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            C N IGDH LL+  KNK+DYCR+HG +I Y    L
Sbjct  164  CDNPIGDHYLLKSVKNKIDYCRIHGIEIVYNMAHL  198



>ref|NP_001288054.1| calmodulin binding transcription activator 1 [Malus domestica]
 ref|XP_008340813.1| PREDICTED: putative glycosyltransferase 2 [Malus domestica]
 ref|XP_008353228.1| PREDICTED: putative glycosyltransferase 2 [Malus domestica]
 ref|XP_008361964.1| PREDICTED: putative glycosyltransferase 2 [Malus domestica]
 gb|ADL36660.1| CAMTA domain class transcription factor [Malus domestica]
Length=461

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 62/97 (64%), Gaps = 3/97 (3%)
 Frame = +1

Query  214  LGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP---SFIPGAANRVLVVTGSQA  384
            L D+P   +   DP+  Y++   + +WDE+R  WL+++P   +F+     RVL+VTGS  
Sbjct  101  LKDEPATDDEKRDPNQPYSLGPKISDWDEQRSDWLKKNPGFPNFVGPNKPRVLLVTGSSP  160

Query  385  TQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
              C+N +GDH LL+  KNK+DYCRLHG ++FY   LL
Sbjct  161  KPCENPVGDHYLLKSIKNKIDYCRLHGIEVFYNFALL  197



>gb|EMT04084.1| Xyloglucan 6-xylosyltransferase [Aegilops tauschii]
Length=451

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 57/95 (60%), Gaps = 3/95 (3%)
 Frame = +1

Query  220  DDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPS---FIPGAANRVLVVTGSQATQ  390
            DD PE       D  YT+   + +WDE+R AW  +HP    F+     RV++VTGS    
Sbjct  96   DDEPEPQPRSLRDPPYTLGPKISDWDEQRAAWNRRHPETPPFLNDVKPRVMLVTGSSPKP  155

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            C+N +GDH LL+  KNK+DYCR+HG +IFY   LL
Sbjct  156  CENPVGDHYLLKSIKNKIDYCRIHGLEIFYNMALL  190



>ref|XP_007209124.1| hypothetical protein PRUPE_ppa005479mg [Prunus persica]
 gb|EMJ10323.1| hypothetical protein PRUPE_ppa005479mg [Prunus persica]
Length=459

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 60/91 (66%), Gaps = 5/91 (5%)
 Frame = +1

Query  220  DDPPEKNFYD-DPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAAN---RVLVVTGSQAT  387
            +DP E    + +P++ YT+   + NWD++R AWL+ +P F P   N   RVL+VTGS   
Sbjct  103  NDPDELTQTEINPNITYTLGPKIANWDKERNAWLQSNPEF-PSLVNGKPRVLLVTGSPPK  161

Query  388  QCKNQIGDHLLLRLFKNKVDYCRLHGYDIFY  480
             C N IGDH LL++ KNK+DYCRLHG +I Y
Sbjct  162  PCDNPIGDHYLLKVIKNKIDYCRLHGIEIVY  192



>ref|XP_007201035.1| hypothetical protein PRUPE_ppa005690mg [Prunus persica]
 gb|EMJ02234.1| hypothetical protein PRUPE_ppa005690mg [Prunus persica]
Length=448

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 57/85 (67%), Gaps = 3/85 (4%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQCKNQIGDHLL  420
            +P+  YT+   + NWDE+R  WL+++P+F   I     RVL+VTGS    C+N +GDH L
Sbjct  102  EPNKPYTLGPKISNWDEQRSKWLKENPNFPNFIGPNKPRVLLVTGSSPKPCENPVGDHYL  161

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCRLHG ++FY   LL
Sbjct  162  LKSIKNKIDYCRLHGIEVFYNMALL  186



>ref|XP_004229187.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Solanum lycopersicum]
Length=464

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 61/97 (63%), Gaps = 3/97 (3%)
 Frame = +1

Query  214  LGDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQA  384
            + +D  E  F  DP+  Y +   + +WDE+R  WL+++P+F   +     RVL+VTGS  
Sbjct  106  VDEDDGEPEFKRDPNQPYALGPKIIDWDEQRGEWLKKNPNFPNFVGTNKPRVLLVTGSSP  165

Query  385  TQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
              C+N +GDH LL+  KNK+DYCRLHG +IFY   LL
Sbjct  166  KPCENPVGDHYLLKSIKNKIDYCRLHGIEIFYNMALL  202



>gb|ADG38703.1| AT4G02500-like protein, partial [Capsella grandiflora]
 gb|ADG38704.1| AT4G02500-like protein, partial [Capsella grandiflora]
 gb|ADG38705.1| AT4G02500-like protein, partial [Capsella grandiflora]
 gb|ADG38706.1| AT4G02500-like protein, partial [Capsella grandiflora]
 gb|ADG38707.1| AT4G02500-like protein, partial [Capsella grandiflora]
 gb|ADG38708.1| AT4G02500-like protein, partial [Capsella grandiflora]
Length=165

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 53/80 (66%), Gaps = 3/80 (4%)
 Frame = +1

Query  265  YTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQCKNQIGDHLLLRLFK  435
            YT+   + +WDE+R  WL ++PSF   I     RVL+VTGS    C+N +GDH LL+  K
Sbjct  1    YTLGPKISDWDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYLLKSIK  60

Query  436  NKVDYCRLHGYDIFYXTVLL  495
            NK+DYCRLHG +IFY   LL
Sbjct  61   NKIDYCRLHGIEIFYNMALL  80



>dbj|BAJ96459.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=474

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 69/131 (53%), Gaps = 10/131 (8%)
 Frame = +1

Query  124  PNPSFNGGFPSLAGKISGGGEECSYKQGFNLGDDPPEKNFYDD-PDLRYTIEKPVKNWDE  300
            P+  F   FP    +      E  Y +   L   P  + FYDD   L Y +++ V  WD 
Sbjct  72   PSLPFPTSFPQHQAEDDDSDSEGLYAR---LAAHP--RTFYDDDAGLSYAVDRRVTGWDA  126

Query  301  KRKAWLEQH-PSFIP---GAANRVLVVTGSQATQCKNQIGDHLLLRLFKNKVDYCRLHGY  468
            KR  WL QH P  +    G   RV++++GSQ+  C    GDH+LLR  KNK+DY RLHG 
Sbjct  127  KRAEWLRQHYPRGLRARRGPGERVVMLSGSQSYPCAGDGGDHMLLRFLKNKLDYARLHGM  186

Query  469  DIFYXTVLLQP  501
            ++ Y T LLQP
Sbjct  187  ELLYNTALLQP  197



>gb|KJB22531.1| hypothetical protein B456_004G052700 [Gossypium raimondii]
Length=459

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 57/85 (67%), Gaps = 3/85 (4%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQ---HPSFIPGAANRVLVVTGSQATQCKNQIGDHLL  420
            DP+  Y++   + +WDE+R  WL++   +P+FI     RVL+VTGS    C+N +GDH L
Sbjct  113  DPNAPYSLGPRISDWDEQRSRWLQENPNYPNFIGPNKPRVLLVTGSSPKPCENPVGDHYL  172

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCRLHG +IFY   LL
Sbjct  173  LKSIKNKIDYCRLHGIEIFYNMALL  197



>emb|CDY70090.1| BnaCnng66640D, partial [Brassica napus]
Length=354

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQCKNQIGDHLL  420
            DP+  YT+   + +WDE+R  WL ++P+F   I     RVL+VTGS    C+N +GDH L
Sbjct  113  DPNKPYTLGPKISDWDEQRSDWLAKNPTFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYL  172

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCRLHG +IFY   LL
Sbjct  173  LKSIKNKIDYCRLHGIEIFYNMALL  197



>ref|XP_004987032.1| PREDICTED: xyloglucan 6-xylosyltransferase-like [Setaria italica]
Length=434

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 58/94 (62%), Gaps = 6/94 (6%)
 Frame = +1

Query  226  PPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP---SFIPGAANRVLVVTGSQATQCK  396
            PP +   D P    ++   V ++DE+R  WL  +P   +F+     RVLVV+GS   +C 
Sbjct  88   PPPRQLMDPP---LSLGPAVSDYDERRDKWLRDNPRFPAFVALGRPRVLVVSGSSPRRCS  144

Query  397  NQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQ  498
               GDHLLLR FKNKVDYCR+HG+DIFY T +L 
Sbjct  145  APDGDHLLLRAFKNKVDYCRVHGFDIFYSTSVLD  178



>ref|XP_002874911.1| hypothetical protein ARALYDRAFT_490316 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51170.1| hypothetical protein ARALYDRAFT_490316 [Arabidopsis lyrata subsp. 
lyrata]
Length=463

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQCKNQIGDHLL  420
            DP+  YT+   + +WDE+R  WL ++PSF   I     RVL+VTGS    C+N +GDH L
Sbjct  115  DPNKPYTLGPKISDWDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYL  174

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCRLHG +IFY   LL
Sbjct  175  LKSIKNKIDYCRLHGIEIFYNMALL  199



>ref|NP_567241.1| UDP-xylosyltransferase 2 [Arabidopsis thaliana]
 sp|O22775.1|XXT2_ARATH RecName: Full=Xyloglucan 6-xylosyltransferase 2; Short=AtXT2; 
AltName: Full=Putative glycosyltransferase 2; Short=AtGT2 [Arabidopsis 
thaliana]
 gb|AAC19271.1| T14P8.23 [Arabidopsis thaliana]
 emb|CAC01674.1| putative golgi glycosyltransferase [Arabidopsis thaliana]
 gb|AAL14393.1| AT4g02500/T10P11_20 [Arabidopsis thaliana]
 gb|AAM98170.1| putative glycosyltransferase [Arabidopsis thaliana]
 gb|AAP31945.1| At4g02500 [Arabidopsis thaliana]
 gb|AEE82181.1| UDP-xylosyltransferase 2 [Arabidopsis thaliana]
 gb|AHL38708.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=461

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQCKNQIGDHLL  420
            DP+  YT+   + +WDE+R  WL ++PSF   I     RVL+VTGS    C+N +GDH L
Sbjct  113  DPNKPYTLGPKISDWDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYL  172

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCRLHG +IFY   LL
Sbjct  173  LKSIKNKIDYCRLHGIEIFYNMALL  197



>ref|XP_010523024.1| PREDICTED: putative glycosyltransferase 3 [Tarenaya hassleriana]
Length=454

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 59/95 (62%), Gaps = 6/95 (6%)
 Frame = +1

Query  220  DDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAAN---RVLVVTGSQATQ  390
            D+P E +   + ++ YT+   + NWDE+RK WL Q+P F P   N   R+L++TGS    
Sbjct  102  DEPTESDL--NLNMTYTLGPKITNWDEQRKVWLSQNPEF-PNVVNGKPRILLLTGSPPKP  158

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            C N IGDH LL+  KNK+DYCRLHG +I Y    L
Sbjct  159  CDNPIGDHYLLKSVKNKIDYCRLHGIEIVYNMAHL  193



>ref|XP_008235042.1| PREDICTED: putative glycosyltransferase 2 [Prunus mume]
Length=449

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQCKNQIGDHLL  420
            DP+  Y +   + NWDE+R  WL+++P+F   I     RVL+VTGS    C+N +GDH L
Sbjct  103  DPNKPYNLGPKISNWDEQRSKWLKENPNFPNFIGPNKPRVLLVTGSSPKPCENPVGDHYL  162

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCRLHG ++FY   LL
Sbjct  163  LKSIKNKIDYCRLHGIEVFYNMALL  187



>ref|XP_006287708.1| hypothetical protein CARUB_v10000915mg [Capsella rubella]
 ref|XP_006287709.1| hypothetical protein CARUB_v10000915mg [Capsella rubella]
 gb|EOA20606.1| hypothetical protein CARUB_v10000915mg [Capsella rubella]
 gb|EOA20607.1| hypothetical protein CARUB_v10000915mg [Capsella rubella]
Length=460

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQCKNQIGDHLL  420
            DP+  YT+   + +WDE+R  WL ++PSF   I     RVL+VTGS    C+N +GDH L
Sbjct  112  DPNKPYTLGPKISDWDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYL  171

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCRLHG +IFY   LL
Sbjct  172  LKSIKNKIDYCRLHGIEIFYNMALL  196



>ref|NP_196389.1| xyloglucan 6-xylosyltransferase [Arabidopsis thaliana]
 sp|Q9LF80.1|GT3_ARATH RecName: Full=Putative glycosyltransferase 3; Short=AtGT3 [Arabidopsis 
thaliana]
 emb|CAC01676.1| putative golgi glycosyltransferase [Arabidopsis thaliana]
 dbj|BAB11451.1| alpha galactosyltransferase protein [Arabidopsis thaliana]
 gb|AAQ56808.1| At5g07720 [Arabidopsis thaliana]
 dbj|BAE99734.1| alpha galactosyltransferase protein [Arabidopsis thaliana]
 gb|AED91197.1| xyloglucan 6-xylosyltransferase [Arabidopsis thaliana]
 gb|AHL38639.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=457

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 62/96 (65%), Gaps = 6/96 (6%)
 Frame = +1

Query  217  GDDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP---SFIPGAANRVLVVTGSQAT  387
             ++PP+ +   D ++ YT+   + NWD+KRK WL Q+P   SFI G A +VL++TGS   
Sbjct  104  SNEPPDSDL--DLNMTYTLGPKITNWDQKRKLWLTQNPDFPSFINGKA-KVLLLTGSPPK  160

Query  388  QCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
             C N IGDH LL+  KNK+DYCR+HG +I Y    L
Sbjct  161  PCDNPIGDHYLLKSVKNKIDYCRIHGIEIVYNMAHL  196



>gb|KJB84424.1| hypothetical protein B456_N024600 [Gossypium raimondii]
Length=459

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 57/85 (67%), Gaps = 3/85 (4%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQ---HPSFIPGAANRVLVVTGSQATQCKNQIGDHLL  420
            DP+  Y++   + +WDE+R  WL++   +P+FI     RVL+VTGS    C+N +GDH L
Sbjct  113  DPNAPYSLGPGISDWDEQRSRWLQENPNYPNFIGPNKPRVLLVTGSSPKPCENPVGDHYL  172

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCRLHG +IFY   LL
Sbjct  173  LKSIKNKIDYCRLHGIEIFYNMALL  197



>gb|AAC78266.1| putative glycosyltransferase [Arabidopsis thaliana]
 emb|CAB80743.1| putative glycosyltransferase [Arabidopsis thaliana]
Length=459

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQCKNQIGDHLL  420
            DP+  YT+   + +WDE+R  WL ++PSF   I     RVL+VTGS    C+N +GDH L
Sbjct  113  DPNKPYTLGPKISDWDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYL  172

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCRLHG +IFY   LL
Sbjct  173  LKSIKNKIDYCRLHGIEIFYNMALL  197



>ref|XP_010456020.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Camelina sativa]
 ref|XP_010456021.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Camelina sativa]
Length=463

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQCKNQIGDHLL  420
            DP+  YT+   + +WDE+R  WL ++PSF   I     RVL+VTGS    C+N +GDH L
Sbjct  115  DPNKPYTLGPKISDWDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYL  174

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCRLHG +IFY   LL
Sbjct  175  LKSIKNKIDYCRLHGIEIFYNMALL  199



>ref|XP_010258549.1| PREDICTED: putative glycosyltransferase 5 isoform X2 [Nelumbo 
nucifera]
Length=457

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQCKNQIGDHLL  420
            +P++ YT+   + NW+E+RKAWL  +P F   I G A R+L+VTGS    C N IGDH L
Sbjct  111  NPNITYTLGPKISNWNEERKAWLNNNPEFPNYISGKA-RILLVTGSPPNPCDNPIGDHYL  169

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCR+HG +I Y    L
Sbjct  170  LKAIKNKIDYCRIHGIEIVYNLAHL  194



>ref|XP_010422579.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Camelina sativa]
Length=463

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQCKNQIGDHLL  420
            DP+  YT+   + +WDE+R  WL ++PSF   I     RVL+VTGS    C+N +GDH L
Sbjct  115  DPNKPYTLGPKISDWDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYL  174

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCRLHG +IFY   LL
Sbjct  175  LKSIKNKIDYCRLHGIEIFYNMALL  199



>ref|NP_191831.1| xyloglucan 6-xylosyltransferase [Arabidopsis thaliana]
 ref|NP_001030917.1| xyloglucan 6-xylosyltransferase [Arabidopsis thaliana]
 sp|Q9LZJ3.1|XXT1_ARATH RecName: Full=Xyloglucan 6-xylosyltransferase 1; Short=AtXT1 
[Arabidopsis thaliana]
 gb|AAL11581.1|AF424587_1 AT3g62720/F26K9_150 [Arabidopsis thaliana]
 emb|CAB83122.1| alpha galactosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAN73295.1| At3g62720/F26K9_150 [Arabidopsis thaliana]
 dbj|BAH20193.1| AT3G62720 [Arabidopsis thaliana]
 gb|AEE80383.1| xyloglucan 6-xylosyltransferase [Arabidopsis thaliana]
 gb|AEE80384.1| xyloglucan 6-xylosyltransferase [Arabidopsis thaliana]
 gb|AHL38717.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=460

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 61/95 (64%), Gaps = 3/95 (3%)
 Frame = +1

Query  220  DDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQ  390
            D+  E+   D  +  Y++   + +WDE+R+ WL+Q+PSF   +     RVL+VTGS    
Sbjct  102  DEGDEEKSRDRTNKPYSLGPKISDWDEQRRDWLKQNPSFPNFVAPNKPRVLLVTGSAPKP  161

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            C+N +GDH LL+  KNK+DYCR+HG +IFY   LL
Sbjct  162  CENPVGDHYLLKSIKNKIDYCRIHGIEIFYNMALL  196



>ref|XP_010429788.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Camelina sativa]
Length=464

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQCKNQIGDHLL  420
            DP+  YT+   + +WDE+R  WL ++PSF   I     RVL+VTGS    C+N +GDH L
Sbjct  116  DPNKPYTLGPKISDWDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYL  175

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCRLHG +IFY   LL
Sbjct  176  LKSIKNKIDYCRLHGIEIFYNMALL  200



>ref|NP_001068066.1| Os11g0546500 [Oryza sativa Japonica Group]
 gb|ABA94224.1| Glycosyltransferase 6, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28429.1| Os11g0546500 [Oryza sativa Japonica Group]
Length=483

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 59/97 (61%), Gaps = 8/97 (8%)
 Frame = +1

Query  235  KNFYDDPDLRYTIE----KPVKNWDEKRKAWLE-QHPSFIPGAA---NRVLVVTGSQATQ  390
            + FYDD  + Y +E      +  WD +R AW+  ++P  +   A    RV++V+GSQA  
Sbjct  104  RTFYDDSRVSYAVEVGRRGGITGWDARRAAWMRLRYPRGLNATAAGRERVVMVSGSQAPP  163

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLLQP  501
            C+ + GDHLL R  KNKVDYCRLHG ++ Y   LLQP
Sbjct  164  CRGEGGDHLLFRFLKNKVDYCRLHGVELLYNNALLQP  200



>ref|XP_011071657.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like, partial [Sesamum 
indicum]
Length=454

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 57/88 (65%), Gaps = 3/88 (3%)
 Frame = +1

Query  241  FYDDPDLRYTIEKPVKNWDEKRKAWLEQHP---SFIPGAANRVLVVTGSQATQCKNQIGD  411
            F  DP   Y++   + +WDE+R  WL+++P   +FI     RVL+VTGS    C+N +GD
Sbjct  108  FKRDPSQPYSLGPNISDWDEQRAEWLKKNPDFPNFIAENKPRVLLVTGSSPKPCENPVGD  167

Query  412  HLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            H LL+  KNK+DYCRLHG +IFY   LL
Sbjct  168  HYLLKSIKNKIDYCRLHGIEIFYNMALL  195



>ref|XP_010258542.1| PREDICTED: putative glycosyltransferase 5 isoform X1 [Nelumbo 
nucifera]
Length=461

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQCKNQIGDHLL  420
            +P++ YT+   + NW+E+RKAWL  +P F   I G A R+L+VTGS    C N IGDH L
Sbjct  111  NPNITYTLGPKISNWNEERKAWLNNNPEFPNYISGKA-RILLVTGSPPNPCDNPIGDHYL  169

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCR+HG +I Y    L
Sbjct  170  LKAIKNKIDYCRIHGIEIVYNLAHL  194



>gb|KHG26935.1| Putative glycosyltransferase 2 -like protein [Gossypium arboreum]
Length=459

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLE---QHPSFIPGAANRVLVVTGSQATQCKNQIGDHLL  420
            DP+  Y++   + +WDE+R  WL+    +P+FI     RVL+VTGS    C+N +GDH L
Sbjct  113  DPNAPYSLGPKISDWDEQRSRWLQDNPNYPNFIGPNKPRVLLVTGSSPKPCENPVGDHYL  172

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCRLHG +IFY   LL
Sbjct  173  LKSIKNKIDYCRLHGIEIFYNMALL  197



>ref|XP_006374450.1| hypothetical protein POPTR_0015s07290g [Populus trichocarpa]
 gb|ERP52247.1| hypothetical protein POPTR_0015s07290g [Populus trichocarpa]
Length=453

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 60/95 (63%), Gaps = 6/95 (6%)
 Frame = +1

Query  220  DDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAAN---RVLVVTGSQATQ  390
            DDP E     +P++ Y++   + NW+++RK WL Q+P F P   N   R+L++TGS  + 
Sbjct  101  DDPAESEI--NPNVTYSLGPKISNWNQERKVWLSQNPEF-PNFVNGKPRILLLTGSPPSP  157

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            C N IGDH LL+  KNK+DYCR+HG +I Y    L
Sbjct  158  CDNPIGDHYLLKAIKNKIDYCRIHGIEIVYNMAHL  192



>ref|XP_004290777.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Fragaria vesca 
subsp. vesca]
Length=450

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 57/85 (67%), Gaps = 3/85 (4%)
 Frame = +1

Query  250  DPDLRYTIEKPVKNWDEKRKAWLEQHPS---FIPGAANRVLVVTGSQATQCKNQIGDHLL  420
            DP+  YT+   + +WD++R  WL+Q+P+   F+     RVL+VTGS    C+N +GDH L
Sbjct  104  DPNKPYTLGPKISDWDQQRSKWLKQNPNMSNFVGPNKPRVLLVTGSSPKPCENPVGDHYL  163

Query  421  LRLFKNKVDYCRLHGYDIFYXTVLL  495
            L+  KNK+DYCRLHG ++FY   LL
Sbjct  164  LKSIKNKIDYCRLHGIEVFYNMALL  188



>emb|CDX93965.1| BnaC04g21240D [Brassica napus]
Length=458

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 3/80 (4%)
 Frame = +1

Query  265  YTIEKPVKNWDEKRKAWLEQHPSFIPGAAN---RVLVVTGSQATQCKNQIGDHLLLRLFK  435
            Y++   + +WDE+R+ WL+Q+PSF   AA    RVL+VTGS    C+N +GDH LL+  K
Sbjct  116  YSLGPKISDWDEQRRDWLKQNPSFPNFAAANKPRVLLVTGSAPKPCENPVGDHYLLKSIK  175

Query  436  NKVDYCRLHGYDIFYXTVLL  495
            NK+DYCR+HG +IFY   LL
Sbjct  176  NKIDYCRIHGIEIFYNMALL  195



>gb|KJB50959.1| hypothetical protein B456_008G195000 [Gossypium raimondii]
Length=460

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 61/95 (64%), Gaps = 6/95 (6%)
 Frame = +1

Query  220  DDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHP---SFIPGAANRVLVVTGSQATQ  390
            D+ PE     +P++ YT+   + +WD++RK WL ++P   +F+ G A R+L+VTGS    
Sbjct  108  DESPETEL--NPNVTYTLGPKITDWDQQRKVWLSKNPEFPNFVNGKA-RILLVTGSPPNP  164

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            C N IGDH LL+  KNK+DYCRLHG +I Y    L
Sbjct  165  CDNAIGDHYLLKAIKNKIDYCRLHGIEIVYNMAHL  199



>gb|ADG38709.1| AT4G02500-like protein, partial [Neslia paniculata]
Length=165

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 53/80 (66%), Gaps = 3/80 (4%)
 Frame = +1

Query  265  YTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQCKNQIGDHLLLRLFK  435
            YT+   + +WDE+R  WL ++PSF   I     RVL+VTGS    C+N +GDH LL+  K
Sbjct  1    YTLGPKILDWDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYLLKSIK  60

Query  436  NKVDYCRLHGYDIFYXTVLL  495
            NK+DYCRLHG +IFY   LL
Sbjct  61   NKIDYCRLHGIEIFYNMALL  80



>gb|KDP31286.1| hypothetical protein JCGZ_11662 [Jatropha curcas]
Length=422

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 62/99 (63%), Gaps = 8/99 (8%)
 Frame = +1

Query  220  DDPPEKNFYDDPDLR----YTIEKPVKNWDEKRKAWLEQH---PSFIPGAANRVLVVTGS  378
            DDP + N   +P++     YT+   + NWD++RK WL Q+   P+F+ G A R+L++TGS
Sbjct  64   DDPTDPNELPEPEINPNVTYTLGPKIANWDQERKVWLTQNAEFPNFVNGKA-RILLLTGS  122

Query  379  QATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
                C N IGDH LL+  KNK+DYCR+HG +I Y    L
Sbjct  123  PPKPCDNPIGDHYLLKAIKNKIDYCRIHGIEIVYNMAHL  161



>ref|XP_010269507.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Nelumbo nucifera]
Length=455

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 60/91 (66%), Gaps = 3/91 (3%)
 Frame = +1

Query  232  EKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQCKNQ  402
            E++   DP+  Y++   + +WDE+R  WL+++P+F   I     RVL+VTGS    C+N 
Sbjct  103  EEDEKPDPNKPYSLGPKISDWDEQRARWLQENPNFPNFIGPNKPRVLLVTGSSPKPCENP  162

Query  403  IGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            +GDH LL+  KNK+DYCRLHG +IFY   LL
Sbjct  163  VGDHYLLKSIKNKIDYCRLHGIEIFYNMALL  193



>dbj|BAK06850.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=443

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 60/101 (59%), Gaps = 9/101 (9%)
 Frame = +1

Query  220  DDPPEKNFYDDPDLRYTIEKP------VKNWDEKRKAWLEQHPSF---IPGAANRVLVVT  372
            ++PP  +  ++  LR   ++P      V ++D +R AWL  HP F   +     RVL+VT
Sbjct  79   NEPPVPSESEEQPLRQLTDRPYSLGPNVSDYDARRAAWLAAHPRFPAMVAPERPRVLMVT  138

Query  373  GSQATQCKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            GS   +CK   GDH+LLR FKNK DYCR+HG DIFY   +L
Sbjct  139  GSSPRRCKEAEGDHVLLRAFKNKADYCRVHGLDIFYSNAVL  179



>ref|XP_010423175.1| PREDICTED: putative glycosyltransferase 3 [Camelina sativa]
Length=459

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 60/95 (63%), Gaps = 6/95 (6%)
 Frame = +1

Query  220  DDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSFIPGAAN---RVLVVTGSQATQ  390
            ++PP+ +   D ++ YT+   + NWD+KRK WL Q+P F P   N   +VL++TGS    
Sbjct  107  NEPPDSDL--DLNMTYTLGPKITNWDQKRKLWLTQNPGF-PSVVNGKAKVLLLTGSPPKP  163

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            C N IGDH LL+  KNK+DYCR+HG +I Y    L
Sbjct  164  CDNSIGDHYLLKSVKNKIDYCRIHGIEIVYNMAHL  198



>ref|XP_004136173.1| PREDICTED: xyloglucan 6-xylosyltransferase-like [Cucumis sativus]
 ref|XP_004160566.1| PREDICTED: xyloglucan 6-xylosyltransferase-like [Cucumis sativus]
 gb|KGN44922.1| hypothetical protein Csa_7G396380 [Cucumis sativus]
Length=411

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 58/90 (64%), Gaps = 3/90 (3%)
 Frame = +1

Query  235  KNFYDDPDLRYTIEKPVKNWDEKRKAWLEQH---PSFIPGAANRVLVVTGSQATQCKNQI  405
            K+F    +  Y +   V +WDE+R+ WL+ +   P+FI     RVL+VTGS   +C+N I
Sbjct  62   KSFSGRTEKPYRLAPQVSDWDERRRKWLKDNRGFPNFIRPGKPRVLLVTGSSPEKCENPI  121

Query  406  GDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            GDH LL+  KNK+DYCRLHG +IFY   +L
Sbjct  122  GDHYLLKSIKNKIDYCRLHGIEIFYNLAIL  151



>ref|XP_006402349.1| hypothetical protein EUTSA_v10005949mg [Eutrema salsugineum]
 gb|ESQ43802.1| hypothetical protein EUTSA_v10005949mg [Eutrema salsugineum]
Length=468

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 59/95 (62%), Gaps = 3/95 (3%)
 Frame = +1

Query  220  DDPPEKNFYDDPDLRYTIEKPVKNWDEKRKAWLEQHPSF---IPGAANRVLVVTGSQATQ  390
            D+  E+   +D    Y++   + NWDE+R  WL+Q+PSF   +     RVL+VTGS    
Sbjct  103  DEGDEEKSEEDRSKPYSLGPKISNWDEQRNDWLKQNPSFPNFVAPNKPRVLLVTGSAPKP  162

Query  391  CKNQIGDHLLLRLFKNKVDYCRLHGYDIFYXTVLL  495
            C+N +GDH LL+  KNK+DYCR HG +IFY   LL
Sbjct  163  CENPVGDHYLLKSIKNKIDYCRTHGIEIFYNMALL  197



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564814758300