BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF011L02

Length=523
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009603199.1|  PREDICTED: uncharacterized protein LOC104098231    106   3e-23   Nicotiana tomentosiformis
ref|XP_006359953.1|  PREDICTED: uncharacterized protein LOC102605...    104   2e-22   Solanum tuberosum [potatoes]
ref|XP_006359954.1|  PREDICTED: uncharacterized protein LOC102605...    104   2e-22   Solanum tuberosum [potatoes]
ref|XP_004246017.1|  PREDICTED: uncharacterized protein LOC101254412    103   4e-22   Solanum lycopersicum
ref|XP_009769854.1|  PREDICTED: uncharacterized protein LOC104220660    101   1e-21   Nicotiana sylvestris
emb|CDP07209.1|  unnamed protein product                              99.8    6e-21   Coffea canephora [robusta coffee]
gb|KJB25097.1|  hypothetical protein B456_004G177500                  92.4    6e-19   Gossypium raimondii
gb|EYU37484.1|  hypothetical protein MIMGU_mgv1a002766mg              92.8    2e-18   Erythranthe guttata [common monkey flower]
gb|KJB25099.1|  hypothetical protein B456_004G177500                  92.0    2e-18   Gossypium raimondii
gb|KJB25101.1|  hypothetical protein B456_004G177500                  92.0    2e-18   Gossypium raimondii
gb|KJB25098.1|  hypothetical protein B456_004G177500                  92.0    3e-18   Gossypium raimondii
gb|KJB25102.1|  hypothetical protein B456_004G177500                  91.7    4e-18   Gossypium raimondii
gb|KCW72694.1|  hypothetical protein EUGRSUZ_E01147                   91.7    4e-18   Eucalyptus grandis [rose gum]
ref|XP_010056116.1|  PREDICTED: uncharacterized protein LOC104444...  91.3    5e-18   
emb|CDX84232.1|  BnaC04g09940D                                        86.7    6e-18   
ref|XP_010505074.1|  PREDICTED: uncharacterized protein LOC104781967  91.3    6e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010056115.1|  PREDICTED: uncharacterized protein LOC104444...  90.9    9e-18   Eucalyptus grandis [rose gum]
ref|XP_010266424.1|  PREDICTED: uncharacterized protein LOC104603...  89.4    3e-17   Nelumbo nucifera [Indian lotus]
gb|KJB25104.1|  hypothetical protein B456_004G177500                  89.0    3e-17   Gossypium raimondii
gb|KFK36454.1|  hypothetical protein AALP_AA4G126700                  89.0    3e-17   Arabis alpina [alpine rockcress]
emb|CDP07210.1|  unnamed protein product                              88.6    5e-17   Coffea canephora [robusta coffee]
ref|XP_002881404.1|  hypothetical protein ARALYDRAFT_902666           87.8    1e-16   
ref|XP_006293822.1|  hypothetical protein CARUB_v10022808mg           87.4    1e-16   Capsella rubella
emb|CDX84192.1|  BnaC04g09540D                                        87.4    1e-16   
ref|XP_009143647.1|  PREDICTED: uncharacterized protein LOC103867343  87.0    2e-16   Brassica rapa
ref|XP_010509590.1|  PREDICTED: uncharacterized protein LOC104785987  87.0    2e-16   Camelina sativa [gold-of-pleasure]
emb|CDY31704.1|  BnaA05g08430D                                        87.0    2e-16   Brassica napus [oilseed rape]
ref|XP_010518959.1|  PREDICTED: UDP-D-xylose:L-fucose alpha-1,3-D...  87.0    2e-16   Tarenaya hassleriana [spider flower]
ref|XP_010516741.1|  PREDICTED: uncharacterized protein LOC104792321  87.0    2e-16   Camelina sativa [gold-of-pleasure]
dbj|BAH19600.1|  AT2G35610                                            86.7    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850250.1|  xyloglucanase 113                                   86.7    2e-16   Arabidopsis thaliana [mouse-ear cress]
gb|KJB51494.1|  hypothetical protein B456_008G219000                  85.1    2e-16   Gossypium raimondii
gb|EPS61566.1|  hypothetical protein M569_13228                       85.5    2e-16   Genlisea aurea
ref|XP_011082183.1|  PREDICTED: uncharacterized protein LOC105165...  86.3    3e-16   Sesamum indicum [beniseed]
ref|XP_011082185.1|  PREDICTED: uncharacterized protein LOC105165...  86.3    3e-16   Sesamum indicum [beniseed]
ref|XP_011082184.1|  PREDICTED: uncharacterized protein LOC105165...  86.3    3e-16   Sesamum indicum [beniseed]
emb|CDY32116.1|  BnaC04g44500D                                        86.3    3e-16   Brassica napus [oilseed rape]
gb|KHF98530.1|  hypothetical protein F383_12515                       86.3    3e-16   Gossypium arboreum [tree cotton]
ref|XP_007040866.1|  Xyloglucanase 113 isoform 2                      85.5    3e-16   
ref|XP_007040867.1|  Xyloglucanase 113 isoform 3                      85.5    4e-16   
gb|KDP31566.1|  hypothetical protein JCGZ_15383                       85.9    4e-16   Jatropha curcas
ref|XP_010266425.1|  PREDICTED: uncharacterized protein LOC104603...  85.9    4e-16   Nelumbo nucifera [Indian lotus]
ref|XP_006410719.1|  hypothetical protein EUTSA_v10016368mg           85.5    5e-16   Eutrema salsugineum [saltwater cress]
ref|XP_007040865.1|  Xyloglucanase 113 isoform 1                      85.5    5e-16   
ref|XP_011028505.1|  PREDICTED: uncharacterized protein LOC105128...  85.1    9e-16   Populus euphratica
gb|KJB51493.1|  hypothetical protein B456_008G219000                  84.7    1e-15   Gossypium raimondii
gb|KHG12902.1|  hypothetical protein F383_16835                       84.3    1e-15   Gossypium arboreum [tree cotton]
ref|XP_009141501.1|  PREDICTED: uncharacterized protein LOC103865...  84.3    1e-15   Brassica rapa
ref|XP_009141500.1|  PREDICTED: uncharacterized protein LOC103865...  84.0    2e-15   Brassica rapa
emb|CDY40459.1|  BnaA04g20580D                                        84.0    2e-15   Brassica napus [oilseed rape]
ref|XP_011028504.1|  PREDICTED: uncharacterized protein LOC105128...  83.6    3e-15   Populus euphratica
ref|XP_004300682.1|  PREDICTED: uncharacterized protein LOC101298609  83.2    4e-15   Fragaria vesca subsp. vesca
ref|XP_006430896.1|  hypothetical protein CICLE_v10011269mg           82.8    5e-15   Citrus clementina [clementine]
ref|XP_006385158.1|  hypothetical protein POPTR_0004s24390g           82.0    9e-15   
ref|XP_003547737.1|  PREDICTED: uncharacterized protein LOC100780346  81.3    2e-14   Glycine max [soybeans]
gb|KHN27499.1|  hypothetical protein glysoja_018611                   81.3    2e-14   Glycine soja [wild soybean]
ref|XP_008365916.1|  PREDICTED: uncharacterized protein LOC103429...  79.3    6e-14   
gb|KDO72261.1|  hypothetical protein CISIN_1g036925mg                 79.3    7e-14   Citrus sinensis [apfelsine]
ref|XP_006482352.1|  PREDICTED: uncharacterized protein LOC102613765  79.3    8e-14   Citrus sinensis [apfelsine]
emb|CDP12729.1|  unnamed protein product                              78.6    1e-13   Coffea canephora [robusta coffee]
gb|KHG12903.1|  hypothetical protein F383_16835                       77.8    2e-13   Gossypium arboreum [tree cotton]
ref|XP_010676705.1|  PREDICTED: uncharacterized protein LOC104892...  77.4    3e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676706.1|  PREDICTED: uncharacterized protein LOC104892...  77.0    3e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007210882.1|  hypothetical protein PRUPE_ppa002815mg           77.4    3e-13   Prunus persica
ref|XP_003548765.1|  PREDICTED: uncharacterized protein LOC100819032  77.4    3e-13   Glycine max [soybeans]
gb|KHN03113.1|  hypothetical protein glysoja_049543                   77.0    4e-13   Glycine soja [wild soybean]
ref|XP_010676703.1|  PREDICTED: uncharacterized protein LOC104892...  77.0    4e-13   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN41773.1|  Pentatricopeptide repeat-containing protein, mito...  77.8    4e-13   Glycine soja [wild soybean]
ref|XP_007156343.1|  hypothetical protein PHAVU_003G278500g           75.9    6e-13   Phaseolus vulgaris [French bean]
ref|XP_009362859.1|  PREDICTED: uncharacterized protein LOC103952897  76.3    9e-13   Pyrus x bretschneideri [bai li]
gb|KHN05539.1|  hypothetical protein glysoja_020504                   75.9    1e-12   Glycine soja [wild soybean]
ref|XP_006590766.1|  PREDICTED: uncharacterized protein LOC100789338  75.9    1e-12   Glycine max [soybeans]
ref|XP_002519934.1|  reticulon3-A3, putative                          75.5    2e-12   Ricinus communis
ref|XP_004509491.1|  PREDICTED: uncharacterized protein LOC101505601  74.7    3e-12   Cicer arietinum [garbanzo]
emb|CDP12730.1|  unnamed protein product                              74.7    3e-12   Coffea canephora [robusta coffee]
emb|CAN79199.1|  hypothetical protein VITISV_040773                   74.7    3e-12   Vitis vinifera
emb|CDP12731.1|  unnamed protein product                              74.3    4e-12   Coffea canephora [robusta coffee]
emb|CBI29197.3|  unnamed protein product                              73.9    4e-12   Vitis vinifera
ref|XP_006878624.1|  hypothetical protein AMTR_s00011p00260650        73.9    5e-12   Amborella trichopoda
ref|XP_003517099.1|  PREDICTED: uncharacterized protein LOC100776463  73.2    7e-12   Glycine max [soybeans]
ref|XP_002269181.2|  PREDICTED: uncharacterized protein LOC100263017  73.2    8e-12   Vitis vinifera
ref|XP_008782814.1|  PREDICTED: uncharacterized protein LOC103702...  70.5    1e-11   Phoenix dactylifera
gb|AES95448.2|  nucleotide-diphospho-sugar transferase family pro...  72.4    2e-11   Medicago truncatula
ref|XP_010111777.1|  hypothetical protein L484_008781                 72.0    2e-11   Morus notabilis
ref|XP_003612490.1|  hypothetical protein MTR_5g025590                72.0    2e-11   
ref|XP_008782812.1|  PREDICTED: uncharacterized protein LOC103702...  68.9    5e-11   Phoenix dactylifera
ref|XP_004982506.1|  PREDICTED: uncharacterized protein LOC101753789  70.5    6e-11   Setaria italica
gb|AET03500.2|  nucleotide-diphospho-sugar transferase family pro...  70.5    7e-11   Medicago truncatula
ref|XP_003629024.1|  hypothetical protein MTR_8g072310                70.1    8e-11   
gb|EMS55953.1|  hypothetical protein TRIUR3_26709                     69.7    1e-10   Triticum urartu
gb|EPS61907.1|  hypothetical protein M569_12886                       66.6    2e-10   Genlisea aurea
ref|XP_007158076.1|  hypothetical protein PHAVU_002G122000g           68.6    3e-10   Phaseolus vulgaris [French bean]
gb|AAD15452.2|  unknown protein                                       68.6    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001143144.1|  hypothetical protein                             68.2    4e-10   Zea mays [maize]
ref|XP_003562333.1|  PREDICTED: uncharacterized protein LOC100845970  67.8    4e-10   Brachypodium distachyon [annual false brome]
ref|XP_010235552.1|  PREDICTED: uncharacterized protein LOC100829311  67.8    5e-10   
ref|XP_004512439.1|  PREDICTED: uncharacterized protein LOC101497257  67.0    8e-10   
ref|XP_002464281.1|  hypothetical protein SORBIDRAFT_01g015590        65.9    2e-09   Sorghum bicolor [broomcorn]
ref|XP_008444233.1|  PREDICTED: uncharacterized protein LOC103487624  65.5    3e-09   Cucumis melo [Oriental melon]
ref|XP_010540709.1|  PREDICTED: uncharacterized protein LOC104814389  65.5    3e-09   Tarenaya hassleriana [spider flower]
ref|XP_004142646.1|  PREDICTED: uncharacterized protein LOC101203732  63.9    1e-08   Cucumis sativus [cucumbers]
ref|XP_010907098.1|  PREDICTED: uncharacterized protein LOC105033...  62.4    3e-08   Elaeis guineensis
ref|XP_010907097.1|  PREDICTED: uncharacterized protein LOC105033...  62.4    3e-08   Elaeis guineensis
ref|XP_010676704.1|  PREDICTED: uncharacterized protein LOC104892...  61.6    4e-08   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB25103.1|  hypothetical protein B456_004G177500                  60.8    7e-08   Gossypium raimondii
ref|NP_001050567.1|  Os03g0586300                                     59.3    2e-07   
gb|EPS68350.1|  hypothetical protein M569_06419                       58.9    3e-07   Genlisea aurea
gb|EEC75649.1|  hypothetical protein OsI_12401                        58.9    3e-07   Oryza sativa Indica Group [Indian rice]
gb|ABF97349.1|  expressed protein                                     58.9    4e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009383104.1|  PREDICTED: uncharacterized protein LOC103970914  55.5    5e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002988322.1|  glycosyltransferase-like protein                 54.3    1e-05   
ref|XP_002991425.1|  glycosyltransferase-like protein                 54.3    1e-05   



>ref|XP_009603199.1| PREDICTED: uncharacterized protein LOC104098231 [Nicotiana tomentosiformis]
Length=636

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 95/140 (68%), Gaps = 8/140 (6%)
 Frame = +1

Query  103  QEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSPD  282
            +EMANSKPLFLTIYATV +G+VFS+ YVFSA+YSS  +S+ +          IAPS S D
Sbjct  8    KEMANSKPLFLTIYATVLIGIVFSSVYVFSAIYSSPHSSTFS--------LSIAPSASSD  59

Query  283  VPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFX  462
              A   +Q  N S  +  G       Q +SK LKPIWI PP GS+MP LE+FRL+KEL  
Sbjct  60   AKAEPSSQASNFSRLQADGDSTPLNPQLQSKLLKPIWIVPPAGSKMPYLESFRLSKELVE  119

Query  463  ERVRDNVIIVTFGNYAFMDF  522
            ERV  NV++VTFGNYAFMDF
Sbjct  120  ERVIGNVVVVTFGNYAFMDF  139



>ref|XP_006359953.1| PREDICTED: uncharacterized protein LOC102605574 isoform X1 [Solanum 
tuberosum]
Length=635

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 95/140 (68%), Gaps = 9/140 (6%)
 Frame = +1

Query  103  QEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSPD  282
            +EMANSKPLFLTIYATV +G+VFS+ YVFSA+YSS  ++ S           +APS S D
Sbjct  8    KEMANSKPLFLTIYATVLIGIVFSSVYVFSAIYSSPNSTFS---------LSMAPSTSSD  58

Query  283  VPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFX  462
            V A    Q  N S ++   +    K Q +SK LKPIW  PP GS+M  LETF+L+KEL  
Sbjct  59   VKAEPSVQASNFSHRQVDDASIPVKPQHQSKLLKPIWKVPPAGSKMLDLETFKLSKELVQ  118

Query  463  ERVRDNVIIVTFGNYAFMDF  522
            ERV DN+++VTFGNYAFMDF
Sbjct  119  ERVTDNIVVVTFGNYAFMDF  138



>ref|XP_006359954.1| PREDICTED: uncharacterized protein LOC102605574 isoform X2 [Solanum 
tuberosum]
Length=634

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 95/140 (68%), Gaps = 9/140 (6%)
 Frame = +1

Query  103  QEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSPD  282
            +EMANSKPLFLTIYATV +G+VFS+ YVFSA+YSS  ++ S           +APS S D
Sbjct  8    KEMANSKPLFLTIYATVLIGIVFSSVYVFSAIYSSPNSTFS---------LSMAPSTSSD  58

Query  283  VPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFX  462
            V A    Q  N S ++   +    K Q +SK LKPIW  PP GS+M  LETF+L+KEL  
Sbjct  59   VKAEPSVQASNFSHRQVDDASIPVKPQHQSKLLKPIWKVPPAGSKMLDLETFKLSKELVQ  118

Query  463  ERVRDNVIIVTFGNYAFMDF  522
            ERV DN+++VTFGNYAFMDF
Sbjct  119  ERVTDNIVVVTFGNYAFMDF  138



>ref|XP_004246017.1| PREDICTED: uncharacterized protein LOC101254412 [Solanum lycopersicum]
Length=635

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 93/140 (66%), Gaps = 9/140 (6%)
 Frame = +1

Query  103  QEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSPD  282
            +EMANSKPLFLTIYATV +G+VFS+ YVFSA+YSS  ++ S           IAPS S D
Sbjct  8    KEMANSKPLFLTIYATVVIGIVFSSVYVFSAIYSSPNSTFS---------LSIAPSASSD  58

Query  283  VPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFX  462
              A    Q  N S ++        K Q + K LKPIW  PP GS+MP LETF+L+KEL  
Sbjct  59   EKAEPSVQASNFSHRQVDDVSIPVKPQLQRKLLKPIWEVPPAGSKMPDLETFKLSKELVQ  118

Query  463  ERVRDNVIIVTFGNYAFMDF  522
            ERV DN++IVTFGNYAFMDF
Sbjct  119  ERVIDNIVIVTFGNYAFMDF  138



>ref|XP_009769854.1| PREDICTED: uncharacterized protein LOC104220660 [Nicotiana sylvestris]
Length=636

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 93/140 (66%), Gaps = 8/140 (6%)
 Frame = +1

Query  103  QEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSPD  282
            +EMANSKPLF+TIYATV +G+VFS+ YVFSA+YSS  +S+ +          IAPS S D
Sbjct  8    KEMANSKPLFMTIYATVLIGIVFSSVYVFSAIYSSPHSSTFS--------LSIAPSASSD  59

Query  283  VPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFX  462
              A   +Q  N S  +  G       Q +SK LK IW  PP GS+MP LE+FRL+KEL  
Sbjct  60   AEAEPSSQASNFSRLQADGHSTPLNPQLQSKLLKAIWTVPPAGSKMPDLESFRLSKELVQ  119

Query  463  ERVRDNVIIVTFGNYAFMDF  522
            ERV  NV++VTFGNYAFMDF
Sbjct  120  ERVIGNVVVVTFGNYAFMDF  139



>emb|CDP07209.1| unnamed protein product [Coffea canephora]
Length=633

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 101/141 (72%), Gaps = 13/141 (9%)
 Frame = +1

Query  100  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  279
            +++MAN KP+FLTIYATV VGVV S+FYVFSAVYSSS++SSS+  +S +        +SP
Sbjct  8    IKDMANYKPVFLTIYATVVVGVVVSSFYVFSAVYSSSSSSSSSSSSSLW--------FSP  59

Query  280  DVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELF  459
                 V  Q+ N S    V       +Q +SKS+KPIW +PP GS+MP L+TFRLTKEL 
Sbjct  60   -----VQNQVSNSSHVTVVNVSLGSTSQTQSKSMKPIWEAPPSGSKMPPLKTFRLTKELV  114

Query  460  XERVRDNVIIVTFGNYAFMDF  522
             +RV+DNVI+VTFGNYAFMDF
Sbjct  115  QQRVKDNVIVVTFGNYAFMDF  135



>gb|KJB25097.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=399

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 78/156 (50%), Gaps = 36/156 (23%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  270
            +  VQE A SKPLFLTIY T+ VG+V ++                         +  +  
Sbjct  5    RNAVQEAAASKPLFLTIYTTIIVGIVATS------------------------FYVFSAI  40

Query  271  YSPDVPAAV------------LTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGS  414
            YSP  P +             L+Q    +    +  P    +Q  S  LK IW +PP  S
Sbjct  41   YSPSAPTSTQSISTSWLSSPPLSQNGGSNFSNNISQPTDKASQPGSNQLKTIWEAPPSNS  100

Query  415  RMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            +MP LE+F+LTKEL  ER +DNVIIVTFGN+AFMDF
Sbjct  101  KMPPLESFKLTKELVGERAKDNVIIVTFGNFAFMDF  136



>gb|EYU37484.1| hypothetical protein MIMGU_mgv1a002766mg [Erythranthe guttata]
Length=640

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 93/141 (66%), Gaps = 5/141 (4%)
 Frame = +1

Query  100  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  279
            ++E+  S+PLFLTIYATV VG++ S+FYVFSAV+S S + SS   +S      +  + SP
Sbjct  7    LKEVTTSRPLFLTIYATVIVGILVSSFYVFSAVFSGSNSVSSPWFSSLSPAGDVVRASSP  66

Query  280  DVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELF  459
                A      N S +  +GS     ++ K   L PIW +PPPGS MP LETFRLTKEL 
Sbjct  67   SFNGA-----SNSSHEVVIGSAPNLPSRPKKTPLSPIWKAPPPGSEMPPLETFRLTKELV  121

Query  460  XERVRDNVIIVTFGNYAFMDF  522
             +RV+DNVIIVTFGN+AFMDF
Sbjct  122  QQRVKDNVIIVTFGNFAFMDF  142



>gb|KJB25099.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
 gb|KJB25100.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=519

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 78/156 (50%), Gaps = 36/156 (23%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  270
            +  VQE A SKPLFLTIY T+ VG+V ++                         +  +  
Sbjct  5    RNAVQEAAASKPLFLTIYTTIIVGIVATS------------------------FYVFSAI  40

Query  271  YSPDVPAAV------------LTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGS  414
            YSP  P +             L+Q    +    +  P    +Q  S  LK IW +PP  S
Sbjct  41   YSPSAPTSTQSISTSWLSSPPLSQNGGSNFSNNISQPTDKASQPGSNQLKTIWEAPPSNS  100

Query  415  RMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            +MP LE+F+LTKEL  ER +DNVIIVTFGN+AFMDF
Sbjct  101  KMPPLESFKLTKELVGERAKDNVIIVTFGNFAFMDF  136



>gb|KJB25101.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=588

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 78/156 (50%), Gaps = 36/156 (23%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  270
            +  VQE A SKPLFLTIY T+ VG+V ++                         +  +  
Sbjct  5    RNAVQEAAASKPLFLTIYTTIIVGIVATS------------------------FYVFSAI  40

Query  271  YSPDVPAAV------------LTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGS  414
            YSP  P +             L+Q    +    +  P    +Q  S  LK IW +PP  S
Sbjct  41   YSPSAPTSTQSISTSWLSSPPLSQNGGSNFSNNISQPTDKASQPGSNQLKTIWEAPPSNS  100

Query  415  RMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            +MP LE+F+LTKEL  ER +DNVIIVTFGN+AFMDF
Sbjct  101  KMPPLESFKLTKELVGERAKDNVIIVTFGNFAFMDF  136



>gb|KJB25098.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=559

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 78/156 (50%), Gaps = 36/156 (23%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  270
            +  VQE A SKPLFLTIY T+ VG+V ++                         +  +  
Sbjct  5    RNAVQEAAASKPLFLTIYTTIIVGIVATS------------------------FYVFSAI  40

Query  271  YSPDVPAAV------------LTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGS  414
            YSP  P +             L+Q    +    +  P    +Q  S  LK IW +PP  S
Sbjct  41   YSPSAPTSTQSISTSWLSSPPLSQNGGSNFSNNISQPTDKASQPGSNQLKTIWEAPPSNS  100

Query  415  RMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            +MP LE+F+LTKEL  ER +DNVIIVTFGN+AFMDF
Sbjct  101  KMPPLESFKLTKELVGERAKDNVIIVTFGNFAFMDF  136



>gb|KJB25102.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=634

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 78/156 (50%), Gaps = 36/156 (23%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  270
            +  VQE A SKPLFLTIY T+ VG+V ++                         +  +  
Sbjct  5    RNAVQEAAASKPLFLTIYTTIIVGIVATS------------------------FYVFSAI  40

Query  271  YSPDVPAAV------------LTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGS  414
            YSP  P +             L+Q    +    +  P    +Q  S  LK IW +PP  S
Sbjct  41   YSPSAPTSTQSISTSWLSSPPLSQNGGSNFSNNISQPTDKASQPGSNQLKTIWEAPPSNS  100

Query  415  RMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            +MP LE+F+LTKEL  ER +DNVIIVTFGN+AFMDF
Sbjct  101  KMPPLESFKLTKELVGERAKDNVIIVTFGNFAFMDF  136



>gb|KCW72694.1| hypothetical protein EUGRSUZ_E01147 [Eucalyptus grandis]
Length=611

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 91/157 (58%), Gaps = 33/157 (21%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  270
            K+  QE+A+S+PLFLTIYATV  G+V S+ YVFSAV+S                   A  
Sbjct  4    KDSCQEVASSRPLFLTIYATVIAGIVLSSLYVFSAVFS-------------------ANK  44

Query  271  YSPDVPAAVLT------------QIHNESLKETVGSPQ-APKTQAKSKSLKPIWISPPPG  411
             SPD  + + +            Q  N SL  TVG+   AP +Q        +W+ PP  
Sbjct  45   SSPDSTSWLSSPSSLSYVDSHSGQAFNSSLATTVGAAAPAPSSQHGDALANSMWV-PPKS  103

Query  412  SRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            S+MPSL+TFRLTKEL  +RV+DNVIIVTFGNYAFMDF
Sbjct  104  SKMPSLKTFRLTKELVEQRVKDNVIIVTFGNYAFMDF  140



>ref|XP_010056116.1| PREDICTED: uncharacterized protein LOC104444183 isoform X2 [Eucalyptus 
grandis]
Length=636

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 91/155 (59%), Gaps = 31/155 (20%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  270
            K+  QE+A+S+PLFLTIYATV  G+V S+ YVFSAV+S                   A  
Sbjct  4    KDSCQEVASSRPLFLTIYATVIAGIVLSSLYVFSAVFS-------------------ANK  44

Query  271  YSPDVPAAVLT----------QIHNESLKETVGSPQ-APKTQAKSKSLKPIWISPPPGSR  417
             SPD  + + +          Q  N SL  TVG+   AP +Q        +W+ PP  S+
Sbjct  45   SSPDSTSWLSSPSSLSYSHSGQAFNSSLATTVGAAAPAPSSQHGDALANSMWV-PPKSSK  103

Query  418  MPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            MPSL+TFRLTKEL  +RV+DNVIIVTFGNYAFMDF
Sbjct  104  MPSLKTFRLTKELVEQRVKDNVIIVTFGNYAFMDF  138



>emb|CDX84232.1| BnaC04g09940D [Brassica napus]
Length=156

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  361  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            +A+ KSL  IW+SPP   +MP LETF+LTKELF ERV+DNVIIVTFGNY FMDF
Sbjct  92   EAEGKSLGKIWVSPPREKKMPPLETFKLTKELFGERVKDNVIIVTFGNYVFMDF  145



>ref|XP_010505074.1| PREDICTED: uncharacterized protein LOC104781967 [Camelina sativa]
Length=644

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  361  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            +A+ KSL  IW+SPP   +MPSLETF+LTKELF ERV+DNVIIVTFGNYAFMDF
Sbjct  93   EAQGKSLGKIWVSPPRDKKMPSLETFKLTKELFGERVKDNVIIVTFGNYAFMDF  146



>ref|XP_010056115.1| PREDICTED: uncharacterized protein LOC104444183 isoform X1 [Eucalyptus 
grandis]
 gb|KCW72693.1| hypothetical protein EUGRSUZ_E01147 [Eucalyptus grandis]
Length=638

 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 95/146 (65%), Gaps = 11/146 (8%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaas-ssapiassfsLFPIAP  267
            K+  QE+A+S+PLFLTIYATV  G+V S+ YVFSAV+S++ +S  S    SS S      
Sbjct  4    KDSCQEVASSRPLFLTIYATVIAGIVLSSLYVFSAVFSANKSSPDSTSWLSSPSSLSYVD  63

Query  268  SYSPDVPAAVLTQIHNESLKETVGSPQ-APKTQAKSKSLKPIWISPPPGSRMPSLETFRL  444
            S+S         Q  N SL  TVG+   AP +Q        +W+ PP  S+MPSL+TFRL
Sbjct  64   SHS--------GQAFNSSLATTVGAAAPAPSSQHGDALANSMWV-PPKSSKMPSLKTFRL  114

Query  445  TKELFXERVRDNVIIVTFGNYAFMDF  522
            TKEL  +RV+DNVIIVTFGNYAFMDF
Sbjct  115  TKELVEQRVKDNVIIVTFGNYAFMDF  140



>ref|XP_010266424.1| PREDICTED: uncharacterized protein LOC104603944 isoform X1 [Nelumbo 
nucifera]
Length=634

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 83/140 (59%), Gaps = 10/140 (7%)
 Frame = +1

Query  103  QEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSPD  282
            Q+ ANSKPLF+TIYATV VG+  S+ YVFSA+YS     S           P + S    
Sbjct  7    QDAANSKPLFVTIYATVLVGIALSSVYVFSAIYSGKTIYS----------IPWSSSSLSR  56

Query  283  VPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFX  462
            V A  L    N S          P +Q +S   KPIW  PPPG++MP L+ FRLTKEL  
Sbjct  57   VDAPQLEHALNFSRPFAGVGVTGPASQPQSIWTKPIWEVPPPGTKMPPLKAFRLTKELVS  116

Query  463  ERVRDNVIIVTFGNYAFMDF  522
             RV+DN+IIVTFGNYAFMDF
Sbjct  117  HRVKDNIIIVTFGNYAFMDF  136



>gb|KJB25104.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=620

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 78/144 (54%), Gaps = 26/144 (18%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  270
            +  VQE A SKPLFLTIY T+ VG+V ++                         +  +  
Sbjct  5    RNAVQEAAASKPLFLTIYTTIIVGIVATS------------------------FYVFSAI  40

Query  271  YSPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTK  450
            YSP  P +  TQ  + S   +    Q   +Q  S  LK IW +PP  S+MP LE+F+LTK
Sbjct  41   YSPSAPTS--TQSISTSWLSSPPLSQNKASQPGSNQLKTIWEAPPSNSKMPPLESFKLTK  98

Query  451  ELFXERVRDNVIIVTFGNYAFMDF  522
            EL  ER +DNVIIVTFGN+AFMDF
Sbjct  99   ELVGERAKDNVIIVTFGNFAFMDF  122



>gb|KFK36454.1| hypothetical protein AALP_AA4G126700 [Arabis alpina]
Length=642

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 90/152 (59%), Gaps = 29/152 (19%)
 Frame = +1

Query  103  QEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYS--  276
            +E  NSKPLF+TIYATV +GV+ S+FYVFSA+YS                 P   SYS  
Sbjct  10   REATNSKPLFVTIYATVIIGVLVSSFYVFSAIYS-----------------PSNGSYSWL  52

Query  277  PDVPAAVLTQI-HNESLKETVGSPQAPKTQ---------AKSKSLKPIWISPPPGSRMPS  426
               P +   +I H      TV  P AP  Q         A+ KSL  IW+SPP   +MP 
Sbjct  53   SSPPLSTSGRIYHPPQENTTVELPVAPPPQVLPLPTPEEAQGKSLGKIWVSPPRDKKMPP  112

Query  427  LETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            LETF+LTKELF ERV+DNVIIVTFGNYAFMDF
Sbjct  113  LETFKLTKELFGERVKDNVIIVTFGNYAFMDF  144



>emb|CDP07210.1| unnamed protein product [Coffea canephora]
Length=705

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +1

Query  301  TQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDN  480
             Q+ N S    V       +Q +SKS+ PIW  PP GS+MP L+TF+LTKEL  +RV+DN
Sbjct  65   NQVSNCSHLTVVNVSLGSASQTQSKSMMPIWEVPPSGSKMPPLKTFKLTKELVQQRVKDN  124

Query  481  VIIVTFGNYAFMDF  522
            V++VTFGNYAFMDF
Sbjct  125  VVVVTFGNYAFMDF  138



>ref|XP_002881404.1| hypothetical protein ARALYDRAFT_902666 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57663.1| hypothetical protein ARALYDRAFT_902666 [Arabidopsis lyrata subsp. 
lyrata]
Length=640

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  361  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            +A+ +SL  IW+SPP   +MP LETF+LTKELF ERV+DNVIIVTFGNYAFMDF
Sbjct  92   EAQGRSLGKIWVSPPRDKKMPPLETFKLTKELFGERVKDNVIIVTFGNYAFMDF  145



>ref|XP_006293822.1| hypothetical protein CARUB_v10022808mg [Capsella rubella]
 gb|EOA26720.1| hypothetical protein CARUB_v10022808mg [Capsella rubella]
Length=645

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  367  KSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            K KSL  IW+SPP   +MP LETF+LTKELF ERV+DNVIIVTFGNYAFMDF
Sbjct  96   KGKSLGKIWVSPPRDKKMPPLETFKLTKELFGERVKDNVIIVTFGNYAFMDF  147



>emb|CDX84192.1| BnaC04g09540D [Brassica napus]
Length=632

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  361  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            +A+ KSL  IW+SPP   +MP LE+F+LTKELF ERV+DNVIIVTFGNYAFMDF
Sbjct  92   EAQGKSLGKIWVSPPRDKKMPPLESFKLTKELFGERVKDNVIIVTFGNYAFMDF  145



>ref|XP_009143647.1| PREDICTED: uncharacterized protein LOC103867343 [Brassica rapa]
Length=643

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  361  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            +A+ KSL  IW+SPP   +MP LE+F+LTKELF ERV+DNVIIVTFGNYAFMDF
Sbjct  92   EAEGKSLGKIWVSPPRDKKMPPLESFKLTKELFGERVKDNVIIVTFGNYAFMDF  145



>ref|XP_010509590.1| PREDICTED: uncharacterized protein LOC104785987 [Camelina sativa]
Length=644

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  361  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            +A+ KSL  IW+SPP   +MP LETF+LTKELF ER +DNVIIVTFGNYAFMDF
Sbjct  93   EAQGKSLGKIWVSPPRDKKMPPLETFKLTKELFGERAKDNVIIVTFGNYAFMDF  146



>emb|CDY31704.1| BnaA05g08430D [Brassica napus]
Length=632

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  361  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            +A+ KSL  IW+SPP   +MP LE+F+LTKELF ERV+DNVIIVTFGNYAFMDF
Sbjct  92   EAEGKSLGKIWVSPPRDKKMPPLESFKLTKELFGERVKDNVIIVTFGNYAFMDF  145



>ref|XP_010518959.1| PREDICTED: UDP-D-xylose:L-fucose alpha-1,3-D-xylosyltransferase 
MGP4 [Tarenaya hassleriana]
Length=631

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 91/144 (63%), Gaps = 15/144 (10%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  270
            +  V+E  NSKPLF+TIY TV VGV+ S+F+VFSA+YS S  SSS   +   S     P 
Sbjct  5    RNAVREATNSKPLFVTIYGTVIVGVIVSSFFVFSAIYSPSNGSSSWLSSPPLSSVGRFPI  64

Query  271  YSPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTK  450
             SP    + L              P +P +Q++ KSL PIW+ PP   +MP LETFRLTK
Sbjct  65   QSPSNATSDL--------------PVSPPSQSQGKSLNPIWV-PPQEKKMPPLETFRLTK  109

Query  451  ELFXERVRDNVIIVTFGNYAFMDF  522
            EL  ERV+DNV+IVTFGN+AFMDF
Sbjct  110  ELVGERVKDNVVIVTFGNFAFMDF  133



>ref|XP_010516741.1| PREDICTED: uncharacterized protein LOC104792321 [Camelina sativa]
Length=644

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  361  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            +A+ KSL  IW+SPP   +MP LETF+LTKELF ER +DNVIIVTFGNYAFMDF
Sbjct  93   EAQGKSLGKIWVSPPRDKKMPPLETFKLTKELFGERAKDNVIIVTFGNYAFMDF  146



>dbj|BAH19600.1| AT2G35610 [Arabidopsis thaliana]
Length=644

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  361  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            +A+  SL  IW+SPP   +MP LETF+LTKELF ERV+DNVIIVTFGNYAFMDF
Sbjct  93   EAQGNSLGKIWVSPPRDKKMPPLETFKLTKELFGERVKDNVIIVTFGNYAFMDF  146



>ref|NP_850250.1| xyloglucanase 113 [Arabidopsis thaliana]
 gb|AAL67023.1| unknown protein [Arabidopsis thaliana]
 gb|AEC09128.1| xyloglucanase 113 [Arabidopsis thaliana]
 gb|AHL38813.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=644

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  361  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            +A+  SL  IW+SPP   +MP LETF+LTKELF ERV+DNVIIVTFGNYAFMDF
Sbjct  93   EAQGNSLGKIWVSPPRDKKMPPLETFKLTKELFGERVKDNVIIVTFGNYAFMDF  146



>gb|KJB51494.1| hypothetical protein B456_008G219000 [Gossypium raimondii]
Length=391

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 90/144 (63%), Gaps = 18/144 (13%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  270
            +  VQE A SKPLFLTIYATV +G V S+FYVFSA+YS +A+             P    
Sbjct  5    RNAVQETAASKPLFLTIYATVILGTVVSSFYVFSAIYSPTAS-------------PTRSI  51

Query  271  YSPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTK  450
             S  + A  L+Q +  SL   +  P    +Q +S  L+PIW +P   S+MP L++FRLTK
Sbjct  52   SSSWLLAPPLSQ-NGVSLSSNISQP----SQHRSNKLRPIWEAPSRTSKMPRLKSFRLTK  106

Query  451  ELFXERVRDNVIIVTFGNYAFMDF  522
            EL  +R +DNVIIVTFGN+AFMDF
Sbjct  107  ELVAQRAKDNVIIVTFGNFAFMDF  130



>gb|EPS61566.1| hypothetical protein M569_13228, partial [Genlisea aurea]
Length=430

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  364  AKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
             ++KSL PIW  PPPGS+MP LETFRLTKE+  +RVR NVI+VTFGN+AFMDF
Sbjct  4    VQNKSLVPIWQVPPPGSKMPPLETFRLTKEMVQQRVRGNVIVVTFGNFAFMDF  56



>ref|XP_011082183.1| PREDICTED: uncharacterized protein LOC105165007 isoform X1 [Sesamum 
indicum]
Length=640

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 95/141 (67%), Gaps = 5/141 (4%)
 Frame = +1

Query  100  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  279
            ++E AN++PLFLTIYATV +G+  S+FYVFSAV+SSS + SS   ++S     +A + SP
Sbjct  7    LKEAANARPLFLTIYATVIIGIFVSSFYVFSAVFSSSNSVSSPWFSTSPPSGDVAEASSP  66

Query  280  DVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELF  459
                   +Q  N S +  V       +    K LKP+W +P PGS+MP LETF+LTKEL 
Sbjct  67   S-----FSQPSNASRQIVVSIAPDSASVPGRKFLKPLWKAPLPGSKMPPLETFKLTKELV  121

Query  460  XERVRDNVIIVTFGNYAFMDF  522
             +RV+DNVI+VTFGN+AFMDF
Sbjct  122  QQRVKDNVIVVTFGNFAFMDF  142



>ref|XP_011082185.1| PREDICTED: uncharacterized protein LOC105165007 isoform X3 [Sesamum 
indicum]
Length=622

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 95/141 (67%), Gaps = 5/141 (4%)
 Frame = +1

Query  100  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  279
            ++E AN++PLFLTIYATV +G+  S+FYVFSAV+SSS + SS   ++S     +A + SP
Sbjct  7    LKEAANARPLFLTIYATVIIGIFVSSFYVFSAVFSSSNSVSSPWFSTSPPSGDVAEASSP  66

Query  280  DVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELF  459
                   +Q  N S +  V       +    K LKP+W +P PGS+MP LETF+LTKEL 
Sbjct  67   S-----FSQPSNASRQIVVSIAPDSASVPGRKFLKPLWKAPLPGSKMPPLETFKLTKELV  121

Query  460  XERVRDNVIIVTFGNYAFMDF  522
             +RV+DNVI+VTFGN+AFMDF
Sbjct  122  QQRVKDNVIVVTFGNFAFMDF  142



>ref|XP_011082184.1| PREDICTED: uncharacterized protein LOC105165007 isoform X2 [Sesamum 
indicum]
Length=639

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 95/143 (66%), Gaps = 10/143 (7%)
 Frame = +1

Query  100  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  279
            ++E AN++PLFLTIYATV +G+  S+FYVFSAV+SSS + SS         F  +P  S 
Sbjct  7    LKEAANARPLFLTIYATVIIGIFVSSFYVFSAVFSSSNSVSSP-------WFSTSPP-SG  58

Query  280  DVPAAV--LTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKE  453
            DV A+    +Q  N S +  V       +    K LKP+W +P PGS+MP LETF+LTKE
Sbjct  59   DVAASSPSFSQPSNASRQIVVSIAPDSASVPGRKFLKPLWKAPLPGSKMPPLETFKLTKE  118

Query  454  LFXERVRDNVIIVTFGNYAFMDF  522
            L  +RV+DNVI+VTFGN+AFMDF
Sbjct  119  LVQQRVKDNVIVVTFGNFAFMDF  141



>emb|CDY32116.1| BnaC04g44500D [Brassica napus]
Length=636

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 89/150 (59%), Gaps = 27/150 (18%)
 Frame = +1

Query  103  QEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSPD  282
            +E  NSKPLF+TIYATV +GV+ S+FYVFSAVYS +                 + S+   
Sbjct  10   REATNSKPLFVTIYATVIIGVLVSSFYVFSAVYSPTNG---------------STSWLSS  54

Query  283  VPAAVLTQIHNESLKETVGSPQAP----------KTQAKSKSLKPIWISPPPGSRMPSLE  432
             P +   +IH  S +E   S   P          + Q KS SL  IW+SPP   +MP LE
Sbjct  55   PPLSTAGRIHKLS-QENATSQSLPVALPPPPPEEEAQGKS-SLGKIWVSPPKDKKMPPLE  112

Query  433  TFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
             F+LTKELF ERV+DNVIIVTFGNYAFMDF
Sbjct  113  AFKLTKELFGERVKDNVIIVTFGNYAFMDF  142



>gb|KHF98530.1| hypothetical protein F383_12515 [Gossypium arboreum]
Length=605

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 77/156 (49%), Gaps = 36/156 (23%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  270
            +  VQE A SKPLFLTIY T+ VG+V ++                         +  +  
Sbjct  5    RNAVQEAAASKPLFLTIYTTIIVGIVATS------------------------FYVFSAI  40

Query  271  YSPDVPAAV------------LTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGS  414
            YSP    +             L+Q    +    +  P    +Q  S  LK IW +PP  S
Sbjct  41   YSPSASTSTQSISTSWLSSPPLSQNGGSNFSNNISLPTDKASQPGSNQLKTIWQAPPSNS  100

Query  415  RMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            +MP LE+F+LTKEL  ER +DNVIIVTFGN+AFMDF
Sbjct  101  KMPPLESFKLTKELVGERAKDNVIIVTFGNFAFMDF  136



>ref|XP_007040866.1| Xyloglucanase 113 isoform 2 [Theobroma cacao]
 gb|EOY25367.1| Xyloglucanase 113 isoform 2 [Theobroma cacao]
Length=518

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 95/146 (65%), Gaps = 14/146 (10%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  270
            +  VQE A SKPLFLTIYATV VG+V S+FYVFSA+YS SA+++ +          ++ S
Sbjct  5    RNAVQEAAGSKPLFLTIYATVIVGIVVSSFYVFSAIYSPSASTTQS----------VSTS  54

Query  271  Y--SPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRL  444
            +  SP +    ++    +S+   +  P    +Q  S +L+PIW +PP  S+MP L+ F L
Sbjct  55   WLSSPSLSQNGVSLSSGQSIN--ISQPSGIASQPGSNNLRPIWEAPPRTSKMPPLKFFSL  112

Query  445  TKELFXERVRDNVIIVTFGNYAFMDF  522
            TKEL  ER +DNVIIVTFGN+AFMDF
Sbjct  113  TKELVEERAKDNVIIVTFGNFAFMDF  138



>ref|XP_007040867.1| Xyloglucanase 113 isoform 3 [Theobroma cacao]
 gb|EOY25368.1| Xyloglucanase 113 isoform 3 [Theobroma cacao]
Length=546

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 95/146 (65%), Gaps = 14/146 (10%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  270
            +  VQE A SKPLFLTIYATV VG+V S+FYVFSA+YS SA+++ +          ++ S
Sbjct  5    RNAVQEAAGSKPLFLTIYATVIVGIVVSSFYVFSAIYSPSASTTQS----------VSTS  54

Query  271  Y--SPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRL  444
            +  SP +    ++    +S+   +  P    +Q  S +L+PIW +PP  S+MP L+ F L
Sbjct  55   WLSSPSLSQNGVSLSSGQSI--NISQPSGIASQPGSNNLRPIWEAPPRTSKMPPLKFFSL  112

Query  445  TKELFXERVRDNVIIVTFGNYAFMDF  522
            TKEL  ER +DNVIIVTFGN+AFMDF
Sbjct  113  TKELVEERAKDNVIIVTFGNFAFMDF  138



>gb|KDP31566.1| hypothetical protein JCGZ_15383 [Jatropha curcas]
Length=647

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 97/146 (66%), Gaps = 7/146 (5%)
 Frame = +1

Query  85   LEKEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIA  264
            L +   Q + N+KPLFLTIYATV VG++FS+FYVFSAVYSSS+ S++  ++S  S     
Sbjct  11   LWRNAYQAVVNTKPLFLTIYATVVVGILFSSFYVFSAVYSSSSLSATTWLSSPPSSLSRH  70

Query  265  PSYSPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRL  444
               S ++          E+    V SP     + ++K LKPIW +PP  S+MPS++ FRL
Sbjct  71   IDQSSNIS-------QQEAKSIVVVSPPIKTLRPQTKQLKPIWEAPPGNSKMPSIKKFRL  123

Query  445  TKELFXERVRDNVIIVTFGNYAFMDF  522
            TK++  ERV+DNVIIVTFGNYAFMDF
Sbjct  124  TKKMVEERVQDNVIIVTFGNYAFMDF  149



>ref|XP_010266425.1| PREDICTED: uncharacterized protein LOC104603944 isoform X2 [Nelumbo 
nucifera]
Length=616

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 71/144 (49%), Gaps = 36/144 (25%)
 Frame = +1

Query  103  QEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS----  270
            Q+ ANSKPLF+TIYATV                                L  IA S    
Sbjct  7    QDAANSKPLFVTIYATV--------------------------------LVGIALSSVYV  34

Query  271  YSPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTK  450
            +S       +  I   S   +      P +Q +S   KPIW  PPPG++MP L+ FRLTK
Sbjct  35   FSAIYSGKTIYSIPWSSSSLSRVGVTGPASQPQSIWTKPIWEVPPPGTKMPPLKAFRLTK  94

Query  451  ELFXERVRDNVIIVTFGNYAFMDF  522
            EL   RV+DN+IIVTFGNYAFMDF
Sbjct  95   ELVSHRVKDNIIIVTFGNYAFMDF  118



>ref|XP_006410719.1| hypothetical protein EUTSA_v10016368mg [Eutrema salsugineum]
 gb|ESQ52172.1| hypothetical protein EUTSA_v10016368mg [Eutrema salsugineum]
Length=645

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  364  AKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            A+ KSL  IW+SPP   +MP LE+F+LTKELF ERV+DNVIIVTFGNYAFMDF
Sbjct  95   AQVKSLGKIWVSPPRDKKMPPLESFKLTKELFGERVKDNVIIVTFGNYAFMDF  147



>ref|XP_007040865.1| Xyloglucanase 113 isoform 1 [Theobroma cacao]
 gb|EOY25366.1| Xyloglucanase 113 isoform 1 [Theobroma cacao]
Length=636

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 95/146 (65%), Gaps = 14/146 (10%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  270
            +  VQE A SKPLFLTIYATV VG+V S+FYVFSA+YS SA+++ +          ++ S
Sbjct  5    RNAVQEAAGSKPLFLTIYATVIVGIVVSSFYVFSAIYSPSASTTQS----------VSTS  54

Query  271  Y--SPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRL  444
            +  SP +    ++    +S+   +  P    +Q  S +L+PIW +PP  S+MP L+ F L
Sbjct  55   WLSSPSLSQNGVSLSSGQSI--NISQPSGIASQPGSNNLRPIWEAPPRTSKMPPLKFFSL  112

Query  445  TKELFXERVRDNVIIVTFGNYAFMDF  522
            TKEL  ER +DNVIIVTFGN+AFMDF
Sbjct  113  TKELVEERAKDNVIIVTFGNFAFMDF  138



>ref|XP_011028505.1| PREDICTED: uncharacterized protein LOC105128495 isoform X2 [Populus 
euphratica]
Length=648

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 97/146 (66%), Gaps = 13/146 (9%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  270
            +   QE+ANSKPLF+ IYATV +G+VF + YV SAVYS++++SSS            +  
Sbjct  16   RNAYQEIANSKPLFVAIYATVFLGIVFYSLYVLSAVYSANSSSSS-----------TSWL  64

Query  271  YSPDVPAAV-LTQIHNESLKETVGSPQAPKTQA-KSKSLKPIWISPPPGSRMPSLETFRL  444
             SP +P ++ + Q  N S   T+ +  +P T   ++  +KPIW  PP G++ P L+TFRL
Sbjct  65   SSPPIPTSIDVDQSSNFSKPTTLAAGSSPLTSNPQTMQIKPIWEPPPHGTKFPPLKTFRL  124

Query  445  TKELFXERVRDNVIIVTFGNYAFMDF  522
            TK+L  +RV+DNVIIVTFGNYAFMDF
Sbjct  125  TKQLVQQRVKDNVIIVTFGNYAFMDF  150



>gb|KJB51493.1| hypothetical protein B456_008G219000 [Gossypium raimondii]
Length=628

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 90/144 (63%), Gaps = 18/144 (13%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  270
            +  VQE A SKPLFLTIYATV +G V S+FYVFSA+YS +A+             P    
Sbjct  5    RNAVQETAASKPLFLTIYATVILGTVVSSFYVFSAIYSPTAS-------------PTRSI  51

Query  271  YSPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTK  450
             S  + A  L+Q +  SL   +  P    +Q +S  L+PIW +P   S+MP L++FRLTK
Sbjct  52   SSSWLLAPPLSQ-NGVSLSSNISQP----SQHRSNKLRPIWEAPSRTSKMPRLKSFRLTK  106

Query  451  ELFXERVRDNVIIVTFGNYAFMDF  522
            EL  +R +DNVIIVTFGN+AFMDF
Sbjct  107  ELVAQRAKDNVIIVTFGNFAFMDF  130



>gb|KHG12902.1| hypothetical protein F383_16835 [Gossypium arboreum]
Length=611

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 90/144 (63%), Gaps = 18/144 (13%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  270
            +  VQE A SKPLFLTIYATV +G V S+FYVFSA+YS +A+             P    
Sbjct  5    RNAVQETAASKPLFLTIYATVILGTVVSSFYVFSAIYSPTAS-------------PTRSI  51

Query  271  YSPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTK  450
             S  + A  L+Q +  SL   +  P    +Q +S  L+PIW +P   S+MP L++FRLTK
Sbjct  52   SSSWLLAPPLSQ-NGVSLSSNISQP----SQHRSNKLRPIWEAPSRTSKMPRLKSFRLTK  106

Query  451  ELFXERVRDNVIIVTFGNYAFMDF  522
            EL  +R +DNVIIVTFGN+AFMDF
Sbjct  107  ELVAQRAKDNVIIVTFGNFAFMDF  130



>ref|XP_009141501.1| PREDICTED: uncharacterized protein LOC103865462 isoform X2 [Brassica 
rapa]
Length=640

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 90/150 (60%), Gaps = 27/150 (18%)
 Frame = +1

Query  103  QEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSPD  282
            +E  NSKPLF+TIYATV +GV+ S+FYVFSA+YS +                 + S+   
Sbjct  10   REATNSKPLFVTIYATVIIGVLVSSFYVFSAIYSPTNG---------------STSWLSS  54

Query  283  VPAAVLTQIHNESLKETVGSPQAP---------KTQAKSKS-LKPIWISPPPGSRMPSLE  432
             P +   +IH   L +   + Q+          + +AK KS L  IW+SPP   +MP LE
Sbjct  55   PPLSTAGRIHK--LPQDNATSQSLPVALPPPAPEEEAKGKSSLGKIWVSPPKDKKMPPLE  112

Query  433  TFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
             F+LTKELF ERV+DNVIIVTFGNYAFMDF
Sbjct  113  AFKLTKELFGERVKDNVIIVTFGNYAFMDF  142



>ref|XP_009141500.1| PREDICTED: uncharacterized protein LOC103865462 isoform X1 [Brassica 
rapa]
Length=644

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = +1

Query  355  KTQAKSKS-LKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            + +AK KS L  IW+SPP   +MP LE F+LTKELF ERV+DNVIIVTFGNYAFMDF
Sbjct  90   EEEAKGKSSLGKIWVSPPKDKKMPPLEAFKLTKELFGERVKDNVIIVTFGNYAFMDF  146



>emb|CDY40459.1| BnaA04g20580D [Brassica napus]
Length=640

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +1

Query  355  KTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            + Q KS SL  IW+SPP   +MP LE F+LTKELF ERV+DNVIIVTFGNYAFMDF
Sbjct  88   EAQGKS-SLGKIWVSPPKDKKMPPLEAFKLTKELFGERVKDNVIIVTFGNYAFMDF  142



>ref|XP_011028504.1| PREDICTED: uncharacterized protein LOC105128495 isoform X1 [Populus 
euphratica]
Length=652

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 97/150 (65%), Gaps = 17/150 (11%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  270
            +   QE+ANSKPLF+ IYATV +G+VF + YV SAVYS++++SSS            +  
Sbjct  16   RNAYQEIANSKPLFVAIYATVFLGIVFYSLYVLSAVYSANSSSSS-----------TSWL  64

Query  271  YSPDVPAAV-----LTQIHNESLKETVGSPQAPKTQA-KSKSLKPIWISPPPGSRMPSLE  432
             SP +P ++     + Q  N S   T+ +  +P T   ++  +KPIW  PP G++ P L+
Sbjct  65   SSPPIPTSIDNTRHVDQSSNFSKPTTLAAGSSPLTSNPQTMQIKPIWEPPPHGTKFPPLK  124

Query  433  TFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            TFRLTK+L  +RV+DNVIIVTFGNYAFMDF
Sbjct  125  TFRLTKQLVQQRVKDNVIIVTFGNYAFMDF  154



>ref|XP_004300682.1| PREDICTED: uncharacterized protein LOC101298609 [Fragaria vesca 
subsp. vesca]
Length=629

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 86/136 (63%), Gaps = 13/136 (10%)
 Frame = +1

Query  115  NSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSPDVPAA  294
            NSKPLF+ +YATV VG++FS+ YV SA+YS  AA+ S            A S+  +V ++
Sbjct  9    NSKPLFVAVYATVIVGIIFSSLYVISAIYSGKAATFS------------ATSFQNNVGSS  56

Query  295  VLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVR  474
               Q  N S    V    +P  ++++ S KPIW   P   +MP LETFRLTKEL  +RV+
Sbjct  57   PSEQALNVSQSAVVQGVPSPNLESRNVSTKPIW-EAPNTKKMPELETFRLTKELVQQRVK  115

Query  475  DNVIIVTFGNYAFMDF  522
            DNV+IVTFGNYAFMDF
Sbjct  116  DNVVIVTFGNYAFMDF  131



>ref|XP_006430896.1| hypothetical protein CICLE_v10011269mg [Citrus clementina]
 gb|ESR44136.1| hypothetical protein CICLE_v10011269mg [Citrus clementina]
Length=639

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 99/153 (65%), Gaps = 25/153 (16%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasss---------apiass  243
            +   QE+ NSKPLFLTIY TV VG+VFS+FYVFSAVYS S+AS++             ++
Sbjct  5    RNWYQELVNSKPLFLTIYTTVIVGIVFSSFYVFSAVYSPSSASANWFSSPPSISHSPVAA  64

Query  244  fsLFPIAPSYSPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMP  423
             S   +AP++SP +  + + +               P+ Q++SK +KPIW   P   R+P
Sbjct  65   SSYINVAPNFSPTLKVSAIPR---------------PRPQSRSKQVKPIW-EVPQTKRLP  108

Query  424  SLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            SL++F+LTKEL  +RV+DN+II+TFGNYAFMDF
Sbjct  109  SLKSFQLTKELVEQRVQDNIIIMTFGNYAFMDF  141



>ref|XP_006385158.1| hypothetical protein POPTR_0004s24390g [Populus trichocarpa]
 gb|ERP62955.1| hypothetical protein POPTR_0004s24390g [Populus trichocarpa]
Length=638

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 95/144 (66%), Gaps = 19/144 (13%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  270
            +   QE+ANSKPLF+ IYATV +G+VFS+ YV SAVYS++++SSS            +  
Sbjct  16   RNAYQEIANSKPLFVAIYATVFLGIVFSSLYVLSAVYSANSSSSS-----------TSWL  64

Query  271  YSPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTK  450
             SP +P ++      ++ +    SP  P +  ++  +KPIW  PP G++ P L+TFRLTK
Sbjct  65   SSPPIPTSI------DNTRPAGSSP--PTSNPQTMQIKPIWEPPPHGTKFPPLKTFRLTK  116

Query  451  ELFXERVRDNVIIVTFGNYAFMDF  522
            +L  +RV+DNVIIVTFGNYAFMDF
Sbjct  117  QLVQQRVKDNVIIVTFGNYAFMDF  140



>ref|XP_003547737.1| PREDICTED: uncharacterized protein LOC100780346 [Glycine max]
Length=638

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 78/155 (50%), Gaps = 39/155 (25%)
 Frame = +1

Query  103  QEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSPD  282
            +E+ANSKPLFLTIY  V +G+V S+                         +  +  YS +
Sbjct  8    EEVANSKPLFLTIYTVVIIGIVVSS------------------------FYVFSAIYSAN  43

Query  283  VPAA---------------VLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSR  417
             P+A               V  Q  N S    V +   P  + +++S + IW  PPP  +
Sbjct  44   PPSAQSSAWLSSISSDATHVTDQTLNVSQSAAVHTVPPPSPRPRNESPRSIWDDPPPNKK  103

Query  418  MPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            MP L+ FRLTKEL  +RV+DN IIVTFGNYAFMDF
Sbjct  104  MPPLKDFRLTKELVRQRVKDNAIIVTFGNYAFMDF  138



>gb|KHN27499.1| hypothetical protein glysoja_018611 [Glycine soja]
Length=648

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 80/159 (50%), Gaps = 39/159 (25%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  270
            ++  +E+ANSKPLFLTIY  V +G+V S+                         +  +  
Sbjct  4    RKGFEEVANSKPLFLTIYTVVIIGIVVSS------------------------FYVFSAI  39

Query  271  YSPDVPAA---------------VLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPP  405
            YS + P+A               V  Q  N S    V +   P  + +++S + IW  PP
Sbjct  40   YSANPPSAQSSAWLSSISSDATHVTDQTLNVSQSAAVHTVPPPSPRPRNESPRSIWDDPP  99

Query  406  PGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            P  +MP L+ FRLTKEL  +RV+DN IIVTFGNYAFMDF
Sbjct  100  PNKKMPPLKDFRLTKELVRQRVKDNAIIVTFGNYAFMDF  138



>ref|XP_008365916.1| PREDICTED: uncharacterized protein LOC103429549 isoform X1 [Malus 
domestica]
 ref|XP_008365917.1| PREDICTED: uncharacterized protein LOC103429549 isoform X2 [Malus 
domestica]
Length=630

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = +1

Query  298  LTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRD  477
            L Q  N S  E V +   P    +S S +PIW +PP   +MP L+ FRL+KEL  +RV+D
Sbjct  58   LEQAPNVSQPEIVQAIATPSLGPQSMSTRPIWEAPPRTKKMPPLKKFRLSKELVQQRVKD  117

Query  478  NVIIVTFGNYAFMDF  522
            NV+IVTFGNYAFMDF
Sbjct  118  NVVIVTFGNYAFMDF  132



>gb|KDO72261.1| hypothetical protein CISIN_1g036925mg [Citrus sinensis]
Length=639

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 98/153 (64%), Gaps = 25/153 (16%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasss---------apiass  243
            +   QE+ NSKPLFLTIY TV VG+VFS+FYVFSAVYS S+AS++             ++
Sbjct  5    RNWYQELVNSKPLFLTIYTTVIVGIVFSSFYVFSAVYSPSSASANWFSSPPSISHSPVAA  64

Query  244  fsLFPIAPSYSPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMP  423
             S   +AP++SP             +LK +   P  P  Q+ SK +KPIW   P   R+P
Sbjct  65   SSYINVAPNFSP-------------TLKVSAIPPPLP--QSSSKQVKPIW-EVPQTKRLP  108

Query  424  SLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            SL++F+LTKEL  +RV+DN+II+TFGNYAFMDF
Sbjct  109  SLKSFQLTKELVEQRVQDNIIIMTFGNYAFMDF  141



>ref|XP_006482352.1| PREDICTED: uncharacterized protein LOC102613765 [Citrus sinensis]
Length=639

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 98/153 (64%), Gaps = 25/153 (16%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasss---------apiass  243
            +   QE+ NSKPLFLTIY TV VG+VFS+FYVFSAVYS S+AS++             ++
Sbjct  5    RNWYQELVNSKPLFLTIYTTVIVGIVFSSFYVFSAVYSPSSASANWFSSPPSISHSPVAA  64

Query  244  fsLFPIAPSYSPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMP  423
             S   +AP++SP             +LK +   P  P  Q+ SK +KPIW   P   R+P
Sbjct  65   SSYINVAPNFSP-------------TLKVSAIPPPLP--QSSSKQVKPIW-EVPQTKRLP  108

Query  424  SLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            SL++F+LTKEL  +RV+DN+II+TFGNYAFMDF
Sbjct  109  SLKSFQLTKELVEQRVQDNIIIMTFGNYAFMDF  141



>emb|CDP12729.1| unnamed protein product [Coffea canephora]
Length=615

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  343  PQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            P AP ++ ++K + PIW  PP GS+MP L+ F+L+K+L  +RV+DN+II+TFGNY FMDF
Sbjct  56   PLAPISRLQNKLVNPIWQVPPAGSKMPPLKAFKLSKKLVQQRVKDNIIIITFGNYGFMDF  115



>gb|KHG12903.1| hypothetical protein F383_16835 [Gossypium arboreum]
Length=619

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  358  TQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            +Q +S  L+PIW +P   S+MP L++FRLTKEL  +R +DNVIIVTFGN+AFMDF
Sbjct  67   SQHRSNKLRPIWEAPSRTSKMPRLKSFRLTKELVAQRAKDNVIIVTFGNFAFMDF  121



>ref|XP_010676705.1| PREDICTED: uncharacterized protein LOC104892459 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=531

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 78/149 (52%), Gaps = 32/149 (21%)
 Frame = +1

Query  100  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  279
             QE A SKPLF+TIYATV +G+ FS+                        ++  +  YS 
Sbjct  7    CQEAAKSKPLFVTIYATVIIGIFFSS------------------------VYVFSAIYSS  42

Query  280  DVPAAVLTQIHNESLKETVGSPQAPKTQ------AKSKS--LKPIWISPPPGSRMPSLET  435
              P A ++     S  + +   Q           AKS+S  LKPIW  P    +MP L++
Sbjct  43   KPPDAEISLSFPHSGGDPLHEAQNSSLSTTSLSPAKSRSTLLKPIWEPPSKTKKMPPLKS  102

Query  436  FRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            FRLTKEL  +RV+DN+IIVTFGNYAFMDF
Sbjct  103  FRLTKELVEKRVKDNIIIVTFGNYAFMDF  131



>ref|XP_010676706.1| PREDICTED: uncharacterized protein LOC104892459 isoform X4 [Beta 
vulgaris subsp. vulgaris]
Length=507

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 78/149 (52%), Gaps = 32/149 (21%)
 Frame = +1

Query  100  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  279
             QE A SKPLF+TIYATV +G+ FS+                        ++  +  YS 
Sbjct  7    CQEAAKSKPLFVTIYATVIIGIFFSS------------------------VYVFSAIYSS  42

Query  280  DVPAAVLTQIHNESLKETVGSPQAPKTQ------AKSKS--LKPIWISPPPGSRMPSLET  435
              P A ++     S  + +   Q           AKS+S  LKPIW  P    +MP L++
Sbjct  43   KPPDAEISLSFPHSGGDPLHEAQNSSLSTTSLSPAKSRSTLLKPIWEPPSKTKKMPPLKS  102

Query  436  FRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            FRLTKEL  +RV+DN+IIVTFGNYAFMDF
Sbjct  103  FRLTKELVEKRVKDNIIIVTFGNYAFMDF  131



>ref|XP_007210882.1| hypothetical protein PRUPE_ppa002815mg [Prunus persica]
 gb|EMJ12081.1| hypothetical protein PRUPE_ppa002815mg [Prunus persica]
Length=630

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 85/136 (63%), Gaps = 12/136 (9%)
 Frame = +1

Query  115  NSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSPDVPAA  294
            N+KP+F+TIYATV +G++FS+ YV SA+YS  +A+ S              S+   V + 
Sbjct  9    NAKPVFVTIYATVIIGIIFSSLYVISAIYSGKSAADSTT------------SWLSHVGSP  56

Query  295  VLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVR  474
             + Q  N S    V +   P  + +S S +PIW +P    +MP+L+ FRL+KEL  ERV+
Sbjct  57   PVEQAPNVSEPAIVQAVPTPSLEPRSMSTRPIWEAPLHTKKMPALKKFRLSKELVQERVK  116

Query  475  DNVIIVTFGNYAFMDF  522
            DNVIIVTFGNYAFMDF
Sbjct  117  DNVIIVTFGNYAFMDF  132



>ref|XP_003548765.1| PREDICTED: uncharacterized protein LOC100819032 [Glycine max]
Length=639

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 82/159 (52%), Gaps = 39/159 (25%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  270
            ++  +E+ANSKPLFLTIY  V +G+V S+                         F  +  
Sbjct  4    RKGCEEVANSKPLFLTIYTVVIIGIVVSS------------------------FFVFSAI  39

Query  271  YSPDVPAAVL-----------TQIHNESLKETVGSPQ----APKTQAKSKSLKPIWISPP  405
            YS + P+A             T++ +++LK +  +       P   ++++    IW  PP
Sbjct  40   YSTNPPSAQSSAWLSSISSDETRVTDQTLKVSRSAAVLIVPTPSPGSQNEWPTSIWDDPP  99

Query  406  PGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            P  +MP LE FRLTK+L  +RV+DN +IVTFGNYAFMDF
Sbjct  100  PNKKMPPLEDFRLTKKLVQQRVKDNAVIVTFGNYAFMDF  138



>gb|KHN03113.1| hypothetical protein glysoja_049543 [Glycine soja]
Length=610

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 82/159 (52%), Gaps = 39/159 (25%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  270
            ++  +E+ANSKPLFLTIY  V +G+V S+                         F  +  
Sbjct  4    RKGCEEVANSKPLFLTIYTVVIIGIVVSS------------------------FFVFSAI  39

Query  271  YSPDVPAAVL-----------TQIHNESLKETVGSPQ----APKTQAKSKSLKPIWISPP  405
            YS + P+A             T++ +++LK +  +       P   ++++    IW  PP
Sbjct  40   YSTNPPSAQSSAWLSSISSDETRVTDQTLKVSRSAAVLIVPTPSPGSQNEWPTSIWDDPP  99

Query  406  PGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            P  +MP LE FRLTK+L  +RV+DN +IVTFGNYAFMDF
Sbjct  100  PNKKMPPLEDFRLTKKLVQQRVKDNAVIVTFGNYAFMDF  138



>ref|XP_010676703.1| PREDICTED: uncharacterized protein LOC104892459 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=629

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 78/149 (52%), Gaps = 32/149 (21%)
 Frame = +1

Query  100  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  279
             QE A SKPLF+TIYATV +G+ FS+                        ++  +  YS 
Sbjct  7    CQEAAKSKPLFVTIYATVIIGIFFSS------------------------VYVFSAIYSS  42

Query  280  DVPAAVLTQIHNESLKETVGSPQAPKTQ------AKSKS--LKPIWISPPPGSRMPSLET  435
              P A ++     S  + +   Q           AKS+S  LKPIW  P    +MP L++
Sbjct  43   KPPDAEISLSFPHSGGDPLHEAQNSSLSTTSLSPAKSRSTLLKPIWEPPSKTKKMPPLKS  102

Query  436  FRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            FRLTKEL  +RV+DN+IIVTFGNYAFMDF
Sbjct  103  FRLTKELVEKRVKDNIIIVTFGNYAFMDF  131



>gb|KHN41773.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine 
soja]
Length=1470

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 58/152 (38%), Positives = 80/152 (53%), Gaps = 38/152 (25%)
 Frame = +1

Query  103  QEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSPD  282
            +E+A+S+PLFLTIY  V VGVVFS+                        L+  +    P 
Sbjct  4    EEVAHSRPLFLTIYTIVFVGVVFSS------------------------LYVFSAIRYPS  39

Query  283  VPAAVLTQIHNESLKETVGS------------PQAPKTQAKSKSLKPIWISPPPGSRMPS  426
              A+  + + NE ++ T  +            P  P  +A++   +PI   PP   +MPS
Sbjct  40   TNASTWS-LSNEDVRLTEQTLNVSQSGNAHVVPSVPP-EARNVKTRPILNIPPRNKKMPS  97

Query  427  LETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            L TFRLT+EL  +RV+DN+IIVTFGNYAFMDF
Sbjct  98   LNTFRLTEELVQQRVKDNIIIVTFGNYAFMDF  129



>ref|XP_007156343.1| hypothetical protein PHAVU_003G278500g, partial [Phaseolus vulgaris]
 gb|ESW28337.1| hypothetical protein PHAVU_003G278500g, partial [Phaseolus vulgaris]
Length=446

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 87/144 (60%), Gaps = 10/144 (7%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  270
            ++  +E+ANSKPLFLTIY  V +G+V S+FYVFSA+YSS+ +++ +             S
Sbjct  4    RKGCEEVANSKPLFLTIYTVVVIGIVVSSFYVFSAIYSSNPSAAQSSAWL---------S  54

Query  271  YSPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTK  450
              P     V  Q  N S       P+ P + A+++  + IW  PP   RMP L  FRLTK
Sbjct  55   SLPSENTRVTDQTLNVSRSAVHFVPR-PSSGAQNEWSRTIWDIPPTNKRMPPLSDFRLTK  113

Query  451  ELFXERVRDNVIIVTFGNYAFMDF  522
             L  +RV+DNV+IVTFGNYAFMDF
Sbjct  114  ALVQQRVKDNVVIVTFGNYAFMDF  137



>ref|XP_009362859.1| PREDICTED: uncharacterized protein LOC103952897 [Pyrus x bretschneideri]
Length=632

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = +1

Query  298  LTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRD  477
            L Q  N S  E V +   P     S S +PIW +P    +MP L+ FRL+KEL  +RV+D
Sbjct  60   LEQAPNVSQPEIVQAISTPSLGPHSMSTRPIWEAPTRTKKMPPLKKFRLSKELVQQRVKD  119

Query  478  NVIIVTFGNYAFMDF  522
            NV+IVTFGNYAFMDF
Sbjct  120  NVVIVTFGNYAFMDF  134



>gb|KHN05539.1| hypothetical protein glysoja_020504 [Glycine soja]
Length=637

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 85/143 (59%), Gaps = 18/143 (13%)
 Frame = +1

Query  100  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  279
             +E+A+S+PLFLTIY  V VG+VFS+ YVFSA+   SA               I  ++S 
Sbjct  3    CEEVAHSRPLFLTIYTIVIVGIVFSSLYVFSAIRHPSA---------------IPSTWSL  47

Query  280  DVPAAVLT-QIHNESLKETVG-SPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKE  453
                  LT Q  N S  ETV   P  P+ +A+    +PI   PP   +MPSL  FRLTKE
Sbjct  48   SNEDVRLTEQTLNGSQSETVHIVPSVPQ-EARKMRTRPILSVPPRNKKMPSLNAFRLTKE  106

Query  454  LFXERVRDNVIIVTFGNYAFMDF  522
            L  +RV+DN+II+TFGNYAFMDF
Sbjct  107  LVQQRVKDNIIILTFGNYAFMDF  129



>ref|XP_006590766.1| PREDICTED: uncharacterized protein LOC100789338 [Glycine max]
Length=627

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 85/143 (59%), Gaps = 18/143 (13%)
 Frame = +1

Query  100  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  279
             +E+A+S+PLFLTIY  V VG+VFS+ YVFSA+   SA               I  ++S 
Sbjct  3    CEEVAHSRPLFLTIYTIVIVGIVFSSLYVFSAIRHPSA---------------IPSTWSL  47

Query  280  DVPAAVLT-QIHNESLKETVG-SPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKE  453
                  LT Q  N S  ETV   P  P+ +A+    +PI   PP   +MPSL  FRLTKE
Sbjct  48   SNEDVRLTEQTLNGSQSETVHIVPSVPQ-EARKMRTRPILSVPPRNKKMPSLNAFRLTKE  106

Query  454  LFXERVRDNVIIVTFGNYAFMDF  522
            L  +RV+DN+II+TFGNYAFMDF
Sbjct  107  LVQQRVKDNIIILTFGNYAFMDF  129



>ref|XP_002519934.1| reticulon3-A3, putative [Ricinus communis]
 gb|EEF42538.1| reticulon3-A3, putative [Ricinus communis]
Length=639

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 46/66 (70%), Gaps = 2/66 (3%)
 Frame = +1

Query  331  TVGSPQAPKTQAKSKSL--KPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGN  504
            TV SP     Q K  S+   PIW  PPP S+M  ++ FRLTK+L  +RV+DNVIIVTFGN
Sbjct  77   TVSSPTTKSQQDKKSSILETPIWEIPPPNSKMLPIKKFRLTKQLVEKRVKDNVIIVTFGN  136

Query  505  YAFMDF  522
            +AFMDF
Sbjct  137  FAFMDF  142



>ref|XP_004509491.1| PREDICTED: uncharacterized protein LOC101505601 [Cicer arietinum]
Length=638

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 82/160 (51%), Gaps = 40/160 (25%)
 Frame = +1

Query  91   KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  270
            +   +E+  SKPLFLTIY  V +G+V S+                         +     
Sbjct  5    RNGCEEVVQSKPLFLTIYTIVIIGIVVSS------------------------FYVFLAI  40

Query  271  YSPDVPAA-----VLTQIHNES---LKETVGSPQAPKTQAKS------KSLKP--IWISP  402
            YS + PAA     + + I NE+   +  T+   Q+ K Q  S      +++ P  +W  P
Sbjct  41   YSSNTPAAHSSAWLSSSISNENSRVIDHTLNISQSEKAQTVSTPSPEKQNVWPSFVWEVP  100

Query  403  PPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            P   +MP L+TFRLTKEL  +RV+DNV+IVTFGNYAFMDF
Sbjct  101  PSNKKMPPLKTFRLTKELVQQRVKDNVVIVTFGNYAFMDF  140



>emb|CDP12730.1| unnamed protein product [Coffea canephora]
Length=622

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = +1

Query  298  LTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRD  477
            L +  N S   T     A K +  +K +KP+W  P  GS+MP L+TFRL+K+L  +RV+D
Sbjct  58   LNKALNSSHMTTENVMLATKPRLHNKLVKPVWEIPSTGSKMPPLKTFRLSKKLVQQRVKD  117

Query  478  NVIIVTFGNYAFMDF  522
            N++IVT+ NYAFMDF
Sbjct  118  NIVIVTYANYAFMDF  132



>emb|CAN79199.1| hypothetical protein VITISV_040773 [Vitis vinifera]
Length=715

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  382  KPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            +PIW +PP G + PSL+ F+LTK L  +RV+DNVIIVTFGNYAFMDF
Sbjct  127  RPIWEAPPRGEKRPSLKAFQLTKTLVEQRVKDNVIIVTFGNYAFMDF  173



>emb|CDP12731.1| unnamed protein product [Coffea canephora]
Length=646

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +1

Query  331  TVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYA  510
            T  S  AP ++ ++K  K IW  PP GS+MP L+ F+L+K+L  +RV+DN+IIVT+ NYA
Sbjct  83   TGNSSLAPISRLQNKLAKHIWEVPPAGSKMPPLKAFKLSKKLVQQRVKDNIIIVTYANYA  142

Query  511  FMDF  522
            FMDF
Sbjct  143  FMDF  146



>emb|CBI29197.3| unnamed protein product [Vitis vinifera]
Length=642

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 90/143 (63%), Gaps = 7/143 (5%)
 Frame = +1

Query  103  QEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSPD  282
             + ANSKPLFLTIYATV VG+VFS+FYVFSA+YS+ +++     A     F      S  
Sbjct  7    HDAANSKPLFLTIYATVIVGIVFSSFYVFSAIYSADSSTWKVSFALLNVSFLTGIVQS--  64

Query  283  VPAAVLTQIHNESLKETVGSPQAPKTQA---KSKSLKPIWISPPPGSRMPSLETFRLTKE  453
                 + Q  N S +   G+  AP  ++   ++   +PIW +PP G + PSL+ F+LTK 
Sbjct  65   --VTDVDQGPNVSQRTDWGAVPAPPPKSPKSQNMWTRPIWEAPPRGEKRPSLKAFQLTKT  122

Query  454  LFXERVRDNVIIVTFGNYAFMDF  522
            L  +RV+DNVIIVTFGNYAFMDF
Sbjct  123  LVEQRVKDNVIIVTFGNYAFMDF  145



>ref|XP_006878624.1| hypothetical protein AMTR_s00011p00260650 [Amborella trichopoda]
 gb|ERM94769.1| hypothetical protein AMTR_s00011p00260650 [Amborella trichopoda]
Length=638

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 76/159 (48%), Gaps = 43/159 (27%)
 Frame = +1

Query  103  QEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYS--  276
            QE+AN KPLF+ I ATV   ++ +                         +F   P YS  
Sbjct  7    QELANMKPLFIGIQATVLAAILLTT------------------------VFIGRPIYSGI  42

Query  277  ----PDVPAAVLTQI-HNESLKETVG-------SPQAPKTQAKSKSL-----KPIWISPP  405
                P    A +T + H  ++ +T G       S +  +T   S        K IW SPP
Sbjct  43   WSGTPSSTDAGVTHVEHVSNISQTGGNETIDNFSDRGTETIPSSSKFQNIWEKAIWESPP  102

Query  406  PGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
             GS+MP L  F+LTK++  +R +DNVIIVTFGN+AFMDF
Sbjct  103  AGSKMPDLNEFQLTKQMVADRAKDNVIIVTFGNHAFMDF  141



>ref|XP_003517099.1| PREDICTED: uncharacterized protein LOC100776463 [Glycine max]
Length=627

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 81/152 (53%), Gaps = 36/152 (24%)
 Frame = +1

Query  100  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  279
             +E+A+S+PLFLTIY  V VGVVFS+                        L+  +    P
Sbjct  3    CEEVAHSRPLFLTIYTIVFVGVVFSS------------------------LYVFSAIRYP  38

Query  280  DVPAAVLTQIHNESLK---ETVGSPQAPKT--------QAKSKSLKPIWISPPPGSRMPS  426
               A+  + + NE ++   +T+   Q+           +A++   +PI   PP   +MPS
Sbjct  39   STNASTWS-LSNEDVRLTEQTLNVSQSGNAHVVPSVPPEARNVKTRPILNIPPRNKKMPS  97

Query  427  LETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            L TFRLT+EL  +RV+DN+IIVTFGNYAFMDF
Sbjct  98   LNTFRLTEELVQQRVKDNIIIVTFGNYAFMDF  129



>ref|XP_002269181.2| PREDICTED: uncharacterized protein LOC100263017 [Vitis vinifera]
Length=631

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  382  KPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            +PIW +PP G + PSL+ F+LTK L  +RV+DNVIIVTFGNYAFMDF
Sbjct  88   RPIWEAPPRGEKRPSLKAFQLTKTLVEQRVKDNVIIVTFGNYAFMDF  134



>ref|XP_008782814.1| PREDICTED: uncharacterized protein LOC103702257 isoform X2 [Phoenix 
dactylifera]
Length=286

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 73/159 (46%), Gaps = 49/159 (31%)
 Frame = +1

Query  118  SKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSPDVPAAV  297
             KPLFL IYATV  G+VFS                         LF ++  YSP   A  
Sbjct  10   GKPLFLVIYATVVAGIVFST------------------------LFILSTVYSPATDANP  45

Query  298  LTQIH------------------NESLKETVGSPQA------PKTQAKSKSLKPIWISPP  405
            L+ +H                     L E+  S  A      P  + ++   + IW   P
Sbjct  46   LSFLHFSSSAAPPRLPDRDFTRKGNGLSESEASRNATANIPPPTAKPRNMFTRGIW-DAP  104

Query  406  PGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
             G++MP L++FRLTKE+   R RDNVIIVTFGNYA+MDF
Sbjct  105  VGTKMPDLKSFRLTKEMVEHRARDNVIIVTFGNYAYMDF  143



>gb|AES95448.2| nucleotide-diphospho-sugar transferase family protein [Medicago 
truncatula]
Length=688

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 79/141 (56%), Gaps = 13/141 (9%)
 Frame = +1

Query  100  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  279
             +E+A+S+P+FLTIY  V V      F       ++S+A SS         FP   +  P
Sbjct  3    CEEVAHSRPVFLTIYTVVIVVSSLYVFSAIHYSSTTSSAWSS---------FPPLSNEDP  53

Query  280  DVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELF  459
                 +L +  + S  ET+ +  +   + ++ S KPI   PP   +MP L+ FRLTKEL 
Sbjct  54   ----RLLDRTFDASQLETMHAVPSAFPELQNVSRKPILNVPPRNKKMPPLKEFRLTKELV  109

Query  460  XERVRDNVIIVTFGNYAFMDF  522
             +RV+DN+IIVTFGNYAFMDF
Sbjct  110  QQRVKDNIIIVTFGNYAFMDF  130



>ref|XP_010111777.1| hypothetical protein L484_008781 [Morus notabilis]
 gb|EXC31691.1| hypothetical protein L484_008781 [Morus notabilis]
Length=635

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +1

Query  376  SLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
             ++PIW +P    +MP L++FRLTKEL  +RV+DNV+IVTFGNYAFMDF
Sbjct  91   GVRPIWEAPSRTKKMPPLKSFRLTKELVQQRVKDNVVIVTFGNYAFMDF  139



>ref|XP_003612490.1| hypothetical protein MTR_5g025590 [Medicago truncatula]
Length=628

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 79/141 (56%), Gaps = 13/141 (9%)
 Frame = +1

Query  100  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  279
             +E+A+S+P+FLTIY  V V      F       ++S+A SS         FP   +  P
Sbjct  3    CEEVAHSRPVFLTIYTVVIVVSSLYVFSAIHYSSTTSSAWSS---------FPPLSNEDP  53

Query  280  DVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELF  459
                 +L +  + S  ET+ +  +   + ++ S KPI   PP   +MP L+ FRLTKEL 
Sbjct  54   ----RLLDRTFDASQLETMHAVPSAFPELQNVSRKPILNVPPRNKKMPPLKEFRLTKELV  109

Query  460  XERVRDNVIIVTFGNYAFMDF  522
             +RV+DN+IIVTFGNYAFMDF
Sbjct  110  QQRVKDNIIIVTFGNYAFMDF  130



>ref|XP_008782812.1| PREDICTED: uncharacterized protein LOC103702257 isoform X1 [Phoenix 
dactylifera]
Length=291

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = +1

Query  352  PKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            P  + ++   + IW   P G++MP L++FRLTKE+   R RDNVIIVTFGNYA+MDF
Sbjct  93   PTAKPRNMFTRGIW-DAPVGTKMPDLKSFRLTKEMVEHRARDNVIIVTFGNYAYMDF  148



>ref|XP_004982506.1| PREDICTED: uncharacterized protein LOC101753789 [Setaria italica]
Length=619

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 41/61 (67%), Gaps = 4/61 (7%)
 Frame = +1

Query  340  SPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMD  519
            +P  P+T       +PIW  PP GSRMPS   FRLT+++   R RD VI+VTFGNYAF+D
Sbjct  64   APAQPETMYN----RPIWKPPPRGSRMPSPRAFRLTRDMVAARARDGVIVVTFGNYAFLD  119

Query  520  F  522
            F
Sbjct  120  F  120



>gb|AET03500.2| nucleotide-diphospho-sugar transferase family protein [Medicago 
truncatula]
Length=637

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  388  IWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            +W  PP   +MP L+ FRLTKEL  +RV+DNV+IVTFGNYAFMDF
Sbjct  95   VWEIPPSNKKMPPLKNFRLTKELVQQRVKDNVVIVTFGNYAFMDF  139



>ref|XP_003629024.1| hypothetical protein MTR_8g072310 [Medicago truncatula]
Length=655

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  388  IWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            +W  PP   +MP L+ FRLTKEL  +RV+DNV+IVTFGNYAFMDF
Sbjct  95   VWEIPPSNKKMPPLKNFRLTKELVQQRVKDNVVIVTFGNYAFMDF  139



>gb|EMS55953.1| hypothetical protein TRIUR3_26709 [Triticum urartu]
Length=609

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +1

Query  382  KPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            +PIW  P  GSRMPS   FRLT+++   R RD VI+VTFGNYAFMDF
Sbjct  71   RPIWKPPARGSRMPSPRAFRLTRDMVRARARDGVIVVTFGNYAFMDF  117



>gb|EPS61907.1| hypothetical protein M569_12886, partial [Genlisea aurea]
Length=244

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +1

Query  325  KETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGN  504
            + + G      T    K    IW  PP GS MP  E F+LTKEL  +RV++N+I+VTFGN
Sbjct  57   RSSAGMVSRDSTSLTQKRHGIIWEVPPLGSEMPPREAFKLTKELVQKRVKNNIIVVTFGN  116

Query  505  YAFMDF  522
             AFMDF
Sbjct  117  LAFMDF  122



>ref|XP_007158076.1| hypothetical protein PHAVU_002G122000g [Phaseolus vulgaris]
 gb|ESW30070.1| hypothetical protein PHAVU_002G122000g [Phaseolus vulgaris]
Length=626

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +1

Query  304  QIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNV  483
            Q  N S   TV  P  P  +A+    +PI   PP    MP LE F LTKEL  +RV+DNV
Sbjct  57   QTLNGSRFATVDVPSVPP-EARDVRTRPILDVPPRNKEMPPLEAFGLTKELIQKRVKDNV  115

Query  484  IIVTFGNYAFMDF  522
            IIVTF NYAFMDF
Sbjct  116  IIVTFANYAFMDF  128



>gb|AAD15452.2| unknown protein [Arabidopsis thaliana]
Length=528

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  418  MPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            MP LETF+LTKELF ERV+DNVIIVTFGNYAFMDF
Sbjct  1    MPPLETFKLTKELFGERVKDNVIIVTFGNYAFMDF  35



>ref|NP_001143144.1| hypothetical protein [Zea mays]
 gb|ACG29327.1| hypothetical protein [Zea mays]
 gb|ACN27867.1| unknown [Zea mays]
 gb|ACR35913.1| unknown [Zea mays]
 tpg|DAA50140.1| TPA: hypothetical protein ZEAMMB73_624371 [Zea mays]
Length=615

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +1

Query  358  TQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
             QA++   +PIW  PP  +RMPS   FRLT+++   R RD VI+VTFGNYAF+DF
Sbjct  63   AQAETMYNRPIWKPPPRRARMPSPRAFRLTRDMVAARARDGVIVVTFGNYAFLDF  117



>ref|XP_003562333.1| PREDICTED: uncharacterized protein LOC100845970 [Brachypodium 
distachyon]
Length=614

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 40/64 (63%), Gaps = 4/64 (6%)
 Frame = +1

Query  331  TVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYA  510
             V  P  P+T       +PIW  PP GSRMP    FRLT+++   R RD VI+VTFGNYA
Sbjct  56   NVSGPAQPETIYN----RPIWKPPPRGSRMPPPRAFRLTRDMVRARARDGVIVVTFGNYA  111

Query  511  FMDF  522
            F+DF
Sbjct  112  FLDF  115



>ref|XP_010235552.1| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
 ref|XP_010235553.1| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
 ref|XP_010235554.1| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
 ref|XP_010235555.1| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
 ref|XP_003572620.2| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
Length=642

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (66%), Gaps = 4/61 (7%)
 Frame = +1

Query  340  SPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMD  519
            +P  P+T       +PIW  PP GSRMP    FRLT+++   R RD VI+VTFGNYAF+D
Sbjct  87   APAQPETMYN----RPIWKPPPRGSRMPPPRAFRLTRDMVRARARDGVIVVTFGNYAFLD  142

Query  520  F  522
            F
Sbjct  143  F  143



>ref|XP_004512439.1| PREDICTED: uncharacterized protein LOC101497257 [Cicer arietinum]
Length=623

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  382  KPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            KP++   P   +MP L+ FRLTKEL  +RV+DN+IIVTFGNYAFMDF
Sbjct  79   KPVFDVSPRNKKMPPLKDFRLTKELVQQRVKDNIIIVTFGNYAFMDF  125



>ref|XP_002464281.1| hypothetical protein SORBIDRAFT_01g015590 [Sorghum bicolor]
 gb|EER91279.1| hypothetical protein SORBIDRAFT_01g015590 [Sorghum bicolor]
Length=615

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 4/61 (7%)
 Frame = +1

Query  340  SPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMD  519
            +P  P+T       +PIW  PP  +RMPS   FRLT+++   R RD VI+VTFGNYAF+D
Sbjct  61   TPAQPETMYN----RPIWKPPPRRARMPSPRAFRLTRDMVAARARDGVIVVTFGNYAFLD  116

Query  520  F  522
            F
Sbjct  117  F  117



>ref|XP_008444233.1| PREDICTED: uncharacterized protein LOC103487624 [Cucumis melo]
Length=640

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 78/141 (55%), Gaps = 5/141 (4%)
 Frame = +1

Query  100  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  279
             Q+  N++PLFL IYATV  G+VFS+ YVFSAVYSSS   S +    S        S S 
Sbjct  7    CQDGVNTRPLFLVIYATVIAGIVFSSLYVFSAVYSSSNPLSDSSSWFSSPSSEFTNSDS-  65

Query  280  DVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELF  459
                 +  Q  + S   T  +P    T   +K  KPIW   P    MP  ETF L+KEL 
Sbjct  66   ---TLIKDQRSDVSEPSTGPTPDFSSTIVHNKGEKPIW-EAPNTKDMPPPETFHLSKELV  121

Query  460  XERVRDNVIIVTFGNYAFMDF  522
              R +DN+IIVTFGNYAFMDF
Sbjct  122  QRRAKDNIIIVTFGNYAFMDF  142



>ref|XP_010540709.1| PREDICTED: uncharacterized protein LOC104814389 [Tarenaya hassleriana]
Length=598

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  397  SPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            +PP   +MP LETFRLTKEL   R +DN++IVTFGN+AFMDF
Sbjct  75   APPHDKKMPPLETFRLTKELVGGRAKDNIVIVTFGNFAFMDF  116



>ref|XP_004142646.1| PREDICTED: uncharacterized protein LOC101203732 [Cucumis sativus]
 gb|KGN54526.1| hypothetical protein Csa_4G358640 [Cucumis sativus]
Length=640

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +1

Query  340  SPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMD  519
            +P    T  ++K  +PIW   P    MP  E F L+KEL  +R +DN+IIVTFGNYAFMD
Sbjct  83   TPDFSNTVVQNKGERPIW-EAPNTKNMPPPEAFNLSKELVQKRAKDNIIIVTFGNYAFMD  141

Query  520  F  522
            F
Sbjct  142  F  142



>ref|XP_010907098.1| PREDICTED: uncharacterized protein LOC105033849 isoform X2 [Elaeis 
guineensis]
Length=641

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +1

Query  352  PKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            P  + ++   + IW   P G++MP L++FRLTKE+     ++NVIIVTFGNYA+MDF
Sbjct  88   PTAKPRNMFTRDIW-DVPVGTKMPELKSFRLTKEMLEHWAKENVIIVTFGNYAYMDF  143



>ref|XP_010907097.1| PREDICTED: uncharacterized protein LOC105033849 isoform X1 [Elaeis 
guineensis]
Length=643

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +1

Query  352  PKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            P  + ++   + IW   P G++MP L++FRLTKE+     ++NVIIVTFGNYA+MDF
Sbjct  90   PTAKPRNMFTRDIW-DVPVGTKMPELKSFRLTKEMLEHWAKENVIIVTFGNYAYMDF  145



>ref|XP_010676704.1| PREDICTED: uncharacterized protein LOC104892459 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=533

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  418  MPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            MP L++FRLTKEL  +RV+DN+IIVTFGNYAFMDF
Sbjct  1    MPPLKSFRLTKELVEKRVKDNIIIVTFGNYAFMDF  35



>gb|KJB25103.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=533

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  418  MPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            MP LE+F+LTKEL  ER +DNVIIVTFGN+AFMDF
Sbjct  1    MPPLESFKLTKELVGERAKDNVIIVTFGNFAFMDF  35



>ref|NP_001050567.1| Os03g0586300 [Oryza sativa Japonica Group]
 gb|AAT76325.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12481.1| Os03g0586300 [Oryza sativa Japonica Group]
Length=356

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  382  KPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            +PIW  PP   RMP+   FRLT+E+   R R   I+VTFGN+AF+DF
Sbjct  73   RPIWKPPPRRERMPAPRAFRLTREMVGARARGGAIVVTFGNHAFLDF  119



>gb|EPS68350.1| hypothetical protein M569_06419, partial [Genlisea aurea]
Length=546

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  400  PPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            P  GS MP  E+FRLT+EL  ER  DNV+++TFGN+AF+DF
Sbjct  1    PGDGSEMPPPESFRLTRELVAERAEDNVVVITFGNFAFVDF  41



>gb|EEC75649.1| hypothetical protein OsI_12401 [Oryza sativa Indica Group]
Length=622

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  382  KPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            +PIW  PP   RMP+   FRLT+E+   R R   I+VTFGN+AF+DF
Sbjct  73   RPIWKPPPRRERMPAPRAFRLTREMVGARARGGAIVVTFGNHAFLDF  119



>gb|ABF97349.1| expressed protein [Oryza sativa Japonica Group]
Length=622

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  382  KPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            +PIW  PP   RMP+   FRLT+E+   R R   I+VTFGN+AF+DF
Sbjct  73   RPIWKPPPRRERMPAPRAFRLTREMVGARARGGAIVVTFGNHAFLDF  119



>ref|XP_009383104.1| PREDICTED: uncharacterized protein LOC103970914 [Musa acuminata 
subsp. malaccensis]
Length=682

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +1

Query  382  KPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            + +W   P  S+MP L+ F+LTKE+   R +DN I VTFGN+AF+DF
Sbjct  138  RAVW-DVPVSSKMPDLKLFQLTKEMVKHRAKDNFIFVTFGNHAFLDF  183



>ref|XP_002988322.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ10741.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=557

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  382  KPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            K IW  PP GS +P  E F L+KE+   R + NVI+VTF N+AF DF
Sbjct  8    KAIWEIPPHGSELPPREAFVLSKEMVEFRAKKNVIMVTFANHAFEDF  54



>ref|XP_002991425.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ07537.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=545

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  382  KPIWISPPPGSRMPSLETFRLTKELFXERVRDNVIIVTFGNYAFMDF  522
            K IW  PP GS +P  E F L+KE+   R + NVI+VTF N+AF DF
Sbjct  8    KAIWEIPPHGSELPPREAFVLSKEMVEFRAKKNVIMVTFANHAFEDF  54



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564104274800