BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF011K06

Length=575
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009797154.1|  PREDICTED: uncharacterized protein LOC104243632  71.6    7e-19   Nicotiana sylvestris
ref|XP_004245835.1|  PREDICTED: uncharacterized protein LOC101251207  70.5    1e-17   Solanum lycopersicum
ref|XP_009600967.1|  PREDICTED: uncharacterized protein LOC104096313  68.2    7e-17   Nicotiana tomentosiformis
emb|CDP13437.1|  unnamed protein product                              66.6    1e-09   Coffea canephora [robusta coffee]



>ref|XP_009797154.1| PREDICTED: uncharacterized protein LOC104243632 [Nicotiana sylvestris]
Length=500

 Score = 71.6 bits (174),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +2

Query  353  VLKSGPPSNNPPSFLCSCSLPVLLATKRITLRLLHHSCQASWLRVHMK  496
            +LKS   S N  SFLCSCS+PVLLATKRITL+L+HHSC  SW+RVH+K
Sbjct  94   ILKSNNSSKNQ-SFLCSCSVPVLLATKRITLKLIHHSCHVSWIRVHIK  140


 Score = 48.9 bits (115),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 5/48 (10%)
 Frame = +3

Query  117  RPDLEIEIPSCSDSGTHHHHQIHFKNEPFCPPIQSPTQTLVSTPHKRP  260
            + +L+I+IPS  DS T+   QIHF NEPFC   QSP +TL+STPHKRP
Sbjct  30   KINLQIKIPS-PDSSTN---QIHFINEPFCQN-QSPNKTLLSTPHKRP  72



>ref|XP_004245835.1| PREDICTED: uncharacterized protein LOC101251207 [Solanum lycopersicum]
Length=523

 Score = 70.5 bits (171),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 43/53 (81%), Gaps = 3/53 (6%)
 Frame = +2

Query  338  FRPTAVLKSGPPSNNPPSFLCSCSLPVLLATKRITLRLLHHSCQASWLRVHMK  496
            F+ T VLKS   SN   SFLC CS+PVLLATKRITLRLLHHSC ASW+RVH+K
Sbjct  116  FKAT-VLKSSSSSNQ--SFLCPCSIPVLLATKRITLRLLHHSCHASWIRVHLK  165


 Score = 45.8 bits (107),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 36/48 (75%), Gaps = 5/48 (10%)
 Frame = +3

Query  117  RPDLEIEIPSCSDSGTHHHHQIHFKNEPFCPPIQSPTQTLVSTPHKRP  260
            + +L+I+IPS  DS T+   QIHF++EP C   QSP +TL+STPHKRP
Sbjct  47   KINLQIKIPS-PDSSTN---QIHFRDEPICQN-QSPGKTLLSTPHKRP  89



>ref|XP_009600967.1| PREDICTED: uncharacterized protein LOC104096313 [Nicotiana tomentosiformis]
Length=504

 Score = 68.2 bits (165),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  353  VLKSGPPSNNPPSFLCSCSLPVLLATKRITLRLLHHSCQASWLRVHMK  496
            +LKS   S N  SFLC CS+PVL+ATKRITL+L+HHSC  SW+RVH+K
Sbjct  98   ILKSNNSSKNQ-SFLCPCSVPVLVATKRITLKLIHHSCHVSWIRVHLK  144


 Score = 45.8 bits (107),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 5/48 (10%)
 Frame = +3

Query  117  RPDLEIEIPSCSDSGTHHHHQIHFKNEPFCPPIQSPTQTLVSTPHKRP  260
            + +L+I+IPS  DS T+   QIH  NEPFC   QSP +TL+STPHKRP
Sbjct  34   KINLQIKIPS-PDSSTN---QIHIINEPFCQN-QSPNKTLLSTPHKRP  76



>emb|CDP13437.1| unnamed protein product [Coffea canephora]
Length=554

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 2/49 (4%)
 Frame = +2

Query  350  AVLKSGPPSNNPPSFLCSCSLPVLLATKRITLRLLHHSCQASWLRVHMK  496
            AVLKS   S+N  S+LCS S  VLLATKRITLR +HHSC ASW RVH+K
Sbjct  145  AVLKS--DSSNHQSYLCSPSFHVLLATKRITLRFIHHSCHASWFRVHLK  191



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750