BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF011K19

Length=488
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009781169.1|  PREDICTED: phosphatidylinositol N-acetylgluc...    232   3e-70   Nicotiana sylvestris
ref|XP_009587153.1|  PREDICTED: uncharacterized protein LOC104084897    231   9e-70   Nicotiana tomentosiformis
ref|XP_011077579.1|  PREDICTED: uncharacterized protein LOC105161555    226   9e-68   Sesamum indicum [beniseed]
ref|XP_002309122.2|  hypothetical protein POPTR_0006s09880g             218   5e-65   
ref|XP_011019147.1|  PREDICTED: uncharacterized protein LOC105121959    217   2e-64   Populus euphratica
ref|XP_010553086.1|  PREDICTED: uncharacterized protein LOC104823284    215   7e-64   Tarenaya hassleriana [spider flower]
ref|XP_006398643.1|  hypothetical protein EUTSA_v10013276mg             211   2e-62   Eutrema salsugineum [saltwater cress]
gb|KJB17034.1|  hypothetical protein B456_002G261700                    207   3e-62   Gossypium raimondii
ref|XP_008442461.1|  PREDICTED: uncharacterized protein LOC103486318    211   3e-62   Cucumis melo [Oriental melon]
gb|KJB76912.1|  hypothetical protein B456_012G112200                    208   4e-62   Gossypium raimondii
ref|XP_002531354.1|  glycosyltransferase, putative                      208   1e-61   
ref|XP_009370203.1|  PREDICTED: uncharacterized protein LOC103959579    208   3e-61   Pyrus x bretschneideri [bai li]
ref|XP_006363049.1|  PREDICTED: uncharacterized protein LOC102604925    208   3e-61   Solanum tuberosum [potatoes]
gb|KJB17032.1|  hypothetical protein B456_002G261700                    207   4e-61   Gossypium raimondii
ref|XP_006429312.1|  hypothetical protein CICLE_v10011473mg             208   4e-61   Citrus clementina [clementine]
ref|XP_006480973.1|  PREDICTED: uncharacterized protein LOC102615235    208   4e-61   Citrus sinensis [apfelsine]
ref|XP_004246336.1|  PREDICTED: uncharacterized protein LOC101252422    207   4e-61   Solanum lycopersicum
emb|CDP06508.1|  unnamed protein product                                206   5e-61   Coffea canephora [robusta coffee]
gb|KJB17030.1|  hypothetical protein B456_002G261700                    207   7e-61   Gossypium raimondii
ref|XP_010678109.1|  PREDICTED: uncharacterized protein LOC104893676    207   7e-61   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP24481.1|  hypothetical protein JCGZ_25045                         205   8e-61   Jatropha curcas
emb|CAB69850.1|  putative protein                                       206   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011094980.1|  PREDICTED: uncharacterized protein LOC105174543    207   1e-60   Sesamum indicum [beniseed]
ref|XP_009130666.1|  PREDICTED: uncharacterized protein LOC103855432    207   2e-60   Brassica rapa
ref|XP_002870938.1|  predicted protein                                  206   2e-60   Arabidopsis lyrata subsp. lyrata
gb|KFK44566.1|  hypothetical protein AALP_AA1G274200                    206   2e-60   Arabis alpina [alpine rockcress]
emb|CDY11210.1|  BnaA03g00460D                                          206   2e-60   Brassica napus [oilseed rape]
ref|XP_004137727.1|  PREDICTED: GDP-mannose-dependent alpha-manno...    206   2e-60   Cucumis sativus [cucumbers]
ref|XP_007205049.1|  hypothetical protein PRUPE_ppa004263mg             206   2e-60   Prunus persica
gb|KHG08972.1|  GDP-mannose-dependent alpha-mannosyltransferase         206   2e-60   Gossypium arboreum [tree cotton]
ref|XP_010490595.1|  PREDICTED: uncharacterized protein LOC104768346    206   3e-60   Camelina sativa [gold-of-pleasure]
gb|AAK76635.1|  unknown protein                                         204   4e-60   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568085.2|  sulfoquinovosyldiacylglycerol 2                       205   4e-60   Arabidopsis thaliana [mouse-ear cress]
emb|CBI30420.3|  unnamed protein product                                203   6e-60   Vitis vinifera
ref|XP_009593272.1|  PREDICTED: uncharacterized protein LOC104089...    205   6e-60   Nicotiana tomentosiformis
ref|XP_008388188.1|  PREDICTED: uncharacterized protein LOC103450599    204   8e-60   
ref|XP_010558362.1|  PREDICTED: uncharacterized protein LOC104827042    205   8e-60   Tarenaya hassleriana [spider flower]
ref|XP_007026774.1|  Sulfoquinovosyldiacylglycerol 2                    205   8e-60   
gb|KHN31576.1|  GDP-mannose-dependent alpha-mannosyltransferase         202   9e-60   Glycine soja [wild soybean]
ref|XP_009358856.1|  PREDICTED: uncharacterized protein LOC103949460    204   1e-59   Pyrus x bretschneideri [bai li]
gb|KHN46311.1|  GDP-mannose-dependent alpha-mannosyltransferase         202   1e-59   Glycine soja [wild soybean]
ref|XP_003516943.1|  PREDICTED: uncharacterized protein LOC100780899    204   2e-59   Glycine max [soybeans]
ref|XP_006287534.1|  hypothetical protein CARUB_v10000742mg             204   2e-59   Capsella rubella
ref|XP_003520926.1|  PREDICTED: uncharacterized protein LOC100803792    204   2e-59   Glycine max [soybeans]
ref|XP_010452011.1|  PREDICTED: uncharacterized protein LOC104734184    204   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_002278868.2|  PREDICTED: uncharacterized protein LOC100259616    203   2e-59   Vitis vinifera
emb|CAN62120.1|  hypothetical protein VITISV_037025                     202   3e-59   Vitis vinifera
ref|NP_001266888.1|  uncharacterized protein LOC101027242               194   3e-59   
gb|EYU41861.1|  hypothetical protein MIMGU_mgv1a004551mg                203   4e-59   Erythranthe guttata [common monkey flower]
ref|XP_008800789.1|  PREDICTED: uncharacterized protein LOC103715059    202   5e-59   Phoenix dactylifera
emb|CDY10486.1|  BnaCnng03870D                                          200   5e-59   Brassica napus [oilseed rape]
emb|CDX80782.1|  BnaC03g00360D                                          201   5e-59   
ref|XP_010424824.1|  PREDICTED: uncharacterized protein LOC104709996    205   5e-59   
ref|XP_003604630.1|  Glycogen synthase                                  202   1e-58   Medicago truncatula
ref|XP_007133940.1|  hypothetical protein PHAVU_010G005100g             202   1e-58   Phaseolus vulgaris [French bean]
ref|XP_002323560.1|  SULFOQUINOVOSYLDIACYLGLYCEROL 2 family protein     199   1e-58   
ref|XP_008239560.1|  PREDICTED: uncharacterized protein LOC103338145    201   2e-58   Prunus mume [ume]
ref|XP_006848130.1|  hypothetical protein AMTR_s00029p00223030          194   2e-58   
ref|XP_011047417.1|  PREDICTED: uncharacterized protein LOC105141...    198   3e-58   Populus euphratica
ref|XP_010256624.1|  PREDICTED: uncharacterized protein LOC104596978    200   5e-58   Nelumbo nucifera [Indian lotus]
emb|CDX97820.1|  BnaC04g41190D                                          198   5e-58   
ref|XP_010909645.1|  PREDICTED: uncharacterized protein LOC105035694    200   7e-58   Elaeis guineensis
gb|ABA55726.1|  sulfoquinovosyldiacylglycerol synthase type 2           199   8e-58   Vigna unguiculata
ref|XP_004506782.1|  PREDICTED: GDP-mannose-dependent alpha-manno...    199   1e-57   Cicer arietinum [garbanzo]
ref|XP_004302644.1|  PREDICTED: phosphatidylinositol N-acetylgluc...    198   2e-57   Fragaria vesca subsp. vesca
ref|XP_006657378.1|  PREDICTED: uncharacterized protein LOC102710508    197   3e-57   
ref|XP_009787548.1|  PREDICTED: uncharacterized protein LOC104235470    197   4e-57   Nicotiana sylvestris
emb|CDY40312.1|  BnaA10g27560D                                          197   6e-57   Brassica napus [oilseed rape]
ref|XP_009407545.1|  PREDICTED: phosphatidylinositol N-acetylgluc...    197   6e-57   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN24299.1|  GDP-mannose-dependent alpha-mannosyltransferase         195   9e-57   Glycine soja [wild soybean]
gb|EYU26645.1|  hypothetical protein MIMGU_mgv1a004620mg                197   9e-57   Erythranthe guttata [common monkey flower]
ref|XP_006338993.1|  PREDICTED: phosphatidylinositol N-acetylgluc...    196   1e-56   Solanum tuberosum [potatoes]
ref|XP_003561543.1|  PREDICTED: uncharacterized protein LOC100842...    196   1e-56   Brachypodium distachyon [annual false brome]
gb|EEE66415.1|  hypothetical protein OsJ_22761                          194   1e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003552228.1|  PREDICTED: uncharacterized protein LOC100807...    196   2e-56   Glycine max [soybeans]
gb|EMS55944.1|  GDP-mannose-dependent alpha-mannosyltransferase         196   2e-56   Triticum urartu
dbj|BAJ85864.1|  predicted protein                                      196   2e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006602643.1|  PREDICTED: uncharacterized protein LOC100807...    196   2e-56   Glycine max [soybeans]
ref|XP_008650830.1|  PREDICTED: uncharacterized protein LOC100192...    195   2e-56   
gb|EMT15547.1|  Putative glycosyltransferase                            195   2e-56   
ref|XP_004987290.1|  PREDICTED: uncharacterized protein LOC101765158    195   2e-56   Setaria italica
ref|XP_010228495.1|  PREDICTED: uncharacterized protein LOC100842...    195   3e-56   Brachypodium distachyon [annual false brome]
dbj|BAD31817.1|  putative sulfolipid synthase                           194   4e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002459190.1|  hypothetical protein SORBIDRAFT_02g000240          194   5e-56   Sorghum bicolor [broomcorn]
ref|XP_004249580.1|  PREDICTED: uncharacterized protein LOC101249508    194   7e-56   Solanum lycopersicum
gb|EPS61329.1|  hypothetical protein M569_13468                         185   1e-55   Genlisea aurea
ref|XP_004968167.1|  PREDICTED: uncharacterized protein LOC101764078    192   1e-55   
ref|XP_007140380.1|  hypothetical protein PHAVU_008G106900g             193   1e-55   Phaseolus vulgaris [French bean]
ref|XP_009409491.1|  PREDICTED: phosphatidylinositol N-acetylgluc...    191   2e-55   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY72486.1|  hypothetical protein OsI_00342                          191   2e-55   Oryza sativa Indica Group [Indian rice]
ref|NP_001041991.1|  Os01g0142300                                       191   2e-55   
ref|XP_008650829.1|  PREDICTED: uncharacterized protein LOC100192...    191   9e-55   Zea mays [maize]
gb|EMS60261.1|  GDP-mannose-dependent alpha-mannosyltransferase         192   2e-54   Triticum urartu
gb|EMT15719.1|  Putative glycosyltransferase                            188   2e-54   
ref|XP_002457385.1|  hypothetical protein SORBIDRAFT_03g006480          189   2e-54   Sorghum bicolor [broomcorn]
gb|AES79437.2|  group 1 family glycosyltransferase                      190   3e-54   Medicago truncatula
ref|XP_003623219.1|  Phosphatidylinositol N-acetylglucosaminyltra...    189   6e-54   
ref|XP_003568443.1|  PREDICTED: uncharacterized protein LOC100832140    187   1e-53   Brachypodium distachyon [annual false brome]
ref|XP_006643739.1|  PREDICTED: uncharacterized protein LOC102711739    187   1e-53   Oryza brachyantha
ref|XP_004984689.1|  PREDICTED: uncharacterized protein LOC101779471    186   2e-53   Setaria italica
ref|NP_001144658.1|  uncharacterized protein LOC100277683               185   5e-53   Zea mays [maize]
emb|CDM81044.1|  unnamed protein product                                184   1e-52   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006649799.1|  PREDICTED: uncharacterized protein LOC102700221    183   1e-52   Oryza brachyantha
ref|XP_008653982.1|  PREDICTED: uncharacterized protein LOC103634168    182   4e-52   Zea mays [maize]
ref|XP_002468134.1|  hypothetical protein SORBIDRAFT_01g040150          181   7e-52   Sorghum bicolor [broomcorn]
gb|ACG31912.1|  glycosyl transferase, group 1 family protein            181   9e-52   Zea mays [maize]
gb|ACN34235.1|  unknown                                                 181   9e-52   Zea mays [maize]
ref|NP_001150015.1|  glycosyl transferase, group 1 family protein       181   1e-51   Zea mays [maize]
ref|XP_002968644.1|  UDP-sulfoquinovose: alpha-diacylglycerol-sul...    183   1e-51   Selaginella moellendorffii
ref|XP_003558286.1|  PREDICTED: uncharacterized protein LOC100846446    181   1e-51   Brachypodium distachyon [annual false brome]
tpg|DAA44536.1|  TPA: hypothetical protein ZEAMMB73_879639              181   1e-51   
dbj|BAJ91585.1|  predicted protein                                      181   1e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAY89357.1|  hypothetical protein OsI_10861                          180   2e-51   Oryza sativa Indica Group [Indian rice]
ref|NP_001049645.1|  Os03g0265100                                       179   8e-51   
ref|XP_009122830.1|  PREDICTED: uncharacterized protein LOC103847496    179   4e-50   Brassica rapa
ref|XP_001766232.1|  predicted protein                                  173   3e-48   
ref|XP_001756850.1|  predicted protein                                  172   7e-48   
gb|KCW88121.1|  hypothetical protein EUGRSUZ_A00516                     169   3e-47   Eucalyptus grandis [rose gum]
gb|EMT15626.1|  Lipopolysaccharide core biosynthesis glycosyltran...    166   1e-45   
ref|XP_008370134.1|  PREDICTED: uncharacterized protein LOC103433646    164   3e-45   
emb|CDY21645.1|  BnaC09g46470D                                          159   3e-45   Brassica napus [oilseed rape]
emb|CDX82174.1|  BnaC02g21160D                                          151   4e-42   
ref|XP_010031046.1|  PREDICTED: uncharacterized protein LOC104420932    131   3e-33   Eucalyptus grandis [rose gum]
gb|KDO53238.1|  hypothetical protein CISIN_1g009759mg                   131   4e-33   Citrus sinensis [apfelsine]
ref|XP_009593273.1|  PREDICTED: uncharacterized protein LOC104089...    128   5e-32   
tpg|DAA59318.1|  TPA: hypothetical protein ZEAMMB73_291487              123   8e-32   
ref|XP_002953985.1|  hypothetical protein VOLCADRAFT_82536              127   3e-31   Volvox carteri f. nagariensis
ref|XP_011047421.1|  PREDICTED: uncharacterized protein LOC105141...    125   6e-31   Populus euphratica
gb|KEH28856.1|  group 1 family glycosyltransferase                      125   8e-31   Medicago truncatula
gb|KJB17031.1|  hypothetical protein B456_002G261700                    119   6e-29   Gossypium raimondii
ref|XP_011396666.1|  GDP-mannose-dependent alpha-mannosyltransferase    119   1e-28   Auxenochlorella protothecoides
ref|XP_011047420.1|  PREDICTED: uncharacterized protein LOC105141...    117   6e-28   Populus euphratica
ref|XP_006583630.1|  PREDICTED: uncharacterized protein LOC100804237    114   4e-27   
emb|CDX75469.1|  BnaA01g02330D                                          106   3e-26   
gb|KIY98280.1|  sulfoquinovosyltransferase                              110   5e-25   Monoraphidium neglectum
ref|XP_005843576.1|  hypothetical protein CHLNCDRAFT_33086              104   3e-23   Chlorella variabilis
ref|XP_005644605.1|  UDP-Glycosyltransferase/glycogen phosphorylase     103   1e-22   Coccomyxa subellipsoidea C-169
ref|XP_001421416.1|  predicted protein                                99.4    2e-21   Ostreococcus lucimarinus CCE9901
gb|ABC24951.1|  plastid sulfolipid synthase                           94.4    8e-21   Prototheca wickerhamii
gb|KJB17033.1|  hypothetical protein B456_002G261700                  96.3    3e-20   Gossypium raimondii
ref|XP_001699258.1|  sulfolipid synthase                              94.7    6e-20   Chlamydomonas reinhardtii
ref|XP_003083256.1|  sulfolipid synthase (ISS)                        94.7    2e-19   
ref|XP_010101801.1|  GDP-mannose-dependent alpha-mannosyltransferase  92.4    2e-19   
emb|CEG01736.1|  Glycosyl transferase, family 1                       94.0    6e-19   Ostreococcus tauri
ref|XP_007514956.1|  SqdX                                             94.4    6e-19   Bathycoccus prasinos
ref|XP_003057606.1|  glycosyltransferase family 4 protein             93.6    8e-19   Micromonas pusilla CCMP1545
ref|XP_005715110.1|  unnamed protein product                          91.7    2e-18   Chondrus crispus [carageen]
ref|XP_005705641.1|  UDP-sulfoquinovose:DAG sulfoquinovosyltransf...  89.7    5e-18   Galdieria sulphuraria
gb|KIZ02980.1|  sulfoquinovosyltransferase                            88.6    2e-17   Monoraphidium neglectum
ref|XP_005538341.1|  sulfoquinovosyldiacylglycerol biosynthesis p...  88.6    2e-17   Cyanidioschyzon merolae strain 10D
ref|XP_002501927.1|  glycosyltransferase family 4 protein             89.0    3e-17   Micromonas commoda
ref|XP_009035363.1|  hypothetical protein AURANDRAFT_2613             85.5    1e-16   Aureococcus anophagefferens
ref|XP_009034698.1|  hypothetical protein AURANDRAFT_52616            84.7    3e-16   Aureococcus anophagefferens
ref|XP_001689662.1|  sulfolipid synthase                              82.0    2e-15   Chlamydomonas reinhardtii
gb|KIZ01145.1|  hypothetical protein MNEG_6812                        77.4    4e-15   Monoraphidium neglectum
gb|KDO53239.1|  hypothetical protein CISIN_1g009759mg                 79.7    1e-14   Citrus sinensis [apfelsine]
gb|EJK62906.1|  hypothetical protein THAOC_16464                      80.1    2e-14   Thalassiosira oceanica
ref|XP_005706721.1|  sulfoquinovosyltransferase                       79.0    7e-14   Galdieria sulphuraria
gb|EWM27152.1|  gdp-mannose-dependent alpha-mannosyltransferase       78.2    9e-14   Nannochloropsis gaditana
ref|XP_002185276.1|  glycosyl transferase, group 1                    77.8    1e-13   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002295162.1|  predicted protein                                67.8    2e-10   Thalassiosira pseudonana CCMP1335
dbj|BAJ94304.1|  predicted protein                                    67.0    4e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_005834049.1|  hypothetical protein GUITHDRAFT_45198            64.7    2e-09   Guillardia theta CCMP2712
ref|WP_036004685.1|  glycosyl transferase                             65.1    2e-09   [Leptolyngbya] sp. JSC-1
ref|WP_017309223.1|  MULTISPECIES: glycosyl transferase               64.3    3e-09   Hapalosiphonaceae
ref|WP_015158023.1|  glycosyltransferase                              63.5    7e-09   Chamaesiphon minutus
ref|WP_016866990.1|  glycosyl transferase                             63.2    1e-08   Fischerella muscicola
emb|CAE20224.1|  SqdX                                                 63.2    1e-08   Prochlorococcus marinus str. MIT 9313
ref|WP_006617169.1|  glycosyl transferase                             62.4    1e-08   Arthrospira platensis
ref|WP_015202192.1|  group 1 glycosyl transferase                     62.4    1e-08   Crinalium epipsammum
ref|WP_006042635.1|  glycosyl transferase                             62.4    1e-08   Synechococcus sp. WH 7805
ref|WP_035156195.1|  glycosyl transferase                             62.4    2e-08   Calothrix sp. 336/3
ref|WP_016863486.1|  glycosyl transferase                             62.0    2e-08   Fischerella muscicola
ref|WP_009456118.1|  MULTISPECIES: glycosyl transferase               62.0    2e-08   Fischerella
ref|WP_008050780.1|  glycosyl transferase                             62.0    2e-08   Arthrospira
ref|WP_006669182.1|  glycosyl transferase                             62.0    2e-08   Arthrospira
ref|WP_006625687.1|  glycosyl transferase                             62.0    2e-08   Arthrospira platensis
ref|WP_011931986.1|  glycosyl transferase                             61.6    3e-08   Synechococcus sp. WH 7803
ref|WP_038551862.1|  glycosyl transferase                             61.6    3e-08   Synechococcus sp. KORDI-52
gb|AHF62481.1|  SqdX                                                  61.6    3e-08   Synechococcus sp. WH 8109
ref|WP_011363092.1|  glycosyl transferase                             61.6    3e-08   Synechococcus sp. CC9605
ref|WP_009768435.1|  glycosyltransferase                              61.6    3e-08   Oscillatoriales cyanobacterium JSC-12
ref|WP_015156349.1|  group 1 glycosyl transferase                     61.6    3e-08   Cyanobacteria [blue-green bacteria]
emb|CBJ27895.1|  UDP-sulfoquinovose: diacylglycerol alpha-sulfoqu...  59.3    3e-08   Ectocarpus siliculosus
ref|WP_017303625.1|  glycosyl transferase                             61.2    4e-08   Spirulina subsalsa
ref|WP_009788501.1|  glycosyl transferase                             61.2    4e-08   Synechococcus sp. BL107
ref|WP_006101106.1|  glycosyl transferase                             61.2    4e-08   Coleofasciculus chthonoplastes
ref|WP_028953281.1|  glycosyl transferase                             61.2    4e-08   Synechococcus sp. CC9616
ref|WP_039713912.1|  glycosyl transferase                             61.2    4e-08   
ref|WP_040054255.1|  glycosyl transferase                             61.2    4e-08   
ref|WP_036533451.1|  glycosyl transferase                             61.2    4e-08   Neosynechococcus sphagnicola
ref|WP_026733611.1|  glycosyl transferase                             60.8    5e-08   Fischerella sp. PCC 9605
ref|WP_026720234.1|  glycosyl transferase                             60.8    5e-08   Fischerella sp. PCC 9431
ref|WP_007099486.1|  glycosyl transferase                             60.8    5e-08   Synechococcus sp. RS9916
ref|WP_011824740.1|  glycosyl transferase                             60.8    6e-08   
ref|WP_009786934.1|  glycosyl transferase                             60.8    6e-08   Lyngbya sp. PCC 8106
ref|WP_041384827.1|  glycosyl transferase                             60.8    6e-08   Prochlorococcus marinus
ref|WP_011126929.1|  glycosyl transferase                             60.8    6e-08   Synechococcus
ref|WP_027254623.1|  glycosyl transferase                             60.5    6e-08   Planktothrix agardhii
gb|AFZ29723.1|  glycosyl transferase group 1                          60.8    6e-08   Gloeocapsa sp. PCC 7428
ref|WP_015168332.1|  glycosyltransferase                              60.5    6e-08   Synechococcus sp. PCC 7502
ref|WP_026797347.1|  glycosyl transferase                             60.5    6e-08   Planktothrix
ref|WP_042156569.1|  glycosyl transferase                             60.5    7e-08   Planktothrix agardhii
ref|WP_011358891.1|  glycosyl transferase                             60.5    7e-08   Synechococcus sp. CC9902
gb|ACB50919.1|  probable sulfolipid sulfoquinovosyldiacylglycerol...  60.5    7e-08   Cyanothece sp. ATCC 51142
ref|WP_026793415.1|  MULTISPECIES: glycosyl transferase               60.5    7e-08   Planktothrix
gb|EHA59149.1|  glycosyl transferase group 1                          60.5    7e-08   Synechococcus sp. WH 8016
ref|WP_008230224.1|  Glycosyltransferase                              60.1    8e-08   Richelia intracellularis
emb|CCH68234.1|  Glycosyltransferase                                  60.1    8e-08   Richelia intracellularis HH01
ref|WP_015165224.1|  group 1 glycosyl transferase                     60.1    8e-08   Pseudanabaena sp. PCC 7367
ref|WP_019501737.1|  hypothetical protein                             60.1    9e-08   Pseudanabaena sp. PCC 6802
ref|WP_042341390.1|  glycosyl transferase                             60.1    9e-08   Calothrix sp. PCC 7507
ref|WP_015184883.1|  glycosyltransferase                              60.1    9e-08   Microcoleus sp. PCC 7113
gb|AFY33983.1|  glycosyl transferase group 1                          60.1    1e-07   Calothrix sp. PCC 7507
ref|WP_044304974.1|  glycosyl transferase                             60.1    1e-07   Richelia intracellularis
ref|WP_043694049.1|  glycosyl transferase                             59.7    1e-07   Synechococcus sp. KORDI-49
ref|WP_023066667.1|  glycosyl transferases group 1 family protein     59.7    1e-07   Lyngbya aestuarii
ref|WP_015223063.1|  group 1 glycosyl transferase                     59.7    1e-07   
gb|KIJ83524.1|  glycosyl transferase                                  59.7    1e-07   Scytonema tolypothrichoides VB-61278
ref|WP_015124487.1|  glycosyltransferase                              59.7    1e-07   Synechococcus sp. PCC 6312
ref|WP_015220908.1|  group 1 glycosyl transferase                     59.7    1e-07   Cyanobacterium aponinum
ref|WP_013323818.1|  glycosyl transferase                             59.7    1e-07   Cyanothece sp. PCC 7822
ref|WP_011316987.1|  glycosyl transferase                             59.7    1e-07   Trichormus variabilis
ref|WP_017662025.1|  glycosyl transferase                             59.7    1e-07   Geitlerinema sp. PCC 7105
ref|WP_015200905.1|  group 1 glycosyl transferase                     59.3    2e-07   Calothrix parietina
ref|WP_015170725.1|  group 1 glycosyl transferase                     58.9    2e-07   Geitlerinema sp. PCC 7407
ref|WP_007101086.1|  glycosyl transferase                             58.9    2e-07   Synechococcus sp. RS9917
gb|KIE08753.1|  glycosyl transferase                                  58.9    2e-07   Tolypothrix bouteillei VB521301
ref|WP_015175196.1|  glycosyl transferase group 1                     58.9    2e-07   Oscillatoria nigro-viridis
ref|WP_010996422.1|  glycosyl transferase                             58.9    2e-07   Nostocaceae
ref|WP_036913154.1|  MULTISPECIES: glycosyl transferase               58.9    2e-07   Prochlorococcus
ref|WP_008276523.1|  glycosyl transferase                             58.5    3e-07   Cyanothece sp. CCY0110
ref|WP_009633426.1|  glycosyltransferase                              58.5    3e-07   Synechocystis sp. PCC 7509
ref|WP_017292828.1|  glycosyl transferase                             58.5    3e-07   Geminocystis herdmanii
ref|XP_005767468.1|  SQDG synthase                                    58.9    3e-07   Emiliania huxleyi CCMP1516
ref|WP_016872824.1|  glycosyl transferase                             58.5    3e-07   Chlorogloeopsis fritschii
ref|WP_038014997.1|  glycosyl transferase                             58.5    3e-07   Synechococcus sp. WH 8016
ref|WP_032513539.1|  glycosyl transferase                             58.2    3e-07   Prochlorococcus marinus
ref|WP_019494764.1|  glycosyl transferase                             58.2    4e-07   Calothrix sp. PCC 7103
ref|WP_024750270.1|  MULTISPECIES: glycosyl transferase               58.2    4e-07   Cyanothece
ref|WP_011821147.1|  glycosyl transferase                             58.2    4e-07   Prochlorococcus marinus
ref|WP_036900899.1|  glycosyl transferase                             58.2    4e-07   Prochlorococcus sp. MIT 0601
ref|WP_007308077.1|  glycosyl transferase                             58.2    4e-07   Crocosphaera watsonii
ref|WP_015136558.1|  glycosyltransferase                              58.2    4e-07   Nostoc sp. PCC 7524
ref|WP_011133293.1|  glycosyl transferase                             58.2    4e-07   Prochlorococcus marinus
ref|WP_006910279.1|  glycosyl transferase                             58.2    4e-07   Cyanobium sp. PCC 7001
ref|WP_040944740.1|  glycosyl transferase                             57.8    4e-07   
gb|ACO31913.1|  glycosyl transferase, group 1 family                  58.2    5e-07   Acidobacterium capsulatum ATCC 51196
ref|WP_012196344.1|  glycosyl transferase                             58.2    5e-07   Prochlorococcus marinus
ref|WP_015225187.1|  group 1 glycosyl transferase                     58.2    5e-07   Halothece sp. PCC 7418
ref|WP_041918928.1|  glycosyl transferase                             57.8    5e-07   Gloeocapsa sp. PCC 7428
ref|WP_016953042.1|  glycosyl transferase                             57.8    5e-07   Anabaena sp. PCC 7108
ref|WP_036922652.1|  glycosyl transferase                             57.8    5e-07   
ref|WP_019478276.1|  glycosyl transferase                             57.8    5e-07   
ref|WP_011934471.1|  glycosyl transferase                             57.8    5e-07   Synechococcus sp. RCC307
ref|WP_041036120.1|  glycosyl transferase                             57.8    5e-07   Tolypothrix campylonemoides
ref|WP_025893675.1|  glycosyl transferase                             57.8    6e-07   
ref|WP_032522712.1|  glycosyl transferase                             57.8    6e-07   Prochlorococcus marinus
ref|WP_040937362.1|  glycosyl transferase                             57.4    7e-07   
ref|WP_029636073.1|  glycosyl transferase [                           57.4    7e-07   [Scytonema hofmanni] UTEX B 1581
ref|WP_039753013.1|  glycosyl transferase                             57.4    7e-07   
ref|WP_010313930.1|  glycosyl transferase                             57.4    7e-07   Synechococcus sp. CB0205
ref|WP_038654761.1|  glycosyl transferase                             57.4    7e-07   Prochlorococcus sp. MIT 0801
ref|WP_015956855.1|  glycosyl transferase                             57.4    7e-07   Cyanothece sp. PCC 7424
ref|WP_006633738.1|  glycosyl transferase                             57.4    7e-07   Microcoleus vaginatus
ref|WP_011618042.1|  glycosyl transferase                             57.4    8e-07   Synechococcus sp. CC9311
ref|WP_023072791.1|  group 1 glycosyl transferase                     57.4    8e-07   Leptolyngbya sp. Heron Island J
ref|WP_007356158.1|  MULTISPECIES: glycosyl transferase               57.4    8e-07   Kamptonema
ref|WP_025891213.1|  glycosyl transferase                             57.4    8e-07   
ref|XP_005791415.1|  hypothetical protein EMIHUDRAFT_223825           56.2    8e-07   Emiliania huxleyi CCMP1516
ref|WP_017297313.1|  glycosyl transferase                             57.4    8e-07   Nodosilinea nodulosa
gb|ABE11344.1|  SqdX                                                  57.4    8e-07   uncultured Prochlorococcus marinus clone HOT0M-10E12
ref|WP_011377300.1|  glycosyl transferase                             57.4    8e-07   Prochlorococcus marinus
ref|WP_025965969.1|  glycosyl transferase                             57.4    8e-07   
ref|WP_025936122.1|  MULTISPECIES: glycosyl transferase               57.4    8e-07   
ref|WP_017744576.1|  glycosyl transferase                             57.0    8e-07   Scytonema hofmannii
ref|WP_025943510.1|  glycosyl transferase                             57.4    8e-07   
ref|WP_025934143.1|  MULTISPECIES: glycosyl transferase               57.0    8e-07   
ref|WP_032516163.1|  glycosyl transferase                             57.0    9e-07   Prochlorococcus marinus
ref|WP_025937741.1|  glycosyl transferase                             57.0    9e-07   
ref|WP_025923959.1|  glycosyl transferase                             57.0    9e-07   
ref|WP_025927153.1|  glycosyl transferase                             57.0    9e-07   
ref|WP_011819276.1|  glycosyl transferase                             57.0    9e-07   
ref|WP_009628051.1|  glycosyl transferase group 1                     57.0    9e-07   
ref|WP_032525173.1|  glycosyl transferase                             57.0    9e-07   
ref|WP_025938801.1|  glycosyl transferase                             57.0    9e-07   
ref|WP_025923704.1|  glycosyl transferase                             57.0    9e-07   
ref|WP_002806204.1|  glycosyl transferase                             57.0    9e-07   
ref|WP_042851210.1|  glycosyl transferase                             57.0    9e-07   
ref|WP_035991630.1|  glycosyl transferase                             57.0    9e-07   
ref|WP_025980084.1|  MULTISPECIES: glycosyl transferase               57.0    9e-07   
ref|WP_025956304.1|  glycosyl transferase                             57.0    9e-07   
ref|WP_025928974.1|  glycosyl transferase                             57.0    9e-07   
ref|WP_025921690.1|  glycosyl transferase                             57.0    9e-07   
ref|WP_010650574.1|  glycosyl transferase                             57.0    9e-07   
ref|WP_025967691.1|  glycosyl transferase                             57.0    9e-07   
ref|WP_015215962.1|  glycosyl transferase group 1                     57.0    9e-07   
ref|WP_011125976.1|  MULTISPECIES: glycosyl transferase               57.0    1e-06   
ref|WP_015113812.1|  group 1 glycosyl transferase                     57.0    1e-06   
ref|WP_010312701.1|  glycosyl transferase                             57.0    1e-06   
ref|WP_032526403.1|  glycosyl transferase                             57.0    1e-06   
ref|WP_026787523.1|  glycosyl transferase                             57.0    1e-06   
ref|WP_025915258.1|  glycosyl transferase                             57.0    1e-06   
ref|WP_006513788.1|  glycosyltransferase                              57.0    1e-06   
ref|WP_015208499.1|  glycosyltransferase                              57.0    1e-06   
ref|WP_028085475.1|  glycosyl transferase                             57.0    1e-06   
ref|WP_032517996.1|  glycosyl transferase                             57.0    1e-06   
ref|WP_028091028.1|  glycosyl transferase                             57.0    1e-06   
ref|WP_015118690.1|  glycosyltransferase                              56.6    1e-06   
ref|WP_006196765.1|  glycosyl transferase                             56.6    1e-06   
ref|WP_015083608.1|  group 1 glycosyl transferase                     56.6    1e-06   
ref|WP_039202474.1|  glycosyl transferase                             56.6    1e-06   
ref|WP_019477192.1|  glycosyl transferase                             56.6    1e-06   
ref|WP_019476471.1|  glycosyl transferase                             56.6    1e-06   
ref|WP_005883102.1|  glycosyl transferase                             56.6    1e-06   
ref|WP_027403809.1|  glycosyl transferase                             56.6    1e-06   
ref|WP_025974177.1|  glycosyl transferase                             56.6    1e-06   
ref|WP_025968880.1|  glycosyl transferase                             56.6    1e-06   
ref|WP_025927759.1|  MULTISPECIES: glycosyl transferase               56.6    1e-06   
ref|WP_025882496.1|  glycosyl transferase                             56.6    1e-06   
ref|WP_025913940.1|  MULTISPECIES: glycosyl transferase               56.6    1e-06   
ref|WP_027843401.1|  glycosyl transferase                             56.6    1e-06   
ref|WP_011056273.1|  glycosyl transferase                             56.6    1e-06   
ref|WP_025971371.1|  glycosyl transferase                             56.6    1e-06   
ref|WP_025965084.1|  glycosyl transferase                             56.6    1e-06   
ref|WP_025947052.1|  glycosyl transferase                             56.6    1e-06   
ref|XP_005789854.1|  hypothetical protein EMIHUDRAFT_225608           56.2    2e-06   
ref|WP_038542489.1|  glycosyl transferase                             56.2    2e-06   
ref|WP_025939760.1|  glycosyl transferase                             56.2    2e-06   
ref|WP_025961606.1|  glycosyl transferase                             56.2    2e-06   
ref|WP_025925654.1|  MULTISPECIES: glycosyl transferase               56.2    2e-06   
ref|WP_016515815.1|  GDP-mannose-dependent alpha-mannosyltransferase  56.2    2e-06   
ref|WP_037218313.1|  glycosyl transferase                             56.2    2e-06   
ref|WP_018396637.1|  glycosyl transferase                             56.2    2e-06   
ref|WP_025947613.1|  glycosyl transferase                             56.2    2e-06   
ref|WP_017719528.1|  glycosyl transferase                             56.2    2e-06   
ref|WP_025935527.1|  glycosyl transferase                             56.2    2e-06   
ref|WP_012008540.1|  glycosyl transferase                             56.2    2e-06   
ref|WP_013192302.1|  glycosyl transferase                             55.8    2e-06   
ref|WP_036899853.1|  glycosyl transferase                             55.8    2e-06   
ref|WP_019474951.1|  glycosyl transferase                             55.8    2e-06   
ref|WP_015784192.1|  glycosyl transferase                             55.8    2e-06   
ref|WP_017713210.1|  glycosyl transferase                             55.8    2e-06   
ref|WP_008180177.1|  glycosyl transferase                             55.8    2e-06   
ref|WP_012596832.1|  glycosyl transferase                             55.8    2e-06   
ref|WP_011824631.1|  glycosyl transferase                             55.8    3e-06   
ref|WP_002733558.1|  glycosyl transferases group 1 family protein     55.8    3e-06   
ref|WP_008196868.1|  glycosyl transferase                             55.8    3e-06   
ref|WP_002775633.1|  glycosyl transferase                             55.8    3e-06   
ref|WP_002752604.1|  glycosyl transferase                             55.8    3e-06   
ref|WP_011295609.1|  glycosyl transferase                             55.8    3e-06   
ref|WP_002782662.1|  SqdX protein                                     55.8    3e-06   
dbj|GAL95034.1|  glycosyl transferase group 1                         55.8    3e-06   
ref|WP_011243256.1|  MULTISPECIES: glycosyl transferase               55.8    3e-06   
ref|WP_002765335.1|  glycosyl transferase                             55.8    3e-06   
ref|WP_002749281.1|  glycosyl transferases group 1 family protein     55.8    3e-06   
ref|WP_002758085.1|  glycosyl transferase                             55.8    3e-06   
ref|WP_002787970.1|  glycosyl transferase                             55.5    3e-06   
ref|WP_017314735.1|  glycosyl transferase                             55.5    3e-06   
ref|WP_031206256.1|  glycosyl transferase                             55.8    3e-06   
ref|WP_012953900.1|  glycosyl transferase                             55.5    3e-06   
ref|WP_025922712.1|  MULTISPECIES: glycosyl transferase               55.5    3e-06   
ref|WP_025945509.1|  glycosyl transferase                             55.5    3e-06   
ref|WP_033394097.1|  GDP-mannose-dependent alpha-mannosyltransferase  55.5    3e-06   
ref|WP_017288576.1|  glycosyl transferase                             55.5    4e-06   
ref|WP_025103208.1|  glycosyl transferase                             55.8    4e-06   
ref|WP_011610261.1|  glycosyl transferase                             55.1    4e-06   
ref|WP_015230997.1|  glycosyltransferase                              55.1    4e-06   
ref|WP_037265355.1|  GDP-mannose-dependent alpha-mannosyltransferase  55.1    4e-06   
ref|WP_036477227.1|  glycosyl transferase                             55.1    4e-06   
ref|WP_024544755.1|  glycosyl transferase                             55.1    4e-06   
ref|WP_022608621.1|  glycosyltransferase                              55.1    4e-06   
ref|WP_006275757.1|  glycosyl transferase                             55.1    4e-06   
ref|WP_031206758.1|  glycosyl transferase                             55.5    4e-06   
ref|WP_029259007.1|  glycosyl transferase                             55.5    5e-06   
ref|WP_015133176.1|  group 1 glycosyl transferase                     55.1    5e-06   
ref|WP_029265536.1|  glycosyl transferase                             55.5    5e-06   
gb|KGF92154.1|  Glycosyltransferase                                   55.1    5e-06   
ref|WP_008314395.1|  glycosyltransferase                              54.7    5e-06   
ref|WP_006172769.1|  glycosyl transferase                             54.7    5e-06   
ref|WP_024125070.1|  sulfoquinovosyldiacylglycerol biosynthesis p...  54.7    5e-06   
ref|WP_036905889.1|  glycosyl transferase                             54.7    6e-06   
ref|WP_015142815.1|  glycosyltransferase                              54.7    6e-06   
ref|WP_004163138.1|  glycosyl transferase                             54.7    6e-06   
ref|WP_012629991.1|  glycosyl transferase                             54.7    6e-06   
ref|WP_041426021.1|  glycosyl transferase                             54.7    6e-06   
ref|WP_025967336.1|  glycosyl transferase                             54.7    6e-06   
dbj|BAM54556.1|  hypothetical protein BEST7613_5625                   54.7    7e-06   
ref|WP_017321552.1|  glycosyl transferase                             54.3    7e-06   
ref|WP_040158057.1|  GDP-mannose-dependent alpha-mannosyltransferase  54.3    7e-06   
ref|WP_010873332.1|  glycosyl transferase                             54.3    7e-06   
ref|WP_036919584.1|  MULTISPECIES: glycosyl transferase               54.3    7e-06   
ref|WP_040568599.1|  GDP-mannose-dependent alpha-mannosyltransferase  51.2    8e-06   
ref|WP_012409446.1|  glycosyl transferase                             54.3    8e-06   
ref|WP_043670146.1|  glycosyl transferase                             54.3    8e-06   
ref|WP_009344130.1|  glycosyl transferase                             54.3    8e-06   
ref|WP_015195528.1|  glycosyl transferase group 1                     54.3    8e-06   
ref|WP_023646031.1|  glycosyl transferase                             54.3    9e-06   
ref|WP_035833307.1|  glycosyl transferase                             53.9    1e-05   
ref|WP_028948727.1|  glycosyl transferase                             53.9    1e-05   
ref|WP_042182514.1|  GDP-mannose-dependent alpha-mannosyltransferase  53.9    1e-05   
ref|WP_041840032.1|  glycosyl transferase                             53.9    1e-05   
ref|WP_019507997.1|  glycosyl transferase                             53.9    1e-05   
gb|ABO18479.1|  SqdX                                                  53.5    1e-05   
ref|WP_029952897.1|  glycosyl transferase                             53.1    1e-05   
gb|KGF85728.1|  Glycosyltransferase                                   53.5    1e-05   
gb|EFQ83967.1|  glycosyltransferase, group 1 family protein           53.5    1e-05   
ref|WP_040320578.1|  GDP-mannose-dependent alpha-mannosyltransferase  53.5    1e-05   
ref|WP_030478220.1|  GDP-mannose-dependent alpha-mannosyltransferase  53.5    1e-05   
gb|KGG03241.1|  Glycosyltransferase                                   53.1    2e-05   
ref|WP_006457040.1|  glycosyl transferase                             53.1    2e-05   
ref|WP_026537866.1|  GDP-mannose-dependent alpha-mannosyltransferase  53.1    2e-05   
ref|YP_002049079.1|  SqdX                                             53.1    2e-05   
ref|WP_017655891.1|  glycosyl transferase                             53.1    2e-05   
ref|WP_012164458.1|  glycosyl transferase                             53.1    2e-05   
ref|WP_018774804.1|  glycosyl transferase                             53.1    2e-05   
emb|CDN11933.1|  Glycosyltransferase                                  53.1    2e-05   
ref|WP_010467672.1|  glycosyl transferase                             53.1    2e-05   
gb|AAW57084.1|  probable sulfolipid sulfoquinovosyldiacylglycerol...  52.8    2e-05   
ref|WP_006509265.1|  glycosyltransferase                              52.4    3e-05   
ref|WP_011429929.1|  glycosyl transferase                             52.0    5e-05   
ref|WP_021760711.1|  hypothetical protein                             51.2    5e-05   
gb|EQM83636.1|  hypothetical protein L687_12045                       52.0    5e-05   
ref|WP_012300092.1|  glycosyl transferase                             52.0    5e-05   
ref|WP_006527890.1|  glycosyltransferase                              51.6    5e-05   
ref|WP_044106990.1|  glycosyl transferase                             51.6    6e-05   
ref|WP_022877224.1|  glycosyl transferase                             52.0    6e-05   
ref|WP_015152019.1|  glycosyltransferase                              51.6    7e-05   
ref|WP_016455577.1|  MULTISPECIES: hypothetical protein               51.2    7e-05   
ref|WP_040341224.1|  GDP-mannose-dependent alpha-mannosyltransferase  51.6    7e-05   
ref|WP_033104609.1|  glycosyl transferase                             51.6    7e-05   
ref|WP_025781484.1|  glycosyl transferase                             50.8    1e-04   
ref|WP_015109858.1|  glycosyltransferase                              50.8    1e-04   
ref|WP_015245390.1|  glycosyl transferase family 1                    50.8    1e-04   
ref|WP_020392501.1|  hypothetical protein                             50.8    1e-04   
ref|WP_013160550.1|  glycosyl transferase                             50.8    1e-04   
ref|WP_025776825.1|  GDP-mannose-dependent alpha-mannosyltransferase  50.8    1e-04   
ref|WP_043810223.1|  GDP-mannose-dependent alpha-mannosyltransferase  50.4    1e-04   
ref|WP_028277286.1|  GDP-mannose-dependent alpha-mannosyltransferase  50.4    1e-04   
ref|WP_009883866.1|  glycosyl transferase                             50.4    1e-04   
ref|WP_017328405.1|  glycosyl transferase                             50.4    1e-04   
ref|WP_039209925.1|  GDP-mannose-dependent alpha-mannosyltransferase  50.4    1e-04   
emb|CEH03950.1|  Glycosyltransferase                                  50.4    1e-04   
ref|WP_028821988.1|  GDP-mannose-dependent alpha-mannosyltransferase  50.4    1e-04   
ref|WP_010532798.1|  glycosyl transferase                             50.4    1e-04   
ref|WP_019618011.1|  hypothetical protein                             50.4    2e-04   
ref|WP_029263624.1|  MULTISPECIES: glycosyl transferase               50.4    2e-04   
ref|WP_035742699.1|  GDP-mannose-dependent alpha-mannosyltransferase  50.1    2e-04   
ref|WP_009774051.1|  glycosyl transferase                             50.1    2e-04   
ref|WP_038462874.1|  GDP-mannose-dependent alpha-mannosyltransferase  50.1    2e-04   
ref|WP_010549462.1|  glycosyl transferase                             50.1    2e-04   
emb|CAN01012.1|  putative mannosyl transferase                        50.1    2e-04   
ref|WP_043560645.1|  glycosyl transferase                             50.1    2e-04   
ref|WP_043584535.1|  glycosyl transferase                             50.1    2e-04   
ref|WP_043361862.1|  glycosyl transferase                             50.1    2e-04   
ref|WP_035057403.1|  hypothetical protein                             49.7    2e-04   
ref|WP_011433965.1|  glycosyl transferase                             49.7    2e-04   
gb|EKU48690.1|  glycosyl transferase, GT1 family protein              49.7    2e-04   
dbj|BAJ73294.1|  glycosyltransferase                                  50.1    2e-04   
gb|KEP74091.1|  glycosyl transferase                                  49.7    3e-04   
ref|WP_036279917.1|  glycosyl transferase                             49.7    3e-04   
ref|WP_036331424.1|  hypothetical protein                             49.3    3e-04   
gb|KID32394.1|  glycosyltransferase                                   49.3    4e-04   
ref|WP_025155600.1|  glycosyl transferase                             49.3    4e-04   
ref|WP_035877682.1|  glycosyl transferase                             49.3    4e-04   
ref|WP_030007647.1|  glycosyl transferase                             49.3    4e-04   
ref|WP_007272087.1|  alpha-D-mannose-alpha(1-6)phosphatidyl myo-i...  49.3    4e-04   
ref|WP_012308070.1|  glycosyl transferase                             48.9    4e-04   
ref|WP_015489676.1|  glycosyl transferase                             48.9    4e-04   
ref|WP_040684547.1|  glycosyl transferase                             48.9    4e-04   
gb|KHS52460.1|  glycosyl transferase group 1                          48.9    5e-04   
ref|WP_035836934.1|  glycosyl transferase                             48.9    5e-04   
ref|WP_013178429.1|  glycosyl transferase family 1                    48.9    6e-04   
ref|WP_015776662.1|  glycosyl transferase                             48.5    6e-04   
gb|ADB30445.1|  glycosyl transferase group 1                          48.5    8e-04   
ref|WP_041289846.1|  glycosyl transferase                             48.1    8e-04   
ref|WP_019180590.1|  hypothetical protein                             48.1    0.001   



>ref|XP_009781169.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase 
GPI3 subunit-like [Nicotiana sylvestris]
Length=508

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  114  SSKMTITEYREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLRE  293
            S+KMTITEYR+EE  + P LL S+M+SRPRRIALFVEPSPFAY+SGYKNRFQNFIKYLRE
Sbjct  72   SNKMTITEYRDEEEENPPPLLVSEMSSRPRRIALFVEPSPFAYVSGYKNRFQNFIKYLRE  131

Query  294  MGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVH  473
            +GDEVMVVTTHEGVP+EFYGAKL+GSQSFPCPWYRKVPLSLALSPRIISEV QFKPDI+H
Sbjct  132  LGDEVMVVTTHEGVPQEFYGAKLIGSQSFPCPWYRKVPLSLALSPRIISEVVQFKPDIIH  191

Query  474  ASSPG  488
            ASSPG
Sbjct  192  ASSPG  196



>ref|XP_009587153.1| PREDICTED: uncharacterized protein LOC104084897 [Nicotiana tomentosiformis]
Length=509

 Score =   231 bits (588),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  114  SSKMTITEYREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLRE  293
            S+KMTITEYR+EE  + P LL S+M+S PRRIALFVEPSPFAY+SGYKNRFQNFIKYLRE
Sbjct  73   SNKMTITEYRDEEEENPPPLLVSEMSSTPRRIALFVEPSPFAYVSGYKNRFQNFIKYLRE  132

Query  294  MGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVH  473
            MGDEVMVVTTHEGVP+EFYGAKL+GSQSFPCPWYRKVPLSLALSPRIISEV QFKPDI+H
Sbjct  133  MGDEVMVVTTHEGVPQEFYGAKLIGSQSFPCPWYRKVPLSLALSPRIISEVVQFKPDIIH  192

Query  474  ASSPG  488
            ASSPG
Sbjct  193  ASSPG  197



>ref|XP_011077579.1| PREDICTED: uncharacterized protein LOC105161555 [Sesamum indicum]
Length=520

 Score =   226 bits (575),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 135/172 (78%), Gaps = 14/172 (8%)
 Frame = +3

Query  3    SSCSRAKNPSVLFFFFLGVKTQSLNLGLASTLWEFAV---------SSKMTITEYR-EEE  152
            S  SR + P  L    L +KTQSL    +  L    V         +SKMTITEYR EEE
Sbjct  40   SCTSRLREPITL----LCLKTQSLQYKRSKELRVLKVRTSSESASTTSKMTITEYRGEEE  95

Query  153  NGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEG  332
            + + P LLES+M S PRRIALFVEPSPF+Y+SGYKNRFQNFIKYLREMGDEVMVVTTHEG
Sbjct  96   DENPPPLLESEMNSSPRRIALFVEPSPFSYVSGYKNRFQNFIKYLREMGDEVMVVTTHEG  155

Query  333  VPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            VP+EFYGA+L+GS+SFPCPWY+KVPLSLALSPRIIS VAQFKPDI+HASSPG
Sbjct  156  VPQEFYGAQLIGSRSFPCPWYQKVPLSLALSPRIISAVAQFKPDIIHASSPG  207



>ref|XP_002309122.2| hypothetical protein POPTR_0006s09880g [Populus trichocarpa]
 gb|EEE92645.2| hypothetical protein POPTR_0006s09880g [Populus trichocarpa]
Length=520

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  114  SSKMTITEYREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLRE  293
            ++ MTI+E REE+  + P  L+ D  SRPRRIALFVEPSPFAY+SGYKNRFQNFIKYLRE
Sbjct  87   NNDMTISEVREEDEENPPPFLDYDTISRPRRIALFVEPSPFAYVSGYKNRFQNFIKYLRE  146

Query  294  MGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVH  473
            MGDEVMVVTTHEGVP+EFYGAKL+GS+SFPCPWY+KVPLSLALSPRIISEVA+FKPDI+H
Sbjct  147  MGDEVMVVTTHEGVPQEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIISEVARFKPDIIH  206

Query  474  ASSPG  488
            ASSPG
Sbjct  207  ASSPG  211



>ref|XP_011019147.1| PREDICTED: uncharacterized protein LOC105121959 [Populus euphratica]
Length=520

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  114  SSKMTITEYREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLRE  293
            ++ M I+E REE+  + P  L+ D  SRPRRIALFVEPSPFAY+SGYKNRFQNFIKYLRE
Sbjct  87   NNDMAISEVREEDEENPPPFLDYDTISRPRRIALFVEPSPFAYVSGYKNRFQNFIKYLRE  146

Query  294  MGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVH  473
            MGDEVMVVTTHEGVP+EFYGAKL+GS+SFPCPWY+KVPLSLALSPRIISEVA+FKPDI+H
Sbjct  147  MGDEVMVVTTHEGVPQEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIISEVARFKPDIIH  206

Query  474  ASSPG  488
            ASSPG
Sbjct  207  ASSPG  211



>ref|XP_010553086.1| PREDICTED: uncharacterized protein LOC104823284 [Tarenaya hassleriana]
Length=518

 Score =   215 bits (548),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 123/144 (85%), Gaps = 1/144 (1%)
 Frame = +3

Query  60   KTQSLNLGLASTLWEFAVSSKMTITEYREEENGSLPL-LLESDMTSRPRRIALFVEPSPF  236
            K +    G+   +   + S+ MTITE RE++N  +   LL+S+  SRPRRIALFVEPSPF
Sbjct  64   KGRVFGEGIGREVVSASGSNDMTITEVREDQNEEIEAPLLDSETVSRPRRIALFVEPSPF  123

Query  237  AYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSL  416
            +Y+SGYKNRFQNFIKYLREMGDEV+VVTTHEGVP+EFYGAK++GS+SFPCPWY+KVPLSL
Sbjct  124  SYVSGYKNRFQNFIKYLREMGDEVIVVTTHEGVPQEFYGAKVIGSRSFPCPWYQKVPLSL  183

Query  417  ALSPRIISEVAQFKPDIVHASSPG  488
            ALSPRIISE+A+FKPDI+HASSPG
Sbjct  184  ALSPRIISEIARFKPDIIHASSPG  207



>ref|XP_006398643.1| hypothetical protein EUTSA_v10013276mg [Eutrema salsugineum]
 gb|ESQ40096.1| hypothetical protein EUTSA_v10013276mg [Eutrema salsugineum]
Length=516

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 115/126 (91%), Gaps = 1/126 (1%)
 Frame = +3

Query  114  SSKMTITEYREEENGSLPL-LLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLR  290
            S+ MTITE REE+   +   LL+ +  S+PRRIALFVEPSPFAY+SGYKNRFQNFI+YLR
Sbjct  80   SNDMTITEVREEDESEIEAPLLDPESYSKPRRIALFVEPSPFAYVSGYKNRFQNFIRYLR  139

Query  291  EMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIV  470
            EMGDEV+VVTTHEGVPEEFYGAK++GS+SFPCPWY+KVPLSLALSPRIISE+A+FKPDI+
Sbjct  140  EMGDEVIVVTTHEGVPEEFYGAKVIGSRSFPCPWYQKVPLSLALSPRIISEIARFKPDII  199

Query  471  HASSPG  488
            HASSPG
Sbjct  200  HASSPG  205



>gb|KJB17034.1| hypothetical protein B456_002G261700 [Gossypium raimondii]
Length=352

 Score =   207 bits (527),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 115/126 (91%), Gaps = 1/126 (1%)
 Frame = +3

Query  114  SSKMTITEYREEEN-GSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLR  290
            +S++++ E +E++     P L++S+  S+PRRIALFVEPSPF+Y+SGYKNRFQNFIKYLR
Sbjct  79   ASELSVAEVKEDDGEDENPPLIDSENNSKPRRIALFVEPSPFSYVSGYKNRFQNFIKYLR  138

Query  291  EMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIV  470
            EMGDEVMVVTTHEGVP EFYGAKL+GS+SFPCPWY+KVPLSLALSPRIISEVA+FKPDI+
Sbjct  139  EMGDEVMVVTTHEGVPTEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIISEVARFKPDII  198

Query  471  HASSPG  488
            HASSPG
Sbjct  199  HASSPG  204



>ref|XP_008442461.1| PREDICTED: uncharacterized protein LOC103486318 [Cucumis melo]
Length=514

 Score =   211 bits (537),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 114/126 (90%), Gaps = 1/126 (1%)
 Frame = +3

Query  114  SSKMTITEYREEENG-SLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLR  290
            ++KMTI E R E+     P LL+ +  S+PRRIALFVEPSPFAY+SGYKNRFQNFI+YLR
Sbjct  77   ANKMTIAEVRPEDGEEDSPPLLDPETNSKPRRIALFVEPSPFAYVSGYKNRFQNFIRYLR  136

Query  291  EMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIV  470
            EMGDEVMVVTTHEGVP+EFYGAKL+GS+SFPCPWY+KVPLSLALSPRIISEVA+FKPDI+
Sbjct  137  EMGDEVMVVTTHEGVPKEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIISEVARFKPDII  196

Query  471  HASSPG  488
            HASSPG
Sbjct  197  HASSPG  202



>gb|KJB76912.1| hypothetical protein B456_012G112200 [Gossypium raimondii]
Length=403

 Score =   208 bits (529),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 111/122 (91%), Gaps = 3/122 (2%)
 Frame = +3

Query  123  MTITEYREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGD  302
            MTITE REEEN   P L++    S+ RRIALFVEPSPF+Y+SGYKNRFQNFI+YLREMGD
Sbjct  1    MTITEMREEEN---PPLIDPGNDSKHRRIALFVEPSPFSYVSGYKNRFQNFIRYLREMGD  57

Query  303  EVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASS  482
            EVMVVTTHEGVP+EFYGAKL+GS+SFPCPWY+ VPLSLALSPRIISEV+QFKPDI+HASS
Sbjct  58   EVMVVTTHEGVPQEFYGAKLVGSRSFPCPWYQNVPLSLALSPRIISEVSQFKPDIIHASS  117

Query  483  PG  488
            PG
Sbjct  118  PG  119



>ref|XP_002531354.1| glycosyltransferase, putative [Ricinus communis]
 gb|EEF31038.1| glycosyltransferase, putative [Ricinus communis]
Length=452

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 114/125 (91%), Gaps = 3/125 (2%)
 Frame = +3

Query  123  MTITEYREEENGSL---PLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLRE  293
            MTI E+REEE       P LL+S+  SRPRRIALFVEPSPFAY+SGYKNRFQNFI+YLRE
Sbjct  1    MTIREFREEEEEEEENPPPLLDSETNSRPRRIALFVEPSPFAYVSGYKNRFQNFIRYLRE  60

Query  294  MGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVH  473
            MGDEVMVVTTHEGVP+EFYGAKL+GS+SFPCPWY+KVPLSLALSPRIISEVA+FKPDI+H
Sbjct  61   MGDEVMVVTTHEGVPQEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIISEVARFKPDIIH  120

Query  474  ASSPG  488
            ASSPG
Sbjct  121  ASSPG  125



>ref|XP_009370203.1| PREDICTED: uncharacterized protein LOC103959579 [Pyrus x bretschneideri]
Length=512

 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 115/129 (89%), Gaps = 5/129 (4%)
 Frame = +3

Query  114  SSKMTITEY----REEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIK  281
            +S MTITE     +E E G  P + ES++ SRPRRIALFVEPSPFAY+SGYKNRFQNFI+
Sbjct  71   ASDMTITEVGLEEKEVEEGPPPYV-ESEINSRPRRIALFVEPSPFAYVSGYKNRFQNFIR  129

Query  282  YLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKP  461
            YLREMGDEVMVVTTHEGVP+EFYGAKL+GS+SFPCP Y+KVPLSLALSPRIISEVAQFKP
Sbjct  130  YLREMGDEVMVVTTHEGVPDEFYGAKLIGSRSFPCPLYQKVPLSLALSPRIISEVAQFKP  189

Query  462  DIVHASSPG  488
            DI+HASSPG
Sbjct  190  DIIHASSPG  198



>ref|XP_006363049.1| PREDICTED: uncharacterized protein LOC102604925 [Solanum tuberosum]
Length=506

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +3

Query  111  VSSKMTITEYREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLR  290
            +SSKMTITEYR+EE    P LL       PRRIALFVEPSPF+Y+SGYKNRFQNFIKYLR
Sbjct  69   ISSKMTITEYRDEEEEEYPPLLLESEMKEPRRIALFVEPSPFSYVSGYKNRFQNFIKYLR  128

Query  291  EMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIV  470
            EMGDEVMVVTTHEGVPEEFYGAKL+GS+SFPCP Y KVPLSLALSPRIISEVAQFKPDI+
Sbjct  129  EMGDEVMVVTTHEGVPEEFYGAKLIGSRSFPCPCYAKVPLSLALSPRIISEVAQFKPDII  188

Query  471  HASSPG  488
            HASSPG
Sbjct  189  HASSPG  194



>gb|KJB17032.1| hypothetical protein B456_002G261700 [Gossypium raimondii]
Length=490

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 115/126 (91%), Gaps = 1/126 (1%)
 Frame = +3

Query  114  SSKMTITEYREEEN-GSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLR  290
            +S++++ E +E++     P L++S+  S+PRRIALFVEPSPF+Y+SGYKNRFQNFIKYLR
Sbjct  79   ASELSVAEVKEDDGEDENPPLIDSENNSKPRRIALFVEPSPFSYVSGYKNRFQNFIKYLR  138

Query  291  EMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIV  470
            EMGDEVMVVTTHEGVP EFYGAKL+GS+SFPCPWY+KVPLSLALSPRIISEVA+FKPDI+
Sbjct  139  EMGDEVMVVTTHEGVPTEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIISEVARFKPDII  198

Query  471  HASSPG  488
            HASSPG
Sbjct  199  HASSPG  204



>ref|XP_006429312.1| hypothetical protein CICLE_v10011473mg [Citrus clementina]
 gb|ESR42552.1| hypothetical protein CICLE_v10011473mg [Citrus clementina]
 gb|KDO53237.1| hypothetical protein CISIN_1g009759mg [Citrus sinensis]
Length=526

 Score =   208 bits (530),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 115/126 (91%), Gaps = 3/126 (2%)
 Frame = +3

Query  117  SKMTITEYREEENGSLPLLLE--SDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLR  290
            S MTI+E RE+E  + PLL    ++  SRPRRIALFVEPSPF+Y+SGYKNRFQNFIKYLR
Sbjct  90   SNMTISEVREDEVEA-PLLDPEINENNSRPRRIALFVEPSPFSYVSGYKNRFQNFIKYLR  148

Query  291  EMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIV  470
            EMGDEVMVVTTHEGVP+EFYGAKL+GS+SFPCPWY+KVPLSLALSPRIISEVA+FKPDI+
Sbjct  149  EMGDEVMVVTTHEGVPQEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIISEVARFKPDII  208

Query  471  HASSPG  488
            HASSPG
Sbjct  209  HASSPG  214



>ref|XP_006480973.1| PREDICTED: uncharacterized protein LOC102615235 [Citrus sinensis]
Length=526

 Score =   208 bits (530),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 115/126 (91%), Gaps = 3/126 (2%)
 Frame = +3

Query  117  SKMTITEYREEENGSLPLLLE--SDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLR  290
            S MTI+E RE+E  + PLL    ++  SRPRRIALFVEPSPF+Y+SGYKNRFQNFIKYLR
Sbjct  90   SNMTISEVREDEVEA-PLLDPEINENNSRPRRIALFVEPSPFSYVSGYKNRFQNFIKYLR  148

Query  291  EMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIV  470
            EMGDEVMVVTTHEGVP+EFYGAKL+GS+SFPCPWY+KVPLSLALSPRIISEVA+FKPDI+
Sbjct  149  EMGDEVMVVTTHEGVPQEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIISEVARFKPDII  208

Query  471  HASSPG  488
            HASSPG
Sbjct  209  HASSPG  214



>ref|XP_004246336.1| PREDICTED: uncharacterized protein LOC101252422 [Solanum lycopersicum]
Length=506

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +3

Query  111  VSSKMTITEYREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLR  290
            +SSKMTITEYR+EE    P LL       PRRIALFVEPSPF+Y+SGYKNRFQNFIKYLR
Sbjct  69   ISSKMTITEYRDEEEEEYPPLLLESEMKEPRRIALFVEPSPFSYVSGYKNRFQNFIKYLR  128

Query  291  EMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIV  470
            EMGDEVMVVTTHEGVPEEFYGAKL+GS+SFPCP Y KVPLSLALSPRIISEVAQFKPDI+
Sbjct  129  EMGDEVMVVTTHEGVPEEFYGAKLIGSRSFPCPCYAKVPLSLALSPRIISEVAQFKPDII  188

Query  471  HASSPG  488
            HASSPG
Sbjct  189  HASSPG  194



>emb|CDP06508.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   206 bits (524),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +3

Query  123  MTITEYREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGD  302
            MTITEY EEE  S P LLES+M SRPRRIALF+EPSPF+Y+SGYKNRFQNFIKYLRE+GD
Sbjct  1    MTITEYMEEEEESPPPLLESEMNSRPRRIALFIEPSPFSYVSGYKNRFQNFIKYLRELGD  60

Query  303  EVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASS  482
            EVMVVTTHEGVP+EFYGAKL+GS+SFPCPWY+KVPLSLALSPRIISEVA+FKPDI+HASS
Sbjct  61   EVMVVTTHEGVPQEFYGAKLIGSRSFPCPWYKKVPLSLALSPRIISEVARFKPDIIHASS  120

Query  483  PG  488
            PG
Sbjct  121  PG  122



>gb|KJB17030.1| hypothetical protein B456_002G261700 [Gossypium raimondii]
Length=516

 Score =   207 bits (528),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 115/126 (91%), Gaps = 1/126 (1%)
 Frame = +3

Query  114  SSKMTITEYREEEN-GSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLR  290
            +S++++ E +E++     P L++S+  S+PRRIALFVEPSPF+Y+SGYKNRFQNFIKYLR
Sbjct  79   ASELSVAEVKEDDGEDENPPLIDSENNSKPRRIALFVEPSPFSYVSGYKNRFQNFIKYLR  138

Query  291  EMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIV  470
            EMGDEVMVVTTHEGVP EFYGAKL+GS+SFPCPWY+KVPLSLALSPRIISEVA+FKPDI+
Sbjct  139  EMGDEVMVVTTHEGVPTEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIISEVARFKPDII  198

Query  471  HASSPG  488
            HASSPG
Sbjct  199  HASSPG  204



>ref|XP_010678109.1| PREDICTED: uncharacterized protein LOC104893676 [Beta vulgaris 
subsp. vulgaris]
Length=503

 Score =   207 bits (527),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 113/123 (92%), Gaps = 1/123 (1%)
 Frame = +3

Query  120  KMTITEYREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMG  299
            KM I+E  + E   +P+L +++ TSRPRRIALFVEPSPFAY+SGYKNRFQNFIKYLREMG
Sbjct  70   KMAISELSQSEEEEIPILEDAE-TSRPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMG  128

Query  300  DEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHAS  479
            DEVMVVTTHEGVPEEFYGAKL+GS+SFPCPWY+KVPLSLALSPRIISEVA FKPDI+HAS
Sbjct  129  DEVMVVTTHEGVPEEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIISEVAAFKPDIIHAS  188

Query  480  SPG  488
            SPG
Sbjct  189  SPG  191



>gb|KDP24481.1| hypothetical protein JCGZ_25045 [Jatropha curcas]
Length=437

 Score =   205 bits (522),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 113/125 (90%), Gaps = 3/125 (2%)
 Frame = +3

Query  123  MTITEYREEENGSL---PLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLRE  293
            MTI E REEE       P LL+++  +RPRRIALFVEPSPFAY+SGYKNRFQNFI+YLRE
Sbjct  1    MTIREVREEEEEEEENPPPLLDAETNARPRRIALFVEPSPFAYVSGYKNRFQNFIRYLRE  60

Query  294  MGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVH  473
            MGDEVMVVTTHEGVP+EFYGAKL+GS+SFPCPWY+KVPLSLALSPRIISEVA+FKPDI+H
Sbjct  61   MGDEVMVVTTHEGVPQEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIISEVARFKPDIIH  120

Query  474  ASSPG  488
            ASSPG
Sbjct  121  ASSPG  125



>emb|CAB69850.1| putative protein [Arabidopsis thaliana]
Length=470

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 115/126 (91%), Gaps = 1/126 (1%)
 Frame = +3

Query  114  SSKMTITEYREEENGSLPL-LLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLR  290
            S+ MTIT+ RE++   +   LL+ +  S+PRRIALFVEPSPFAY+SGYKNRFQNFI+YLR
Sbjct  74   SNDMTITQVREDDESEIDAPLLDPESLSKPRRIALFVEPSPFAYVSGYKNRFQNFIRYLR  133

Query  291  EMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIV  470
            EMGDEV+VVTTHEGVPEEFYGA+++GS+SFPCP+Y+KVPLSLALSPRIISE+A+FKPDI+
Sbjct  134  EMGDEVIVVTTHEGVPEEFYGARVIGSRSFPCPYYQKVPLSLALSPRIISEIARFKPDII  193

Query  471  HASSPG  488
            HASSPG
Sbjct  194  HASSPG  199



>ref|XP_011094980.1| PREDICTED: uncharacterized protein LOC105174543 [Sesamum indicum]
Length=526

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = +3

Query  117  SKMTITEY-REEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLRE  293
            S MTI EY  EEE  + P LLES+M SRPRRIALFVEPSPFAY+SGYKNRFQNFIKYLRE
Sbjct  91   SNMTIREYGEEEEEENPPPLLESEMNSRPRRIALFVEPSPFAYVSGYKNRFQNFIKYLRE  150

Query  294  MGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVH  473
            MGDEVMVVTTHEGVPEEFYGAKL+GS+SFPCPWY+KVPLSLALSPRIIS VAQFKPDI+H
Sbjct  151  MGDEVMVVTTHEGVPEEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIISAVAQFKPDIIH  210

Query  474  ASSPG  488
            ASSPG
Sbjct  211  ASSPG  215



>ref|XP_009130666.1| PREDICTED: uncharacterized protein LOC103855432 [Brassica rapa]
Length=525

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 130/165 (79%), Gaps = 8/165 (5%)
 Frame = +3

Query  3    SSCSRAKNPSVLFFFFLGVKTQSLNLGLASTLWEFAVSSKMTITEYREEENGS---LPLL  173
            +SC R  +P  L    +  K+QS   GL       + SS MTITE R E + S    PLL
Sbjct  54   ASCPRRSSPVSL----IRRKSQSFFAGLEVVSASSSGSSGMTITEARGEGDESEIEAPLL  109

Query  174  LESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYG  353
             + +  S+PRRIALFVEPSPFAY+SGYKNRFQNFI+YLREMGDEV+VVTTHEGVPEEFYG
Sbjct  110  -DPESYSKPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVIVVTTHEGVPEEFYG  168

Query  354  AKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            AK++GS+SFPCP+Y+KVPLSLALSPRIISE+A+FKPDI+HASSPG
Sbjct  169  AKVIGSRSFPCPYYQKVPLSLALSPRIISEIARFKPDIIHASSPG  213



>ref|XP_002870938.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47197.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=518

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 115/126 (91%), Gaps = 1/126 (1%)
 Frame = +3

Query  114  SSKMTITEYREEENGSLPL-LLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLR  290
            S+ MTIT+ RE++   +   LL+ +  S+PRRIALFVEPSPFAY+SGYKNRFQNFI+YLR
Sbjct  82   SNDMTITQVREDDESEIEAPLLDPESLSKPRRIALFVEPSPFAYVSGYKNRFQNFIRYLR  141

Query  291  EMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIV  470
            EMGDEV+VVTTHEGVPEEFYGAK++GS+SFPCP+Y+KVPLSLALSPRIISE+A+FKPDI+
Sbjct  142  EMGDEVIVVTTHEGVPEEFYGAKVIGSRSFPCPYYQKVPLSLALSPRIISEIARFKPDII  201

Query  471  HASSPG  488
            HASSPG
Sbjct  202  HASSPG  207



>gb|KFK44566.1| hypothetical protein AALP_AA1G274200 [Arabis alpina]
Length=507

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 115/128 (90%), Gaps = 1/128 (1%)
 Frame = +3

Query  108  AVSSKMTITEYREEENGSLPL-LLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKY  284
            +VS  MTITE REE+   +   LL+ +  S+PRRIALFVEPSPFAY+SGYKNRFQNFI+Y
Sbjct  69   SVSKNMTITEVREEDESEIEAPLLDPESLSKPRRIALFVEPSPFAYVSGYKNRFQNFIRY  128

Query  285  LREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPD  464
            LREMGDEV+VVTT EGVPEEFYGAK++GS+SFPCP+Y+KVPLSLALSPRIISE+A+FKPD
Sbjct  129  LREMGDEVIVVTTQEGVPEEFYGAKVIGSKSFPCPFYQKVPLSLALSPRIISEIARFKPD  188

Query  465  IVHASSPG  488
            I+HASSPG
Sbjct  189  IIHASSPG  196



>emb|CDY11210.1| BnaA03g00460D [Brassica napus]
Length=534

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 130/165 (79%), Gaps = 8/165 (5%)
 Frame = +3

Query  3    SSCSRAKNPSVLFFFFLGVKTQSLNLGLASTLWEFAVSSKMTITEYREEENGS---LPLL  173
            +SC R  +P  L    +  K+QS   GL       + SS MTITE R E + S    PLL
Sbjct  54   ASCPRRSSPVSL----IRRKSQSFFAGLEVVSASSSGSSGMTITEARGEGDESEIEAPLL  109

Query  174  LESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYG  353
             + +  S+PRRIALFVEPSPFAY+SGYKNRFQNFI+YLREMGDEV+VVTTHEGVPEEFYG
Sbjct  110  -DPESYSKPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVIVVTTHEGVPEEFYG  168

Query  354  AKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            AK++GS+SFPCP+Y+KVPLSLALSPRIISE+A+FKPDI+HASSPG
Sbjct  169  AKVIGSRSFPCPYYQKVPLSLALSPRIISEIARFKPDIIHASSPG  213



>ref|XP_004137727.1| PREDICTED: GDP-mannose-dependent alpha-mannosyltransferase-like 
[Cucumis sativus]
 ref|XP_004156597.1| PREDICTED: GDP-mannose-dependent alpha-mannosyltransferase-like 
[Cucumis sativus]
 gb|KGN58788.1| hypothetical protein Csa_3G732460 [Cucumis sativus]
Length=515

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 113/126 (90%), Gaps = 1/126 (1%)
 Frame = +3

Query  114  SSKMTITEYREEENG-SLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLR  290
            ++KMTI E R E+     P LL+ +  S+PRRIALFVEPSPFAY+SGYKNRFQNFI+YLR
Sbjct  78   ANKMTIAEVRPEDGEEDSPPLLDPETNSKPRRIALFVEPSPFAYVSGYKNRFQNFIRYLR  137

Query  291  EMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIV  470
            EMGDEVMVVTTHEGVP+EFYGAKL+GS+SFPCP Y+KVPLSLALSPRIISEVA+FKPDI+
Sbjct  138  EMGDEVMVVTTHEGVPKEFYGAKLIGSRSFPCPLYQKVPLSLALSPRIISEVARFKPDII  197

Query  471  HASSPG  488
            HASSPG
Sbjct  198  HASSPG  203



>ref|XP_007205049.1| hypothetical protein PRUPE_ppa004263mg [Prunus persica]
 gb|EMJ06248.1| hypothetical protein PRUPE_ppa004263mg [Prunus persica]
Length=519

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 115/126 (91%), Gaps = 1/126 (1%)
 Frame = +3

Query  114  SSKMTITEYREEENGSLPL-LLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLR  290
            +S MTITE  +EE    P   ++S++ SRPRRIALFVEPSPFAY+SGYKNRFQNFI+YLR
Sbjct  80   ASNMTITEVEQEEEEEAPPPYVDSEINSRPRRIALFVEPSPFAYVSGYKNRFQNFIRYLR  139

Query  291  EMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIV  470
            EMGDEVMVVTTHEGVP+EFYGAKL+GS+SFPCPWY+KVPLSLALSPRIISEVAQFKPDI+
Sbjct  140  EMGDEVMVVTTHEGVPDEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIISEVAQFKPDII  199

Query  471  HASSPG  488
            HASSPG
Sbjct  200  HASSPG  205



>gb|KHG08972.1| GDP-mannose-dependent alpha-mannosyltransferase [Gossypium arboreum]
Length=516

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 115/126 (91%), Gaps = 1/126 (1%)
 Frame = +3

Query  114  SSKMTITEYREEEN-GSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLR  290
            +S +++ E +E++     P L++S+  ++PRRIALFVEPSPF+Y+SGYKNRFQNFIKYLR
Sbjct  79   ASGLSVAEVKEDDGEDENPPLIDSENNAKPRRIALFVEPSPFSYVSGYKNRFQNFIKYLR  138

Query  291  EMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIV  470
            EMGDEVMVVTTHEGVP+EFYGAKL+GS+SFPCPWY+KVPLSLALSPRIISEVA+FKPDI+
Sbjct  139  EMGDEVMVVTTHEGVPKEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIISEVARFKPDII  198

Query  471  HASSPG  488
            HASSPG
Sbjct  199  HASSPG  204



>ref|XP_010490595.1| PREDICTED: uncharacterized protein LOC104768346 [Camelina sativa]
Length=511

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 121/148 (82%), Gaps = 1/148 (1%)
 Frame = +3

Query  48   FLGVKTQSLNLGLASTLWEFAVSSKMTITEYREEENGSLPL-LLESDMTSRPRRIALFVE  224
            FL  KT+ +      +    + S  MTITE R++    +   LL+ +  S+PRRIALFVE
Sbjct  53   FLRNKTKLIRRDAVVSAVSASGSDDMTITEVRDDNESEIDAPLLDPESLSKPRRIALFVE  112

Query  225  PSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKV  404
            PSPFAY+SGYKNRFQNFI+YLREMGDEV+VVTTHEGVP+EFYGAK++GS+SFPCP+Y+KV
Sbjct  113  PSPFAYVSGYKNRFQNFIRYLREMGDEVIVVTTHEGVPDEFYGAKVIGSRSFPCPYYQKV  172

Query  405  PLSLALSPRIISEVAQFKPDIVHASSPG  488
            PLSLALSPRIISE+A+FKPDI+HASSPG
Sbjct  173  PLSLALSPRIISEIARFKPDIIHASSPG  200



>gb|AAK76635.1| unknown protein [Arabidopsis thaliana]
Length=434

 Score =   204 bits (518),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 113/123 (92%), Gaps = 1/123 (1%)
 Frame = +3

Query  123  MTITEYREEENGSLPL-LLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMG  299
            MTIT+ RE++   +   LL+ +  S+PRRIALFVEPSPFAY+SGYKNRFQNFI+YLREMG
Sbjct  1    MTITQVREDDESEIDAPLLDPESLSKPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMG  60

Query  300  DEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHAS  479
            DEV+VVTTHEGVPEEFYGA+++GS+SFPCP+Y+KVPLSLALSPRIISE+A+FKPDI+HAS
Sbjct  61   DEVIVVTTHEGVPEEFYGARVIGSRSFPCPYYQKVPLSLALSPRIISEIARFKPDIIHAS  120

Query  480  SPG  488
            SPG
Sbjct  121  SPG  123



>ref|NP_568085.2| sulfoquinovosyldiacylglycerol 2 [Arabidopsis thaliana]
 gb|AAM18913.1|AF454354_1 sulfolipid synthase [Arabidopsis thaliana]
 gb|AAO64198.1| unknown protein [Arabidopsis thaliana]
 gb|AED90311.1| sulfoquinovosyldiacylglycerol 2 [Arabidopsis thaliana]
 gb|AHL38652.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=510

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 115/126 (91%), Gaps = 1/126 (1%)
 Frame = +3

Query  114  SSKMTITEYREEENGSLPL-LLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLR  290
            S+ MTIT+ RE++   +   LL+ +  S+PRRIALFVEPSPFAY+SGYKNRFQNFI+YLR
Sbjct  74   SNDMTITQVREDDESEIDAPLLDPESLSKPRRIALFVEPSPFAYVSGYKNRFQNFIRYLR  133

Query  291  EMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIV  470
            EMGDEV+VVTTHEGVPEEFYGA+++GS+SFPCP+Y+KVPLSLALSPRIISE+A+FKPDI+
Sbjct  134  EMGDEVIVVTTHEGVPEEFYGARVIGSRSFPCPYYQKVPLSLALSPRIISEIARFKPDII  193

Query  471  HASSPG  488
            HASSPG
Sbjct  194  HASSPG  199



>emb|CBI30420.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   203 bits (517),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 93/100 (93%), Positives = 100/100 (100%), Gaps = 0/100 (0%)
 Frame = +3

Query  189  TSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMG  368
            TSRPRRIALFVEPSPFAY+SGYKNRFQNFI+YLREMGDEVMVVTTHEGVP+EFYGAKL+G
Sbjct  25   TSRPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPQEFYGAKLIG  84

Query  369  SQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            S+SFPCPWYRKVPLSLALSPRIISEVA+FKPDI+HASSPG
Sbjct  85   SRSFPCPWYRKVPLSLALSPRIISEVARFKPDIIHASSPG  124



>ref|XP_009593272.1| PREDICTED: uncharacterized protein LOC104089958 isoform X1 [Nicotiana 
tomentosiformis]
Length=505

 Score =   205 bits (521),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 114/127 (90%), Gaps = 3/127 (2%)
 Frame = +3

Query  108  AVSSKMTITEYREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYL  287
            A +S MTI   REEE    P  LES++TS+PRRIA+FVEPSPFAY+SGYKNRFQNFI+YL
Sbjct  71   ASNSNMTI---REEEEEGPPPFLESEITSKPRRIAIFVEPSPFAYVSGYKNRFQNFIRYL  127

Query  288  REMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDI  467
            REMGDEVMVVTTHEGVP+EFYGAKL+GS SFPCPWY+KVPLSLALSPRIISEV +FKPDI
Sbjct  128  REMGDEVMVVTTHEGVPQEFYGAKLIGSLSFPCPWYQKVPLSLALSPRIISEVKRFKPDI  187

Query  468  VHASSPG  488
            +HASSPG
Sbjct  188  IHASSPG  194



>ref|XP_008388188.1| PREDICTED: uncharacterized protein LOC103450599 [Malus domestica]
Length=514

 Score =   204 bits (520),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 113/128 (88%), Gaps = 3/128 (2%)
 Frame = +3

Query  114  SSKMTITEYREEENGSL---PLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKY  284
            +S MTITE  + E       P  +ES++ SRPRRIALFVEPSPFAY+SGYKNRFQNFI+Y
Sbjct  73   ASDMTITEVGQXEEEEEEGPPPYVESEINSRPRRIALFVEPSPFAYVSGYKNRFQNFIRY  132

Query  285  LREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPD  464
            LREMGDEVMVVTTHEGVP+EFYGAKL+GS+SFP PWY+KVPLSLALSPRIISEVAQFKPD
Sbjct  133  LREMGDEVMVVTTHEGVPDEFYGAKLIGSRSFPFPWYQKVPLSLALSPRIISEVAQFKPD  192

Query  465  IVHASSPG  488
            I+HASSPG
Sbjct  193  IIHASSPG  200



>ref|XP_010558362.1| PREDICTED: uncharacterized protein LOC104827042 [Tarenaya hassleriana]
Length=518

 Score =   205 bits (521),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 113/126 (90%), Gaps = 1/126 (1%)
 Frame = +3

Query  114  SSKMTITEYREEENGSLPL-LLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLR  290
            S+ MTITE  E  N  +   LL+S+M SRPRRIALFVEPSPF+YISGYKNRFQNFIKYLR
Sbjct  82   SNDMTITEVSEGGNEDIEAPLLDSEMVSRPRRIALFVEPSPFSYISGYKNRFQNFIKYLR  141

Query  291  EMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIV  470
            EMGDEV+VVTTHEGVP+EF+GAK++GS+SFPCP Y+ VPLSLALSPRIISEVA+FKPDI+
Sbjct  142  EMGDEVIVVTTHEGVPQEFHGAKVIGSRSFPCPLYQNVPLSLALSPRIISEVARFKPDII  201

Query  471  HASSPG  488
            HASSPG
Sbjct  202  HASSPG  207



>ref|XP_007026774.1| Sulfoquinovosyldiacylglycerol 2 [Theobroma cacao]
 gb|EOY07276.1| Sulfoquinovosyldiacylglycerol 2 [Theobroma cacao]
Length=518

 Score =   205 bits (521),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 116/128 (91%), Gaps = 3/128 (2%)
 Frame = +3

Query  114  SSKMTITEYREEENG---SLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKY  284
            +S+MTITE REEE G   S PL+   +  S PRRIALFVEPSPF+Y+SGYKNRFQNFI+Y
Sbjct  79   ASEMTITEVREEEEGGEESPPLIDSENKNSGPRRIALFVEPSPFSYVSGYKNRFQNFIRY  138

Query  285  LREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPD  464
            LREMGDEVMVVTTHEGVP+EFYGAKL+GS+SFPCPWY+KVPLSLALSPRIISEVA+FKPD
Sbjct  139  LREMGDEVMVVTTHEGVPQEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIISEVARFKPD  198

Query  465  IVHASSPG  488
            I+HASSPG
Sbjct  199  IIHASSPG  206



>gb|KHN31576.1| GDP-mannose-dependent alpha-mannosyltransferase [Glycine soja]
Length=441

 Score =   202 bits (515),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 110/128 (86%), Gaps = 2/128 (2%)
 Frame = +3

Query  105  FAVSSKMTITEYREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKY  284
             A  S + + E  EEE      LL+ +  SRPRRIALFVEPSPFAY+SGYKNRFQNFIKY
Sbjct  3    IATDSLLQVVE--EEEGPPDFALLDPEDNSRPRRIALFVEPSPFAYVSGYKNRFQNFIKY  60

Query  285  LREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPD  464
            LREMGDEVMVVTTHEGVP+EFYGAKL+GS+SFPCPWY+KVPLSLALSPRIIS VA+FKPD
Sbjct  61   LREMGDEVMVVTTHEGVPKEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIISAVAEFKPD  120

Query  465  IVHASSPG  488
            I+HASSPG
Sbjct  121  IIHASSPG  128



>ref|XP_009358856.1| PREDICTED: uncharacterized protein LOC103949460 [Pyrus x bretschneideri]
Length=514

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 112/128 (88%), Gaps = 3/128 (2%)
 Frame = +3

Query  114  SSKMTITEYREEENGSLPLLLE---SDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKY  284
            +S MTITE  +EE            S++ SRPRRIALFVEPSPFAY+SGYKNRFQNFI+Y
Sbjct  73   ASDMTITEVGQEEKEEEEGPPPYAESEINSRPRRIALFVEPSPFAYVSGYKNRFQNFIRY  132

Query  285  LREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPD  464
            LREMGDEVMVVTTHEGVP+EFYGAKL+GS+SFPCPWY+KVPLSLALSPRIISEVAQFKPD
Sbjct  133  LREMGDEVMVVTTHEGVPDEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIISEVAQFKPD  192

Query  465  IVHASSPG  488
            I+HASSPG
Sbjct  193  IIHASSPG  200



>gb|KHN46311.1| GDP-mannose-dependent alpha-mannosyltransferase [Glycine soja]
Length=441

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 109/128 (85%), Gaps = 6/128 (5%)
 Frame = +3

Query  123  MTITE------YREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKY  284
            MTI E        EEE      LL+ +  SRPRRIALFVEPSPFAY+SGYKNRFQNFIKY
Sbjct  1    MTIAEDSLLQVVEEEEGPPDFALLDPEDNSRPRRIALFVEPSPFAYVSGYKNRFQNFIKY  60

Query  285  LREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPD  464
            LREMGDEVMVVTTHEGVP+EFYGAKL+GS+SFPCPWY+KVPLSLALSPRIIS VA+FKPD
Sbjct  61   LREMGDEVMVVTTHEGVPKEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIISAVAEFKPD  120

Query  465  IVHASSPG  488
            I+HASSPG
Sbjct  121  IIHASSPG  128



>ref|XP_003516943.1| PREDICTED: uncharacterized protein LOC100780899 [Glycine max]
Length=523

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 115/138 (83%), Gaps = 2/138 (1%)
 Frame = +3

Query  75   NLGLASTLWEFAVSSKMTITEYREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGY  254
            +L L +T    A  S + + E  EEE      LL+ +  SRPRRIALFVEPSPFAY+SGY
Sbjct  75   SLVLCATNMTIAEDSLLQVVE--EEEGPPDFALLDPEDNSRPRRIALFVEPSPFAYVSGY  132

Query  255  KNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRI  434
            KNRFQNFIKYLREMGDEVMVVTTHEGVP+EFYGAKL+GS+SFPCPWY+KVPLSLALSPRI
Sbjct  133  KNRFQNFIKYLREMGDEVMVVTTHEGVPKEFYGAKLIGSRSFPCPWYQKVPLSLALSPRI  192

Query  435  ISEVAQFKPDIVHASSPG  488
            IS VA+FKPDI+HASSPG
Sbjct  193  ISAVAEFKPDIIHASSPG  210



>ref|XP_006287534.1| hypothetical protein CARUB_v10000742mg [Capsella rubella]
 gb|EOA20432.1| hypothetical protein CARUB_v10000742mg [Capsella rubella]
Length=514

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 115/126 (91%), Gaps = 1/126 (1%)
 Frame = +3

Query  114  SSKMTITEYREEENGSLPL-LLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLR  290
            S+ MT+T+ RE++   +   LL+ +  S+PRRIALFVEPSPFAY+SGYKNRFQNFI+YLR
Sbjct  78   SNDMTLTQAREDDESEIEAPLLDPESLSKPRRIALFVEPSPFAYVSGYKNRFQNFIRYLR  137

Query  291  EMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIV  470
            EMGDEV+VVTTHEGVP+EFYGAK++GS+SFPCP+Y+KVPLSLALSPRIISE+A+FKPDI+
Sbjct  138  EMGDEVIVVTTHEGVPDEFYGAKVIGSRSFPCPYYQKVPLSLALSPRIISEIARFKPDII  197

Query  471  HASSPG  488
            HASSPG
Sbjct  198  HASSPG  203



>ref|XP_003520926.1| PREDICTED: uncharacterized protein LOC100803792 [Glycine max]
Length=517

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 125/171 (73%), Gaps = 12/171 (7%)
 Frame = +3

Query  6    SCSRAKNPSVLFFFFLGVKTQSL----------NLGLASTLWEFAVSSKMTITEYREEEN  155
            SCS++  P  +  F    +  SL          +L L +     A  S + + E  EEE 
Sbjct  36   SCSQSFGPKAINPFCRKARFCSLQGSTSVKSRKSLVLCAINMTIATDSLLQVVE--EEEG  93

Query  156  GSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGV  335
                 LL+ +  SRPRRIALFVEPSPFAY+SGYKNRFQNFIKYLREMGDEVMVVTTHEGV
Sbjct  94   PPDFALLDPEDNSRPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGV  153

Query  336  PEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            P+EFYGAKL+GS+SFPCPWY+KVPLSLALSPRIIS VA+FKPDI+HASSPG
Sbjct  154  PKEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIISAVAEFKPDIIHASSPG  204



>ref|XP_010452011.1| PREDICTED: uncharacterized protein LOC104734184 [Camelina sativa]
Length=517

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 115/129 (89%), Gaps = 2/129 (2%)
 Frame = +3

Query  108  AVSSKMTITEYRE--EENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIK  281
            + S  MTITE R+  EE+     LL+ +  S+PRRIALFVEPSPFAY+SGYKNRFQNFI+
Sbjct  78   SASDDMTITEVRDDDEESEIEAPLLDPESLSKPRRIALFVEPSPFAYVSGYKNRFQNFIR  137

Query  282  YLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKP  461
            YLREMGDEV+VVTTHEGVP+EFYGAK++GS+SFPCP+Y+KVPLSLALSPRIISE+A+FKP
Sbjct  138  YLREMGDEVIVVTTHEGVPDEFYGAKVIGSRSFPCPYYQKVPLSLALSPRIISEIARFKP  197

Query  462  DIVHASSPG  488
            DI+HASSPG
Sbjct  198  DIIHASSPG  206



>ref|XP_002278868.2| PREDICTED: uncharacterized protein LOC100259616 [Vitis vinifera]
Length=519

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/100 (93%), Positives = 100/100 (100%), Gaps = 0/100 (0%)
 Frame = +3

Query  189  TSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMG  368
            TSRPRRIALFVEPSPFAY+SGYKNRFQNFI+YLREMGDEVMVVTTHEGVP+EFYGAKL+G
Sbjct  108  TSRPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPQEFYGAKLIG  167

Query  369  SQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            S+SFPCPWYRKVPLSLALSPRIISEVA+FKPDI+HASSPG
Sbjct  168  SRSFPCPWYRKVPLSLALSPRIISEVARFKPDIIHASSPG  207



>emb|CAN62120.1| hypothetical protein VITISV_037025 [Vitis vinifera]
Length=497

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/100 (93%), Positives = 100/100 (100%), Gaps = 0/100 (0%)
 Frame = +3

Query  189  TSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMG  368
            TSRPRRIALFVEPSPFAY+SGYKNRFQNFI+YLREMGDEVMVVTTHEGVP+EFYGAKL+G
Sbjct  25   TSRPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPQEFYGAKLIG  84

Query  369  SQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            S+SFPCPWYRKVPLSLALSPRIISEVA+FKPDI+HASSPG
Sbjct  85   SRSFPCPWYRKVPLSLALSPRIISEVARFKPDIIHASSPG  124



>ref|NP_001266888.1| uncharacterized protein LOC101027242 [Zea mays]
 gb|ACR37973.1| unknown [Zea mays]
 tpg|DAA59316.1| TPA: hypothetical protein ZEAMMB73_291487 [Zea mays]
Length=206

 Score =   194 bits (494),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  177  ESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGA  356
            E+   SRPRRIALFVEPSPFAY+SGYKNRFQNFIKYLREMGDEV+VVTTHEGVP+EF+GA
Sbjct  76   EAPPESRPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVVTTHEGVPQEFHGA  135

Query  357  KLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            KL+GS SFPCPWY+KVPLSLALSPRII+EVA+FKPDI+HASSPG
Sbjct  136  KLIGSWSFPCPWYQKVPLSLALSPRIIAEVARFKPDIIHASSPG  179



>gb|EYU41861.1| hypothetical protein MIMGU_mgv1a004551mg [Erythranthe guttata]
Length=521

 Score =   203 bits (516),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +3

Query  165  PLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEE  344
            P ++ES++ SRPRRIALFVEPSPFAY+SGYKNRFQNFI+YLREMGDEVMVVTTHEGVP+E
Sbjct  101  PPMVESEINSRPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPQE  160

Query  345  FYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            FYGA+L+GS+SFPCPWY+KVPLSLALSPRIIS VA+FKPDI+HASSPG
Sbjct  161  FYGAQLIGSRSFPCPWYQKVPLSLALSPRIISAVAKFKPDIIHASSPG  208



>ref|XP_008800789.1| PREDICTED: uncharacterized protein LOC103715059 [Phoenix dactylifera]
Length=503

 Score =   202 bits (514),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 115/128 (90%), Gaps = 1/128 (1%)
 Frame = +3

Query  108  AVSSKMTITEYREEENGSLPLLLE-SDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKY  284
            A + KMTI E +E+E    P LLE ++  SRPRRIALFVEPSPFAY+SGYKNRFQNFIKY
Sbjct  64   ASARKMTIEEIKEQEVEEAPPLLEDAEANSRPRRIALFVEPSPFAYVSGYKNRFQNFIKY  123

Query  285  LREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPD  464
            LREMGDEV+VVTTH+GVP+EF+GAKL+GS SFPCPWY+KVPLSLALSPRIISEVA+FKPD
Sbjct  124  LREMGDEVIVVTTHKGVPQEFHGAKLIGSWSFPCPWYQKVPLSLALSPRIISEVAKFKPD  183

Query  465  IVHASSPG  488
            I+HASSPG
Sbjct  184  IIHASSPG  191



>emb|CDY10486.1| BnaCnng03870D [Brassica napus]
Length=417

 Score =   200 bits (509),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +3

Query  153  NGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEG  332
            +G    LL+ +  S+PRRIALFVEPSPFAY+SGYKNRFQNFI+YLREMGDEV+VVTTHEG
Sbjct  10   DGDEAPLLDPESYSKPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVIVVTTHEG  69

Query  333  VPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            VPEEFYGAK++GS+SFPCPWY+KVPLSLALSPRIISE+A+FKPDI+HASSPG
Sbjct  70   VPEEFYGAKVIGSKSFPCPWYQKVPLSLALSPRIISEIARFKPDIIHASSPG  121



>emb|CDX80782.1| BnaC03g00360D [Brassica napus]
Length=426

 Score =   201 bits (510),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 112/125 (90%), Gaps = 4/125 (3%)
 Frame = +3

Query  123  MTITEYR---EEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLRE  293
            MTITE R   EE     PLL + +  S+PRRIALFVEPSPFAY+SGYKNRFQNFI+YLRE
Sbjct  1    MTITEARGEGEESEIEAPLL-DPESYSKPRRIALFVEPSPFAYVSGYKNRFQNFIRYLRE  59

Query  294  MGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVH  473
            MGDEV+VVTTHEGVPEEFYGAK++GS+SFPCP+Y+KVPLSLALSPRIISE+A+FKPDI+H
Sbjct  60   MGDEVIVVTTHEGVPEEFYGAKVIGSRSFPCPYYQKVPLSLALSPRIISEIARFKPDIIH  119

Query  474  ASSPG  488
            ASSPG
Sbjct  120  ASSPG  124



>ref|XP_010424824.1| PREDICTED: uncharacterized protein LOC104709996 [Camelina sativa]
Length=666

 Score =   205 bits (522),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 114/126 (90%), Gaps = 1/126 (1%)
 Frame = +3

Query  114  SSKMTITEYREEENGSLPL-LLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLR  290
            S  MTITE R+++   +   LL+ +  S+PRRIALFVEPSPFAY+SGYKNRFQNFI+YLR
Sbjct  90   SDDMTITEVRDDDESEIEAPLLDPESLSKPRRIALFVEPSPFAYVSGYKNRFQNFIRYLR  149

Query  291  EMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIV  470
            EMGDEV+VVTTHEGVP+EFYGAK++GS+SFPCP+Y+KVPLSLALSPRIISE+A+FKPDI+
Sbjct  150  EMGDEVIVVTTHEGVPDEFYGAKVIGSRSFPCPYYQKVPLSLALSPRIISEIARFKPDII  209

Query  471  HASSPG  488
            HASSPG
Sbjct  210  HASSPG  215


 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 5/60 (8%)
 Frame = +3

Query  324  HEGVPEEFYGAKLMGSQ-----SFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            ++GV  E +  +    +     SFPCP+Y+KVPLSLALSPRIISE+A+FKPDI+HASSPG
Sbjct  296  NKGVDSESFNPRFRSQEMRIRLSFPCPYYQKVPLSLALSPRIISEIARFKPDIIHASSPG  355



>ref|XP_003604630.1| Glycogen synthase [Medicago truncatula]
 gb|AES86827.1| group 1 family glycosyltransferase [Medicago truncatula]
Length=510

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 114/130 (88%), Gaps = 6/130 (5%)
 Frame = +3

Query  114  SSKMTITE-----YREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFI  278
            ++KMTI E      R+EE G  P  + +D+ S+PRRIALFVEPSPF+Y+SGYKNRFQNFI
Sbjct  72   ATKMTIDEESLLNSRDEEEGP-PDSVLNDIHSKPRRIALFVEPSPFSYVSGYKNRFQNFI  130

Query  279  KYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFK  458
            KYLREMGDEVMVVTTHEGVP+EFYGA+L+GS+SFP PWY+KVPLSLALSPRIIS VAQFK
Sbjct  131  KYLREMGDEVMVVTTHEGVPKEFYGAQLIGSKSFPFPWYQKVPLSLALSPRIISAVAQFK  190

Query  459  PDIVHASSPG  488
            PDI+HASSPG
Sbjct  191  PDIIHASSPG  200



>ref|XP_007133940.1| hypothetical protein PHAVU_010G005100g [Phaseolus vulgaris]
 gb|ESW05934.1| hypothetical protein PHAVU_010G005100g [Phaseolus vulgaris]
Length=529

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 102/106 (96%), Gaps = 0/106 (0%)
 Frame = +3

Query  171  LLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFY  350
            LL+ +  SRPRRIALFVEPSPFAY+SGYKNRFQNFIKYLREMGDEVMVVTTHEGVP+EF+
Sbjct  107  LLDPESNSRPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPKEFH  166

Query  351  GAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            GAKL+GS+SFPCPWY+KVPLSLALSPRIIS VAQFKPDI+HASSPG
Sbjct  167  GAKLIGSRSFPCPWYQKVPLSLALSPRIISAVAQFKPDIIHASSPG  212



>ref|XP_002323560.1| SULFOQUINOVOSYLDIACYLGLYCEROL 2 family protein [Populus trichocarpa]
 gb|EEF05321.1| SULFOQUINOVOSYLDIACYLGLYCEROL 2 family protein [Populus trichocarpa]
Length=429

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 108/122 (89%), Gaps = 2/122 (2%)
 Frame = +3

Query  123  MTITEYREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGD  302
            MT  E  E+E    P  L+ +  SRPRRIALFVEPSPFAY+SGYKNRFQNFIK+LREMGD
Sbjct  1    MTRGEVGEDEEN--PPFLDYETISRPRRIALFVEPSPFAYVSGYKNRFQNFIKFLREMGD  58

Query  303  EVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASS  482
            EVMVVTTHEGVP+EFYGAKL+GS+SFP PWY+KVPLSLALSPRIISEVA+FKPDI+HASS
Sbjct  59   EVMVVTTHEGVPQEFYGAKLIGSRSFPFPWYQKVPLSLALSPRIISEVARFKPDIIHASS  118

Query  483  PG  488
            PG
Sbjct  119  PG  120



>ref|XP_008239560.1| PREDICTED: uncharacterized protein LOC103338145 [Prunus mume]
Length=519

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 114/126 (90%), Gaps = 1/126 (1%)
 Frame = +3

Query  114  SSKMTITEYREEENG-SLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLR  290
            +S MTITE  +EE     P  ++S++ SRPRRIALFVEPSPFAY+SGYKNRFQNFI+YLR
Sbjct  80   ASNMTITEVEQEEEEEGPPPYVDSEINSRPRRIALFVEPSPFAYVSGYKNRFQNFIRYLR  139

Query  291  EMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIV  470
            EMGDEVMVVTTHEGVP+EFYGAKL+GS+SFP PWY+KVPLSLALSPRIISEVAQFKPDI+
Sbjct  140  EMGDEVMVVTTHEGVPDEFYGAKLIGSRSFPFPWYQKVPLSLALSPRIISEVAQFKPDII  199

Query  471  HASSPG  488
            HASSPG
Sbjct  200  HASSPG  205



>ref|XP_006848130.1| hypothetical protein AMTR_s00029p00223030 [Amborella trichopoda]
 gb|ERN09711.1| hypothetical protein AMTR_s00029p00223030 [Amborella trichopoda]
Length=274

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 97/98 (99%), Gaps = 0/98 (0%)
 Frame = +3

Query  195  RPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQ  374
            +PRRIALFVEPSPFAY+SGYKNRFQNFIKYLREMGDEV+VVTTHEGVP+EFYGAKL+GS 
Sbjct  29   KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVVTTHEGVPQEFYGAKLIGSW  88

Query  375  SFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            SFPCPWY+KVPLSLALSPRIISEVA+FKPDI+HASSPG
Sbjct  89   SFPCPWYQKVPLSLALSPRIISEVAKFKPDIIHASSPG  126



>ref|XP_011047417.1| PREDICTED: uncharacterized protein LOC105141768 isoform X1 [Populus 
euphratica]
 ref|XP_011047418.1| PREDICTED: uncharacterized protein LOC105141768 isoform X1 [Populus 
euphratica]
 ref|XP_011047419.1| PREDICTED: uncharacterized protein LOC105141768 isoform X1 [Populus 
euphratica]
Length=429

 Score =   198 bits (504),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 108/122 (89%), Gaps = 2/122 (2%)
 Frame = +3

Query  123  MTITEYREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGD  302
            MT  E  E+E    P  L+ +  SRPRRIALFVEPSPFAY+SGYKNRFQNFIK+LREMGD
Sbjct  1    MTRGEVGEDEEN--PPFLDYETISRPRRIALFVEPSPFAYVSGYKNRFQNFIKFLREMGD  58

Query  303  EVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASS  482
            EV+VVTTHEGVP+EFYGAKL+GS+SFP PWY+KVPLSLALSPRIISEVA+FKPDI+HASS
Sbjct  59   EVLVVTTHEGVPQEFYGAKLIGSRSFPFPWYQKVPLSLALSPRIISEVARFKPDIIHASS  118

Query  483  PG  488
            PG
Sbjct  119  PG  120



>ref|XP_010256624.1| PREDICTED: uncharacterized protein LOC104596978 [Nelumbo nucifera]
Length=509

 Score =   200 bits (508),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 108/126 (86%), Gaps = 1/126 (1%)
 Frame = +3

Query  114  SSKMTITEYREE-ENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLR  290
             + M ITE  EE E    P+  E++  S+PRRI LFVEPSPFAY+SGYKNRFQNFIK+LR
Sbjct  72   DNNMAITEVNEEKEEQGPPVSEETEGISKPRRIVLFVEPSPFAYVSGYKNRFQNFIKHLR  131

Query  291  EMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIV  470
            EMGDEVMVVTTHEGVP EFYGAKL+GS+SFPCPWY+KVPLSLALSPRII EVA+F PDI+
Sbjct  132  EMGDEVMVVTTHEGVPREFYGAKLIGSRSFPCPWYQKVPLSLALSPRIILEVARFNPDII  191

Query  471  HASSPG  488
            HASSPG
Sbjct  192  HASSPG  197



>emb|CDX97820.1| BnaC04g41190D [Brassica napus]
Length=441

 Score =   198 bits (504),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +3

Query  153  NGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEG  332
            +G    LL+ +  S+PRRIALFVEPSPFAY+SGYKNRFQNFI+YLREMGDEV+VVTTHEG
Sbjct  10   DGDEAPLLDPESYSKPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVIVVTTHEG  69

Query  333  VPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            VPEEFYGAK++GS+SFPCPWY+KVPLSLALSPRIISE+A+F PDI+HASSPG
Sbjct  70   VPEEFYGAKVIGSKSFPCPWYQKVPLSLALSPRIISEIARFNPDIIHASSPG  121



>ref|XP_010909645.1| PREDICTED: uncharacterized protein LOC105035694 [Elaeis guineensis]
Length=544

 Score =   200 bits (509),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +3

Query  165  PLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEE  344
            PLL  ++  S+PRRIALFVEPSPFAY+SGYKNRFQNFIKYLREMGDEV+VVTTHEGVP+E
Sbjct  125  PLLEAAEANSKPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVVTTHEGVPQE  184

Query  345  FYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            F+GAKL+GS SFPCPWY+KVPLSLALSPRIISEVA+FKPDI+HASSPG
Sbjct  185  FHGAKLIGSWSFPCPWYQKVPLSLALSPRIISEVAKFKPDIIHASSPG  232



>gb|ABA55726.1| sulfoquinovosyldiacylglycerol synthase type 2 [Vigna unguiculata]
Length=523

 Score =   199 bits (507),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 111/131 (85%), Gaps = 6/131 (5%)
 Frame = +3

Query  114  SSKMTITE-----YREEENGSLPL-LLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNF  275
            +++MTI E       EEE G     LL+ +  SRPRRIALFVEPSPFAY+SGYKNRFQN 
Sbjct  81   ATEMTIAEDCLLEAVEEEEGPPDFSLLDPESNSRPRRIALFVEPSPFAYVSGYKNRFQNS  140

Query  276  IKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQF  455
            IKYLREMGDEVMVVTTHEG P+EF+GAKL+GS+SFPCPWY+KVPLSLALSPRIIS VAQF
Sbjct  141  IKYLREMGDEVMVVTTHEGAPKEFHGAKLIGSRSFPCPWYQKVPLSLALSPRIISAVAQF  200

Query  456  KPDIVHASSPG  488
            KPDI+HASSPG
Sbjct  201  KPDIIHASSPG  211



>ref|XP_004506782.1| PREDICTED: GDP-mannose-dependent alpha-mannosyltransferase-like 
[Cicer arietinum]
Length=512

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 111/131 (85%), Gaps = 6/131 (5%)
 Frame = +3

Query  114  SSKMTITE------YREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNF  275
            S+KMTI +        EEE     +L +++  SRPRRIALFVEPSPF+Y+SGYKNRFQNF
Sbjct  72   STKMTIDDDSLLNSRDEEECPPDSVLYDTENNSRPRRIALFVEPSPFSYVSGYKNRFQNF  131

Query  276  IKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQF  455
            IKYLREMGDEVMVVTTHEGVP+EFYGA L+GS+SFP PWY+KVPLSLALSPRIIS VAQF
Sbjct  132  IKYLREMGDEVMVVTTHEGVPKEFYGAHLIGSKSFPFPWYQKVPLSLALSPRIISAVAQF  191

Query  456  KPDIVHASSPG  488
            KPDI+HASSPG
Sbjct  192  KPDIIHASSPG  202



>ref|XP_004302644.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase 
GPI3 subunit [Fragaria vesca subsp. vesca]
Length=505

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  180  SDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAK  359
            S+  SRPRRIALFVEPSPFAY+SGYKNRFQNFI+YLREMGDEVMVVTTHEGVPEEFYGAK
Sbjct  89   SESNSRPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPEEFYGAK  148

Query  360  LMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
             +GS+SFPCPWY+ VPLSLALSPRIISEVA FKPDI+HASSPG
Sbjct  149  CIGSRSFPCPWYQNVPLSLALSPRIISEVANFKPDIIHASSPG  191



>ref|XP_006657378.1| PREDICTED: uncharacterized protein LOC102710508 [Oryza brachyantha]
Length=471

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  180  SDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAK  359
            S + SRPRRIALFVEPSPFAY+SGYKNRFQNFIKYLREMGDEV+V+TTHEGVP+EFYGAK
Sbjct  53   SPLDSRPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVITTHEGVPQEFYGAK  112

Query  360  LMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            L+GS SFPCPWY+KVPLSLALSPRII EVA+FKPDI+HASSPG
Sbjct  113  LIGSWSFPCPWYQKVPLSLALSPRIIGEVARFKPDIIHASSPG  155



>ref|XP_009787548.1| PREDICTED: uncharacterized protein LOC104235470 [Nicotiana sylvestris]
Length=506

 Score =   197 bits (501),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 115/127 (91%), Gaps = 3/127 (2%)
 Frame = +3

Query  108  AVSSKMTITEYREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYL  287
            A +S MTI   REEE    P LLES+++S+PRRIA+FVEPSPFAY+SGYKNRFQNFI+YL
Sbjct  72   ASNSNMTI---REEEEEGPPPLLESEISSKPRRIAIFVEPSPFAYVSGYKNRFQNFIRYL  128

Query  288  REMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDI  467
            REMGDEVMVVTTHEGVP+EFYGAKL+GS SFPCPWY+KVPLSLALSPRIISEV +FKPDI
Sbjct  129  REMGDEVMVVTTHEGVPQEFYGAKLIGSLSFPCPWYQKVPLSLALSPRIISEVKRFKPDI  188

Query  468  VHASSPG  488
            +HASSPG
Sbjct  189  IHASSPG  195



>emb|CDY40312.1| BnaA10g27560D [Brassica napus]
Length=514

 Score =   197 bits (501),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +3

Query  153  NGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEG  332
            +G    LL+ +  S+PRRIALFVEPSPFAY+SGYKNRFQNFI+YLREMGDEV+VVTTHEG
Sbjct  88   DGDEAPLLDPESYSKPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVIVVTTHEG  147

Query  333  VPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            VP+EFYGAK++GS+SFPCPWY+KVPLSLALSPRIISE+A+F PDI+HASSPG
Sbjct  148  VPQEFYGAKVIGSRSFPCPWYQKVPLSLALSPRIISEIARFNPDIIHASSPG  199



>ref|XP_009407545.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase 
GPI3 subunit-like [Musa acuminata subsp. malaccensis]
Length=507

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 104/109 (95%), Gaps = 1/109 (1%)
 Frame = +3

Query  165  PLLLES-DMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPE  341
            P++LE  +  S+PRRIALFVEPSPFAYISGYKNRFQNFIK+LREMGDEV+VVTTHEGVP+
Sbjct  87   PMILEDQEGNSKPRRIALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVIVVTTHEGVPQ  146

Query  342  EFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            EFYGAK++GS SFPCPWY+KVPLSLALSPRIISEVA+FKPDI+HASSPG
Sbjct  147  EFYGAKVIGSWSFPCPWYQKVPLSLALSPRIISEVAKFKPDIIHASSPG  195



>gb|KHN24299.1| GDP-mannose-dependent alpha-mannosyltransferase [Glycine soja]
Length=437

 Score =   195 bits (495),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 108/125 (86%), Gaps = 3/125 (2%)
 Frame = +3

Query  123  MTITE---YREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLRE  293
            MT+ E   + E EN    +  E++  SRPRRIALFVEPSPFAY+SGYKNRFQNFI+ LRE
Sbjct  1    MTMAEVDSHEEGENEGALVGSENENNSRPRRIALFVEPSPFAYVSGYKNRFQNFIRCLRE  60

Query  294  MGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVH  473
            MGDEVMVVTTHEGVP+EFYGAKL+GS SFPCP Y+KVPLSLALSPRIISEVA+FKPDI+H
Sbjct  61   MGDEVMVVTTHEGVPQEFYGAKLIGSWSFPCPLYQKVPLSLALSPRIISEVARFKPDIIH  120

Query  474  ASSPG  488
            ASSPG
Sbjct  121  ASSPG  125



>gb|EYU26645.1| hypothetical protein MIMGU_mgv1a004620mg [Erythranthe guttata]
Length=518

 Score =   197 bits (500),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 115/128 (90%), Gaps = 2/128 (2%)
 Frame = +3

Query  111  VSSKMTITEYREEENGSL-PL-LLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKY  284
            VSS M+ITE+ EEE     PL L+E ++ S+PRRIALFVEPSPFAY+SGYKNRFQNFIKY
Sbjct  78   VSSDMSITEHSEEEEEKENPLPLVECEINSKPRRIALFVEPSPFAYVSGYKNRFQNFIKY  137

Query  285  LREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPD  464
            LREMGDEVMVVTTHEGVP+EF+GA+++GS+SFPCP Y KVPLSLALSPRIIS VAQFKPD
Sbjct  138  LREMGDEVMVVTTHEGVPQEFHGAQIIGSRSFPCPLYEKVPLSLALSPRIISAVAQFKPD  197

Query  465  IVHASSPG  488
            I+HASSPG
Sbjct  198  IIHASSPG  205



>ref|XP_006338993.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase 
GPI3 subunit-like [Solanum tuberosum]
Length=503

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 102/103 (99%), Gaps = 0/103 (0%)
 Frame = +3

Query  180  SDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAK  359
            S+M+S+PRRIA+FVEPSPF+Y+SGYKNRFQNFI+YLREMGDEVMVVTTHEGVP+EFYGAK
Sbjct  91   SEMSSKPRRIAIFVEPSPFSYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPQEFYGAK  150

Query  360  LMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            L+GS+SFPCP Y+KVPLSLALSPRIISEVA+FKPDI+HASSPG
Sbjct  151  LIGSRSFPCPLYQKVPLSLALSPRIISEVARFKPDIIHASSPG  193



>ref|XP_003561543.1| PREDICTED: uncharacterized protein LOC100842407 isoform X2 [Brachypodium 
distachyon]
Length=482

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +3

Query  150  ENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHE  329
            ++G  P    S+  SRPRRIALFVEPSPFAY+SGYKNRFQNFIKYLREMGDEV+VVTTHE
Sbjct  58   DDGDEPPPPTSEADSRPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVVTTHE  117

Query  330  GVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            GVP EF+GAKL+GS SFPCPWY KVPLSLALSPRII EVA+FKPDI+HASSPG
Sbjct  118  GVPAEFHGAKLVGSWSFPCPWYNKVPLSLALSPRIIGEVARFKPDIIHASSPG  170



>gb|EEE66415.1| hypothetical protein OsJ_22761 [Oryza sativa Japonica Group]
Length=443

 Score =   194 bits (494),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  180  SDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAK  359
            + + SRPRRIALFVEPSPFAY+SGYKNRF NFIKYLREMGDEV+V+TTHEGVP+EFYGAK
Sbjct  61   ASLDSRPRRIALFVEPSPFAYVSGYKNRFLNFIKYLREMGDEVIVITTHEGVPQEFYGAK  120

Query  360  LMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            L+GS SFPCPWY+KVPLSLALSPRII EVA+FKPDI+HASSPG
Sbjct  121  LIGSWSFPCPWYQKVPLSLALSPRIIGEVARFKPDIIHASSPG  163



>ref|XP_003552228.1| PREDICTED: uncharacterized protein LOC100807850 isoform X1 [Glycine 
max]
Length=515

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 115/141 (82%), Gaps = 7/141 (5%)
 Frame = +3

Query  87   ASTLW---EFAVSS-KMTITE---YREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYI  245
            + TLW    F + +  MT+ E   + E EN    +  E++  SRPRRIALFVEPSPFAY+
Sbjct  63   SKTLWGRKSFVLGAGNMTMAEVDSHEEGENEGALVGSENENNSRPRRIALFVEPSPFAYV  122

Query  246  SGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALS  425
            SGYKNRFQNFI+ LREMGDEVMVVTTHEGVP+EFYGAKL+GS SFPCP Y+KVPLSLALS
Sbjct  123  SGYKNRFQNFIRCLREMGDEVMVVTTHEGVPQEFYGAKLIGSWSFPCPLYQKVPLSLALS  182

Query  426  PRIISEVAQFKPDIVHASSPG  488
            PRIISEVA+FKPDI+HASSPG
Sbjct  183  PRIISEVARFKPDIIHASSPG  203



>gb|EMS55944.1| GDP-mannose-dependent alpha-mannosyltransferase [Triticum urartu]
Length=493

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  180  SDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAK  359
            S+  SRPRRIALFVEPSPFAY+SGYKNRFQNFIKYLREMGDEV+V+TTHEGVP+EF+GAK
Sbjct  79   SEADSRPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVITTHEGVPDEFHGAK  138

Query  360  LMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            L+GS SFPCPWY+KVPLSLALSPRII EVA+FKPDI+HASSPG
Sbjct  139  LIGSWSFPCPWYQKVPLSLALSPRIIGEVARFKPDIIHASSPG  181



>dbj|BAJ85864.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=499

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  180  SDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAK  359
            S+  SRPRRIALFVEPSPFAY+SGYKNRFQNFIKYLREMGDEV+V+TTHEGVP+EF+GAK
Sbjct  79   SEADSRPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVITTHEGVPDEFHGAK  138

Query  360  LMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            L+GS SFPCPWY+KVPLSLALSPRII EVA+FKPDI+HASSPG
Sbjct  139  LIGSWSFPCPWYQKVPLSLALSPRIIGEVARFKPDIIHASSPG  181



>ref|XP_006602643.1| PREDICTED: uncharacterized protein LOC100807850 isoform X2 [Glycine 
max]
Length=543

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 115/141 (82%), Gaps = 7/141 (5%)
 Frame = +3

Query  87   ASTLW---EFAVSS-KMTITE---YREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYI  245
            + TLW    F + +  MT+ E   + E EN    +  E++  SRPRRIALFVEPSPFAY+
Sbjct  63   SKTLWGRKSFVLGAGNMTMAEVDSHEEGENEGALVGSENENNSRPRRIALFVEPSPFAYV  122

Query  246  SGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALS  425
            SGYKNRFQNFI+ LREMGDEVMVVTTHEGVP+EFYGAKL+GS SFPCP Y+KVPLSLALS
Sbjct  123  SGYKNRFQNFIRCLREMGDEVMVVTTHEGVPQEFYGAKLIGSWSFPCPLYQKVPLSLALS  182

Query  426  PRIISEVAQFKPDIVHASSPG  488
            PRIISEVA+FKPDI+HASSPG
Sbjct  183  PRIISEVARFKPDIIHASSPG  203



>ref|XP_008650830.1| PREDICTED: uncharacterized protein LOC100192061 isoform X2 [Zea 
mays]
 gb|ACN35313.1| unknown [Zea mays]
 tpg|DAA59317.1| TPA: hypothetical protein ZEAMMB73_291487 [Zea mays]
Length=497

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  177  ESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGA  356
            E+   SRPRRIALFVEPSPFAY+SGYKNRFQNFIKYLREMGDEV+VVTTHEGVP+EF+GA
Sbjct  76   EAPPESRPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVVTTHEGVPQEFHGA  135

Query  357  KLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            KL+GS SFPCPWY+KVPLSLALSPRII+EVA+FKPDI+HASSPG
Sbjct  136  KLIGSWSFPCPWYQKVPLSLALSPRIIAEVARFKPDIIHASSPG  179



>gb|EMT15547.1| Putative glycosyltransferase [Aegilops tauschii]
Length=509

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  180  SDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAK  359
            S+  SRPRRIALFVEPSPFAY+SGYKNRFQNFIKYLREMGDEV+V+TTHEGVP+EF+GAK
Sbjct  77   SEADSRPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVITTHEGVPDEFHGAK  136

Query  360  LMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            L+GS SFPCPWY+KVPLSLALSPRII EVA+FKPDI+HASSPG
Sbjct  137  LIGSWSFPCPWYQKVPLSLALSPRIIGEVARFKPDIIHASSPG  179



>ref|XP_004987290.1| PREDICTED: uncharacterized protein LOC101765158 [Setaria italica]
Length=486

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  192  SRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGS  371
            SRPRRIALFVEPSPFAY+SGYKNRFQNFIKYLREMGDEV+VVTTHEGVP+EF+GAKL+GS
Sbjct  71   SRPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVVTTHEGVPQEFHGAKLIGS  130

Query  372  QSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
             SFPCPWY+KVPLSLALSPRII EVA+FKPDI+HASSPG
Sbjct  131  WSFPCPWYQKVPLSLALSPRIIGEVARFKPDIIHASSPG  169



>ref|XP_010228495.1| PREDICTED: uncharacterized protein LOC100842407 isoform X1 [Brachypodium 
distachyon]
Length=507

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  147  EENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTH  326
             ++G  P    S+  SRPRRIALFVEPSPFAY+SGYKNRFQNFIKYLREMGDEV+VVTTH
Sbjct  57   RDDGDEPPPPTSEADSRPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVVTTH  116

Query  327  EGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            EGVP EF+GAKL+GS SFPCPWY KVPLSLALSPRII EVA+FKPDI+HASSPG
Sbjct  117  EGVPAEFHGAKLVGSWSFPCPWYNKVPLSLALSPRIIGEVARFKPDIIHASSPG  170



>dbj|BAD31817.1| putative sulfolipid synthase [Oryza sativa Japonica Group]
 dbj|BAE79759.1| putative sulfolipid synthase [Oryza sativa Japonica Group]
 dbj|BAG89787.1| unnamed protein product [Oryza sativa Japonica Group]
Length=479

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  180  SDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAK  359
            + + SRPRRIALFVEPSPFAY+SGYKNRF NFIKYLREMGDEV+V+TTHEGVP+EFYGAK
Sbjct  61   ASLDSRPRRIALFVEPSPFAYVSGYKNRFLNFIKYLREMGDEVIVITTHEGVPQEFYGAK  120

Query  360  LMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            L+GS SFPCPWY+KVPLSLALSPRII EVA+FKPDI+HASSPG
Sbjct  121  LIGSWSFPCPWYQKVPLSLALSPRIIGEVARFKPDIIHASSPG  163



>ref|XP_002459190.1| hypothetical protein SORBIDRAFT_02g000240 [Sorghum bicolor]
 gb|EER95711.1| hypothetical protein SORBIDRAFT_02g000240 [Sorghum bicolor]
Length=500

 Score =   194 bits (494),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  192  SRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGS  371
            SRPRRIALFVEPSPFAY+SGYKNRFQNFIKYLREMGDEV+VVTTHEGVP+EF+GAKL+GS
Sbjct  82   SRPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVVTTHEGVPQEFHGAKLIGS  141

Query  372  QSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
             SFPCPWY+KVPLSLALSPRII EVA+FKPDI+HASSPG
Sbjct  142  WSFPCPWYQKVPLSLALSPRIIGEVARFKPDIIHASSPG  180



>ref|XP_004249580.1| PREDICTED: uncharacterized protein LOC101249508 [Solanum lycopersicum]
Length=504

 Score =   194 bits (493),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +3

Query  180  SDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAK  359
            S+ TS+PRRIA+FVEPSPF+Y+SGYKNRFQNFI+YLREMGDEVMVVTTHEGVP+EFYGAK
Sbjct  92   SETTSKPRRIAIFVEPSPFSYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPQEFYGAK  151

Query  360  LMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            L+GS+SFPCP Y KVPLSLALSPRIISEVA+FKPDI+HASSPG
Sbjct  152  LIGSRSFPCPLYEKVPLSLALSPRIISEVARFKPDIIHASSPG  194



>gb|EPS61329.1| hypothetical protein M569_13468, partial [Genlisea aurea]
Length=204

 Score =   185 bits (470),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 96/100 (96%), Gaps = 1/100 (1%)
 Frame = +3

Query  192  SRPR-RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMG  368
            S+P+ RIALFVEPSPFAY+SGYKNRFQNFI+YLREMGDEVM VTTHEG+PEEFYGA+LMG
Sbjct  2    SQPKWRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVMAVTTHEGLPEEFYGAQLMG  61

Query  369  SQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            S+SFPCPWY+ VPLSLALSPRIIS VA+FKPDI+HA+SPG
Sbjct  62   SRSFPCPWYQSVPLSLALSPRIISAVAKFKPDIIHATSPG  101



>ref|XP_004968167.1| PREDICTED: uncharacterized protein LOC101764078 [Setaria italica]
Length=437

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 105/118 (89%), Gaps = 2/118 (2%)
 Frame = +3

Query  135  EYREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMV  314
            E +E+   + PLLL  D  +RPRR+ALFVEPSPFAYISGYKNRFQNFIK+LREMGDEV+V
Sbjct  7    EIKEDLEEAPPLLL--DEAARPRRVALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVIV  64

Query  315  VTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            VT HEGVPEEF+GAK++GS SFPCP Y KVPLSLALSPRIISEVA+FKPDI+HASSPG
Sbjct  65   VTNHEGVPEEFHGAKVIGSWSFPCPMYGKVPLSLALSPRIISEVAKFKPDIIHASSPG  122



>ref|XP_007140380.1| hypothetical protein PHAVU_008G106900g [Phaseolus vulgaris]
 gb|ESW12374.1| hypothetical protein PHAVU_008G106900g [Phaseolus vulgaris]
Length=504

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  144  EEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTT  323
            E EN    L  E++  SRPRRIALFVEPSPFAY+SGYKNRFQNFI+ LREMGDEVMVVTT
Sbjct  80   EGENEGALLGSENEGNSRPRRIALFVEPSPFAYVSGYKNRFQNFIRCLREMGDEVMVVTT  139

Query  324  HEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            HEGVP+EF+GAKL+GS SFPCP Y+KVPLSLALSPRIISEVA+FKPDI+HASSPG
Sbjct  140  HEGVPQEFHGAKLIGSWSFPCPLYQKVPLSLALSPRIISEVARFKPDIIHASSPG  194



>ref|XP_009409491.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase 
GPI3 subunit [Musa acuminata subsp. malaccensis]
Length=438

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 107/126 (85%), Gaps = 4/126 (3%)
 Frame = +3

Query  123  MTITEYRE---EENGSLPLLLES-DMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLR  290
            MT+ E RE   +   + P LLE  +  S PRRIALFVEPSPFAY+SGYKNRFQNFIK LR
Sbjct  1    MTMEEIREALVQGEETPPQLLEDPEANSGPRRIALFVEPSPFAYVSGYKNRFQNFIKNLR  60

Query  291  EMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIV  470
            EMGDEV+VVT HEGVP+EF+GAK++GS SFPCPWY+KVPLSLALSPRIISEVA FKPDI+
Sbjct  61   EMGDEVIVVTNHEGVPQEFHGAKVIGSWSFPCPWYQKVPLSLALSPRIISEVANFKPDII  120

Query  471  HASSPG  488
            HASSPG
Sbjct  121  HASSPG  126



>gb|EAY72486.1| hypothetical protein OsI_00342 [Oryza sativa Indica Group]
Length=436

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 105/119 (88%), Gaps = 2/119 (2%)
 Frame = +3

Query  132  TEYREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVM  311
             E ++E   + PLLL  D  +RPRR+ALFVEPSPFAYISGYKNRFQNFIK+LREMGDEV+
Sbjct  5    AEIKDEMEEAPPLLL--DEAARPRRVALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVI  62

Query  312  VVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            VVT HEGVP+EF+GAK++GS SFPCP Y KVPLSLALSPRIISEVA+FKPDI+HASSPG
Sbjct  63   VVTNHEGVPQEFHGAKVIGSWSFPCPMYGKVPLSLALSPRIISEVAKFKPDIIHASSPG  121



>ref|NP_001041991.1| Os01g0142300 [Oryza sativa Japonica Group]
 dbj|BAD61068.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD61477.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF03905.1| Os01g0142300 [Oryza sativa Japonica Group]
 gb|EEE53847.1| hypothetical protein OsJ_00324 [Oryza sativa Japonica Group]
Length=436

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 105/119 (88%), Gaps = 2/119 (2%)
 Frame = +3

Query  132  TEYREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVM  311
             E ++E   + PLLL  D  +RPRR+ALFVEPSPFAYISGYKNRFQNFIK+LREMGDEV+
Sbjct  5    AEIKDEMEEAPPLLL--DEAARPRRVALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVI  62

Query  312  VVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            VVT HEGVP+EF+GAK++GS SFPCP Y KVPLSLALSPRIISEVA+FKPDI+HASSPG
Sbjct  63   VVTNHEGVPQEFHGAKVIGSWSFPCPMYGKVPLSLALSPRIISEVAKFKPDIIHASSPG  121



>ref|XP_008650829.1| PREDICTED: uncharacterized protein LOC100192061 isoform X1 [Zea 
mays]
Length=498

 Score =   191 bits (485),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 100/105 (95%), Gaps = 1/105 (1%)
 Frame = +3

Query  177  ESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGA  356
            E+   SRPRRIALFVEPSPFAY+SGYKNRFQNFIKYLREMGDEV+VVTTHEGVP+EF+GA
Sbjct  76   EAPPESRPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVVTTHEGVPQEFHGA  135

Query  357  KLMGS-QSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            KL+GS  SFPCPWY+KVPLSLALSPRII+EVA+FKPDI+HASSPG
Sbjct  136  KLIGSWSSFPCPWYQKVPLSLALSPRIIAEVARFKPDIIHASSPG  180



>gb|EMS60261.1| GDP-mannose-dependent alpha-mannosyltransferase [Triticum urartu]
Length=591

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 102/110 (93%), Gaps = 2/110 (2%)
 Frame = +3

Query  165  PLLLESDMTS--RPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVP  338
            PLLL++D  +  RPRR+ALFVEPSPFAYISGYKNRFQNFIK+LREMGDEV+VVT HEGVP
Sbjct  193  PLLLDADEAAYPRPRRVALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVIVVTNHEGVP  252

Query  339  EEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            +EF+GAK++GS SFPCP Y KVPLSLALSPRIISEVA+FKPDI+HASSPG
Sbjct  253  QEFHGAKVIGSWSFPCPLYGKVPLSLALSPRIISEVAKFKPDIIHASSPG  302



>gb|EMT15719.1| Putative glycosyltransferase [Aegilops tauschii]
Length=410

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 101/110 (92%), Gaps = 2/110 (2%)
 Frame = +3

Query  165  PLLLESDMT--SRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVP  338
            PLLL+ +    SRPRR+ALFVEPSPFAYISGYKNRFQNFIK+LREMGDEV+VVT HEGVP
Sbjct  13   PLLLDGEEAAYSRPRRVALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVIVVTNHEGVP  72

Query  339  EEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            +EF+GAK++GS SFPCP Y KVPLSLALSPRIISEVA+FKPDI+HASSPG
Sbjct  73   QEFHGAKVIGSWSFPCPLYGKVPLSLALSPRIISEVAKFKPDIIHASSPG  122



>ref|XP_002457385.1| hypothetical protein SORBIDRAFT_03g006480 [Sorghum bicolor]
 gb|EES02505.1| hypothetical protein SORBIDRAFT_03g006480 [Sorghum bicolor]
Length=430

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 100/108 (93%), Gaps = 2/108 (2%)
 Frame = +3

Query  165  PLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEE  344
            PLLL  D  +RPRR+ALFVEPSPFAYISGYKNRFQNFIK+LREMGDEV+VVT HEGVP+E
Sbjct  10   PLLL--DEAARPRRVALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVIVVTNHEGVPQE  67

Query  345  FYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            F+GAK++GS SFPCP Y KVPLSLALSPRIISEVA+FKPDI+HASSPG
Sbjct  68   FHGAKVIGSWSFPCPMYGKVPLSLALSPRIISEVAKFKPDIIHASSPG  115



>gb|AES79437.2| group 1 family glycosyltransferase [Medicago truncatula]
Length=515

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  177  ESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGA  356
            E++  SRPRRIALFVEPSPFAY+SGYKNRFQNFIK LREMGDEV+VVTTH+GVP+EFYGA
Sbjct  100  ENERNSRPRRIALFVEPSPFAYVSGYKNRFQNFIKCLREMGDEVLVVTTHKGVPQEFYGA  159

Query  357  KLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            KL+GS SFP PWY+ VPLSLALSPRIISEVA+FKPDI+HASSPG
Sbjct  160  KLIGSWSFPLPWYQNVPLSLALSPRIISEVARFKPDIIHASSPG  203



>ref|XP_003623219.1| Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit 
[Medicago truncatula]
Length=539

 Score =   189 bits (481),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  177  ESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGA  356
            E++  SRPRRIALFVEPSPFAY+SGYKNRFQNFIK LREMGDEV+VVTTH+GVP+EFYGA
Sbjct  100  ENERNSRPRRIALFVEPSPFAYVSGYKNRFQNFIKCLREMGDEVLVVTTHKGVPQEFYGA  159

Query  357  KLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            KL+GS SFP PWY+ VPLSLALSPRIISEVA+FKPDI+HASSPG
Sbjct  160  KLIGSWSFPLPWYQNVPLSLALSPRIISEVARFKPDIIHASSPG  203



>ref|XP_003568443.1| PREDICTED: uncharacterized protein LOC100832140 [Brachypodium 
distachyon]
Length=439

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 102/114 (89%), Gaps = 2/114 (2%)
 Frame = +3

Query  147  EENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTH  326
            EE    PLL E+ +  RPRR+ALFVEPSPFAYISGYKNRFQNFIK+LREMGDEV+VVT H
Sbjct  12   EEAPPPPLLDEASL--RPRRVALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVIVVTNH  69

Query  327  EGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            EGVP+EF+GAK++GS SFPCP Y KVPLSLALSPRIISEVA+FKPDI+HASSPG
Sbjct  70   EGVPQEFHGAKVIGSWSFPCPLYGKVPLSLALSPRIISEVAKFKPDIIHASSPG  123



>ref|XP_006643739.1| PREDICTED: uncharacterized protein LOC102711739 [Oryza brachyantha]
Length=437

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +3

Query  183  DMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKL  362
            D  +RPRR+ALFVEPSPFAYISGYKNRFQNFIK+LREMGDEV+VVT HEGVP+EF+GAK+
Sbjct  21   DEAARPRRVALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVIVVTNHEGVPQEFHGAKV  80

Query  363  MGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            +GS SFPCP Y KVPLSLALSPRIISEVA+FKPDI+HASSPG
Sbjct  81   IGSWSFPCPMYGKVPLSLALSPRIISEVAKFKPDIIHASSPG  122



>ref|XP_004984689.1| PREDICTED: uncharacterized protein LOC101779471 [Setaria italica]
Length=413

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 102/119 (86%), Gaps = 4/119 (3%)
 Frame = +3

Query  144  EEENGSLPLLLESDM----TSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVM  311
            + E    PLLL+ +     +SRPRRIALFVEPSPFAYISGYKNRFQNFIK+LREMGDEV+
Sbjct  3    QAEEARAPLLLDEEAGGEWSSRPRRIALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVL  62

Query  312  VVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            VVTTH+G PEEF+GAK++GS SFPCP Y+ VPLSLALSPRI SEV +FKPDI+HA+SPG
Sbjct  63   VVTTHKGAPEEFHGAKVIGSWSFPCPLYQNVPLSLALSPRIFSEVNKFKPDIIHATSPG  121



>ref|NP_001144658.1| uncharacterized protein LOC100277683 [Zea mays]
 gb|ACG42115.1| hypothetical protein [Zea mays]
Length=437

 Score =   185 bits (470),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 104/118 (88%), Gaps = 2/118 (2%)
 Frame = +3

Query  135  EYREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMV  314
            E +++   + P +L+  M  RPRR+ALFVEPSPFAYISGYKNRFQNFIK+LREMGDEV+V
Sbjct  7    EVKDDLEEAPPPVLDEAM--RPRRVALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVIV  64

Query  315  VTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            VT HEGVP+EF+GAK++GS SFPCP Y KVPLSLALSPRIISEVA+FKPDI+HASSPG
Sbjct  65   VTNHEGVPQEFHGAKVIGSWSFPCPMYGKVPLSLALSPRIISEVAKFKPDIIHASSPG  122



>emb|CDM81044.1| unnamed protein product [Triticum aestivum]
Length=440

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +3

Query  195  RPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQ  374
            RPRR+ALFVEPSPFAYISGYKNRFQNFIK+LREMGDEV+VVT HEGVP+EF+GAK++GS 
Sbjct  26   RPRRVALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVIVVTNHEGVPQEFHGAKVIGSW  85

Query  375  SFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            SFPCP Y KVPLSLALSPRIISEVA+FKPDI+HASSPG
Sbjct  86   SFPCPLYGKVPLSLALSPRIISEVAKFKPDIIHASSPG  123



>ref|XP_006649799.1| PREDICTED: uncharacterized protein LOC102700221 [Oryza brachyantha]
Length=417

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 99/113 (88%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  PLLLESD-----MTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHE  329
            PLLL+ D      +SRP RIALFVEPSPFAYISGYKNRFQNFIK+LREMGDEV+VVTTH+
Sbjct  12   PLLLQGDEADGEWSSRPHRIALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVLVVTTHK  71

Query  330  GVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            G PEEF+GAK++GS SFPCP Y+ VPLSLALSPRI S VA+FKPDI+HA+SPG
Sbjct  72   GAPEEFHGAKVIGSWSFPCPLYQNVPLSLALSPRIFSAVAKFKPDIIHATSPG  124



>ref|XP_008653982.1| PREDICTED: uncharacterized protein LOC103634168 [Zea mays]
 tpg|DAA44537.1| TPA: hypothetical protein ZEAMMB73_879639 [Zea mays]
Length=429

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 101/115 (88%), Gaps = 4/115 (3%)
 Frame = +3

Query  156  GSLPLL----LESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTT  323
              +PLL     +++ +S+PRRIALFVEPSPFAYISGYKNRFQNFIK+LREMGDEV+VVTT
Sbjct  7    AQVPLLQTQEADAEWSSKPRRIALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVLVVTT  66

Query  324  HEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            H+G PEEF+GAK++GS SFPCP Y+ VPLSLALSPRI SEV +FKPDI+HA+SPG
Sbjct  67   HKGAPEEFHGAKVIGSWSFPCPLYQNVPLSLALSPRIFSEVNKFKPDIIHATSPG  121



>ref|XP_002468134.1| hypothetical protein SORBIDRAFT_01g040150 [Sorghum bicolor]
 gb|EER95132.1| hypothetical protein SORBIDRAFT_01g040150 [Sorghum bicolor]
Length=414

 Score =   181 bits (460),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 102/115 (89%), Gaps = 4/115 (3%)
 Frame = +3

Query  156  GSLPLLL--ESDM--TSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTT  323
              +PLL   E+D+  +S+PRRIALFVEPSPFAYISGYKNRFQNFIK+LREMGDEV+VVTT
Sbjct  7    AQVPLLQTEEADVEWSSKPRRIALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVLVVTT  66

Query  324  HEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            H+G PEEF+GAK++GS SFPCP Y+ VPLSLALSPRI SEV +FKPDI+HA+SPG
Sbjct  67   HKGAPEEFHGAKVIGSWSFPCPLYQNVPLSLALSPRIFSEVNKFKPDIIHATSPG  121



>gb|ACG31912.1| glycosyl transferase, group 1 family protein [Zea mays]
Length=414

 Score =   181 bits (460),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 100/113 (88%), Gaps = 4/113 (4%)
 Frame = +3

Query  162  LPLL----LESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHE  329
            +PLL     + + +S+PRRIALFVEPSPFAYISGYKNRFQNFIK+LREMGDEV+VVTTH+
Sbjct  9    VPLLQTEEADGEWSSKPRRIALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVLVVTTHK  68

Query  330  GVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            G PEEF+GAK++GS SFPCP Y+ VPLSLALSPRI SEV +FKPDI+HA+SPG
Sbjct  69   GAPEEFHGAKVIGSWSFPCPLYQNVPLSLALSPRIFSEVNKFKPDIIHATSPG  121



>gb|ACN34235.1| unknown [Zea mays]
 gb|AFW88879.1| glycosyl transferase, group 1 family protein [Zea mays]
Length=414

 Score =   181 bits (460),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 100/113 (88%), Gaps = 4/113 (4%)
 Frame = +3

Query  162  LPLL----LESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHE  329
            +PLL     + + +S+PRRIALFVEPSPFAYISGYKNRFQNFIK+LREMGDEV+VVTTH+
Sbjct  9    VPLLQTEEADGEWSSKPRRIALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVLVVTTHK  68

Query  330  GVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            G PEEF+GAK++GS SFPCP Y+ VPLSLALSPRI SEV +FKPDI+HA+SPG
Sbjct  69   GAPEEFHGAKVIGSWSFPCPLYQNVPLSLALSPRIFSEVNKFKPDIIHATSPG  121



>ref|NP_001150015.1| glycosyl transferase, group 1 family protein [Zea mays]
 gb|ACG37508.1| glycosyl transferase, group 1 family protein [Zea mays]
Length=414

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 100/113 (88%), Gaps = 4/113 (4%)
 Frame = +3

Query  162  LPLL----LESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHE  329
            +PLL     + + +S+PRRIALFVEPSPFAYISGYKNRFQNFIK+LREMGDEV+VVTTH+
Sbjct  9    VPLLQTEEADGEWSSKPRRIALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVLVVTTHK  68

Query  330  GVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            G PEEF+GAK++GS SFPCP Y+ VPLSLALSPRI SEV +FKPDI+HA+SPG
Sbjct  69   GAPEEFHGAKVIGSWSFPCPLYQNVPLSLALSPRIFSEVNKFKPDIIHATSPG  121



>ref|XP_002968644.1| UDP-sulfoquinovose: alpha-diacylglycerol-sulfoquinovosyltransferase 
[Selaginella moellendorffii]
 gb|EFJ29760.1| UDP-sulfoquinovose: alpha-diacylglycerol-sulfoquinovosyltransferase 
[Selaginella moellendorffii]
Length=514

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 102/125 (82%), Gaps = 6/125 (5%)
 Frame = +3

Query  117  SKMTITEYREEENGSLPLLLESDM-TSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLRE  293
            SK+       EE G      E D  T  PRRIALFVEPSPFAY+SGYKNRFQNFI+YLRE
Sbjct  79   SKLDAVANAVEERGR-----ERDTGTIGPRRIALFVEPSPFAYVSGYKNRFQNFIRYLRE  133

Query  294  MGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVH  473
            MGDEV+++TTHEGVP EF+GAK++GS SFPCP+Y+ VPLSLALSPRIISEVA FKPDI+H
Sbjct  134  MGDEVLIITTHEGVPTEFHGAKVIGSWSFPCPFYKLVPLSLALSPRIISEVAHFKPDIIH  193

Query  474  ASSPG  488
            ASSPG
Sbjct  194  ASSPG  198



>ref|XP_003558286.1| PREDICTED: uncharacterized protein LOC100846446 [Brachypodium 
distachyon]
Length=420

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 101/117 (86%), Gaps = 5/117 (4%)
 Frame = +3

Query  153  NGSLPLLL-----ESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVV  317
            + + PLLL     +++ +SRP RIALFVEPSPFAYISGYKNRFQNFIK+LREMGDEV+VV
Sbjct  11   DTTAPLLLQVEEADAEWSSRPHRIALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVLVV  70

Query  318  TTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            TTH+G PEEF+GAK++GS SFPCP Y+ VPLSLALSPRI S V +FKPDI+HA+SPG
Sbjct  71   TTHKGAPEEFHGAKVIGSWSFPCPLYQNVPLSLALSPRIFSAVTKFKPDIIHATSPG  127



>tpg|DAA44536.1| TPA: hypothetical protein ZEAMMB73_879639 [Zea mays]
Length=404

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +3

Query  177  ESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGA  356
            +++ +S+PRRIALFVEPSPFAYISGYKNRFQNFIK+LREMGDEV+VVTTH+G PEEF+GA
Sbjct  18   DAEWSSKPRRIALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVLVVTTHKGAPEEFHGA  77

Query  357  KLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            K++GS SFPCP Y+ VPLSLALSPRI SEV +FKPDI+HA+SPG
Sbjct  78   KVIGSWSFPCPLYQNVPLSLALSPRIFSEVNKFKPDIIHATSPG  121



>dbj|BAJ91585.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=415

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 100/113 (88%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  PLLL-----ESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHE  329
            PLLL     +++ +SRP RIALFVEPSPFAYISGYKNRFQNFIK+LREMGDEV+VVTTH+
Sbjct  10   PLLLQVEDADTEWSSRPHRIALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVLVVTTHK  69

Query  330  GVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            G PEEF+GAK++GS SFPCP Y+ VPLSLALSPRI S V++FKPDI+HA+SPG
Sbjct  70   GAPEEFHGAKVIGSWSFPCPLYQNVPLSLALSPRIFSAVSKFKPDIIHATSPG  122



>gb|EAY89357.1| hypothetical protein OsI_10861 [Oryza sativa Indica Group]
Length=415

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 96/113 (85%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  PLLLESDMTS-----RPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHE  329
            PLLL+ D        RP RI LFVEPSPFAYISGYKNRFQNFIK+LREMGDEV+VVTTH+
Sbjct  10   PLLLQGDQVDAEWGCRPHRIVLFVEPSPFAYISGYKNRFQNFIKHLREMGDEVLVVTTHK  69

Query  330  GVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            G PEEF+GAK++GS SFPCP Y+ VPLSLALSPRI S VA+FKPDI+HA+SPG
Sbjct  70   GAPEEFHGAKVIGSWSFPCPLYQNVPLSLALSPRIFSAVAKFKPDIIHATSPG  122



>ref|NP_001049645.1| Os03g0265100 [Oryza sativa Japonica Group]
 gb|AAP06834.1| putative sulfolipid synthase [Oryza sativa Japonica Group]
 gb|ABF95130.1| glycosyl transferase, group 1 family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11559.1| Os03g0265100 [Oryza sativa Japonica Group]
 gb|EAZ26361.1| hypothetical protein OsJ_10243 [Oryza sativa Japonica Group]
 dbj|BAG97169.1| unnamed protein product [Oryza sativa Japonica Group]
Length=415

 Score =   179 bits (453),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 96/113 (85%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  PLLLESDMTS-----RPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHE  329
            PLLL+ D        RP RI LFVEPSPFAYISGYKNRFQNFIK+LREMGDE++VVTTH+
Sbjct  10   PLLLQGDQVDAEWGCRPHRIVLFVEPSPFAYISGYKNRFQNFIKHLREMGDEMLVVTTHK  69

Query  330  GVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            G PEEF+GAK++GS SFPCP Y+ VPLSLALSPRI S VA+FKPDI+HA+SPG
Sbjct  70   GAPEEFHGAKVIGSWSFPCPLYQNVPLSLALSPRIFSAVAKFKPDIIHATSPG  122



>ref|XP_009122830.1| PREDICTED: uncharacterized protein LOC103847496 [Brassica rapa]
Length=539

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 103/140 (74%), Gaps = 28/140 (20%)
 Frame = +3

Query  153  NGSLPLLLESDMTSRPRRIALFVEPSPF----------------------------AYIS  248
            +G    LL+ +  S+PRRIALFVEPSPF                             Y+S
Sbjct  88   DGDEAPLLDPESYSKPRRIALFVEPSPFFSIQTCLCLLCVRRNVSVIQCWAFDAEIYYVS  147

Query  249  GYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSP  428
            GYKNRFQNFI+YLREMGDEV+VVTTHEGVP+EFYGAK++GS+SFPCPWY+KVPLSLALSP
Sbjct  148  GYKNRFQNFIRYLREMGDEVIVVTTHEGVPQEFYGAKVIGSRSFPCPWYQKVPLSLALSP  207

Query  429  RIISEVAQFKPDIVHASSPG  488
            RIISE+A+F PDI+HASSPG
Sbjct  208  RIISEIARFNPDIIHASSPG  227



>ref|XP_001766232.1| predicted protein [Physcomitrella patens]
 gb|EDQ68864.1| predicted protein [Physcomitrella patens]
Length=457

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +3

Query  183  DMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKL  362
            +   +PRR+ LFVEPSPF+YISGYKNR+QNFI+YLRE+GDEV+VVTTH GVP EFYGAK+
Sbjct  50   EWAHKPRRVVLFVEPSPFSYISGYKNRYQNFIRYLRELGDEVLVVTTHHGVPAEFYGAKV  109

Query  363  MGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            +GS SFP PWY+ VP+SLALSPRI  EV  FKPDI+HASSPG
Sbjct  110  IGSWSFPLPWYKAVPMSLALSPRIYKEVKDFKPDIIHASSPG  151



>ref|XP_001756850.1| predicted protein [Physcomitrella patens]
 gb|EDQ78447.1| predicted protein [Physcomitrella patens]
Length=472

 Score =   172 bits (436),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +3

Query  183  DMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKL  362
            +   +PRR+ LFVEPSPF+YISGYKNR+QNFI+YLR++GDEV+VVTTH GVP+EF+GAK+
Sbjct  65   EWAHKPRRVVLFVEPSPFSYISGYKNRYQNFIRYLRQLGDEVLVVTTHHGVPDEFHGAKV  124

Query  363  MGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            +GS SFP PWY+ VP+SLALSPRI +EV  FKPDI+HASSPG
Sbjct  125  IGSWSFPLPWYKAVPMSLALSPRIYNEVKNFKPDIIHASSPG  166



>gb|KCW88121.1| hypothetical protein EUGRSUZ_A00516 [Eucalyptus grandis]
Length=422

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/83 (92%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = +3

Query  240  YISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLA  419
            Y+SGYKNRFQNFIKYLREMGDEVMVVTTHEGVP+EFYGAKL+GS+SFPCPWY+KVPLSLA
Sbjct  28   YVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPDEFYGAKLIGSRSFPCPWYQKVPLSLA  87

Query  420  LSPRIISEVAQFKPDIVHASSPG  488
            LSPRIISEVA+FKPDI+HASSPG
Sbjct  88   LSPRIISEVAKFKPDIIHASSPG  110



>gb|EMT15626.1| Lipopolysaccharide core biosynthesis glycosyltransferase lpsE 
[Aegilops tauschii]
Length=437

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 100/141 (71%), Gaps = 33/141 (23%)
 Frame = +3

Query  165  PLLL-----ESDMTSRPRRIALFVEPSPFA----------------------------YI  245
            PLLL     +++ +SRP RIALFVEPSPFA                            YI
Sbjct  4    PLLLRVEDADAEWSSRPHRIALFVEPSPFASVSLLPPSLFLLLPTQVLKHKALAGLQYYI  63

Query  246  SGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALS  425
            SGYKNRFQNFIK+LREMGDEV+VVTTH+G PEEF+GAK++GS SFPCP Y+ VPLSLALS
Sbjct  64   SGYKNRFQNFIKHLREMGDEVLVVTTHKGAPEEFHGAKVIGSWSFPCPLYQNVPLSLALS  123

Query  426  PRIISEVAQFKPDIVHASSPG  488
            PRI S V++FKPDI+HA+SPG
Sbjct  124  PRIFSAVSKFKPDIIHATSPG  144



>ref|XP_008370134.1| PREDICTED: uncharacterized protein LOC103433646, partial [Malus 
domestica]
Length=422

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  240  YISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLA  419
            Y+SGYKNRFQNFI+YLREMGDEVMVVTTHEGVP+EFYGAKL+GS+SFPCP Y+KVPLSLA
Sbjct  26   YVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPDEFYGAKLIGSRSFPCPLYQKVPLSLA  85

Query  420  LSPRIISEVAQFKPDIVHASSPG  488
            LSPRIISEVAQFKPDI+HASSPG
Sbjct  86   LSPRIISEVAQFKPDIIHASSPG  108



>emb|CDY21645.1| BnaC09g46470D [Brassica napus]
Length=223

 Score =   159 bits (402),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +3

Query  249  GYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSP  428
            GYKNRFQNFI+YL EMGDEV+VVTTHEGVPEEFYGAK++GS+SFPCPWY+KVPLSLALSP
Sbjct  78   GYKNRFQNFIRYLPEMGDEVIVVTTHEGVPEEFYGAKVIGSRSFPCPWYQKVPLSLALSP  137

Query  429  RIISEVAQFKPDIVHASSPG  488
            RIISE+A+FKPDI+HASSPG
Sbjct  138  RIISEIARFKPDIIHASSPG  157



>emb|CDX82174.1| BnaC02g21160D [Brassica napus]
Length=240

 Score =   151 bits (382),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  246  SGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALS  425
             GYKNRFQNFI+YL EMGD+V+VVTTHEGVPEEFYGAK++GS+SFPCPWY+KVP SLALS
Sbjct  16   KGYKNRFQNFIRYLPEMGDKVIVVTTHEGVPEEFYGAKVIGSRSFPCPWYQKVPPSLALS  75

Query  426  PRIISEVAQFKPDIVHASSPG  488
            PRIISE+++FKPDI+HASSPG
Sbjct  76   PRIISEISRFKPDIIHASSPG  96



>ref|XP_010031046.1| PREDICTED: uncharacterized protein LOC104420932 [Eucalyptus grandis]
Length=377

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +3

Query  294  MGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVH  473
            MGDEVMVVTTHEGVP+EFYGAKL+GS+SFPCPWY+KVPLSLALSPRIISEVA+FKPDI+H
Sbjct  1    MGDEVMVVTTHEGVPDEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIISEVAKFKPDIIH  60

Query  474  ASSPG  488
            ASSPG
Sbjct  61   ASSPG  65



>gb|KDO53238.1| hypothetical protein CISIN_1g009759mg [Citrus sinensis]
Length=377

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +3

Query  294  MGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVH  473
            MGDEVMVVTTHEGVP+EFYGAKL+GS+SFPCPWY+KVPLSLALSPRIISEVA+FKPDI+H
Sbjct  1    MGDEVMVVTTHEGVPQEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIISEVARFKPDIIH  60

Query  474  ASSPG  488
            ASSPG
Sbjct  61   ASSPG  65



>ref|XP_009593273.1| PREDICTED: uncharacterized protein LOC104089958 isoform X2 [Nicotiana 
tomentosiformis]
Length=376

 Score =   128 bits (321),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  294  MGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVH  473
            MGDEVMVVTTHEGVP+EFYGAKL+GS SFPCPWY+KVPLSLALSPRIISEV +FKPDI+H
Sbjct  1    MGDEVMVVTTHEGVPQEFYGAKLIGSLSFPCPWYQKVPLSLALSPRIISEVKRFKPDIIH  60

Query  474  ASSPG  488
            ASSPG
Sbjct  61   ASSPG  65



>tpg|DAA59318.1| TPA: hypothetical protein ZEAMMB73_291487 [Zea mays]
Length=175

 Score =   123 bits (308),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  177  ESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGA  356
            E+   SRPRRIALFVEPSPFAY+SGYKNRFQNFIKYLREMGDEV+VVTTHEGVP+EF+GA
Sbjct  76   EAPPESRPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVVTTHEGVPQEFHGA  135

Query  357  KLMGS  371
            KL+GS
Sbjct  136  KLIGS  140



>ref|XP_002953985.1| hypothetical protein VOLCADRAFT_82536 [Volvox carteri f. nagariensis]
 gb|EFJ45014.1| hypothetical protein VOLCADRAFT_82536 [Volvox carteri f. nagariensis]
Length=543

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 75/110 (68%), Gaps = 13/110 (12%)
 Frame = +3

Query  198  PRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGV-------------P  338
            PRR+ +FVEPSPF Y+SGYKNRF   IKYL E G EV+VVTT +G              P
Sbjct  119  PRRVCIFVEPSPFTYVSGYKNRFTTMIKYLVEAGCEVLVVTTGKGFTLPSVDSSSFCDQP  178

Query  339  EEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            E F GA+++ + SF CPWY +VPLS ALSPRI  EV  F+P+++H SSPG
Sbjct  179  ETFCGARVVSALSFGCPWYLQVPLSFALSPRIWREVRDFRPELIHCSSPG  228



>ref|XP_011047421.1| PREDICTED: uncharacterized protein LOC105141768 isoform X3 [Populus 
euphratica]
Length=374

 Score =   125 bits (314),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +3

Query  294  MGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVH  473
            MGDEV+VVTTHEGVP+EFYGAKL+GS+SFP PWY+KVPLSLALSPRIISEVA+FKPDI+H
Sbjct  1    MGDEVLVVTTHEGVPQEFYGAKLIGSRSFPFPWYQKVPLSLALSPRIISEVARFKPDIIH  60

Query  474  ASSPG  488
            ASSPG
Sbjct  61   ASSPG  65



>gb|KEH28856.1| group 1 family glycosyltransferase [Medicago truncatula]
Length=375

 Score =   125 bits (313),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  294  MGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVH  473
            MGDEVMVVTTHEGVP+EFYGA+L+GS+SFP PWY+KVPLSLALSPRIIS VAQFKPDI+H
Sbjct  1    MGDEVMVVTTHEGVPKEFYGAQLIGSKSFPFPWYQKVPLSLALSPRIISAVAQFKPDIIH  60

Query  474  ASSPG  488
            ASSPG
Sbjct  61   ASSPG  65



>gb|KJB17031.1| hypothetical protein B456_002G261700 [Gossypium raimondii]
 gb|KJB17035.1| hypothetical protein B456_002G261700 [Gossypium raimondii]
Length=372

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +3

Query  309  MVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            MVVTTHEGVP EFYGAKL+GS+SFPCPWY+KVPLSLALSPRIISEVA+FKPDI+HASSPG
Sbjct  1    MVVTTHEGVPTEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIISEVARFKPDIIHASSPG  60



>ref|XP_011396666.1| GDP-mannose-dependent alpha-mannosyltransferase [Auxenochlorella 
protothecoides]
 gb|KFM23788.1| GDP-mannose-dependent alpha-mannosyltransferase [Auxenochlorella 
protothecoides]
Length=416

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 74/106 (70%), Gaps = 9/106 (8%)
 Frame = +3

Query  198  PRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGV---------PEEFY  350
            P+RI + VEPSPF Y+ GY NR++N I+YL+E+G EV++VT  + V         PEEF 
Sbjct  7    PKRICILVEPSPFTYVCGYMNRYRNTIRYLKELGCEVLIVTPGKSVASTDDSQRQPEEFC  66

Query  351  GAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            GAK++ + SF  PWY K+PL+  LSPRI  EV  F+P+IVH +SPG
Sbjct  67   GAKVVEAMSFAFPWYAKLPLTFGLSPRIYKEVKSFQPNIVHCTSPG  112



>ref|XP_011047420.1| PREDICTED: uncharacterized protein LOC105141768 isoform X2 [Populus 
euphratica]
Length=424

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +3

Query  303  EVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASS  482
            +V+VVTTHEGVP+EFYGAKL+GS+SFP PWY+KVPLSLALSPRIISEVA+FKPDI+HASS
Sbjct  54   QVLVVTTHEGVPQEFYGAKLIGSRSFPFPWYQKVPLSLALSPRIISEVARFKPDIIHASS  113

Query  483  PG  488
            PG
Sbjct  114  PG  115



>ref|XP_006583630.1| PREDICTED: uncharacterized protein LOC100804237 [Glycine max]
Length=366

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +3

Query  309  MVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            MVVTTHEGVP+EFYGAKL+GS SFPCP Y+KVPLSLALSPRIISEVA+FKPDI+HASSPG
Sbjct  1    MVVTTHEGVPQEFYGAKLIGSWSFPCPLYQKVPLSLALSPRIISEVARFKPDIIHASSPG  60



>emb|CDX75469.1| BnaA01g02330D [Brassica napus]
Length=91

 Score =   106 bits (265),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 59/65 (91%), Gaps = 1/65 (2%)
 Frame = +3

Query  294  MGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVH  473
            MGD +  + + EGVPEEFYGAK++GS+SFPCPWY+KVPL LALSPRIISE+A+FKPDI+H
Sbjct  1    MGDGIEEIES-EGVPEEFYGAKVIGSRSFPCPWYQKVPLLLALSPRIISEIARFKPDIIH  59

Query  474  ASSPG  488
            ASSPG
Sbjct  60   ASSPG  64



>gb|KIY98280.1| sulfoquinovosyltransferase [Monoraphidium neglectum]
Length=549

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 71/114 (62%), Gaps = 10/114 (9%)
 Frame = +3

Query  177  ESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGV-------  335
            + +    P+RI LFVEPSPF Y SGY+ RF   IK + E G +V+V+T   G        
Sbjct  130  QGEGEGSPKRIVLFVEPSPFTYTSGYQTRFLATIKEMVEAGCDVLVITPGRGAAGLLPGG  189

Query  336  ---PEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
               P EF GA+++ + SFPCP Y  VPLSL LSPRI  EV  ++PD++H +SPG
Sbjct  190  KEQPAEFAGARVVEAGSFPCPGYGTVPLSLGLSPRIWREVRSWRPDLIHVTSPG  243



>ref|XP_005843576.1| hypothetical protein CHLNCDRAFT_33086 [Chlorella variabilis]
 gb|EFN51474.1| hypothetical protein CHLNCDRAFT_33086 [Chlorella variabilis]
Length=413

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 66/104 (63%), Gaps = 13/104 (13%)
 Frame = +3

Query  216  FVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGV-------------PEEFYGA  356
             VEPSPF Y+ GY NR++N I++L E G +V+VVT   G+             P EF+GA
Sbjct  1    MVEPSPFTYVCGYMNRYRNTIRFLTEAGVDVLVVTPGPGMTAPGIDFSAACEQPAEFHGA  60

Query  357  KLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            +++ + SF  PWY  +PLS  LSPRI  EV  FKPDI+H SSPG
Sbjct  61   RVVQAFSFGLPWYLSLPLSFGLSPRIYKEVKAFKPDIIHCSSPG  104



>ref|XP_005644605.1| UDP-Glycosyltransferase/glycogen phosphorylase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20061.1| UDP-Glycosyltransferase/glycogen phosphorylase [Coccomyxa subellipsoidea 
C-169]
Length=487

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 80/123 (65%), Gaps = 2/123 (2%)
 Frame = +3

Query  126  TITEYREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDE  305
            T+T  +  E  ++P   ++D     ++IA+FVEPSPF+++SG K RF N IK LR++GD+
Sbjct  52   TVTSAQAAEVLAVPQPEKADAHEEKKKIAIFVEPSPFSHVSGMKIRFSNLIKGLRQLGDD  111

Query  306  VMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRK--VPLSLALSPRIISEVAQFKPDIVHAS  479
            VMVVT     P+ F+GAK++    F  P+YR   + LSL LS R++  +   +PD++H S
Sbjct  112  VMVVTPCINPPKTFHGAKVVNVLGFSLPFYRSPTLLLSLGLSVRVLYFLITQRPDVIHVS  171

Query  480  SPG  488
            SPG
Sbjct  172  SPG  174



>ref|XP_001421416.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 ref|XP_001421447.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO99709.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO99740.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=456

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 67/98 (68%), Gaps = 2/98 (2%)
 Frame = +3

Query  201  RRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSF  380
            RR+A+FVEPSPF+++SG KNRF   I+ LREMGD+V+V+T     P+E++GAK++G + F
Sbjct  82   RRVAIFVEPSPFSHVSGMKNRFLRLIENLREMGDDVVVITPDRDPPKEYHGAKVIGLRGF  141

Query  381  PCPWYRKVPL--SLALSPRIISEVAQFKPDIVHASSPG  488
              P+Y    L  S  L  R+  E  + KPD+VH + PG
Sbjct  142  VLPFYGTDTLLCSFGLDGRVWREFKENKPDLVHCAVPG  179



>gb|ABC24951.1| plastid sulfolipid synthase [Prototheca wickerhamii]
Length=175

 Score = 94.4 bits (233),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 62/100 (62%), Gaps = 17/100 (17%)
 Frame = +3

Query  141  REEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVT  320
            +    G LPL         PRR+   VEPSPF Y+SGY NR++N I+YL E+G EV++VT
Sbjct  84   QASSTGGLPLA--------PRRVCFLVEPSPFTYVSGYMNRYRNTIRYLVELGCEVLIVT  135

Query  321  THEGV---------PEEFYGAKLMGSQSFPCPWYRKVPLS  413
              +GV         P E+ GAK++ + SFP PWYRK+PLS
Sbjct  136  PGKGVAPGMEGQAQPREYCGAKVVEALSFPLPWYRKLPLS  175



>gb|KJB17033.1| hypothetical protein B456_002G261700 [Gossypium raimondii]
Length=470

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 70/126 (56%), Gaps = 47/126 (37%)
 Frame = +3

Query  114  SSKMTITEYREEEN-GSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLR  290
            +S++++ E +E++     P L++S+  S+PRRIALFVEPSPF                  
Sbjct  79   ASELSVAEVKEDDGEDENPPLIDSENNSKPRRIALFVEPSPF------------------  120

Query  291  EMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIV  470
                                        SFPCPWY+KVPLSLALSPRIISEVA+FKPDI+
Sbjct  121  ----------------------------SFPCPWYQKVPLSLALSPRIISEVARFKPDII  152

Query  471  HASSPG  488
            HASSPG
Sbjct  153  HASSPG  158



>ref|XP_001699258.1| sulfolipid synthase [Chlamydomonas reinhardtii]
 gb|EDO98898.1| sulfolipid synthase, partial [Chlamydomonas reinhardtii]
Length=395

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 65/96 (68%), Gaps = 2/96 (2%)
 Frame = +3

Query  207  IALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFPC  386
            +ALFVEPSPF++ISG KNRFQ  I+ LRE GDEV V T     P E++GA+++G   F  
Sbjct  1    VALFVEPSPFSHISGMKNRFQCLIRNLREAGDEVRVFTPDPHAPSEYHGARVVGVLGFKL  60

Query  387  PWYRK--VPLSLALSPRIISEVAQFKPDIVHASSPG  488
            P+Y    + LSL LS  ++ ++   +PD++H S+PG
Sbjct  61   PFYSSPTLLLSLGLSVNVLWQLLTRRPDVIHVSAPG  96



>ref|XP_003083256.1| sulfolipid synthase (ISS), partial [Ostreococcus tauri]
Length=573

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 45/100 (45%), Positives = 66/100 (66%), Gaps = 2/100 (2%)
 Frame = +3

Query  195  RPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQ  374
            + RR+A+FVEPSPF+++SG KNRF   I+ LREMGD+V+V+T     P E++GAK++G +
Sbjct  76   KKRRVAIFVEPSPFSHVSGMKNRFLRLIENLREMGDDVVVITPDRNPPAEYHGAKVIGLR  135

Query  375  SFPCPWYRKVPL--SLALSPRIISEVAQFKPDIVHASSPG  488
             F  P+Y    L  S  +S  +  E  +  PD+VH + PG
Sbjct  136  GFVLPFYGTDTLLCSFGVSGEVWREFRERPPDLVHCAVPG  175



>ref|XP_010101801.1| GDP-mannose-dependent alpha-mannosyltransferase [Morus notabilis]
 gb|EXB89938.1| GDP-mannose-dependent alpha-mannosyltransferase [Morus notabilis]
Length=337

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +3

Query  123  MTITEYREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGD  302
            MTITE R EE    P LL+++  S PRRIALFVEPSPFAY+SGYKNRFQNFI+YLREMGD
Sbjct  1    MTITEVRPEEEEEGPPLLDTENNSSPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGD  60

Query  303  E  305
            E
Sbjct  61   E  61



>emb|CEG01736.1| Glycosyl transferase, family 1 [Ostreococcus tauri]
Length=756

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 45/100 (45%), Positives = 66/100 (66%), Gaps = 2/100 (2%)
 Frame = +3

Query  195  RPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQ  374
            + RR+A+FVEPSPF+++SG KNRF   I+ LREMGD+V+V+T     P E++GAK++G +
Sbjct  79   KKRRVAIFVEPSPFSHVSGMKNRFLRLIENLREMGDDVVVITPDRNPPAEYHGAKVIGLR  138

Query  375  SFPCPWYRKVPL--SLALSPRIISEVAQFKPDIVHASSPG  488
             F  P+Y    L  S  +S  +  E  +  PD+VH + PG
Sbjct  139  GFVLPFYGTDTLLCSFGVSGEVWREFRERPPDLVHCAVPG  178



>ref|XP_007514956.1| SqdX [Bathycoccus prasinos]
 emb|CCO15196.1| SqdX [Bathycoccus prasinos]
Length=865

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 69/108 (64%), Gaps = 2/108 (2%)
 Frame = +3

Query  171  LLESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFY  350
            +L+    S  R++A+FVEPSPF ++SG KNRF   I+ L E+GDEV+V+T     PEE+ 
Sbjct  131  ILKLPAASTKRKVAIFVEPSPFTHVSGMKNRFLRLIENLAELGDEVVVITPCVDPPEEYC  190

Query  351  GAKLMGSQSFPCPWY--RKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            G K++G +    P+Y    + LS  LS R+  +  + KPD++H S+PG
Sbjct  191  GCKVIGVKGIVLPFYGTDTLLLSTGLSGRVYRDFKEKKPDLIHCSTPG  238



>ref|XP_003057606.1| glycosyltransferase family 4 protein [Micromonas pusilla CCMP1545]
 gb|EEH57557.1| glycosyltransferase family 4 protein [Micromonas pusilla CCMP1545]
Length=769

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 46/102 (45%), Positives = 65/102 (64%), Gaps = 2/102 (2%)
 Frame = +3

Query  189  TSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMG  368
            T  PRRI +FVEPSPF+++SG KNRF   I+ L E+GD+V+V+T     P E+ GA+++G
Sbjct  99   TRAPRRIVVFVEPSPFSHVSGMKNRFLRLIENLTELGDDVVVITPDRNPPAEYAGAEVIG  158

Query  369  SQSFPCPWY--RKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
               F  P+Y    + LS A  PR+ +      PD++H SSPG
Sbjct  159  LHGFALPFYPGNTLLLSYARDPRVEALFRTNPPDLIHCSSPG  200



>ref|XP_005715110.1| unnamed protein product [Chondrus crispus]
 emb|CDF35291.1| unnamed protein product [Chondrus crispus]
Length=474

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 62/99 (63%), Gaps = 3/99 (3%)
 Frame = +3

Query  198  PRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVT--THEGVPEEFYGAKLMGS  371
            PRRIAL VEPSPF + SGY NRF+N +  LR+ GD V+V+        P EF GAK++  
Sbjct  56   PRRIALMVEPSPFTHTSGYSNRFKNLLLQLRDAGDSVLVIVPDNDPDAPTEFAGAKIVNV  115

Query  372  QSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
              F  P Y ++ L+L L   + + + +F PD++H ++PG
Sbjct  116  PGFRFPLYHRITLTLGLRG-VYTALKEFDPDVIHLTTPG  153



>ref|XP_005705641.1| UDP-sulfoquinovose:DAG sulfoquinovosyltransferase [Galdieria 
sulphuraria]
 gb|EME29121.1| UDP-sulfoquinovose:DAG sulfoquinovosyltransferase [Galdieria 
sulphuraria]
Length=434

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 63/99 (64%), Gaps = 2/99 (2%)
 Frame = +3

Query  198  PRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEG--VPEEFYGAKLMGS  371
            PR++ + +EP+PF +ISGY NRF+  +KYL++ GDEV+++        P+E YG  ++  
Sbjct  36   PRKVVMIIEPTPFTHISGYSNRFRETLKYLKQAGDEVLIIVPDNSFDAPQEIYGFPIISI  95

Query  372  QSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            + F    Y K+ LS  L   I S + +F+PDIVH S+PG
Sbjct  96   RGFRFFLYPKITLSFGLFGGIFSALRRFRPDIVHVSTPG  134



>gb|KIZ02980.1| sulfoquinovosyltransferase [Monoraphidium neglectum]
Length=430

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 62/97 (64%), Gaps = 2/97 (2%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            ++A+FVEPSPF +ISG KNRF++ I  LRE+GD V+VVT     P+ F+GA+++G   F 
Sbjct  2    KVAIFVEPSPFTHISGLKNRFESLIHGLREVGDSVLVVTPDPAPPKHFFGAEVIGVWGFR  61

Query  384  CPWYRK--VPLSLALSPRIISEVAQFKPDIVHASSPG  488
             P Y    + LS  LS      + + +PD++H S PG
Sbjct  62   PPLYNSPTLLLSTGLSVHAARALWRLRPDVIHVSGPG  98



>ref|XP_005538341.1| sulfoquinovosyldiacylglycerol biosynthesis protein [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM82305.1| sulfoquinovosyldiacylglycerol biosynthesis protein [Cyanidioschyzon 
merolae strain 10D]
Length=517

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 47/145 (32%), Positives = 79/145 (54%), Gaps = 10/145 (7%)
 Frame = +3

Query  81   GLASTLWEFAVSSKMTITEYREEENGSLPLLLESDMTSRPRRIALFVEPSPFAYISGYKN  260
            G+  T   FA++S  T   Y +  +G  P L++     R RR+ L VEP+PF ++SGY N
Sbjct  59   GVPRTSCAFALASVATGPVYPQPTSGDDPNLVDLRRAPR-RRVCLVVEPTPFTHVSGYSN  117

Query  261  RFQNFIKYLREMGDEVMVVTTHEG--VPEEFYGAKLMGSQSFPCPWYRKVPLSLALSP--  428
            RF   ++YL+E GDEV+++T       P+E +G  ++  + F    Y ++ LS+      
Sbjct  118  RFNELLRYLKEAGDEVLIITPDNSPDAPQEVFGYPVITIRGFKFALYPRITLSIGFGSGM  177

Query  429  -----RIISEVAQFKPDIVHASSPG  488
                  ++  V +F PD++H ++PG
Sbjct  178  VFGRRSLLQRVREFDPDLIHLATPG  202



>ref|XP_002501927.1| glycosyltransferase family 4 protein [Micromonas sp. RCC299]
 gb|ACO63185.1| glycosyltransferase family 4 protein [Micromonas sp. RCC299]
Length=763

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 46/103 (45%), Positives = 65/103 (63%), Gaps = 3/103 (3%)
 Frame = +3

Query  189  TSRPR-RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLM  365
            T+R R RI +FVEPSPF+++SG KNRF   I+ L E+GD+V+VVT     P+ + GA+++
Sbjct  82   TTRERKRICIFVEPSPFSHVSGMKNRFLRLIENLVELGDDVVVVTPDRNPPQTYAGAEVI  141

Query  366  GSQSFPCPWYRKVPL--SLALSPRIISEVAQFKPDIVHASSPG  488
            G   F  P+Y    L  S A  PR+     +  PD++H SSPG
Sbjct  142  GVHGFNLPFYMMDTLLFSYAKDPRVEKMFKENPPDLIHCSSPG  184



>ref|XP_009035363.1| hypothetical protein AURANDRAFT_2613, partial [Aureococcus anophagefferens]
 gb|EGB09356.1| hypothetical protein AURANDRAFT_2613, partial [Aureococcus anophagefferens]
Length=379

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 60/99 (61%), Gaps = 2/99 (2%)
 Frame = +3

Query  198  PRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEG--VPEEFYGAKLMGS  371
            PRR+AL VEP+PF ++SGY NRF+  +KYL+E GD+V +    +    P+ + G  +   
Sbjct  1    PRRVALLVEPTPFTHVSGYANRFKEQLKYLKEFGDDVAIAVPDDKPEAPDSYDGFPITTV  60

Query  372  QSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
              F  P Y  + L+  +  +    V +FKPD++HASSPG
Sbjct  61   DGFRFPLYAHLCLTGDIRGQAKRMVERFKPDVIHASSPG  99



>ref|XP_009034698.1| hypothetical protein AURANDRAFT_52616 [Aureococcus anophagefferens]
 gb|EGB11152.1| hypothetical protein AURANDRAFT_52616 [Aureococcus anophagefferens]
Length=432

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 62/108 (57%), Gaps = 7/108 (6%)
 Frame = +3

Query  180  SDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEE-----  344
            SD  +  R++AL VEP+PF ++SGY NRFQ  +K+L   GD V+ V T + VPE      
Sbjct  37   SDTDTPQRKVALLVEPTPFTHVSGYANRFQEMLKHLERRGD-VVAVATPDDVPEAPASFG  95

Query  345  FYGAKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
             +    +G   F  PWY ++ LSL L    +  +    PD+VHASSPG
Sbjct  96   KFAVTTLGGFRFR-PWYPEICLSLDLDGAALQMIRDLDPDVVHASSPG  142



>ref|XP_001689662.1| sulfolipid synthase [Chlamydomonas reinhardtii]
 gb|EDP09400.1| sulfolipid synthase [Chlamydomonas reinhardtii]
Length=402

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 53/85 (62%), Gaps = 13/85 (15%)
 Frame = +3

Query  273  FIKYLREMGDEVMVVTTHEGV-------------PEEFYGAKLMGSQSFPCPWYRKVPLS  413
             I+YL E G +V+VVTT  G              PE F GA+++ + SF CPWY +VPL+
Sbjct  1    MIRYLVEAGCQVLVVTTGAGYTLPGVDASSFREQPETFAGARVVSALSFGCPWYLQVPLT  60

Query  414  LALSPRIISEVAQFKPDIVHASSPG  488
             ALSPRI  EV  F+PD++H SSPG
Sbjct  61   FALSPRIWREVRDFQPDLIHCSSPG  85



>gb|KIZ01145.1| hypothetical protein MNEG_6812, partial [Monoraphidium neglectum]
Length=94

 Score = 77.4 bits (189),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  201  RRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAK  359
            R++A+FVEPSPF++ISG KNRF++ IK LRE GDEVMVVT     P+EF GAK
Sbjct  42   RKVAIFVEPSPFSHISGMKNRFESLIKGLREAGDEVMVVTPDPTPPKEFCGAK  94



>gb|KDO53239.1| hypothetical protein CISIN_1g009759mg [Citrus sinensis]
Length=385

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 38/38 (100%), Gaps = 0/38 (0%)
 Frame = +3

Query  375  SFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            SFPCPWY+KVPLSLALSPRIISEVA+FKPDI+HASSPG
Sbjct  36   SFPCPWYQKVPLSLALSPRIISEVARFKPDIIHASSPG  73



>gb|EJK62906.1| hypothetical protein THAOC_16464 [Thalassiosira oceanica]
Length=482

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 63/103 (61%), Gaps = 6/103 (6%)
 Frame = +3

Query  198  PRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTH-----EGVPEEFYGAKL  362
            PR+IAL VEP+PF ++SGY NRF+  ++YL + GD V ++T       + +PEE +G K+
Sbjct  60   PRKIALLVEPTPFTHVSGYANRFKEMLRYLSKAGDNVDILTVDAKTPKDELPEESFGYKI  119

Query  363  MGSQSFPCPWYRKVPLSLALSP-RIISEVAQFKPDIVHASSPG  488
              +Q F  P Y  + L+  L   +    + + +PD++H +SPG
Sbjct  120  EHTQGFVFPLYDHISLTFDLPEMKGAKMMERRRPDLIHVTSPG  162



>ref|XP_005706721.1| sulfoquinovosyltransferase [Galdieria sulphuraria]
 gb|EME30201.1| sulfoquinovosyltransferase [Galdieria sulphuraria]
Length=561

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 57/99 (58%), Gaps = 2/99 (2%)
 Frame = +3

Query  198  PRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVT--THEGVPEEFYGAKLMGS  371
            P RI + +EPSPF ++SGY NRF   ++YL+E GD+V++V        P+E +G  ++  
Sbjct  142  PHRIVMIIEPSPFTHVSGYSNRFIETLRYLKEAGDDVLIVVPEVSGSAPKEIFGFPIVNI  201

Query  372  QSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
              F    Y  + LS        S + +FKPDIVH ++PG
Sbjct  202  PGFRFALYPNIVLSTGAYVDFFSVLYRFKPDIVHLATPG  240



>gb|EWM27152.1| gdp-mannose-dependent alpha-mannosyltransferase [Nannochloropsis 
gaditana]
Length=505

 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 57/103 (55%), Gaps = 2/103 (2%)
 Frame = +3

Query  186  MTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHE--GVPEEFYGAK  359
            M  RP R+ L VEP+PF ++SGY NRF+  +K+L   GD V + TT +    P +F   +
Sbjct  87   MFKRPLRVGLLVEPTPFTHVSGYANRFKEMLKHLHRTGDRVEICTTDDVPSAPPKFLDYR  146

Query  360  LMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            +  +  F  P Y  + LSL +       +  F+P I+H S+PG
Sbjct  147  INYTPGFRFPLYDHISLSLDVKLVAYQLLKVFRPHIIHVSTPG  189



>ref|XP_002185276.1| glycosyl transferase, group 1 [Phaeodactylum tricornutum CCAP 
1055/1]
 gb|EEC43145.1| glycosyl transferase, group 1 [Phaeodactylum tricornutum CCAP 
1055/1]
Length=507

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 63/104 (61%), Gaps = 8/104 (8%)
 Frame = +3

Query  198  PRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVT------THEGVPEEFYGAK  359
            PR+I L VEP+PF ++SGY NRF+  +K++ + GDEV ++T       HE +P    G  
Sbjct  64   PRKICLMVEPTPFTHVSGYANRFKEMLKFMAKAGDEVDILTVDTKTPAHE-LPTACSGFS  122

Query  360  LMGSQSFPCPWYRKVPLSLALSPRIISE-VAQFKPDIVHASSPG  488
            +  +Q F  P Y ++ L+  L     ++ + +FKPD++H +SPG
Sbjct  123  IKHTQGFTFPLYNQISLTFDLPEMKGAQMLEKFKPDLIHVTSPG  166



>ref|XP_002295162.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED87466.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
Length=366

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 57/97 (59%), Gaps = 6/97 (6%)
 Frame = +3

Query  216  FVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTH-----EGVPEEFYGAKLMGSQSF  380
             +EP+PF ++SGY NRF+  ++YL + GD V ++T       E +P+E +G  +  +Q F
Sbjct  1    MIEPTPFTHVSGYANRFKEMLRYLSKAGDNVDILTVDSKTPKEELPKEAFGYSIEHTQGF  60

Query  381  PCPWYRKVPLSLAL-SPRIISEVAQFKPDIVHASSPG  488
              P Y  + L++ L   +    + + +PD++H +SPG
Sbjct  61   VFPLYNHISLTVDLPEMKGAKMMERRRPDLIHVTSPG  97



>dbj|BAJ94304.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=358

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +3

Query  375  SFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            SFPCP Y+ VPLSLALSPRI S V++FKPDI+HA+SPG
Sbjct  28   SFPCPLYQNVPLSLALSPRIFSAVSKFKPDIIHATSPG  65



>ref|XP_005834049.1| hypothetical protein GUITHDRAFT_45198, partial [Guillardia theta 
CCMP2712]
 gb|EKX47069.1| hypothetical protein GUITHDRAFT_45198, partial [Guillardia theta 
CCMP2712]
Length=323

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 55/93 (59%), Gaps = 2/93 (2%)
 Frame = +3

Query  216  FVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGV--PEEFYGAKLMGSQSFPCP  389
             VEP+PF ++SGY NR+Q  ++Y+++  D++ +VT  +    PE F G  +  +  F   
Sbjct  1    IVEPTPFTHVSGYSNRYQEMLRYMQKAEDQIEIVTPDDSQDPPESFLGYPITYTPGFRFS  60

Query  390  WYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
             Y  + LSL  +   +  + +FKP+++H ++PG
Sbjct  61   LYNLICLSLDQNLVGMKMIERFKPEVLHVTTPG  93



>ref|WP_036004685.1| glycosyl transferase [Leptolyngbya sp. JSC-1]
Length=376

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R  + + +L+ MGD+V+V++   G+  E+ GAK+ G   FP
Sbjct  2    RIALFTE-TFLPKVDGIVTRLSHTVDHLQRMGDQVLVISPDGGL-NEYRGAKIYGIPGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P I  E+A F+PD++H  +P
Sbjct  60   LPLYPELKLALP-RPAIRQELAAFQPDLIHIVNP  92



>ref|WP_017309223.1| MULTISPECIES: glycosyl transferase [Stigonematales]
 gb|KIY10645.1| glycosyl transferase [Mastigocladus laminosus UU774]
Length=377

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ I++L+  GDEV+VV    G+  E+ GAK+ G   FP
Sbjct  2    RIALFTE-TFLPKVDGIVTRLRHTIEHLQRSGDEVLVVCPEGGI-TEYKGAKIYGVSGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ ++L   P I   + QF+PDI+H  +P
Sbjct  60   LPLYPELKMALP-RPAIGHTLEQFQPDIIHVVNP  92



>ref|WP_015158023.1| glycosyltransferase [Chamaesiphon minutus]
 gb|AFY91829.1| glycosyltransferase [Chamaesiphon minutus PCC 6605]
Length=376

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ I+ L   GDEV+V     G+ + ++GAK+ G  +FP
Sbjct  2    RIALFTE-TFLPKVDGIVTRLKHTIEQLTRHGDEVLVFCPDGGL-QSYHGAKIYGLSAFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P I  ++AQF+PD++H  +P
Sbjct  60   LPLYPELKLALP-RPEIGQQLAQFQPDLIHVVNP  92



>ref|WP_016866990.1| glycosyl transferase [Fischerella muscicola]
Length=377

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ I++L+  GDEV+V+    G+  E+ GAK+ G   FP
Sbjct  2    RIALFTE-TFLPKVDGIVTRLRHTIEHLQRSGDEVLVICPDGGI-TEYKGAKIYGVSGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ ++L   P I   + QF+PDI+H  +P
Sbjct  60   LPLYPELKMALP-RPAIGQILEQFQPDIIHVVNP  92



>emb|CAE20224.1| SqdX [Prochlorococcus marinus str. MIT 9313]
Length=409

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 54/98 (55%), Gaps = 3/98 (3%)
 Frame = +3

Query  192  SRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGS  371
            + P +IA F E +    + G   R    +++L E GDEVMV    EG P E+ GA+L+G 
Sbjct  26   AEPVKIAFFTE-TFLPKVDGIVTRLTKTVQHLVEAGDEVMVFCP-EGCPSEYMGAELIGV  83

Query  372  QSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             + P P Y ++ L+L   P +   +  F+PD+VH  +P
Sbjct  84   PAMPLPLYPELKLALP-RPAVAEALETFEPDLVHVVNP  120



>ref|WP_006617169.1| glycosyl transferase [Arthrospira platensis]
 dbj|BAI93034.1| sulfolipid sulfoquinovosyldiacylglycerol biosynthesis protein 
[Arthrospira platensis NIES-39]
 gb|KDR55946.1| glycosyl transferase [Arthrospira platensis str. Paraca]
Length=377

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    I G   R  +  + L  +GDEV++V+  EG   E+ G ++ G + FP
Sbjct  2    RIALFTE-TFLPKIDGIVTRLCHTAEQLNRLGDEVLIVSP-EGGLTEYKGCQIYGVEGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ + L   P I +++A+FKPDI+H ++P
Sbjct  60   LPMYPELKIGLP-HPGIGAKLAEFKPDIIHVANP  92



>ref|WP_015202192.1| group 1 glycosyl transferase [Crinalium epipsammum]
 gb|AFZ12070.1| glycosyl transferase group 1 [Crinalium epipsammum PCC 9333]
Length=377

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ +++L+  GD+V++ +   G+  E+ GAK+ G   FP
Sbjct  2    RIALFTE-TFLPKVDGIVTRLRHTVEHLQRNGDQVLIFSPDGGL-TEYKGAKIYGVSGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P I + + QFKPDI+H  +P
Sbjct  60   LPLYPELKLALP-RPSIGTALEQFKPDIIHVVNP  92



>ref|WP_006042635.1| glycosyl transferase [Synechococcus sp. WH 7805]
 gb|EAR17689.1| SqdX [Synechococcus sp. WH 7805]
Length=382

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 53/94 (56%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            +IA F E +    + G   R    +K+L E GDEV+V    EG PEE+ GA+L+G  + P
Sbjct  2    KIAFFTE-TFLPKVDGIVTRLTKTVKHLVEAGDEVIVFCP-EGCPEEYMGARLIGVPAMP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P +   +  F+PD++H  +P
Sbjct  60   LPLYPELKLALP-RPAVSEAIDSFEPDLIHVVNP  92



>ref|WP_035156195.1| glycosyl transferase [Calothrix sp. 336/3]
 gb|KFB85189.1| glycosyl transferase [Calothrix sp. 336/3]
Length=377

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ +++L+  G++VMV+    G+  E+ GAK+ G   FP
Sbjct  2    RIALFTE-TFLPKVDGIVTRLRHTVEHLQRQGNQVMVICPDGGM-TEYKGAKIYGVSGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P I   + QF+PDI+H  +P
Sbjct  60   LPLYPELKLALP-RPAIAEALEQFQPDIIHVVNP  92



>ref|WP_016863486.1| glycosyl transferase [Fischerella muscicola]
Length=377

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ +++L+  GDEV+VV    G+  E+ GAK+ G   FP
Sbjct  2    RIALFTE-TFLPKVDGIVTRLRHTVEHLQRSGDEVLVVCPEGGI-TEYKGAKVYGISGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ ++L   P I   + QF+PDI+H  +P
Sbjct  60   LPLYPELKMALP-RPAIGHILEQFQPDIIHVVNP  92



>ref|WP_009456118.1| MULTISPECIES: glycosyl transferase [Fischerella]
 gb|EHC16123.1| glycosyl transferase group 1 [Fischerella sp. JSC-11]
Length=377

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ I++L+  GDEV+V+    G+  E+ GAK+ G   FP
Sbjct  2    RIALFTE-TFLPKVDGIVTRLRHTIEHLQRSGDEVLVICPDGGI-TEYKGAKIYGVSGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ ++L   P I   + QF+PDI+H  +P
Sbjct  60   LPLYPELKMALP-RPAIGYILEQFQPDIIHVVNP  92



>ref|WP_008050780.1| glycosyl transferase [Arthrospira sp. PCC 8005]
 emb|CCE16509.1| glycosyltransferase (sulfolipid sulfoquinovosyldiacylglycerol 
biosynthesis protein) [Arthrospira sp. PCC 8005]
 emb|CDM95155.1| glycosyltransferase (sulfolipid sulfoquinovosyldiacylglycerol 
biosynthesis protein) [Arthrospira sp. PCC 8005]
Length=377

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    I G   R  +  + L  +GDEV++V+  EG   E+ G ++ G   FP
Sbjct  2    RIALFTE-TFLPKIDGIVTRLCHTAEQLNRLGDEVLIVSP-EGGLTEYKGCQIYGVDGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ + L   P I +++A+FKPDI+H ++P
Sbjct  60   LPMYPELKIGLP-HPGIGAKLAEFKPDIIHVANP  92



>ref|WP_006669182.1| glycosyl transferase [Arthrospira maxima]
 gb|EDZ94959.1| glycosyl transferase group 1 [Arthrospira maxima CS-328]
Length=377

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    I G   R  +  + L  +GDEV++V+  EG   E+ G ++ G   FP
Sbjct  2    RIALFTE-TFLPKIDGIVTRLCHTAEQLNRLGDEVLIVSP-EGGLTEYKGCQIYGVDGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ + L   P I +++A+FKPDI+H ++P
Sbjct  60   LPMYPELKIGLP-HPGIGAKLAEFKPDIIHVANP  92



>ref|WP_006625687.1| glycosyl transferase [Arthrospira platensis]
 gb|EKD06110.1| glycosyl transferase group 1 [Arthrospira platensis C1]
Length=377

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    I G   R  +  + L  +GDEV++V+  EG   E+ G ++ G   FP
Sbjct  2    RIALFTE-TFLPKIDGIVTRLCHTAEQLNRLGDEVLIVSP-EGGLTEYKGCQIYGVDGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ + L   P I +++A+FKPDI+H ++P
Sbjct  60   LPMYPELKIGLP-HPGIGAKLAEFKPDIIHVANP  92



>ref|WP_011931986.1| glycosyl transferase [Synechococcus sp. WH 7803]
 emb|CAK22478.1| Glycosyltransferase of family GT4; possible alpha-mannosyltransferase 
[Synechococcus sp. WH 7803]
Length=382

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            +IA F E +    + G   R    +K+L + GDEV+V    EG PEE+ GA+L+G  + P
Sbjct  2    KIAFFTE-TFLPKVDGIVTRLTKTVKHLVDAGDEVIVFCP-EGCPEEYMGARLIGVPAMP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P +   +  F+PD++H  +P
Sbjct  60   LPLYPELKLALP-RPAVSEAIDSFQPDLIHVVNP  92



>ref|WP_038551862.1| glycosyl transferase [Synechococcus sp. KORDI-52]
 gb|AII47975.1| glycosyl transferase [Synechococcus sp. KORDI-52]
Length=381

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            ++A F E +    + G   R    +K+L + GDEV VV   EG PEE+ GA+L+G  + P
Sbjct  2    KVAFFTE-TFLPKVDGIVTRLTKTVKHLVDAGDEV-VVFCPEGCPEEYMGARLIGVPAMP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P +   +  F+PD++H  +P
Sbjct  60   LPLYPELKLALP-RPAVSDAIDAFQPDLIHVVNP  92



>gb|AHF62481.1| SqdX [Synechococcus sp. WH 8109]
Length=381

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            ++A F E +    + G   R    +K+L + GDEV VV   EG PEE+ GA+L+G  + P
Sbjct  2    KVAFFTE-TFLPKVDGIVTRLTKTVKHLVDAGDEV-VVFCPEGCPEEYMGARLIGVPAMP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P +   +  F+PD++H  +P
Sbjct  60   LPLYPELKLALP-RPAVSDAIDAFQPDLIHVVNP  92



>ref|WP_011363092.1| glycosyl transferase [Synechococcus sp. CC9605]
 gb|ABB33830.1| SqdX [Synechococcus sp. CC9605]
Length=381

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            ++A F E +    + G   R    +K+L + GDEV VV   EG PEE+ GA+L+G  + P
Sbjct  2    KVAFFTE-TFLPKVDGIVTRLTKTVKHLVDAGDEV-VVFCPEGCPEEYMGARLIGVPAMP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P +   +  F+PD++H  +P
Sbjct  60   LPLYPELKLALP-RPAVSDAIDAFQPDLIHVVNP  92



>ref|WP_009768435.1| glycosyltransferase [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ67638.1| glycosyltransferase [Oscillatoriales cyanobacterium JSC-12]
Length=377

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ I +L+ +GD+V+V+    G+ +E  GA++ G   FP
Sbjct  2    RIALFTE-TFLPKVDGIVTRLRHTIDHLQRLGDQVLVIAPDGGL-KEHKGARVYGVSGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P I  E+ +F PD++H  +P
Sbjct  60   LPLYPELKLALP-RPAIGEELERFNPDLIHVVNP  92



>ref|WP_015156349.1| group 1 glycosyl transferase [Chroococcidiopsis thermalis]
 gb|AFY89809.1| glycosyl transferase group 1 [Chroococcidiopsis thermalis PCC 
7203]
Length=379

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            +IALF E +    + G   R ++ +++L+  GD V+VV    G+ E + GAK+ G   FP
Sbjct  2    KIALFTE-TFLPKVDGIVTRLRHTVEHLQRNGDRVLVVAPEGGITE-YQGAKVYGVSGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ ++L   P I  E+ +F+PDIVH  +P
Sbjct  60   LPLYPELKMALP-RPAIGHELERFQPDIVHVVNP  92



>emb|CBJ27895.1| UDP-sulfoquinovose: diacylglycerol alpha-sulfoquinovosyltransferase 
SQD2, N-terminal fragment, family GT4 [Ectocarpus siliculosus]
Length=193

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +3

Query  192  SRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHE  329
            S P ++AL VEP+PF +ISGY NRF+  +K+L + GDEV ++TT +
Sbjct  91   SPPLKVALLVEPTPFTHISGYSNRFREMLKFLSKAGDEVEILTTDD  136



>ref|WP_017303625.1| glycosyl transferase [Spirulina subsalsa]
Length=377

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 57/94 (61%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ ++ L+  GD+V+VV    G+ +E++GAK+ G  +FP
Sbjct  2    RIALFTE-TFLPKVDGIVTRLRHTVEQLQRQGDQVLVVCPDGGM-KEYHGAKIYGLSAFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ ++L   P I   + +FKPD++H  +P
Sbjct  60   LPMYPELKVALP-RPSIRKALDKFKPDLIHVVNP  92



>ref|WP_009788501.1| glycosyl transferase [Synechococcus sp. BL107]
 gb|EAU71135.1| SqdX [Synechococcus sp. BL107]
Length=382

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            +IA F E +    + G   R    +K+L + GDEV VV   EG P+E+ GA+L+G  + P
Sbjct  2    KIAFFTE-TFLPKVDGIVTRLTKTVKHLVDAGDEV-VVFCPEGCPDEYMGARLIGVPAMP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P +   +  F+PD++H  +P
Sbjct  60   LPLYPELKLALP-RPAVSDAIDSFQPDLIHVVNP  92



>ref|WP_006101106.1| glycosyl transferase [Coleofasciculus chthonoplastes]
 gb|EDX75396.1| glycosyl transferase, group 1 family protein [Coleofasciculus 
chthonoplastes PCC 7420]
Length=377

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ + +L+  GD+V+V+    G+ E   GAK+ G  +FP
Sbjct  2    RIALFTE-TFLPKVDGIVTRLRHTVDHLQRNGDQVLVICPDGGLTEH-KGAKIYGVSAFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P I   +A+FKPD++H  +P
Sbjct  60   LPLYPELKLALP-RPAIGIALAKFKPDVIHVVNP  92



>ref|WP_028953281.1| glycosyl transferase [Synechococcus sp. CC9616]
Length=381

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            ++A F E +    + G   R    +K+L + GDEV VV   EG PEE+ GA+L+G  + P
Sbjct  2    KVAFFTE-TFLPKVDGIVTRLTKTVKHLVDAGDEV-VVFCPEGCPEEYMGARLIGVPAMP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P +   +  F+PD++H  +P
Sbjct  60   LPLYPELKLALP-RPAVSDAIDAFQPDLIHVVNP  92



>ref|WP_039713912.1| glycosyl transferase [Scytonema millei]
 gb|KIF21612.1| glycosyl transferase [Scytonema millei VB511283]
Length=379

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            +IALF E +    + G   R ++ +++L+  GD V+VV    G+ E + GAK+ G   FP
Sbjct  2    KIALFTE-TFLPKVDGIVTRLRHTVEHLQRNGDRVLVVAPEGGITE-YKGAKVYGVSGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ ++L   P I  E+ +F+PDIVH  +P
Sbjct  60   LPLYPELKMALP-RPAIGHELERFQPDIVHVVNP  92



>ref|WP_040054255.1| glycosyl transferase [Candidatus Atelocyanobacterium thalassa]
 gb|KFF42113.1| glycosyltransferase [Candidatus Atelocyanobacterium thalassa 
isolate SIO64986]
Length=372

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 53/94 (56%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    I G   R    I YL+  GD+VMV + + G+ EE+ GA++ G+   P
Sbjct  2    RIALFTE-TFLPKIDGIVTRLCQTIDYLQRSGDQVMVFSPNGGI-EEYKGAEIYGANGIP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+   +P I   +  FKPD++H  +P
Sbjct  60   LPLYPELKLAFP-TPTIGKRLEIFKPDLIHVVNP  92



>ref|WP_036533451.1| glycosyl transferase [Neosynechococcus sphagnicola]
 gb|KGF72549.1| glycosyl transferase [Neosynechococcus sphagnicola sy1]
Length=377

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ +++L+  GD+V+V +   G+  E+ GA++ G   FP
Sbjct  2    RIALFTE-TFLPKVDGIVTRLRHTVEHLQRAGDQVLVFSPDGGL-TEYMGARIHGVSGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P I   + QF+PD+VH  +P
Sbjct  60   LPLYPELKLALP-RPAIGQALKQFRPDVVHVVNP  92



>ref|WP_026733611.1| glycosyl transferase [Fischerella sp. PCC 9605]
Length=377

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ I++L+  GDEV+V+    G+  E+ GA++ G   FP
Sbjct  2    RIALFTE-TFLPKVDGIVTRLRHTIEHLQRSGDEVLVICPDGGI-SEYKGAQIYGVSGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ ++L   P I   + QF+PDI+H  +P
Sbjct  60   LPLYPELKMALP-RPAIGYILEQFQPDIIHVVNP  92



>ref|WP_026720234.1| glycosyl transferase [Fischerella sp. PCC 9431]
Length=377

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ +++L+  GDEV+VV    G+  E+ GA++ G   FP
Sbjct  2    RIALFTE-TFLPKVDGIVTRLRHTVEHLQRSGDEVLVVCPEGGI-TEYKGAQVYGISGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ ++L   P I   + QF+PDI+H  +P
Sbjct  60   LPLYPELKMALP-RPAIGHILEQFQPDIIHVVNP  92



>ref|WP_007099486.1| glycosyl transferase [Synechococcus sp. RS9916]
 gb|EAU75389.1| SqdX [Synechococcus sp. RS9916]
Length=381

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 52/94 (55%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            ++A F E +    + G   R    +K+L + GDEVMV    EG P+ + GAKL+G  + P
Sbjct  2    KVAFFTE-TFLPKVDGIVTRLTKTVKHLVDAGDEVMVFCP-EGCPDNYMGAKLVGVPAMP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P +   +  F+PD++H  +P
Sbjct  60   LPLYPELKLALP-RPAVSDAIDAFQPDLIHVVNP  92



>ref|WP_011824740.1| glycosyl transferase [Prochlorococcus marinus]
 gb|ABM76807.1| SqdX [Prochlorococcus marinus str. MIT 9303]
Length=381

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 52/94 (55%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            +IA F E +    + G   R    +++L E GDEVMV    EG P E+ GA+L+G  + P
Sbjct  2    KIAFFTE-TFLPKVDGIVTRLTKTVQHLVEAGDEVMVFCP-EGCPSEYMGAELIGVPAMP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P +   +  F+PD+VH  +P
Sbjct  60   LPLYPELKLALP-RPAVAEALETFEPDLVHVVNP  92



>ref|WP_009786934.1| glycosyl transferase [Lyngbya sp. PCC 8106]
 gb|EAW34534.1| Glycosyl transferase, group 1 [Lyngbya sp. PCC 8106]
Length=377

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 57/94 (61%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            R+ALF E +    I G   R  + + +LR  GD+V++V+   G+ +E+ G ++ G + FP
Sbjct  2    RVALFTE-TFLPKIDGIVTRLCHTVDHLRRAGDQVLIVSPEGGI-KEYKGCQIFGVEGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ +++   P + S++  F+PD++H ++P
Sbjct  60   LPMYPELKIAIP-HPGVGSKLEAFRPDLIHVANP  92



>ref|WP_041384827.1| glycosyl transferase [Prochlorococcus marinus]
Length=381

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 52/94 (55%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            +IA F E +    + G   R    +++L E GDEVMV    EG P E+ GA+L+G  + P
Sbjct  2    KIAFFTE-TFLPKVDGIVTRLTKTVQHLVEAGDEVMVFCP-EGCPSEYMGAELIGVPAMP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P +   +  F+PD+VH  +P
Sbjct  60   LPLYPELKLALP-RPAVAEALETFEPDLVHVVNP  92



>ref|WP_011126929.1| glycosyl transferase [Synechococcus sp. WH 8102]
 emb|CAE06566.1| SqdX [Synechococcus sp. WH 8102]
Length=381

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 53/94 (56%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            +IA F E +    + G   R    +++L E GDEV+V    EG P+E+ GA+L+G  + P
Sbjct  2    KIAFFTE-TFLPKVDGIVTRLTKTVRHLVEAGDEVIVFCP-EGCPDEYMGARLIGVPAMP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P +   +  F+PD++H  +P
Sbjct  60   LPLYPELKLALP-RPAVSEAIDSFQPDLIHVVNP  92



>ref|WP_027254623.1| glycosyl transferase [Planktothrix agardhii]
Length=377

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 57/94 (61%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    I G   R  + ++ L+ +GD+V+V++   G+  E+ GA++ G + FP
Sbjct  2    RIALFTE-TFLPKIDGIVTRLCHTVEQLQRLGDQVLVISPAGGL-TEYKGARIYGVEGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L +   P I  E+ +F+PD++H ++P
Sbjct  60   LPLYPELKLGIP-HPGIGVELEKFQPDLIHVANP  92



>gb|AFZ29723.1| glycosyl transferase group 1 [Gloeocapsa sp. PCC 7428]
Length=400

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 53/97 (55%), Gaps = 3/97 (3%)
 Frame = +3

Query  195  RPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQ  374
            +P RIALF E +    + G   R  + I +L+  G++VMV     G+ E + GAK+ G  
Sbjct  21   QPMRIALFTE-TFLPKVDGIVTRLSHTIDHLQRNGNQVMVFAPEGGIAE-YKGAKVHGIS  78

Query  375  SFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             FP P Y ++ L+L   P I   +  F+PDI+H  +P
Sbjct  79   GFPLPLYPELKLALP-RPAIGHALENFQPDIIHVVNP  114



>ref|WP_015168332.1| glycosyltransferase [Synechococcus sp. PCC 7502]
 gb|AFY73674.1| glycosyltransferase [Synechococcus sp. PCC 7502]
Length=380

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 54/95 (57%), Gaps = 3/95 (3%)
 Frame = +3

Query  201  RRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSF  380
            R++A+F E +    + G   R ++ +  L ++GDEV+V     G+  E+ GAK+ G   F
Sbjct  2    RKVAIFTE-TFLPKVDGIVTRLKHTVAELVKLGDEVIVFAPDGGI-TEYAGAKVYGVSGF  59

Query  381  PCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
            P P Y ++ ++L   P I  E+ QF PDIVH  +P
Sbjct  60   PLPLYPELKVALP-RPSIGYEIEQFAPDIVHVVNP  93



>ref|WP_026797347.1| glycosyl transferase [Planktothrix prolifica]
Length=377

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 57/94 (61%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    I G   R  + ++ L+ +GD+V+V++   G+  E+ GA++ G + FP
Sbjct  2    RIALFTE-TFLPKIDGIVTRLCHTVEQLQRLGDQVLVISPAGGL-TEYKGARIYGVEGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L +   P I  E+ +F+PD++H ++P
Sbjct  60   LPLYPELKLGIP-HPGIGVELEKFRPDLIHVANP  92



>ref|WP_042156569.1| glycosyl transferase [Planktothrix agardhii]
 gb|KEI69010.1| Glycosyl transferase group 1 [Planktothrix agardhii NIVA-CYA 
126/8]
Length=377

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 57/94 (61%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    I G   R  + ++ L+ +GD+V+V++   G+  E+ GA++ G + FP
Sbjct  2    RIALFTE-TFLPKIDGIVTRLCHTVEQLQRLGDQVLVISPAGGL-TEYKGARIYGVEGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L +   P I  E+ +F+PD++H ++P
Sbjct  60   LPLYPELKLGIP-HPGIGVELEKFRPDLIHVANP  92



>ref|WP_011358891.1| glycosyl transferase [Synechococcus sp. CC9902]
 gb|ABB25023.1| SqdX [Synechococcus sp. CC9902]
Length=382

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            +IA F E +    + G   R    +K+L + GDEV VV   EG P+E+ GA+L+G  + P
Sbjct  2    KIAFFTE-TFLPKVDGIVTRLTKTVKHLVDAGDEV-VVFCPEGCPDEYMGARLIGVPAMP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P +   +  F+PD++H  +P
Sbjct  60   LPLYPELKLALP-RPAVSEAIDTFEPDLIHVVNP  92



>gb|ACB50919.1| probable sulfolipid sulfoquinovosyldiacylglycerol biosynthesis 
protein [Cyanothece sp. ATCC 51142]
Length=387

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 56/96 (58%), Gaps = 3/96 (3%)
 Frame = +3

Query  198  PRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQS  377
            P RIALF E +    I G   R ++ + +L+  GD+V+V +   G+  E  GAK+ G + 
Sbjct  10   PMRIALFTE-TFLPKIDGIVTRLRHTVDHLQRNGDQVLVFSPDGGL-REHKGAKIHGIKG  67

Query  378  FPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P P Y ++ L++  +P++   + +FKPD++H  +P
Sbjct  68   IPLPLYPELKLAIP-TPKVGKALEKFKPDLIHVVNP  102



>ref|WP_026793415.1| MULTISPECIES: glycosyl transferase [Planktothrix]
Length=377

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 57/94 (61%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    I G   R  + ++ L+ +GD+V+V++   G+  E+ GA++ G + FP
Sbjct  2    RIALFTE-TFLPKIDGIVTRLCHTVEQLQRLGDQVLVISPAGGL-TEYKGARIYGVEGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L +   P I  E+ +F+PD++H ++P
Sbjct  60   LPLYPELKLGIP-HPGIGVELEKFQPDLIHVANP  92



>gb|EHA59149.1| glycosyl transferase group 1 [Synechococcus sp. WH 8016]
Length=391

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 52/98 (53%), Gaps = 3/98 (3%)
 Frame = +3

Query  192  SRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGS  371
              P RIA F E +    + G   R    +K+L + GDEV VV   EG P  + GAK++G 
Sbjct  8    DEPLRIAFFTE-TFLPKVDGIVTRLTKTVKHLVDAGDEV-VVFCPEGAPSNYMGAKVVGV  65

Query  372  QSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             + P P Y ++ L+L   P +   +  F+PD++H  +P
Sbjct  66   PAMPLPLYPELKLALP-RPAVSEAIDAFQPDLIHVVNP  102



>ref|WP_008230224.1| Glycosyltransferase [Richelia intracellularis]
 emb|CCH65834.1| Glycosyltransferase [Richelia intracellularis HM01]
Length=372

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 54/94 (57%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            +IALF E +    + G   R ++ I+ L+  GD+V+V+    G+  E+ GAK+ G   FP
Sbjct  2    KIALFTE-TFLPKVDGIVTRLRHTIEQLQNQGDQVLVICPDGGI-SEYKGAKIYGVSGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ ++L   P II  +  F+PD++H  +P
Sbjct  60   LPLYPELKMALP-RPSIIQALDNFEPDLIHVVNP  92



>emb|CCH68234.1| Glycosyltransferase [Richelia intracellularis HH01]
Length=385

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 59/104 (57%), Gaps = 3/104 (3%)
 Frame = +3

Query  174  LESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYG  353
            L+S + +   +IALF E +    + G   R ++ I+ L+  GD+V+V+    G+  E+ G
Sbjct  5    LQSYLANVFMKIALFTE-TFLPKVDGIVTRLRHTIEQLQNQGDQVLVICPDGGI-SEYKG  62

Query  354  AKLMGSQSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
            AK+ G   FP P Y ++ ++L   P II  +  F+PD++H  +P
Sbjct  63   AKVYGVSGFPLPLYPELKMALP-RPSIIQALDNFEPDLIHVVNP  105



>ref|WP_015165224.1| group 1 glycosyl transferase [Pseudanabaena sp. PCC 7367]
 gb|AFY70261.1| glycosyl transferase group 1 [Pseudanabaena sp. PCC 7367]
Length=379

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 55/95 (58%), Gaps = 3/95 (3%)
 Frame = +3

Query  201  RRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSF  380
            R++A+F E +    + G   R ++ ++ L ++GDEVM+     G+  E+ GAK+ G   F
Sbjct  2    RKVAIFTE-TFLPKVDGIVTRLKHTVENLVKLGDEVMIFAPDGGL-TEYCGAKIYGVSGF  59

Query  381  PCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
            P P Y ++ L+L   P I   + QF+PDIVH  +P
Sbjct  60   PLPMYPELKLALP-RPSIGYALEQFQPDIVHLINP  93



>ref|WP_019501737.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=379

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 54/96 (56%), Gaps = 3/96 (3%)
 Frame = +3

Query  201  RRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSF  380
            R++A+F E +    I G   R +  ++ L ++GDEVMV     G+  E+ GA++ G   F
Sbjct  2    RKVAIFTE-TFLPKIDGIVTRLKYTVENLVQLGDEVMVFAPDGGI-REYCGAEVYGVSGF  59

Query  381  PCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
            P P Y ++ L+L   P I   + QF+PDIVH  +P 
Sbjct  60   PLPLYPELKLALP-RPSIGYALEQFQPDIVHVVNPA  94



>ref|WP_042341390.1| glycosyl transferase [Calothrix sp. PCC 7507]
Length=379

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 55/95 (58%), Gaps = 3/95 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    I G   R +  I++L+  G++++V+    G+  E+ GAK+ G   FP
Sbjct  2    RIALFTE-TFLPKIDGITTRLRYTIEHLQRNGNQILVIAPDGGI-SEYKGAKVYGVSGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
             P Y ++ ++L   P I S + +F+PDI+H  +P 
Sbjct  60   LPLYPELKIALP-RPAIASVLKEFQPDIIHVVNPA  93



>ref|WP_015184883.1| glycosyltransferase [Microcoleus sp. PCC 7113]
 gb|AFZ20750.1| glycosyltransferase [Microcoleus sp. PCC 7113]
Length=377

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R  + +++L+  GD+V+V++   G+  E+ GAK+ G   FP
Sbjct  2    RIALFTE-TFLPKVDGIVTRLCHTVEHLQRNGDQVLVISPDGGL-TEYKGAKIYGVSGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P I   + QF+PD++H  +P
Sbjct  60   LPLYPELKLALP-RPSIGVALEQFRPDLIHVVNP  92



>gb|AFY33983.1| glycosyl transferase group 1 [Calothrix sp. PCC 7507]
Length=388

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 55/95 (58%), Gaps = 3/95 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    I G   R +  I++L+  G++++V+    G+  E+ GAK+ G   FP
Sbjct  11   RIALFTE-TFLPKIDGITTRLRYTIEHLQRNGNQILVIAPDGGI-SEYKGAKVYGVSGFP  68

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
             P Y ++ ++L   P I S + +F+PDI+H  +P 
Sbjct  69   LPLYPELKIALP-RPAIASVLKEFQPDIIHVVNPA  102



>ref|WP_044304974.1| glycosyl transferase [Richelia intracellularis]
Length=372

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 54/94 (57%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            +IALF E +    + G   R ++ I+ L+  GD+V+V+    G+  E+ GAK+ G   FP
Sbjct  2    KIALFTE-TFLPKVDGIVTRLRHTIEQLQNQGDQVLVICPDGGI-SEYKGAKVYGVSGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ ++L   P II  +  F+PD++H  +P
Sbjct  60   LPLYPELKMALP-RPSIIQALDNFEPDLIHVVNP  92



>ref|WP_043694049.1| glycosyl transferase [Synechococcus sp. KORDI-49]
 gb|AII46613.1| glycosyl transferase [Synechococcus sp. KORDI-49]
Length=381

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 53/94 (56%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            ++A F E +    + G   R    +++L E GDEV VV   EG PEE+ GA+++G  + P
Sbjct  2    KVAFFTE-TFLPKVDGIVTRLTKTVRHLVEAGDEV-VVFCPEGCPEEYMGARVIGVPAMP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P +   +  F+PD++H  +P
Sbjct  60   LPLYPELKLALP-RPAVSEAIDSFQPDLIHVVNP  92



>ref|WP_023066667.1| glycosyl transferases group 1 family protein [Lyngbya aestuarii]
 gb|ERT07174.1| glycosyl transferases group 1 family protein [Lyngbya aestuarii 
BL J]
Length=377

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 57/94 (61%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            R+ALF E +    I G   R  + + +LR  GD+V++V+   G+ +E+ G ++ G + FP
Sbjct  2    RVALFTE-TFLPKIDGIVTRLCHTVDHLRRAGDQVLIVSPEGGI-KEYKGCQIFGVEGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ +++   P + +++  F+PD++H ++P
Sbjct  60   LPMYPELKIAIP-HPGVGTKLEAFRPDLIHVANP  92



>ref|WP_015223063.1| group 1 glycosyl transferase [Cyanobacterium stanieri]
 gb|AFZ47747.1| glycosyl transferase group 1 [Cyanobacterium stanieri PCC 7202]
Length=378

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 58/94 (62%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ +++L++ GDEV++ +  EG  +E+ GAK+ G +  P
Sbjct  2    RIALFTE-TFLPKVDGIVTRLKHTVEHLQKQGDEVLIFSP-EGGLKEYKGAKINGIKGIP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L++  +P I   + +FKPD+VH  +P
Sbjct  60   LPLYPELKLAIP-NPSIRFALQRFKPDLVHVVNP  92



>gb|KIJ83524.1| glycosyl transferase [Scytonema tolypothrichoides VB-61278]
Length=377

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 53/95 (56%), Gaps = 3/95 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ + YL+  G +V+V+    G+ E + GAK+ G   FP
Sbjct  2    RIALFTE-TFLPKVDGIVTRLRHTVDYLQRHGHQVLVIAPDGGIVE-YKGAKVYGVSGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
             P Y ++ ++L   P I   + +FKPDI+H  +P 
Sbjct  60   LPLYPELKMALP-RPAIGEALEEFKPDIIHVVNPA  93



>ref|WP_015124487.1| glycosyltransferase [Synechococcus sp. PCC 6312]
 gb|AFY60944.1| glycosyltransferase [Synechococcus sp. PCC 6312]
Length=379

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 56/95 (59%), Gaps = 3/95 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            R+AL  E +    + G   R    +++L+E+GD+V+V++   G+ +E+ GA++ G   FP
Sbjct  2    RVALVTE-TFLPKVDGIVTRLCQTVRHLQELGDQVLVISPAGGI-KEYCGAQVHGVTGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSPG  488
             P Y ++ L+L   P I + +  F+PD++H  +P 
Sbjct  60   LPLYPELKLALP-RPSIQTAIEAFQPDLIHVVNPA  93



>ref|WP_015220908.1| group 1 glycosyl transferase [Cyanobacterium aponinum]
 gb|AFZ55189.1| glycosyl transferase group 1 [Cyanobacterium aponinum PCC 10605]
Length=376

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 58/94 (62%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ +++L++ GDEV++ +  EG  +E+ GAK+ G +  P
Sbjct  2    RIALFTE-TFLPKVDGIVTRLKHTVEHLQKQGDEVLIFSP-EGGLKEYKGAKINGIKGIP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L++  +P I   + +FKPD+VH  +P
Sbjct  60   LPLYPELKLAIP-NPSIGFSLRRFKPDLVHVVNP  92



>ref|WP_013323818.1| glycosyl transferase [Cyanothece sp. PCC 7822]
 gb|ADN15750.1| glycosyl transferase group 1 [Cyanothece sp. PCC 7822]
Length=377

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    I G   R ++ +++L+  GD+V+VV   EG  +E+ GAK+ G    P
Sbjct  2    RIALFTE-TFLPKIDGIVTRLRHTVEHLQRNGDQVLVVCP-EGGLKEYKGAKIHGVSGMP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P +   + +FKPD++H  +P
Sbjct  60   LPLYPELKLALP-RPTLRWAIEKFKPDLIHVVNP  92



>ref|WP_011316987.1| glycosyl transferase [Anabaena variabilis]
 gb|ABA19716.1| Glycosyl transferase, group 1 [Anabaena variabilis ATCC 29413]
Length=378

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 54/94 (57%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ + +L+ +G+EV+V+    GV E   GAK+ G   FP
Sbjct  2    RIALFTE-TFLPKVDGIVTRLRHTVDHLQRLGNEVLVIAPDGGVTEH-KGAKVYGVSGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ ++L   P I   + +F+PDI+H  +P
Sbjct  60   LPLYPELKMALP-RPAIGYALEEFQPDIIHVVNP  92



>ref|WP_017662025.1| glycosyl transferase [Geitlerinema sp. PCC 7105]
Length=377

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 57/94 (61%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ +++L+ +GDEV+VV    G+  E+ GA+++G   FP
Sbjct  2    RIALFTE-TFLPKVDGIVTRLRHTVEHLQRLGDEVLVVCPDGGL-TEYKGAQILGVPGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L++  +P I   + +F PD++H  +P
Sbjct  60   LPLYPELKLAVP-NPSIRPVLEEFAPDLIHIVNP  92



>ref|WP_015200905.1| group 1 glycosyl transferase [Calothrix parietina]
 gb|AFZ04296.1| glycosyl transferase group 1 [Calothrix sp. PCC 6303]
Length=378

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 53/94 (56%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R  + + +L+  G++V+VV   EG   E+ GAK+ G   FP
Sbjct  2    RIALFTE-TFLPKVDGIVTRLSHTVDHLQRQGNQVLVVCP-EGGMTEYKGAKIYGVSGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P I   + +F+PDI+H  +P
Sbjct  60   LPLYPELKLALP-RPSIGEALERFRPDIIHVVNP  92



>ref|WP_015170725.1| group 1 glycosyl transferase [Geitlerinema sp. PCC 7407]
 gb|AFY65157.1| glycosyl transferase group 1 [Geitlerinema sp. PCC 7407]
Length=376

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 53/94 (56%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ + YL+ +GD+V+V     G+  E+ GAK+ G   FP
Sbjct  2    RIALFTE-TFLPKVDGIVTRLRHTVDYLQRLGDQVLVFAPEGGI-REYRGAKIEGIPGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L++   P I   +  F+PD++H  +P
Sbjct  60   LPLYPELKLAIP-RPTIRQSLELFQPDLIHVVNP  92



>ref|WP_007101086.1| glycosyl transferase [Synechococcus sp. RS9917]
 gb|EAQ70275.1| SqdX [Synechococcus sp. RS9917]
Length=381

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 51/94 (54%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            +IA F E +    + G   R    +K+L E GDEV+V    EG P E+ GA ++G  + P
Sbjct  2    KIAFFTE-TFLPKVDGIVTRLTKTVKHLVEAGDEVLVFCP-EGAPSEYMGAGVIGVPAMP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P +   +  F+PD+VH  +P
Sbjct  60   LPLYPELKLALP-RPAVSEAIDAFQPDLVHVVNP  92



>gb|KIE08753.1| glycosyl transferase [Tolypothrix bouteillei VB521301]
Length=370

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 54/94 (57%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ I +L+  G++V+V+    G+  E+ GA++ G   FP
Sbjct  2    RIALFTE-TFLPKVDGIVTRLRHTIDHLQRNGNQVLVIAPDGGI-TEYKGARVYGVSGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ ++L   P I   + +FKPDI+H  +P
Sbjct  60   LPLYPELKMALP-RPAIGHTLEEFKPDIIHVVNP  92



>ref|WP_015175196.1| glycosyl transferase group 1 [Oscillatoria nigro-viridis]
 gb|AFZ05874.1| glycosyl transferase group 1 [Oscillatoria nigro-viridis PCC 
7112]
Length=377

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            +IALF E +    I G   R  + + +L+  G++VM+ +   G+ +E+ GA++ G +  P
Sbjct  2    KIALFTE-TFLPKIDGIVTRLIHTVDHLQRAGEQVMIFSPDYGI-KEYKGARVYGVEGLP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ ++L  SP +  ++ QFKPDI+H  +P
Sbjct  60   LPMYPELKMALP-SPAVGRQLQQFKPDIIHVVNP  92



>ref|WP_010996422.1| glycosyl transferase [Nostoc sp. PCC 7120]
 dbj|BAB73964.1| sulfolipid sulfoquinovosyldiacylglycerol biosynthesis protein 
[Nostoc sp. PCC 7120]
Length=378

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 54/94 (57%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ + +L+ +G+EV+V+    G+ E   GAK+ G   FP
Sbjct  2    RIALFTE-TFLPKVDGIVTRLRHTVDHLQRLGNEVLVIAPDGGITEH-KGAKVYGVSGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ ++L   P I   + +F+PDI+H  +P
Sbjct  60   LPLYPELKMALP-RPAIGYALEEFQPDIIHVVNP  92



>ref|WP_036913154.1| MULTISPECIES: glycosyl transferase [Prochlorococcus]
 gb|KGG27004.1| Glycosyltransferase [Prochlorococcus sp. MIT 0701]
 gb|KGG27918.1| Glycosyltransferase [Prochlorococcus sp. MIT 0702]
 gb|KGG31359.1| Glycosyltransferase [Prochlorococcus sp. MIT 0703]
Length=381

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 52/94 (55%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            +IA F E +    + G   R    +++L + GDEVMV    EG P E+ GA+L+G  + P
Sbjct  2    KIAFFTE-TFLPKVDGIVTRLTKTVEHLVKAGDEVMVFCP-EGCPSEYMGAELIGVPAMP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P +   +  F+PD+VH  +P
Sbjct  60   LPLYPELKLALP-RPAVAEALETFEPDLVHVVNP  92



>ref|WP_008276523.1| glycosyl transferase [Cyanothece sp. CCY0110]
 gb|EAZ90322.1| hypothetical protein CY0110_04628 [Cyanothece sp. CCY0110]
Length=377

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    I G   R ++ + +L+  GD+V+V +   G+ +E  GAK+ G +  P
Sbjct  2    RIALFTE-TFLPKIDGIVTRLRHTVDHLQRNGDQVLVFSPDGGL-KEHKGAKIYGVKGIP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L++  +P++   + +FKPD++H  +P
Sbjct  60   LPLYPELKLAIP-TPKVGKALEKFKPDLIHVVNP  92



>ref|WP_009633426.1| glycosyltransferase [Synechocystis sp. PCC 7509]
Length=376

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 54/94 (57%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ +++L+  G+EV+V     G+  E+ GAK+ G   FP
Sbjct  2    RIALFTE-TFLPKVDGIVTRLRHTVEHLQRSGNEVIVFAPDGGI-TEYKGAKVYGVTGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ ++L   P I   + +FKPDI+H  +P
Sbjct  60   LPLYPELKMALP-RPAIGHALEEFKPDIIHVVNP  92



>ref|WP_017292828.1| glycosyl transferase [Geminocystis herdmanii]
Length=377

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 58/94 (62%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ +++L++ GDEV++ +  EG  +E+ GA++ G +  P
Sbjct  2    RIALFTE-TFLPKVDGIVTRLKHTVEHLQKQGDEVLIFSP-EGGLKEYKGARINGIKGIP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L++  +P I   + +FKPD+VH  +P
Sbjct  60   LPLYPELKLAIP-NPSIGFALQRFKPDLVHVVNP  92



>ref|XP_005767468.1| SQDG synthase [Emiliania huxleyi CCMP1516]
 gb|EOD15039.1| SQDG synthase [Emiliania huxleyi CCMP1516]
Length=660

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 45/78 (58%), Gaps = 2/78 (3%)
 Frame = +3

Query  174  LESDMTSRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVT--THEGVPEEF  347
            L  ++   P R+ L VEP+PF ++SGY NRF+ ++KY +  G EV ++T    E  P+ F
Sbjct  45   LPPEVDEVPMRVQLIVEPTPFTHVSGYANRFKEYLKYQKAAGAEVSIITPDDSEDAPKHF  104

Query  348  YGAKLMGSQSFPCPWYRK  401
             G  +   + F  P Y++
Sbjct  105  LGYPIATIRGFRFPLYKQ  122



>ref|WP_016872824.1| glycosyl transferase [Chlorogloeopsis fritschii]
Length=377

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ +++L+  GD+V+V+    G+  E+ GA++ G   FP
Sbjct  2    RIALFTE-TFLPKVDGIVTRLRHTVEHLQRRGDQVLVICPDGGM-TEYKGAQIYGVSGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ ++L   P I   + +F+PDIVH  +P
Sbjct  60   LPLYPELKMALP-RPAIGHTLEKFQPDIVHVVNP  92



>ref|WP_038014997.1| glycosyl transferase [Synechococcus sp. WH 8016]
Length=381

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 51/94 (54%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIA F E +    + G   R    +K+L + GDEV VV   EG P  + GAK++G  + P
Sbjct  2    RIAFFTE-TFLPKVDGIVTRLTKTVKHLVDAGDEV-VVFCPEGAPSNYMGAKVVGVPAMP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P +   +  F+PD++H  +P
Sbjct  60   LPLYPELKLALP-RPAVSEAIDAFQPDLIHVVNP  92



>ref|WP_032513539.1| glycosyl transferase [Prochlorococcus marinus]
Length=377

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 52/94 (55%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            +IALF E +    + G   R    I++L + GDEV+V    EG PE + GA + G  + P
Sbjct  2    KIALFTE-TFLPKVDGIVTRLTKTIEFLIKNGDEVIVFCP-EGCPESYMGATVFGVAAMP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L L   P +  ++ +FKPD++H  +P
Sbjct  60   LPLYPELKLGLP-GPAVSEKLEKFKPDLIHVVNP  92



>ref|WP_019494764.1| glycosyl transferase [Calothrix sp. PCC 7103]
Length=378

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 52/94 (55%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            +IALF E +    + G   R  + + +L+  GD+V+VV    G+  E+ GA++ G   FP
Sbjct  2    KIALFTE-TFLPKVDGIVTRLSHTVDHLQRNGDQVLVVCPEGGI-TEYRGAQIYGVSGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ ++L   P I   V  F+PDI+H  +P
Sbjct  60   LPLYPELKMALP-RPAIGEAVDNFRPDIIHVVNP  92



>ref|WP_024750270.1| MULTISPECIES: glycosyl transferase [Cyanothece]
Length=377

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    I G   R ++ + +L+  GD+V+V +   G+  E  GAK+ G +  P
Sbjct  2    RIALFTE-TFLPKIDGIVTRLRHTVDHLQRNGDQVLVFSPDGGL-REHKGAKIHGIKGIP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L++  +P++   + +FKPD++H  +P
Sbjct  60   LPLYPELKLAIP-TPKVGKALEKFKPDLIHVVNP  92



>ref|WP_011821147.1| glycosyl transferase [Prochlorococcus marinus]
 gb|ABM73063.1| SqdX [Prochlorococcus marinus str. MIT 9515]
Length=377

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 51/94 (54%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            +IA F E +    + G   R    I++L + GDEV+V    EG P  + GA ++G  + P
Sbjct  2    KIAFFTE-TFLPKVDGIVTRLTKTIEFLTKNGDEVIVFCP-EGCPNTYQGATIVGVAAMP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L L   P +  ++ QFKPD++H  +P
Sbjct  60   LPLYPELKLGLP-GPAVSDKLEQFKPDLIHVVNP  92



>ref|WP_036900899.1| glycosyl transferase [Prochlorococcus sp. MIT 0601]
 gb|KGG13696.1| Glycosyltransferase [Prochlorococcus sp. MIT 0601]
Length=382

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 51/94 (54%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            +IA F E +    + G   R    +++L + GDEV VV   EG PEE+ GAK++G  + P
Sbjct  2    KIAFFTE-TFLPKVDGIVTRLTKTVEHLVKAGDEV-VVFCPEGCPEEYMGAKVVGVPAMP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L L   P +   +   KPD++H  +P
Sbjct  60   LPLYPELKLGLP-GPAVSEALDTLKPDLIHVVNP  92



>ref|WP_007308077.1| glycosyl transferase [Crocosphaera watsonii]
 gb|EAM48125.1| Glycosyl transferase, group 1 [Crocosphaera watsonii WH 8501]
 gb|EHJ09949.1| Glycosyl transferase, group 1 [Crocosphaera watsonii WH 0003]
 emb|CCQ64204.1| Glycosyltransferase [Crocosphaera watsonii WH 0401]
 emb|CCQ52032.1| FIG00563136: hypothetical protein [Crocosphaera watsonii WH 8502]
 emb|CCQ55926.1| hypothetical protein CWATWH0005_2915 [Crocosphaera watsonii WH 
0005]
 emb|CCQ68798.1| Glycosyltransferase [Crocosphaera watsonii WH 0402]
Length=377

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    I G   R ++ + +L+  GD+V+V +   G+  E  GAK+ G +  P
Sbjct  2    RIALFTE-TFLPKIDGIVTRLRHTVDHLQRNGDQVLVFSPDGGL-REHKGAKIHGVKGIP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L++  +P++   + +FKPD++H  +P
Sbjct  60   LPLYPELKLAIP-TPQVGKALERFKPDLIHVVNP  92



>ref|WP_015136558.1| glycosyltransferase [Nostoc sp. PCC 7524]
 gb|AFY46091.1| glycosyltransferase [Nostoc sp. PCC 7524]
Length=376

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 53/94 (56%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ + +L+  G++V+V+    G+ E   GAK+ G   FP
Sbjct  2    RIALFTE-TFLPKVDGIVTRLRHTVDHLQRQGNQVLVIAPDGGITEH-KGAKVYGVSGFP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ ++L   P I   + QF+PDI+H  +P
Sbjct  60   LPLYPELKMALP-RPAIGYALEQFQPDIIHVVNP  92



>ref|WP_011133293.1| glycosyl transferase [Prochlorococcus marinus]
 emb|CAE20125.1| SqdX [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
 gb|KGF86912.1| Glycosyltransferase [Prochlorococcus marinus str. EQPAC1]
Length=377

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 52/94 (55%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            +IA F E +    + G   R    I++L + GDEV+V    EG P+ + GA ++G  + P
Sbjct  2    KIAFFTE-TFLPKVDGIVTRLTKTIEFLTKNGDEVIVFCP-EGCPDSYKGATIVGVAAMP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L L   P +  ++ +FKPD+VH  +P
Sbjct  60   LPLYPELKLGLP-GPAVSDKLEEFKPDLVHVVNP  92



>ref|WP_006910279.1| glycosyl transferase [Cyanobium sp. PCC 7001]
 gb|EDY38380.1| SqdX [Cyanobium sp. PCC 7001]
Length=382

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 53/94 (56%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            +IA F E +    + G   R    +++L  +GDEV++    EG PE + GA+++G  + P
Sbjct  2    KIAFFTE-TFLPKVDGIVTRLTKTVQHLVALGDEVLIFCP-EGAPEAYMGARVVGVPAMP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P +   + +F+PD+VH  +P
Sbjct  60   LPLYPELKLALP-RPAVAEALEEFQPDLVHVVNP  92



>ref|WP_040944740.1| glycosyl transferase, partial [Prochloron didemni]
Length=321

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ +++L+  GD+V+V++   G+  E+ GAK+ G    P
Sbjct  2    RIALFTE-TFLPKVDGIVTRLRHTVEHLQRRGDQVLVISPDGGL-TEYKGAKIYGVSGVP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+    P +   +A+F+PD++H  +P
Sbjct  60   LPLYPELTLAFP-GPNVGKVLAEFQPDLIHVVNP  92



>gb|ACO31913.1| glycosyl transferase, group 1 family [Acidobacterium capsulatum 
ATCC 51196]
Length=429

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 55/98 (56%), Gaps = 4/98 (4%)
 Frame = +3

Query  192  SRPRRIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGS  371
            +RP RIAL  E +    I G   R  + I+ LR  G EVM++   +G+ ++F GA + G 
Sbjct  6    ARPLRIALLTE-TFLPKIDGIVTRLCHTIRNLRRAGHEVMIIAP-KGI-DDFEGAPVYGV  62

Query  372  QSFPCPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
              FP P Y  + +++   P +   +A F+PDIVHA +P
Sbjct  63   SGFPFPLYPDLKIAIP-RPSVGEALAAFQPDIVHAINP  99



>ref|WP_012196344.1| glycosyl transferase [Prochlorococcus marinus]
 gb|ABX09724.1| SqdX [Prochlorococcus marinus str. MIT 9211]
Length=382

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 51/94 (54%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            +IA F E +    + G   R    +++L + GDEV+V    EG P+E+ GAK++G  + P
Sbjct  2    KIAFFTE-TFLPKVDGIVTRLTKTLEHLSKAGDEVIVFCP-EGCPDEYMGAKMIGVPAMP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L L   P +   +   KPD++H  +P
Sbjct  60   LPLYPELKLGLP-GPAVSEALENLKPDLIHVVNP  92



>ref|WP_015225187.1| group 1 glycosyl transferase [Halothece sp. PCC 7418]
 gb|AFZ43310.1| glycosyl transferase group 1 [Halothece sp. PCC 7418]
Length=377

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 3/94 (3%)
 Frame = +3

Query  204  RIALFVEPSPFAYISGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLMGSQSFP  383
            RIALF E +    + G   R ++ + YL++ GD+V+VV    G+  E  GA++ G    P
Sbjct  2    RIALFTE-TFLPKVDGIVTRLRHTVNYLQQGGDQVLVVAPDGGI-TEHKGARVYGVSGMP  59

Query  384  CPWYRKVPLSLALSPRIISEVAQFKPDIVHASSP  485
             P Y ++ L+L   P I   + +F+PD+VH  +P
Sbjct  60   LPLYPELKLALP-RPAIGEALEEFQPDLVHLVNP  92



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559954506960