BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF011E16

Length=589
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB83376.1|  hypothetical protein B456_013G244600                    322   8e-108   Gossypium raimondii
gb|KJB83377.1|  hypothetical protein B456_013G244600                    323   4e-107   Gossypium raimondii
ref|XP_010535935.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    325   2e-106   Tarenaya hassleriana [spider flower]
ref|XP_010535933.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    323   6e-106   Tarenaya hassleriana [spider flower]
ref|XP_008449886.1|  PREDICTED: tubulin alpha-3 chain isoform X2        322   1e-105   
ref|XP_009400845.1|  PREDICTED: tubulin alpha-3 chain                   323   1e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002532068.1|  tubulin alpha chain, putative                      323   1e-105   Ricinus communis
ref|XP_004504311.1|  PREDICTED: tubulin alpha-3 chain-like              322   2e-105   Cicer arietinum [garbanzo]
ref|XP_003629736.1|  Alpha-tubulin                                      322   2e-105   Medicago truncatula
gb|KJB83375.1|  hypothetical protein B456_013G244600                    322   2e-105   Gossypium raimondii
ref|XP_009389058.1|  PREDICTED: tubulin alpha-3 chain-like              322   2e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008240534.1|  PREDICTED: tubulin alpha-3 chain isoform X2        322   2e-105   Prunus mume [ume]
ref|XP_011089722.1|  PREDICTED: tubulin alpha-3 chain                   322   2e-105   Sesamum indicum [beniseed]
gb|EPS70933.1|  tubulin alpha-6 chain                                   316   2e-105   Genlisea aurea
gb|KHG06160.1|  Tubulin alpha-3/alpha-5 chain -like protein             322   2e-105   Gossypium arboreum [tree cotton]
ref|XP_010531152.1|  PREDICTED: tubulin alpha-3 chain                   322   3e-105   Tarenaya hassleriana [spider flower]
ref|XP_009353129.1|  PREDICTED: tubulin alpha-3 chain-like              322   4e-105   Pyrus x bretschneideri [bai li]
ref|XP_004149645.1|  PREDICTED: tubulin alpha-3 chain-like              322   4e-105   Cucumis sativus [cucumbers]
ref|XP_008449885.1|  PREDICTED: tubulin alpha-3 chain isoform X1        321   4e-105   Cucumis melo [Oriental melon]
emb|CBI16534.3|  unnamed protein product                                320   5e-105   Vitis vinifera
ref|XP_009126388.1|  PREDICTED: tubulin alpha-3 chain-like              321   6e-105   Brassica rapa
ref|XP_008804327.1|  PREDICTED: tubulin alpha-1 chain-like              321   6e-105   Phoenix dactylifera
ref|XP_009126389.1|  PREDICTED: tubulin alpha-3 chain-like              321   6e-105   Brassica rapa
emb|CDY44941.1|  BnaA02g04460D                                          321   7e-105   Brassica napus [oilseed rape]
ref|XP_010454260.1|  PREDICTED: tubulin alpha-3 chain-like              321   7e-105   Camelina sativa [gold-of-pleasure]
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             321   7e-105   Capsella rubella
ref|XP_006286795.1|  hypothetical protein CARUB_v10003470mg             321   7e-105   Capsella rubella
ref|XP_009126391.1|  PREDICTED: tubulin alpha-3 chain-like              321   7e-105   Brassica rapa
ref|XP_009120857.1|  PREDICTED: tubulin alpha-3 chain                   321   7e-105   Brassica rapa
emb|CDY42294.1|  BnaC02g09000D                                          321   7e-105   Brassica napus [oilseed rape]
ref|NP_197478.1|  tubulin alpha-3                                       321   7e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006584595.1|  PREDICTED: uncharacterized protein LOC100806...    320   7e-105   
emb|CAD26886.1|  alpha-tubulin                                          321   8e-105   Miscanthus sinensis
gb|AGD80034.1|  alpha-tubulin 1                                         320   9e-105   Hevea brasiliensis [jebe]
emb|CDP14299.1|  unnamed protein product                                320   9e-105   Coffea canephora [robusta coffee]
ref|NP_001105588.1|  tubulin alpha-6 chain                              320   1e-104   Zea mays [maize]
emb|CAD24766.1|  alpha-tubulin                                          320   1e-104   Miscanthus sinensis
emb|CDX88875.1|  BnaA03g07740D                                          320   1e-104   
ref|XP_010257632.1|  PREDICTED: tubulin alpha-3 chain                   320   1e-104   Nelumbo nucifera [Indian lotus]
ref|XP_009131752.1|  PREDICTED: tubulin alpha-3 chain-like              320   1e-104   Brassica rapa
ref|XP_007159433.1|  hypothetical protein PHAVU_002G237400g             320   1e-104   Phaseolus vulgaris [French bean]
sp|O22349.1|TBA3_ELEIN  RecName: Full=Tubulin alpha-3 chain; AltN...    320   1e-104   Eleusine indica [crabgrass]
gb|ACN40824.1|  unknown                                                 320   2e-104   Picea sitchensis
ref|XP_011075054.1|  PREDICTED: tubulin alpha-3 chain-like              320   2e-104   Sesamum indicum [beniseed]
ref|XP_007204346.1|  hypothetical protein PRUPE_ppa005649mg             320   2e-104   Prunus persica
ref|XP_008240533.1|  PREDICTED: tubulin alpha-3 chain isoform X1        320   2e-104   Prunus mume [ume]
gb|KDP39691.1|  hypothetical protein JCGZ_02711                         320   2e-104   Jatropha curcas
gb|AHZ58482.1|  alpha-tubulin                                           313   2e-104   Syntrichia caninervis
ref|XP_006657877.1|  PREDICTED: tubulin alpha-3 chain-like              319   3e-104   Oryza brachyantha
gb|EYU20672.1|  hypothetical protein MIMGU_mgv1a004180mg                322   3e-104   Erythranthe guttata [common monkey flower]
ref|XP_011078787.1|  PREDICTED: tubulin alpha-1 chain-like              319   3e-104   Sesamum indicum [beniseed]
emb|CAB77671.1|  alpha-tubulin                                          319   3e-104   Miscanthus sinensis f. glaber
ref|XP_010934670.1|  PREDICTED: tubulin alpha-3 chain-like              319   5e-104   Elaeis guineensis
gb|AGV54500.1|  tubulin A                                               318   5e-104   Phaseolus vulgaris [French bean]
gb|KDP42087.1|  hypothetical protein JCGZ_01875                         318   6e-104   Jatropha curcas
ref|XP_010923361.1|  PREDICTED: tubulin alpha-3 chain                   318   6e-104   Elaeis guineensis
dbj|BAJ06363.1|  alpha-tubulin                                          318   6e-104   Alopecurus aequalis
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   318   6e-104   Vitis vinifera
ref|XP_004170946.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    318   6e-104   
emb|CAD26891.1|  alpha-tubulin                                          318   7e-104   Miscanthus floridulus
ref|XP_008464962.1|  PREDICTED: tubulin alpha-3 chain-like              318   8e-104   Cucumis melo [Oriental melon]
ref|XP_004141134.1|  PREDICTED: tubulin alpha-3 chain-like              318   8e-104   Cucumis sativus [cucumbers]
ref|XP_010112637.1|  Tubulin alpha-3 chain                              318   8e-104   Morus notabilis
ref|NP_001060075.1|  Os07g0574800                                       318   9e-104   
gb|KJB44614.1|  hypothetical protein B456_007G261000                    318   1e-103   Gossypium raimondii
gb|KHG26159.1|  Tubulin alpha-6 chain                                   318   1e-103   Gossypium arboreum [tree cotton]
gb|EYU23006.1|  hypothetical protein MIMGU_mgv1a006283mg                318   1e-103   Erythranthe guttata [common monkey flower]
ref|XP_006579487.1|  PREDICTED: tubulin A isoform X1                    318   1e-103   
gb|ABD92943.1|  alpha tubulin-1B                                        318   1e-103   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001237301.1|  tubulin A                                          318   1e-103   
ref|XP_009408459.1|  PREDICTED: tubulin alpha-3 chain-like              318   1e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001275086.1|  uncharacterized LOC102577521                       318   1e-103   Solanum tuberosum [potatoes]
gb|ABD92942.1|  alpha tubulin-1D                                        318   1e-103   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002319688.1|  Tubulin alpha-1 chain family protein               317   1e-103   Populus trichocarpa [western balsam poplar]
ref|XP_004958110.1|  PREDICTED: tubulin alpha-3 chain-like              317   2e-103   Setaria italica
ref|XP_009413318.1|  PREDICTED: tubulin alpha-3 chain-like              317   2e-103   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAD24765.1|  alpha-tubulin                                          317   2e-103   Miscanthus sinensis
ref|XP_011461685.1|  PREDICTED: tubulin alpha-3 chain isoform X2        316   2e-103   Fragaria vesca subsp. vesca
ref|XP_006858944.1|  hypothetical protein AMTR_s00068p00090790          317   2e-103   Amborella trichopoda
ref|XP_009406530.1|  PREDICTED: tubulin alpha-3 chain-like              317   2e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002303998.1|  alpha-tubulin 2 family protein                     317   3e-103   Populus trichocarpa [western balsam poplar]
gb|AGG37284.1|  alpha-tubulin 2                                         317   3e-103   Salix arbutifolia
ref|XP_007014666.1|  Tubulin alpha-5                                    317   3e-103   Theobroma cacao [chocolate]
gb|KJB80786.1|  hypothetical protein B456_013G115100                    317   3e-103   Gossypium raimondii
ref|XP_009366459.1|  PREDICTED: tubulin alpha-3 chain                   317   3e-103   
ref|XP_009375870.1|  PREDICTED: tubulin alpha-3 chain                   317   3e-103   Pyrus x bretschneideri [bai li]
dbj|BAM28754.1|  tubulin                                                314   3e-103   Brassica rapa subsp. chinensis [bok-choy]
gb|EYU31677.1|  hypothetical protein MIMGU_mgv1a006281mg                317   3e-103   Erythranthe guttata [common monkey flower]
ref|XP_010276368.1|  PREDICTED: tubulin alpha-3 chain-like              317   3e-103   Nelumbo nucifera [Indian lotus]
ref|XP_010528739.1|  PREDICTED: tubulin alpha-6 chain-like              317   4e-103   Tarenaya hassleriana [spider flower]
gb|KHG19627.1|  Tubulin alpha-3/alpha-5 chain -like protein             317   4e-103   Gossypium arboreum [tree cotton]
gb|AIC33057.1|  tubulin alpha-1 chain                                   317   4e-103   Panax ginseng [Asiatic ginseng]
ref|XP_003562846.1|  PREDICTED: tubulin alpha-1 chain                   316   5e-103   Brachypodium distachyon [annual false brome]
emb|CDP17586.1|  unnamed protein product                                316   5e-103   Coffea canephora [robusta coffee]
gb|AAN33000.1|  alpha-tubulin 4                                         311   5e-103   Gossypium hirsutum [American cotton]
ref|XP_008813089.1|  PREDICTED: tubulin alpha-3 chain                   316   5e-103   Phoenix dactylifera
emb|CAD26887.1|  alpha-tubulin                                          316   5e-103   Miscanthus sinensis
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             316   6e-103   Prunus persica
emb|CAD26893.1|  alpha-tubulin                                          316   6e-103   Miscanthus floridulus
ref|XP_008349406.1|  PREDICTED: tubulin alpha-3 chain                   316   7e-103   Malus domestica [apple tree]
gb|AGG37286.1|  alpha-tubulin 4                                         315   8e-103   Salix arbutifolia
ref|XP_010044940.1|  PREDICTED: tubulin alpha-3 chain                   315   8e-103   Eucalyptus grandis [rose gum]
ref|NP_001105324.1|  tubulin alpha-5 chain                              315   9e-103   Zea mays [maize]
ref|NP_001242878.1|  uncharacterized protein LOC100806907               315   9e-103   Glycine max [soybeans]
sp|Q43473.1|TBA1_HORVU  RecName: Full=Tubulin alpha-1 chain             315   9e-103   Hordeum vulgare [barley]
gb|EYU34086.1|  hypothetical protein MIMGU_mgv1a0196711mg               306   1e-102   Erythranthe guttata [common monkey flower]
gb|ABV55994.1|  alpha-tubulin 6                                         315   1e-102   Populus tremuloides
gb|AAO63773.2|  alpha-tubulin 2                                         315   1e-102   Populus tremuloides
ref|XP_007161955.1|  hypothetical protein PHAVU_001G111700g             315   1e-102   Phaseolus vulgaris [French bean]
gb|AGG37290.1|  alpha-tubulin 8                                         315   1e-102   Salix arbutifolia
emb|CAB77672.1|  alpha-tubulin                                          315   1e-102   Miscanthus transmorrisonensis
ref|XP_008351479.1|  PREDICTED: tubulin alpha-3 chain                   315   1e-102   Malus domestica [apple tree]
gb|ABE66388.1|  alpha-tubulin                                           306   1e-102   Striga asiatica [witchweed]
ref|XP_001777081.1|  predicted protein                                  315   1e-102   
gb|ABO47741.1|  alpha-tubulin                                           315   1e-102   Gossypium hirsutum [American cotton]
ref|XP_006488931.1|  PREDICTED: tubulin alpha-1 chain-like isofor...    314   1e-102   
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              315   2e-102   Prunus mume [ume]
ref|XP_001782790.1|  predicted protein                                  315   2e-102   
ref|XP_004295008.1|  PREDICTED: tubulin alpha-3 chain isoform X1        315   2e-102   Fragaria vesca subsp. vesca
emb|CAD26889.1|  alpha-tubulin                                          314   2e-102   Miscanthus transmorrisonensis
gb|ABO47735.1|  alpha-tubulin                                           315   2e-102   Gossypium hirsutum [American cotton]
gb|AGY80453.1|  tubulin                                                 315   2e-102   Dendrocalamus latiflorus [sweet bamboo]
ref|XP_008386829.1|  PREDICTED: tubulin alpha-3 chain-like              314   2e-102   Malus domestica [apple tree]
ref|XP_002525416.1|  tubulin alpha chain, putative                      314   2e-102   Ricinus communis
gb|ACU18775.1|  unknown                                                 306   2e-102   Glycine max [soybeans]
ref|XP_002325422.1|  Tubulin alpha-1 chain family protein               314   2e-102   Populus trichocarpa [western balsam poplar]
emb|CAD26890.1|  alpha-tubulin                                          314   3e-102   Miscanthus sinensis subsp. condensatus
ref|XP_011025144.1|  PREDICTED: tubulin alpha-3 chain                   314   4e-102   Populus euphratica
ref|XP_010673470.1|  PREDICTED: tubulin alpha-3 chain                   314   4e-102   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI19330.3|  unnamed protein product                                312   5e-102   Vitis vinifera
dbj|BAJ06365.1|  alpha-tubulin                                          313   5e-102   Alopecurus aequalis
gb|ACN40426.1|  unknown                                                 309   5e-102   Picea sitchensis
gb|ABO47738.1|  alpha-tubulin                                           313   5e-102   Gossypium hirsutum [American cotton]
dbj|BAJ86161.1|  predicted protein                                      313   5e-102   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABD92939.1|  alpha tubulin-5D                                        313   5e-102   Triticum aestivum [Canadian hard winter wheat]
gb|ABD92940.1|  alpha tubulin-5A                                        313   5e-102   Triticum aestivum [Canadian hard winter wheat]
sp|Q38771.1|TBA_AVESA  RecName: Full=Tubulin alpha chain                313   6e-102   Avena sativa [cultivated oat]
gb|KDO55010.1|  hypothetical protein CISIN_1g0157541mg                  310   6e-102   Citrus sinensis [apfelsine]
gb|KCW87065.1|  hypothetical protein EUGRSUZ_B03604                     313   6e-102   Eucalyptus grandis [rose gum]
gb|AFW89176.1|  hypothetical protein ZEAMMB73_322393                    313   7e-102   
emb|CAD26892.1|  alpha-tubulin                                          313   8e-102   Miscanthus floridulus
ref|XP_002297631.1|  alpha-tubulin 2 family protein                     313   9e-102   Populus trichocarpa [western balsam poplar]
ref|XP_006445597.1|  hypothetical protein CICLE_v10015224mg             313   9e-102   Citrus clementina [clementine]
ref|XP_003624633.1|  Alpha-tubulin                                      313   1e-101   Medicago truncatula
ref|XP_003554022.1|  PREDICTED: tubulin alpha-6 chain-like              313   1e-101   Glycine max [soybeans]
ref|XP_002263822.2|  PREDICTED: tubulin alpha chain                     308   1e-101   
emb|CBI29424.3|  unnamed protein product                                307   1e-101   Vitis vinifera
ref|XP_011048194.1|  PREDICTED: tubulin alpha-6 chain-like              312   1e-101   Populus euphratica
ref|XP_011021469.1|  PREDICTED: tubulin alpha-3 chain-like              312   2e-101   Populus euphratica
ref|XP_011034391.1|  PREDICTED: tubulin alpha-3 chain                   312   2e-101   Populus euphratica
gb|AEG74028.1|  alpha-tubulin                                           312   2e-101   Apopellia endiviifolia (species B)
ref|XP_008455056.1|  PREDICTED: tubulin alpha-4 chain isoform X2        310   2e-101   
ref|XP_006443441.1|  hypothetical protein CICLE_v10020128mg             312   2e-101   Citrus clementina [clementine]
gb|AGG37288.1|  alpha-tubulin 6                                         312   2e-101   Salix arbutifolia
emb|CAD26888.1|  alpha-tubulin                                          312   2e-101   Miscanthus transmorrisonensis
gb|AAX21196.1|  putative alpha-tubulin                                  303   3e-101   Solanum betaceum [tamarillo]
emb|CAD24768.1|  alpha-tubulin                                          311   3e-101   Miscanthus floridulus
emb|CAD24767.1|  alpha-tubulin                                          311   3e-101   Miscanthus floridulus
gb|KDO78780.1|  hypothetical protein CISIN_1g037616mg                   309   4e-101   Citrus sinensis [apfelsine]
ref|XP_006578253.1|  PREDICTED: tubulin alpha-4 chain isoform X2        311   4e-101   
ref|XP_007047652.1|  Tubulin alpha-2 chain                              313   4e-101   
ref|XP_008440460.1|  PREDICTED: tubulin alpha chain-like isoform X2     310   5e-101   
gb|AGV54497.1|  tubulin alpha-3 chain-like protein                      311   5e-101   Phaseolus vulgaris [French bean]
gb|KHN46768.1|  Tubulin alpha-3 chain                                   311   6e-101   Glycine soja [wild soybean]
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   311   7e-101   Vitis vinifera
ref|XP_008236253.1|  PREDICTED: tubulin alpha chain isoform X2          310   7e-101   
gb|AAO23139.1|  alpha tubulin                                           310   8e-101   Populus tremuloides
gb|ABR67425.1|  alpha-tubulin 4                                         310   8e-101   Populus tremuloides
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    310   8e-101   Gossypium hirsutum [American cotton]
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    310   8e-101   
ref|XP_009124557.1|  PREDICTED: tubulin alpha-6 chain-like isofor...    310   8e-101   Brassica rapa
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        310   9e-101   Glycine max [soybeans]
gb|ABO47739.1|  alpha-tubulin                                           310   9e-101   Gossypium hirsutum [American cotton]
ref|XP_010104543.1|  Tubulin alpha chain                                310   1e-100   
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     310   1e-100   Sesamum indicum [beniseed]
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    310   1e-100   Gossypium hirsutum [American cotton]
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        310   1e-100   Cucumis melo [Oriental melon]
ref|XP_010466127.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    309   1e-100   
emb|CBI25125.3|  unnamed protein product                                307   1e-100   Vitis vinifera
tpg|DAA51110.1|  TPA: alpha-tubulin                                     303   1e-100   
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         310   1e-100   Jatropha curcas
ref|XP_006486879.1|  PREDICTED: tubulin alpha chain-like isoform X2     309   1e-100   
ref|XP_006581475.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    310   2e-100   
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             310   2e-100   Populus trichocarpa [western balsam poplar]
emb|CDY25017.1|  BnaC02g39910D                                          308   2e-100   Brassica napus [oilseed rape]
ref|XP_006466395.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    310   2e-100   
gb|KJB58757.1|  hypothetical protein B456_009G224800                    308   2e-100   Gossypium raimondii
dbj|BAJ98211.1|  predicted protein                                      310   2e-100   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010096739.1|  Tubulin alpha chain                                310   2e-100   
ref|XP_003558477.1|  PREDICTED: tubulin alpha-2 chain                   310   2e-100   Brachypodium distachyon [annual false brome]
gb|ABB16994.1|  unknown                                                 310   2e-100   Solanum tuberosum [potatoes]
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    309   2e-100   Citrus sinensis [apfelsine]
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             309   2e-100   Citrus clementina [clementine]
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                309   2e-100   Fragaria vesca subsp. vesca
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   309   2e-100   Citrus sinensis [apfelsine]
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          309   2e-100   Citrus sinensis [apfelsine]
ref|XP_004985171.1|  PREDICTED: tubulin alpha-2 chain-like              309   2e-100   
ref|XP_009107245.1|  PREDICTED: tubulin alpha-2 chain isoform X2        310   2e-100   Brassica rapa
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             309   2e-100   Populus trichocarpa [western balsam poplar]
ref|XP_005851144.1|  alpha-tubulin                                      309   2e-100   Chlorella variabilis
emb|CAB66336.1|  alpha-tubulin                                          309   3e-100   Betula pendula [white birch]
gb|ABO47736.1|  alpha-tubulin                                           309   3e-100   Gossypium hirsutum [American cotton]
ref|XP_002675196.1|  alpha-tubulin                                      309   3e-100   Naegleria gruberi strain NEG-M
ref|XP_002510010.1|  tubulin alpha chain, putative                      309   3e-100   Ricinus communis
gb|ABX57816.1|  alpha tubulin                                           309   3e-100   Picea wilsonii
gb|AAV92352.1|  alpha tubulin 1                                         309   3e-100   Pseudotsuga menziesii var. menziesii
gb|AGG37287.1|  alpha-tubulin 5                                         309   3e-100   Salix arbutifolia
gb|ABK92552.1|  unknown                                                 309   3e-100   Populus trichocarpa [western balsam poplar]
gb|KHG18997.1|  Tubulin alpha chain                                     309   3e-100   Gossypium arboreum [tree cotton]
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             309   3e-100   Citrus clementina [clementine]
emb|CBI22190.3|  unnamed protein product                                307   3e-100   Vitis vinifera
gb|AGG37285.1|  alpha-tubulin 3                                         309   3e-100   Salix arbutifolia
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   309   3e-100   Populus euphratica
gb|AIX10773.1|  alpha tubulin                                           309   3e-100   Panax notoginseng [san-qi]
ref|XP_010531322.1|  PREDICTED: tubulin alpha-4 chain isoform X2        309   3e-100   Tarenaya hassleriana [spider flower]
ref|XP_010693818.1|  PREDICTED: tubulin alpha-3 chain-like              309   3e-100   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010054663.1|  PREDICTED: tubulin alpha-3 chain-like              309   3e-100   Eucalyptus grandis [rose gum]
ref|XP_002522104.1|  tubulin alpha chain, putative                      309   3e-100   Ricinus communis
ref|XP_006472373.1|  PREDICTED: tubulin alpha chain isoform X2          309   3e-100   
ref|XP_007018369.1|  Tubulin alpha-2 chain                              309   3e-100   Theobroma cacao [chocolate]
dbj|BAC24800.1|  alpha tubulin                                          309   4e-100   Physcomitrella patens
ref|XP_007042689.1|  Tubulin alpha-2 chain                              309   4e-100   Theobroma cacao [chocolate]
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     309   4e-100   Eucalyptus grandis [rose gum]
ref|XP_002465633.1|  hypothetical protein SORBIDRAFT_01g042650          309   4e-100   Sorghum bicolor [broomcorn]
ref|XP_004493170.1|  PREDICTED: tubulin alpha-3 chain-like              309   4e-100   
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     309   4e-100   Cucumis melo [Oriental melon]
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                309   4e-100   Cucumis sativus [cucumbers]
emb|CDY66630.1|  BnaCnng51680D                                          308   4e-100   Brassica napus [oilseed rape]
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         309   4e-100   Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                           309   4e-100   Betula pendula [white birch]
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                309   4e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             309   4e-100   Phaseolus vulgaris [French bean]
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             309   4e-100   Eutrema salsugineum [saltwater cress]
gb|AHJ80818.1|  Tua1                                                    303   4e-100   Eragrostis tef [tef]
gb|ABO47740.1|  alpha-tubulin                                           308   4e-100   Gossypium hirsutum [American cotton]
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             308   4e-100   Prunus persica
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             308   4e-100   Capsella rubella
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          308   4e-100   Tarenaya hassleriana [spider flower]
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                308   4e-100   Pyrus x bretschneideri [bai li]
ref|NP_171974.1|  tubulin alpha-4 chain                                 308   4e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002508010.1|  alpha tubulin 2                                    308   5e-100   Micromonas commoda
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                308   5e-100   Nelumbo nucifera [Indian lotus]
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        308   5e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009618479.1|  PREDICTED: tubulin alpha-3 chain-like              308   5e-100   Nicotiana tomentosiformis
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          308   5e-100   Arabidopsis thaliana [mouse-ear cress]
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg                307   5e-100   Erythranthe guttata [common monkey flower]
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   308   5e-100   Fragaria vesca subsp. vesca
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                308   5e-100   Tarenaya hassleriana [spider flower]
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                308   5e-100   Tarenaya hassleriana [spider flower]
gb|AID52921.1|  tubulin alpha chain                                     308   5e-100   Carthamus tinctorius
ref|XP_005651460.1|  tubulin alpha chain                                308   5e-100   Coccomyxa subellipsoidea C-169
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                308   6e-100   Elaeis guineensis
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     308   6e-100   Fragaria vesca subsp. vesca
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     308   6e-100   Pyrus x bretschneideri [bai li]
gb|EMT20847.1|  Tubulin alpha-2 chain                                   308   6e-100   
ref|XP_008372962.1|  PREDICTED: tubulin alpha chain isoform X2          308   6e-100   
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             308   6e-100   Selaginella moellendorffii
ref|XP_009622332.1|  PREDICTED: tubulin alpha-3 chain                   308   6e-100   Nicotiana tomentosiformis
ref|NP_849388.1|  tubulin alpha-6 chain                                 307   6e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                308   6e-100   Cicer arietinum [garbanzo]
ref|XP_003603670.1|  Tubulin alpha-7 chain                              308   6e-100   Medicago truncatula
ref|XP_005643073.1|  tubulin alpha chain                                308   6e-100   Coccomyxa subellipsoidea C-169
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              308   6e-100   Cucumis sativus [cucumbers]
ref|XP_004150268.1|  PREDICTED: tubulin alpha chain-like                308   6e-100   Cucumis sativus [cucumbers]
gb|AGG37283.1|  alpha-tubulin 1                                         308   6e-100   Salix arbutifolia
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               308   7e-100   Pisum sativum [garden pea]
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    308   7e-100   Brassica rapa
ref|XP_008236966.1|  PREDICTED: tubulin alpha chain-like isoform X2     307   7e-100   
dbj|BAP59012.1|  alpha tubulin                                          308   7e-100   Taxus cuspidata [ichii]
emb|CDP02221.1|  unnamed protein product                                308   7e-100   Coffea canephora [robusta coffee]
gb|ABQ59634.1|  alpha-tubulin 5                                         308   7e-100   Populus tremuloides
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              308   8e-100   Camelina sativa [gold-of-pleasure]
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         308   9e-100   Jatropha curcas
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   308   9e-100   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              308   9e-100   Populus euphratica
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                308   1e-99    Populus euphratica
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                308   1e-99    Phoenix dactylifera
ref|XP_010093625.1|  Tubulin alpha chain                                308   1e-99    Morus notabilis
gb|AAO73546.1|  alpha-tubulin                                           308   1e-99    Ceratopteris richardii
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             308   1e-99    
sp|O22348.1|TBA2_ELEIN  RecName: Full=Tubulin alpha-2 chain; AltN...    307   1e-99    
ref|XP_008219157.1|  PREDICTED: tubulin alpha chain-like isoform X2     307   1e-99    
gb|AIX10966.1|  tubulin                                                 307   1e-99    
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                307   2e-99    
ref|XP_006601463.1|  PREDICTED: tubulin alpha-3 chain-like              306   2e-99    
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     307   2e-99    
gb|KIY93466.1|  Tubulin alpha-1 chain                                   298   2e-99    
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              307   2e-99    
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              307   2e-99    
emb|CAD13176.1|  alpha-tubulin                                          307   2e-99    
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 307   2e-99    
gb|EKF30131.1|  epsilon tubulin, putative                               298   2e-99    
gb|KDD76276.1|  tubulin/FtsZ GTPase                                     307   2e-99    
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                307   2e-99    
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     307   2e-99    
gb|ABK92520.1|  unknown                                                 307   2e-99    
ref|XP_010557536.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    307   2e-99    
ref|XP_001764722.1|  predicted protein                                  307   2e-99    
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     307   2e-99    
emb|CCC46467.1|  putative alpha tubulin, fragment                       300   2e-99    
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     307   2e-99    
sp|Q25563.1|TBA13_NAEGR  RecName: Full=Tubulin alpha-13 chain           307   2e-99    
ref|XP_009388503.1|  PREDICTED: tubulin alpha chain isoform X2          307   2e-99    
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              307   2e-99    
gb|ABB02631.1|  unknown                                                 307   2e-99    
gb|ADW66593.1|  alpha tubulin                                           303   2e-99    
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     306   2e-99    
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    306   2e-99    
gb|ABQ59633.1|  alpha-tubulin 3                                         306   3e-99    
ref|XP_010500556.1|  PREDICTED: tubulin alpha-2 chain isoform X2        307   3e-99    
sp|Q9FT36.1|TBA_DAUCA  RecName: Full=Tubulin alpha chain                306   3e-99    
sp|Q96460.1|TBA2_HORVU  RecName: Full=Tubulin alpha-2 chain             306   3e-99    
gb|ABD92930.1|  alpha tubulin-2A                                        306   3e-99    
ref|XP_008352751.1|  PREDICTED: tubulin alpha chain isoform X2          306   3e-99    
gb|ABO47737.1|  alpha-tubulin                                           306   3e-99    
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                306   3e-99    
ref|XP_006649647.1|  PREDICTED: tubulin alpha-2 chain-like              306   3e-99    
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             306   3e-99    
ref|XP_010557535.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    306   3e-99    
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        306   3e-99    
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   306   3e-99    
ref|NP_193232.1|  tubulin alpha-6 chain                                 306   3e-99    
gb|KHG20487.1|  Tubulin alpha chain                                     306   3e-99    
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                306   3e-99    
ref|XP_010461854.1|  PREDICTED: tubulin alpha-6 chain-like              306   3e-99    
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   306   3e-99    
gb|ABE01246.1|  alpha tubulin                                           306   3e-99    
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like              306   3e-99    
ref|XP_009357231.1|  PREDICTED: tubulin alpha chain-like isoform X2     306   3e-99    
gb|KJB29387.1|  hypothetical protein B456_005G097800                    306   3e-99    
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     306   3e-99    
ref|NP_001291325.1|  tubulin alpha chain-like                           306   3e-99    
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             306   3e-99    
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          306   3e-99    
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             306   4e-99    
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             306   4e-99    
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     306   4e-99    
ref|NP_001049400.1|  Os03g0219300                                       306   4e-99    
gb|KHG06861.1|  Tubulin alpha-6 chain                                   306   4e-99    
ref|WP_039310890.1|  hypothetical protein                               306   4e-99    
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     306   4e-99    
gb|KHN01709.1|  Tubulin alpha chain                                     306   4e-99    
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             306   5e-99    
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             306   5e-99    
gb|ACN40181.1|  unknown                                                 306   5e-99    
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     306   5e-99    
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             306   5e-99    
ref|XP_003524707.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    306   5e-99    
gb|AIA82433.1|  alpha-tubulin-like protein 01                           306   5e-99    
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             306   5e-99    
gb|AIA82437.1|  alpha-tubulin-like protein 06                           302   6e-99    
emb|CDO97305.1|  unnamed protein product                                306   6e-99    
sp|P10872.1|TBA_TETPY  RecName: Full=Tubulin alpha chain                306   6e-99    
ref|XP_006338461.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    305   6e-99    
ref|XP_003058621.1|  alpha tubulin                                      306   6e-99    
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                306   6e-99    
ref|NP_001067613.1|  Os11g0247300                                       306   6e-99    
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             306   6e-99    
ref|XP_006606007.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    305   6e-99    
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain                306   6e-99    
gb|ABV55999.1|  alpha-tubulin 7                                         306   6e-99    
emb|CEG01594.1|  Tubulin/FtsZ, 2-layer sandwich domain                  306   7e-99    
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              305   7e-99    
ref|XP_001022424.1|  Tubulin/FtsZ family, GTPase domain containin...    305   7e-99    
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     305   7e-99    
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    305   7e-99    
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                305   7e-99    
emb|CDP00974.1|  unnamed protein product                                305   7e-99    
gb|ABO47742.1|  alpha-tubulin                                           305   7e-99    
ref|XP_007155784.1|  hypothetical protein PHAVU_003G231500g             305   7e-99    
ref|XP_008347837.1|  PREDICTED: tubulin alpha-4 chain isoform X2        306   7e-99    
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              305   8e-99    
ref|XP_004231960.1|  PREDICTED: tubulin alpha-3 chain-like              305   8e-99    
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   305   8e-99    
ref|XP_006589612.1|  PREDICTED: tubulin alpha chain-like isoform X2     305   8e-99    
gb|ACU19580.1|  unknown                                                 305   8e-99    
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             305   8e-99    
gb|KIZ01406.1|  Tubulin alpha-1 chain                                   305   8e-99    
gb|KEH43997.1|  tubulin beta-1 chain                                    305   8e-99    
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                305   8e-99    
ref|XP_006579968.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    306   9e-99    
gb|AGG37289.1|  alpha-tubulin 7                                         305   9e-99    
ref|XP_006573681.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    304   9e-99    
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     305   9e-99    
ref|XP_002886753.1|  alpha-1 tubulin                                    305   1e-98    
ref|XP_001419217.1|  predicted protein                                  305   1e-98    
gb|EKF98903.1|  epsilon tubulin, putative                               298   1e-98    
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like              305   1e-98    
ref|XP_006482577.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    304   1e-98    
gb|KIZ03400.1|  Tubulin alpha chain                                     305   1e-98    
ref|XP_006357741.1|  PREDICTED: tubulin alpha-3 chain-like              305   1e-98    
ref|XP_009779180.1|  PREDICTED: tubulin alpha-3 chain-like              305   1e-98    
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             305   1e-98    
gb|ACY05960.1|  alpha-tubulin                                           303   1e-98    
gb|AFV46219.1|  hypothetical protein                                    304   1e-98    
emb|CCC46464.1|  putative alpha tubulin                                 300   1e-98    
ref|XP_003608582.1|  Tubulin alpha-5 chain                              305   2e-98    
ref|XP_006301274.1|  hypothetical protein CARUB_v10021674mg             305   2e-98    
gb|ACH68563.1|  alpha-tubulin                                           305   2e-98    
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   305   2e-98    
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like                305   2e-98    
ref|XP_004034900.1|  hypothetical protein IMG5_110300                   305   2e-98    
ref|XP_007143142.1|  hypothetical protein PHAVU_007G047300g             304   2e-98    
gb|AAK37831.1|AF182309_1  alpha-tubulin                                 305   2e-98    
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like                304   2e-98    
gb|ESL08706.1|  alpha tubulin                                           300   2e-98    
gb|AEW46684.1|  beta-tubulin                                            304   2e-98    
sp|P33625.1|TBA_EUGGR  RecName: Full=Tubulin alpha chain                304   2e-98    
sp|P09205.1|TBA2_CHLRE  RecName: Full=Tubulin alpha-2 chain             304   3e-98    
gb|AGE09583.1|  TUA1-like protein                                       303   3e-98    
ref|XP_001691876.1|  alpha tubulin 1                                    304   3e-98    
dbj|BAB19779.1|  alpha tubulin                                          304   3e-98    
ref|XP_001420620.1|  predicted protein                                  304   3e-98    
ref|NP_001051132.1|  Os03g0726100                                       304   3e-98    
ref|XP_002951007.1|  alpha tubulin                                      304   3e-98    
ref|NP_001289660.1|  tubulin alpha chain-like                           304   3e-98    
gb|ABF98643.1|  Tubulin alpha-1 chain, putative, expressed              303   3e-98    
ref|XP_006431130.1|  hypothetical protein CICLE_v10011709mg             303   4e-98    
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    303   4e-98    
gb|ACH70610.1|  alpha tubulin                                           303   4e-98    
gb|EPY40566.1|  tubulin alpha                                           300   4e-98    
ref|XP_002517492.1|  tubulin alpha chain, putative                      303   4e-98    
gb|AGV54721.1|  tubulin alpha-3 chain-like protein                      303   4e-98    
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             303   4e-98    
ref|XP_002973792.1|  hypothetical protein SELMODRAFT_100162             303   5e-98    
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    303   5e-98    
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                303   5e-98    
prf||1503274A  alpha1 tubulin                                           303   5e-98 
dbj|BAJ06362.1|  alpha-tubulin                                          303   5e-98    
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                   303   5e-98    
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like              303   5e-98    
ref|XP_002963092.1|  hypothetical protein SELMODRAFT_78469              303   6e-98    
emb|CAA62917.1|  alfa-tubulin                                           303   6e-98    
gb|AIA82435.1|  alpha-tubulin-like protein 03                           303   6e-98    
ref|NP_176654.1|  tubulin alpha-1 chain                                 303   6e-98    
ref|XP_001454509.1|  hypothetical protein                               303   6e-98    
gb|AAX63396.1|  alpha-tubulin                                           303   6e-98    
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              303   7e-98    
gb|AHJ80822.1|  Tua1                                                    303   7e-98    
emb|CAA67848.1|  alpha-tubulin                                          303   7e-98    
ref|XP_001460309.1|  hypothetical protein                               302   7e-98    
ref|XP_006650524.1|  PREDICTED: tubulin alpha-1 chain-like              303   7e-98    
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                303   8e-98    
ref|NP_001167663.1|  tubulin alpha-3 chain                              303   8e-98    
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...    303   8e-98    
gb|AFC88832.1|  putative tubulin alpha-3 chain                          303   8e-98    
emb|CCD12221.1|  unnamed protein product                                300   8e-98    
gb|AHJ80817.1|  Tua1                                                    303   8e-98    
gb|AHJ80815.1|  Tua1                                                    303   8e-98    
ref|XP_007032501.1|  Tubulin alpha-2 chain                              303   8e-98    
gb|ABG78593.1|  alpha-tubulin                                           303   8e-98    
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like              303   9e-98    
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                   303   9e-98    
emb|CAA06619.1|  alpha-tubulin 1                                        303   9e-98    
gb|AHJ80816.1|  Tua1                                                    303   1e-97    
emb|CAI38956.1|  alpha_tubulin,putative                                 302   1e-97    
gb|ABP65320.1|  alpha tubulin                                           303   1e-97    
emb|CDW82295.1|  alpha tubulin                                          303   1e-97    
gb|ETL46656.1|  tubulin alpha chain                                     294   1e-97    
gb|AAB86649.1|  alpha-tubulin                                           302   1e-97    
gb|EKG00415.1|  epsilon tubulin, putative                               300   1e-97    
gb|AAB84298.1|  tubulin                                                 302   1e-97    
dbj|BAJ97454.1|  predicted protein                                      300   1e-97    
gb|ETK93224.1|  tubulin alpha-2 chain                                   293   1e-97    
gb|ETL46639.1|  tubulin alpha chain                                     293   1e-97    
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like                302   1e-97    
gb|EPY32753.1|  tubulin alpha                                           296   2e-97    
gb|ETK93242.1|  tubulin alpha chain                                     293   2e-97    
gb|EPY25298.1|  tubulin alpha                                           299   2e-97    
gb|EJY81124.1|  Alpha tubulin,putative                                  302   2e-97    
gb|KHN42598.1|  Tubulin alpha-2 chain                                   302   2e-97    
emb|CDP12358.1|  unnamed protein product                                301   2e-97    
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672             301   2e-97    
gb|AAQ81585.1|  putative tubulin alpha-2/alpha-4 chain                  301   3e-97    
ref|XP_674476.1|  hypothetical protein                                  292   3e-97    
ref|XP_002980239.1|  hypothetical protein SELMODRAFT_233509             301   4e-97    
ref|XP_010496499.1|  PREDICTED: tubulin alpha-1 chain-like isofor...    300   4e-97    
emb|CAA62916.1|  alpha-tubulin                                          301   4e-97    
emb|CCC46465.1|  putative alpha tubulin                                 301   4e-97    
ref|XP_001770881.1|  predicted protein                                  301   4e-97    
ref|XP_001218934.1|  alpha tubulin                                      301   4e-97    
ref|XP_673091.1|  hypothetical protein                                  294   5e-97    
gb|AAA99441.1|  alpha-tubulin                                           300   5e-97    
ref|XP_001455356.1|  hypothetical protein                               300   6e-97    
gb|ABA00480.1|  alpha-tubulin                                           300   6e-97    
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             300   6e-97    
gb|AAC67376.1|  alpha-tubulin-3                                         293   6e-97    
ref|XP_001315391.1|  alpha-tubulin 1                                    293   7e-97    
gb|EPY36663.1|  tubulin alpha                                           300   7e-97    
ref|XP_802499.1|  alpha tubulin                                         300   7e-97    
sp|Q27352.1|TBA_TRYCR  RecName: Full=Tubulin alpha chain                300   7e-97    
ref|XP_002785264.1|  Tubulin alpha chain, putative                      292   8e-97    
emb|CBH08957.1|  alpha tubulin, (fragment)                              290   9e-97    
gb|ABC59068.2|  alpha tubulin 1                                         300   9e-97    
ref|XP_008606530.1|  tubulin alpha                                      295   9e-97    
gb|AGN32931.1|  alpha tubulin                                           300   1e-96    
ref|XP_002781275.1|  Tubulin alpha chain, putative                      293   1e-96    
gb|EYU34660.1|  hypothetical protein MIMGU_mgv1a006269mg                300   1e-96    
emb|CAA65329.1|  alpha-tubulin                                          300   1e-96    
gb|ACI15922.1|  alpha-tubulin                                           300   1e-96    



>gb|KJB83376.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=271

 Score =   322 bits (825),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEH IQPDGMMPSDTSVG+AND+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVANDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|KJB83377.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=346

 Score =   323 bits (828),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEH IQPDGMMPSDTSVG+AND+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVANDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_010535935.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Tarenaya hassleriana]
Length=450

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 180/182 (99%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTSVG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_010535933.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Tarenaya hassleriana]
Length=449

 Score =   323 bits (829),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 180/182 (99%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTSVG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_008449886.1| PREDICTED: tubulin alpha-3 chain isoform X2 [Cucumis melo]
Length=435

 Score =   322 bits (826),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTS G+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_009400845.1| PREDICTED: tubulin alpha-3 chain [Musa acuminata subsp. malaccensis]
Length=450

 Score =   323 bits (827),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 180/182 (99%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGIQPDG+MPSDTSVG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGIMPSDTSVGVASDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_002532068.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF30323.1| tubulin alpha chain, putative [Ricinus communis]
Length=449

 Score =   323 bits (827),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTSVG+ +D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGVGHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_004504311.1| PREDICTED: tubulin alpha-3 chain-like [Cicer arietinum]
Length=449

 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSD+SVG+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVRSG YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_003629736.1| Alpha-tubulin [Medicago truncatula]
 gb|AET04212.1| tubulin beta-1 chain [Medicago truncatula]
Length=449

 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSD+SVG+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVRSG YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|KJB83375.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=449

 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEH IQPDGMMPSDTSVG+AND+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVANDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_009389058.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=450

 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGIQPDG+MPSDTSVG+A D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGIMPSDTSVGVACDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_008240534.1| PREDICTED: tubulin alpha-3 chain isoform X2 [Prunus mume]
Length=424

 Score =   322 bits (824),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVG A+D+FNTFFSETGSG 
Sbjct  1    MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGAAHDAFNTFFSETGSGN  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVG++IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_011089722.1| PREDICTED: tubulin alpha-3 chain [Sesamum indicum]
Length=449

 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTSVG+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGGYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|EPS70933.1| tubulin alpha-6 chain, partial [Genlisea aurea]
Length=269

 Score =   316 bits (809),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGI PDG+MPSDTSVG A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIHPDGLMPSDTSVGAAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVRSG YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVD CLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRSGGYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDQCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|KHG06160.1| Tubulin alpha-3/alpha-5 chain -like protein [Gossypium arboreum]
Length=449

 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEH IQPDGMMPSDTSVG+AND+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVANDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_010531152.1| PREDICTED: tubulin alpha-3 chain [Tarenaya hassleriana]
Length=449

 Score =   322 bits (825),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTSVG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_009353129.1| PREDICTED: tubulin alpha-3 chain-like [Pyrus x bretschneideri]
Length=449

 Score =   322 bits (824),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVG A DSFNTFFSETGSG 
Sbjct  1    MREIISLHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGAATDSFNTFFSETGSGN  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLS+DYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSLDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_004149645.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 ref|XP_004164931.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 gb|KGN54025.1| hypothetical protein Csa_4G268090 [Cucumis sativus]
Length=449

 Score =   322 bits (824),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTS G+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_008449885.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Cucumis melo]
Length=449

 Score =   321 bits (823),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTS G+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CBI16534.3| unnamed protein product [Vitis vinifera]
Length=417

 Score =   320 bits (820),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+ +D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVGHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_009126388.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   321 bits (823),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_008804327.1| PREDICTED: tubulin alpha-1 chain-like [Phoenix dactylifera]
Length=450

 Score =   321 bits (823),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 180/182 (99%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTSVGIA+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGIAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DE+R+GAYRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEIRAGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_009126389.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   321 bits (822),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CDY44941.1| BnaA02g04460D [Brassica napus]
 emb|CDY44942.1| BnaA02g04470D [Brassica napus]
Length=450

 Score =   321 bits (822),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_010454260.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 ref|XP_010454262.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
Length=450

 Score =   321 bits (822),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_006286664.1| hypothetical protein CARUB_v10002583mg [Capsella rubella]
 ref|XP_010493056.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 ref|XP_010493058.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 gb|EOA19562.1| hypothetical protein CARUB_v10002583mg [Capsella rubella]
Length=450

 Score =   321 bits (822),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_006286795.1| hypothetical protein CARUB_v10003470mg [Capsella rubella]
 gb|EOA19693.1| hypothetical protein CARUB_v10003470mg [Capsella rubella]
Length=450

 Score =   321 bits (822),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_009126391.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   321 bits (822),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_009120857.1| PREDICTED: tubulin alpha-3 chain [Brassica rapa]
 emb|CDX92501.1| BnaA10g15400D [Brassica napus]
 emb|CDX92502.1| BnaA10g15410D [Brassica napus]
Length=450

 Score =   321 bits (822),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CDY42294.1| BnaC02g09000D [Brassica napus]
 emb|CDY42295.1| BnaC02g09010D [Brassica napus]
Length=450

 Score =   321 bits (822),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|NP_197478.1| tubulin alpha-3 [Arabidopsis thaliana]
 ref|NP_197479.1| tubulin alpha-5 [Arabidopsis thaliana]
 ref|XP_002871906.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002873963.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006400538.1| hypothetical protein EUTSA_v10013521mg [Eutrema salsugineum]
 ref|XP_006400540.1| hypothetical protein EUTSA_v10013523mg [Eutrema salsugineum]
 ref|XP_010420793.1| PREDICTED: tubulin alpha-3 chain [Camelina sativa]
 sp|Q56WH1.2|TBA3_ARATH RecName: Full=Tubulin alpha-3 chain [Arabidopsis thaliana]
 sp|B9DHQ0.2|TBA5_ARATH RecName: Full=Tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAK32888.1|AF367301_1 AT5g19770/T29J13_190 [Arabidopsis thaliana]
 gb|AAA32888.1| alpha-tubulin [Arabidopsis thaliana]
 gb|AAA32891.1| alpha-5 tubulin [Arabidopsis thaliana]
 gb|AAK64169.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAL38340.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85097.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN31860.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN31861.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN28834.1| At5g19770/T29J13_190 [Arabidopsis thaliana]
 gb|AAN65084.1| unknown protein [Arabidopsis thaliana]
 gb|EFH48165.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50222.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 gb|AED92747.1| tubulin alpha-3 [Arabidopsis thaliana]
 gb|AED92748.1| tubulin alpha-5 [Arabidopsis thaliana]
 gb|ESQ41991.1| hypothetical protein EUTSA_v10013521mg [Eutrema salsugineum]
 gb|ESQ41993.1| hypothetical protein EUTSA_v10013523mg [Eutrema salsugineum]
 gb|KFK26213.1| tubulin alpha-3 alpha-5 chain [Arabis alpina]
 gb|KFK26214.1| hypothetical protein AALP_AA8G217400 [Arabis alpina]
Length=450

 Score =   321 bits (822),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_006584595.1| PREDICTED: uncharacterized protein LOC100806907 isoform X1 [Glycine 
max]
Length=423

 Score =   320 bits (820),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSD+S G+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSFGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRCGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CAD26886.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   321 bits (822),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSDTSVG+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|AGD80034.1| alpha-tubulin 1 [Hevea brasiliensis]
Length=449

 Score =   320 bits (821),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGI PDGMMPSDTSVG+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIHPDGMMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CDP14299.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   320 bits (821),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGI PDGMMPSD SVGIANDSFNTFFSET +GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIHPDGMMPSDKSVGIANDSFNTFFSETSAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA++VDLEPTVVDEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVG+DI+DLCLD
Sbjct  61   HVPRAIYVDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGRDIIDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFL+FNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIFPSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLIFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIFPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|NP_001105588.1| tubulin alpha-6 chain [Zea mays]
 sp|P33627.1|TBA6_MAIZE RecName: Full=Tubulin alpha-6 chain; AltName: Full=Alpha-6-tubulin 
[Zea mays]
 emb|CAA44863.1| alpha-tubulin #6 [Zea mays]
 gb|ACN35801.1| unknown [Zea mays]
 gb|AFE82989.1| tubulin alpha-5 [Saccharum hybrid cultivar]
 tpg|DAA63282.1| TPA: alpha tubulin6 [Zea mays]
Length=450

 Score =   320 bits (821),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSDTSVG+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CAD24766.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   320 bits (821),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSDTSVG+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CDX88875.1| BnaA03g07740D [Brassica napus]
 emb|CDX70890.1| BnaC03g09740D [Brassica napus]
Length=450

 Score =   320 bits (821),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_010257632.1| PREDICTED: tubulin alpha-3 chain [Nelumbo nucifera]
Length=449

 Score =   320 bits (821),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEH IQPDGMMPSDTSVG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_009131752.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   320 bits (821),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_007159433.1| hypothetical protein PHAVU_002G237400g [Phaseolus vulgaris]
 gb|ESW31427.1| hypothetical protein PHAVU_002G237400g [Phaseolus vulgaris]
Length=449

 Score =   320 bits (820),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSD+S G+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSFGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR GAYRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRCGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>sp|O22349.1|TBA3_ELEIN RecName: Full=Tubulin alpha-3 chain; AltName: Full=Alpha-3-tubulin 
[Eleusine indica]
 gb|AAC05719.1| alpha-tubulin 3 [Eleusine indica]
Length=450

 Score =   320 bits (820),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSDTSVG+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|ACN40824.1| unknown [Picea sitchensis]
Length=449

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTSVG+ +D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGVGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAV VDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVIVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_011075054.1| PREDICTED: tubulin alpha-3 chain-like [Sesamum indicum]
Length=449

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTSVG  NDSFNTFFSET +GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGTENDSFNTFFSETRAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTVVDEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVG+DI+DLCLD
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGRDIIDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_007204346.1| hypothetical protein PRUPE_ppa005649mg [Prunus persica]
 gb|EMJ05545.1| hypothetical protein PRUPE_ppa005649mg [Prunus persica]
Length=449

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVG A+D+FNTFFSETGSG 
Sbjct  1    MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGAAHDAFNTFFSETGSGN  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVG++IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_008240533.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Prunus mume]
Length=449

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVG A+D+FNTFFSETGSG 
Sbjct  1    MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGAAHDAFNTFFSETGSGN  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVG++IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|KDP39691.1| hypothetical protein JCGZ_02711 [Jatropha curcas]
Length=449

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE+IS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTS+G  +DSFNTFFSETGSGK
Sbjct  1    MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSIGTEHDSFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVG++IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIFPSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIFPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|AHZ58482.1| alpha-tubulin, partial [Syntrichia caninervis]
Length=261

 Score =   313 bits (801),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD S G  +D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGRMPSDASTGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_006657877.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=450

 Score =   319 bits (818),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSDTSVG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|EYU20672.1| hypothetical protein MIMGU_mgv1a004180mg [Erythranthe guttata]
Length=540

 Score =   322 bits (826),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSET +GK
Sbjct  92   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETSAGK  151

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+F+DLEPTVVDEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD
Sbjct  152  HVPRAIFLDLEPTVVDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  211

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSV+YGKKSKLGFTI+PSPQV  A
Sbjct  212  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVEYGKKSKLGFTIYPSPQVSTA  271

Query  550  MI  555
            ++
Sbjct  272  VV  273



>ref|XP_011078787.1| PREDICTED: tubulin alpha-1 chain-like [Sesamum indicum]
Length=451

 Score =   319 bits (818),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD + GIA+DSFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGYMPSDKTAGIADDSFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+F+DLEPTVVDEVR+GAYRQLFHPEQLISGKEDAANNFARGHYTVGKDI+DLCLD
Sbjct  61   HVPRAIFLDLEPTVVDEVRNGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIIDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CAB77671.1| alpha-tubulin [Miscanthus sinensis f. glaber]
Length=450

 Score =   319 bits (818),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSDTSVG+A+D+FNTFFSETGSGK
Sbjct  1    MREFISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVADDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_010934670.1| PREDICTED: tubulin alpha-3 chain-like [Elaeis guineensis]
Length=450

 Score =   319 bits (817),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGI PDGMMPSDTSVG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIHPDGMMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|AGV54500.1| tubulin A [Phaseolus vulgaris]
Length=449

 Score =   318 bits (816),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 167/181 (92%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSD+S G+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSFGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR GAYRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRCGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  M  552
            +
Sbjct  181  V  181



>gb|KDP42087.1| hypothetical protein JCGZ_01875 [Jatropha curcas]
Length=450

 Score =   318 bits (816),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEH IQPDGMMPSDTSVG+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_010923361.1| PREDICTED: tubulin alpha-3 chain [Elaeis guineensis]
Length=450

 Score =   318 bits (816),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGIQPDG+MPSDTSVG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGIMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>dbj|BAJ06363.1| alpha-tubulin [Alopecurus aequalis]
Length=450

 Score =   318 bits (816),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGIQ DG MPSDT+VG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQQDGTMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_002285721.1| PREDICTED: tubulin alpha-3 chain [Vitis vinifera]
Length=449

 Score =   318 bits (816),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+ +D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVGHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_004170946.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha-3 chain-like [Cucumis 
sativus]
Length=447

 Score =   318 bits (816),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSDTSVG+A+D+FNTFFSETGSGK
Sbjct  1    MREIISLHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVG++IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGF+I+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFSIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CAD26891.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   318 bits (815),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSDTSVG+A+D+F+TFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFSTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_008464962.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis melo]
Length=449

 Score =   318 bits (815),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSDTSVG+A+D+FNTFFSETGSGK
Sbjct  1    MREIISLHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVG++IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGF+I+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFSIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_004141134.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 gb|KGN59749.1| Tubulin alpha-3 chain [Cucumis sativus]
Length=449

 Score =   318 bits (815),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSDTSVG+A+D+FNTFFSETGSGK
Sbjct  1    MREIISLHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVG++IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGF+I+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFSIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_010112637.1| Tubulin alpha-3 chain [Morus notabilis]
 gb|EXC34492.1| Tubulin alpha-3 chain [Morus notabilis]
Length=449

 Score =   318 bits (815),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+++D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVSHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGGYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|NP_001060075.1| Os07g0574800 [Oryza sativa Japonica Group]
 sp|P28752.1|TBA1_ORYSJ RecName: Full=Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 emb|CAA77988.1| alpha 1 tubulin [Oryza sativa Japonica Group]
 emb|CAA62918.1| alfa-tubulin [Oryza sativa Japonica Group]
 dbj|BAC83168.1| Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 dbj|BAD30236.1| Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 gb|ABG78594.1| alpha-tubulin [Oryza sativa Japonica Group]
 dbj|BAF21989.1| Os07g0574800 [Oryza sativa Japonica Group]
 gb|EAZ04436.1| hypothetical protein OsI_26583 [Oryza sativa Indica Group]
 gb|EAZ40391.1| hypothetical protein OsJ_24840 [Oryza sativa Japonica Group]
 dbj|BAG90561.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91280.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97017.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGH17548.1| alpha tubulin [Oryza sativa]
Length=450

 Score =   318 bits (815),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSDT+VG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|KJB44614.1| hypothetical protein B456_007G261000 [Gossypium raimondii]
Length=449

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE+IS+HIGQAGIQVGNACWELYCLEHGIQPDGMMP DTSVG  +D+FNTFFSETGSGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGMMPGDTSVGACHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVRSGA+RQLFHPEQLISGKEDAANNFARGHYTVG++IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRSGAFRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIFPSPQV  A
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIFPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|KHG26159.1| Tubulin alpha-6 chain [Gossypium arboreum]
Length=449

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE+IS+HIGQAGIQVGNACWELYCLEHGIQPDGMMP DTSVG  +D+FNTFFSETGSGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGMMPGDTSVGACHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVRSGA+RQLFHPEQLISGKEDAANNFARGHYTVG++IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRSGAFRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIFPSPQV  A
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIFPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|EYU23006.1| hypothetical protein MIMGU_mgv1a006283mg [Erythranthe guttata]
Length=449

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+ G+ +D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTFGVGHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_006579487.1| PREDICTED: tubulin A isoform X1 [Glycine max]
Length=449

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSD++ G+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSTFGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRCGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|ABD92943.1| alpha tubulin-1B [Triticum aestivum]
Length=450

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGIQ DG MPSDT+VG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQQDGTMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|NP_001237301.1| tubulin A [Glycine max]
 gb|AAX86047.1| tubulin A [Glycine max]
Length=450

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSD++ G+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSTFGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRCGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_009408459.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=450

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGIQPDG+MPSD+SVG+A D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGIMPSDSSVGMACDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|NP_001275086.1| uncharacterized LOC102577521 [Solanum tuberosum]
 gb|ABC01891.1| tubulin alpha-5 chain-like protein [Solanum tuberosum]
Length=449

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIISVHIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTS G A+D+FNTFFSETG+GK
Sbjct  1    MREIISVHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSPGAAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|ABD92942.1| alpha tubulin-1D [Triticum aestivum]
 gb|ABD92944.1| alpha tubulin-1A [Triticum aestivum]
 gb|EMS54563.1| Tubulin alpha-1 chain [Triticum urartu]
 gb|EMT26472.1| Tubulin alpha-1 chain [Aegilops tauschii]
Length=450

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGIQ DG MPSDT+VG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQQDGTMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_002319688.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
 gb|EEE95611.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
Length=449

 Score =   317 bits (813),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSDTSVG+ +DSFNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSVGVEHDSFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEP+V+DEVRSG YRQLFHPEQLISGKEDAANNFARGHYTVG++IV+LCLD
Sbjct  61   HVPRAIFVDLEPSVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIFPSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIFPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_004958110.1| PREDICTED: tubulin alpha-3 chain-like [Setaria italica]
Length=450

 Score =   317 bits (813),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGI+ DG MPSDTSVG+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEADGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_009413318.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   317 bits (813),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGIQPDG+MPSD+SVG+A D+FNTFFSET +GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGIMPSDSSVGVATDAFNTFFSETSAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CAD24765.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   317 bits (813),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSDTSVG+A+D+FNTFFSETGSGK
Sbjct  1    MREFISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G+YRQLFHPEQLISGKE+AANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKENAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_011461685.1| PREDICTED: tubulin alpha-3 chain isoform X2 [Fragaria vesca subsp. 
vesca]
Length=411

 Score =   316 bits (809),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD ++G+  D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDNTIGVGRDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_006858944.1| hypothetical protein AMTR_s00068p00090790 [Amborella trichopoda]
 gb|ERN20411.1| hypothetical protein AMTR_s00068p00090790 [Amborella trichopoda]
Length=449

 Score =   317 bits (812),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSD S+G+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGIMPSDNSIGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_009406530.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   317 bits (812),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGIQPDG+MPSDTSVG+A D+FNTFFSET +GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGIMPSDTSVGVAQDAFNTFFSETSAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_002303998.1| alpha-tubulin 2 family protein [Populus trichocarpa]
 gb|EEE78977.1| alpha-tubulin 2 family protein [Populus trichocarpa]
Length=450

 Score =   317 bits (812),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGIQPDG+MPSD SVG+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGVMPSDASVGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+F+DLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|AGG37284.1| alpha-tubulin 2 [Salix arbutifolia]
Length=450

 Score =   317 bits (812),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGIQPDG+MPSD SVG+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGVMPSDASVGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+F+DLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_007014666.1| Tubulin alpha-5 [Theobroma cacao]
 gb|EOY32285.1| Tubulin alpha-5 [Theobroma cacao]
Length=449

 Score =   317 bits (812),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEH I PDGMMPSDTSVG+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHEIHPDGMMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|KJB80786.1| hypothetical protein B456_013G115100 [Gossypium raimondii]
Length=449

 Score =   317 bits (811),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE+IS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG  +D+FNTFFSETGSGK
Sbjct  1    MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGACHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVG++IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_009366459.1| PREDICTED: tubulin alpha-3 chain [Pyrus x bretschneideri]
Length=449

 Score =   317 bits (811),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSDTSVG   DSFNTFFSETGSG 
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGTMPSDTSVGSETDSFNTFFSETGSGS  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_009375870.1| PREDICTED: tubulin alpha-3 chain [Pyrus x bretschneideri]
Length=449

 Score =   317 bits (811),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSDT+VG A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDTTVGSAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>dbj|BAM28754.1| tubulin [Brassica rapa subsp. chinensis]
Length=377

 Score =   314 bits (805),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVG +CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGFSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDL LD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLGLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|EYU31677.1| hypothetical protein MIMGU_mgv1a006281mg [Erythranthe guttata]
Length=449

 Score =   317 bits (811),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSD SVG+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGVMPSDNSVGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_010276368.1| PREDICTED: tubulin alpha-3 chain-like [Nelumbo nucifera]
Length=450

 Score =   317 bits (811),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEH IQPDGMMPSDTSVG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVAHDAFNTFFSETGTGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLE TV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLESTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_010528739.1| PREDICTED: tubulin alpha-6 chain-like [Tarenaya hassleriana]
Length=450

 Score =   317 bits (811),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSDT+VG+A DSFNTFFSET SGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTTVGVATDSFNTFFSETSSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVG+ IVD+CLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGRGIVDICLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIFPSPQV  A
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIFPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|KHG19627.1| Tubulin alpha-3/alpha-5 chain -like protein [Gossypium arboreum]
Length=449

 Score =   317 bits (811),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE+IS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG  +D+FNTFFSETGSGK
Sbjct  1    MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGACHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVG++IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|AIC33057.1| tubulin alpha-1 chain [Panax ginseng]
Length=449

 Score =   317 bits (811),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSD +VG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGIMPSDNTVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+F+DLEPTV+DE+R+GAYRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEIRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_003562846.1| PREDICTED: tubulin alpha-1 chain [Brachypodium distachyon]
Length=450

 Score =   316 bits (810),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGIQ DG MPSD++VG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQQDGTMPSDSTVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CDP17586.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   316 bits (810),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGI  DGMMPSDT+VGIA+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIHADGMMPSDTTVGIAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+F+DLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|AAN33000.1| alpha-tubulin 4, partial [Gossypium hirsutum]
Length=311

 Score =   311 bits (797),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE ISVHIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_008813089.1| PREDICTED: tubulin alpha-3 chain [Phoenix dactylifera]
Length=450

 Score =   316 bits (810),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGI PDG MPSDTSVG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIHPDGTMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+F+DLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CAD26887.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   316 bits (810),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSDTSVG A+D+FNTFFSETGSG+
Sbjct  1    MREFISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGAAHDAFNTFFSETGSGQ  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_007205189.1| hypothetical protein PRUPE_ppa005642mg [Prunus persica]
 gb|EMJ06388.1| hypothetical protein PRUPE_ppa005642mg [Prunus persica]
Length=450

 Score =   316 bits (810),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD SVG+  D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDASVGVGRDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CAD26893.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   316 bits (809),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSDTSVG A+D+FNTFFSETGSG+
Sbjct  1    MREFISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGAAHDAFNTFFSETGSGQ  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_008349406.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
 ref|XP_008366135.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
 ref|XP_009339175.1| PREDICTED: tubulin alpha-3 chain-like [Pyrus x bretschneideri]
Length=449

 Score =   316 bits (809),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSDT+VG   D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDTTVGSGRDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|AGG37286.1| alpha-tubulin 4 [Salix arbutifolia]
Length=450

 Score =   315 bits (808),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEH IQPDGMMPSDTSVG A+D+FNTFFSET SGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHDIQPDGMMPSDTSVGAAHDAFNTFFSETSSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQL+SGKEDAANNFARGHYTVGK+IVDLC+D
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLMSGKEDAANNFARGHYTVGKEIVDLCVD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_010044940.1| PREDICTED: tubulin alpha-3 chain [Eucalyptus grandis]
 gb|KCW87066.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=449

 Score =   315 bits (808),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGM+PSD +VG+A D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMLPSDATVGVAADAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+F+DLEPTV+DEVRSG YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|NP_001105324.1| tubulin alpha-5 chain [Zea mays]
 sp|Q02245.1|TBA5_MAIZE RecName: Full=Tubulin alpha-5 chain; AltName: Full=Alpha-5-tubulin 
[Zea mays]
 emb|CAA44862.1| alpha-tubulin #5 [Zea mays]
 gb|AAA33437.1| alpha-tubulin [Zea mays]
 gb|AAA16225.1| alpha-tubulin [Zea mays]
 emb|CAD20822.1| alpha tubulin [Zea mays]
 tpg|DAA41190.1| TPA: alpha tubulin5 [Zea mays]
Length=450

 Score =   315 bits (808),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGI+ DG MPSD+SVG+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEHDGTMPSDSSVGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|NP_001242878.1| uncharacterized protein LOC100806907 [Glycine max]
 gb|ACU18050.1| unknown [Glycine max]
Length=450

 Score =   315 bits (808),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CW LYCLEHGIQPDGMMPSD+S G+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWGLYCLEHGIQPDGMMPSDSSFGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRCGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>sp|Q43473.1|TBA1_HORVU RecName: Full=Tubulin alpha-1 chain [Hordeum vulgare]
 emb|CAA67942.1| alpha-tubulin 1 [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   315 bits (808),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGI  DG MPSDT+VG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGINQDGTMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|EYU34086.1| hypothetical protein MIMGU_mgv1a0196711mg, partial [Erythranthe 
guttata]
Length=199

 Score =   306 bits (785),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MP DT+VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|ABV55994.1| alpha-tubulin 6 [Populus tremuloides]
Length=449

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSDTSVG+ +DSFNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSVGVEHDSFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEP+V+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVG++IV+LCLD
Sbjct  61   HVPRAIFVDLEPSVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|AAO63773.2| alpha-tubulin 2 [Populus tremuloides]
Length=450

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGI+PDG+MPSD SVG+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIRPDGVMPSDASVGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+F+DLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_007161955.1| hypothetical protein PHAVU_001G111700g [Phaseolus vulgaris]
 gb|ESW33949.1| hypothetical protein PHAVU_001G111700g [Phaseolus vulgaris]
Length=448

 Score =   315 bits (807),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGI PDG MPSDT+VGIA+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGINPDGTMPSDTTVGIAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEP+V+DEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVG++IV+LCLD
Sbjct  61   HVPRALFVDLEPSVIDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|AGG37290.1| alpha-tubulin 8 [Salix arbutifolia]
Length=449

 Score =   315 bits (807),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSDTS+G  +DSFNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSIGAEHDSFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEP+V+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVG++IVDLCLD
Sbjct  61   HVPRAIFVDLEPSVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CAB77672.1| alpha-tubulin [Miscanthus transmorrisonensis]
Length=450

 Score =   315 bits (807),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSDTSVG A+D+FNTFFSETGSG+
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGAAHDAFNTFFSETGSGQ  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGLYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFL FNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLAFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_008351479.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
Length=449

 Score =   315 bits (807),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSDT+VG  +D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDTTVGGGHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|ABE66388.1| alpha-tubulin [Striga asiatica]
Length=206

 Score =   306 bits (785),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSDT+VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSP V  A
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPHVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_001777081.1| predicted protein [Physcomitrella patens]
 gb|EDQ58074.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   315 bits (807),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSDT+VG  +D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGRMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|ABO47741.1| alpha-tubulin [Gossypium hirsutum]
Length=449

 Score =   315 bits (807),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIISVHIGQAGIQVGN+CWELYCLEH I PDG MPSDTSVG+A+D+FNTFFSETGSGK
Sbjct  1    MREIISVHIGQAGIQVGNSCWELYCLEHEIHPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGF+VFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFMVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_006488931.1| PREDICTED: tubulin alpha-1 chain-like isoform X2 [Citrus sinensis]
Length=428

 Score =   314 bits (805),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGI PDGMMPSD ++G+A+D+FNTFFSET +G+
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIHPDGMMPSDNTIGVAHDAFNTFFSETSAGR  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKL+DNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLSDNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_008223650.1| PREDICTED: tubulin alpha-3 chain-like [Prunus mume]
Length=450

 Score =   315 bits (807),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD SVG+  D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDASVGVGRDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_001782790.1| predicted protein [Physcomitrella patens]
 ref|XP_001782813.1| predicted protein [Physcomitrella patens]
 dbj|BAC24799.1| alpha tubulin [Physcomitrella patens]
 gb|EDQ52367.1| predicted protein [Physcomitrella patens]
 gb|EDQ52390.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   315 bits (806),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSDT+VG  +D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGRMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_004295008.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   315 bits (806),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD ++G+  D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDNTIGVGRDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CAD26889.1| alpha-tubulin [Miscanthus transmorrisonensis]
Length=438

 Score =   314 bits (805),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQ GNACWELYCLEHGI+PDG MPSDTSVG A+D+FNTFFSETGSG+
Sbjct  1    MREIISIHIGQAGIQGGNACWELYCLEHGIEPDGTMPSDTSVGAAHDAFNTFFSETGSGQ  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGLYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|ABO47735.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG06862.1| Tubulin alpha-6 chain [Gossypium arboreum]
 gb|KJB66054.1| hypothetical protein B456_010G125700 [Gossypium raimondii]
 gb|KJB66055.1| hypothetical protein B456_010G125700 [Gossypium raimondii]
Length=449

 Score =   315 bits (806),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIISVHIGQAGIQVGN+CWELYCLEH I PDG MPSDTSVG+A+D+FNTFFSETGSGK
Sbjct  1    MREIISVHIGQAGIQVGNSCWELYCLEHEIHPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGF+VFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFMVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|AGY80453.1| tubulin [Dendrocalamus latiflorus]
Length=450

 Score =   315 bits (806),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSDTSVG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVD CLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDQCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_008386829.1| PREDICTED: tubulin alpha-3 chain-like [Malus domestica]
Length=449

 Score =   314 bits (805),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGIQP+G MPSDTSVG   DSFNTFFSETGSG 
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPNGTMPSDTSVGSETDSFNTFFSETGSGS  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DE+R+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEIRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_002525416.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF36906.1| tubulin alpha chain, putative [Ricinus communis]
Length=449

 Score =   314 bits (805),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE+IS+HIGQAGIQVGN+CWELYCLEHGIQPDG+M SDTS+G  +DSFNTFFSETGSGK
Sbjct  1    MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMSSDTSIGSEHDSFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVG++IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIFPSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIFPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|ACU18775.1| unknown [Glycine max]
Length=202

 Score =   306 bits (783),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSV YGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVGYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_002325422.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
 gb|EEE99803.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
Length=449

 Score =   314 bits (805),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSDTS+G  +DSFNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSIGAEHDSFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEP+V+DEVRSG YRQLFHPEQLISGKEDAANNFARGHYTVG++IVDLCLD
Sbjct  61   HVPRAIFVDLEPSVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CAD26890.1| alpha-tubulin [Miscanthus sinensis subsp. condensatus]
Length=450

 Score =   314 bits (805),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCL HGI+PDG MPSDTSVG A+D+FNTFFSETGSG+
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLGHGIEPDGTMPSDTSVGAAHDAFNTFFSETGSGQ  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGG GSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGAGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_011025144.1| PREDICTED: tubulin alpha-3 chain [Populus euphratica]
Length=450

 Score =   314 bits (804),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGIQPDG+MPSD SVG A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGVMPSDASVGGAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+F+DLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_010673470.1| PREDICTED: tubulin alpha-3 chain [Beta vulgaris subsp. vulgaris]
Length=449

 Score =   314 bits (804),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSD +VG+ +D+FNTFFSET +GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDNTVGVGHDAFNTFFSETSAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CBI19330.3| unnamed protein product [Vitis vinifera]
Length=395

 Score =   312 bits (799),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>dbj|BAJ06365.1| alpha-tubulin [Alopecurus aequalis]
Length=449

 Score =   313 bits (803),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSDTSVG+A D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGIMPSDTSVGVAKDAFNTFFSETGTGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+GAYRQLFHPEQLIS KEDAANNFARGHYTVG+++VDLCLD
Sbjct  61   HVPRALFVDLEPTVIDEVRTGAYRQLFHPEQLISHKEDAANNFARGHYTVGREVVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFL+FNAVGGGTGSGLGSLLLERLSVDYG+KSKLGFTI+PSPQ+  A
Sbjct  121  RIRKLADNCTGLQGFLIFNAVGGGTGSGLGSLLLERLSVDYGRKSKLGFTIYPSPQISTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|ACN40426.1| unknown [Picea sitchensis]
Length=319

 Score =   309 bits (792),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|ABO47738.1| alpha-tubulin [Gossypium hirsutum]
 gb|KJB40985.1| hypothetical protein B456_007G086400 [Gossypium raimondii]
Length=449

 Score =   313 bits (803),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIISVHIGQAGIQVGN+CWELYCLEH I PDG MPSDTS+G+A+D+FNTFFSETGSGK
Sbjct  1    MREIISVHIGQAGIQVGNSCWELYCLEHEIHPDGTMPSDTSMGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGF+VFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFMVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>dbj|BAJ86161.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88353.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   313 bits (803),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSDTSVG+A D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVAKDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+GAYRQLFHPEQLIS  EDAANNFARGHYTVG+++VDLCLD
Sbjct  61   HVPRALFVDLEPTVIDEVRTGAYRQLFHPEQLISHNEDAANNFARGHYTVGREVVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYG+KSKLGFTI+PSPQ+  A
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGRKSKLGFTIYPSPQISTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|ABD92939.1| alpha tubulin-5D [Triticum aestivum]
 gb|ABD92941.1| alpha tubulin-5B [Triticum aestivum]
Length=449

 Score =   313 bits (803),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSDTSVG+A D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVAKDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+GAYRQLFHPEQLIS  EDAANNFARGHYTVG+++VDLCLD
Sbjct  61   HVPRALFVDLEPTVIDEVRTGAYRQLFHPEQLISHNEDAANNFARGHYTVGREVVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYG+KSKLGFTI+PSPQ+  A
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGRKSKLGFTIYPSPQISTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|ABD92940.1| alpha tubulin-5A [Triticum aestivum]
Length=449

 Score =   313 bits (803),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSDTSVG+A D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVAKDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+GAYRQLFHPEQLIS  EDAANNFARGHYTVG+++VDLCLD
Sbjct  61   HVPRALFVDLEPTVIDEVRTGAYRQLFHPEQLISHNEDAANNFARGHYTVGREVVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYG+KSKLGFTI+PSPQ+  A
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGRKSKLGFTIYPSPQISTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>sp|Q38771.1|TBA_AVESA RecName: Full=Tubulin alpha chain [Avena sativa]
 emb|CAA66075.1| alpha-tubulin [Avena sativa]
Length=447

 Score =   313 bits (803),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGIQ DG MPSDT+VG+A+D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQQDGTMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCL 
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLG  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVR+LADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRQLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|KDO55010.1| hypothetical protein CISIN_1g0157541mg, partial [Citrus sinensis]
Length=353

 Score =   310 bits (794),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGI PDG MPSDTSVG  +D+FNTFFSETGSG+
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIHPDGTMPSDTSVGACHDAFNTFFSETGSGQ  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEP+V+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVG++IVDLCLD
Sbjct  61   HVPRAVFVDLEPSVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|KCW87065.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=458

 Score =   313 bits (803),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDGM+PSD +VG+A D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMLPSDATVGVAADAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+F+DLEPTV+DEVRSG YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVV  543
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQ V
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQAV  178



>gb|AFW89176.1| hypothetical protein ZEAMMB73_322393 [Zea mays]
Length=448

 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSDTSVGIA D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGIARDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEV++GAYRQLFHPEQLIS KEDAANNFARGHYTVG++++DLCLD
Sbjct  61   HVPRALFVDLEPTVIDEVKTGAYRQLFHPEQLISHKEDAANNFARGHYTVGREVIDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYG+KSKLGFTI+PSPQ+  A
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGRKSKLGFTIYPSPQISTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CAD26892.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   313 bits (802),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSDTSVG+A+D+F+TFFSETGSGK
Sbjct  1    MREFISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFSTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G+YRQLFHPEQLISGK DAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKADAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLG+TI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGYTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_002297631.1| alpha-tubulin 2 family protein [Populus trichocarpa]
 gb|ABK92439.1| unknown [Populus trichocarpa]
 gb|EEE82436.1| alpha-tubulin 2 family protein [Populus trichocarpa]
Length=450

 Score =   313 bits (802),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEH IQPDGMMPSDTS G A+D+FNTFFSET SGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHDIQPDGMMPSDTSPGAAHDAFNTFFSETSSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQL+SGKEDAANNFARGHYTVGK+IVDLC+D
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLMSGKEDAANNFARGHYTVGKEIVDLCVD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_006445597.1| hypothetical protein CICLE_v10015224mg [Citrus clementina]
 ref|XP_006488930.1| PREDICTED: tubulin alpha-1 chain-like isoform X1 [Citrus sinensis]
 gb|ESR58837.1| hypothetical protein CICLE_v10015224mg [Citrus clementina]
 gb|KDO54446.1| hypothetical protein CISIN_1g013113mg [Citrus sinensis]
Length=449

 Score =   313 bits (801),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGI PDGMMPSD ++G+A+D+FNTFFSET +G+
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIHPDGMMPSDNTIGVAHDAFNTFFSETSAGR  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKL+DNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLSDNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_003624633.1| Alpha-tubulin [Medicago truncatula]
 gb|ABK28851.1| alpha-tubulin [Medicago truncatula]
 gb|ABN08980.1| Tubulin/FtsZ, C-terminal [Medicago truncatula]
 gb|AES80851.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   313 bits (801),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSDT+ G+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTTPGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVG++IV+LCLD
Sbjct  61   HVPRALFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGF VFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RIRKLADNCTGLQGFFVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_003554022.1| PREDICTED: tubulin alpha-6 chain-like [Glycine max]
 gb|KHN34688.1| Tubulin alpha-3 chain [Glycine soja]
Length=451

 Score =   313 bits (801),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGI PDG MPSDTSVG+A+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGINPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEP+V+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVG++IV+LCLD
Sbjct  61   HVPRALFVDLEPSVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_002263822.2| PREDICTED: tubulin alpha chain, partial [Vitis vinifera]
Length=322

 Score =   308 bits (790),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD ++G  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CBI29424.3| unnamed protein product [Vitis vinifera]
Length=287

 Score =   307 bits (786),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD ++G  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_011048194.1| PREDICTED: tubulin alpha-6 chain-like [Populus euphratica]
Length=450

 Score =   312 bits (800),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEH IQPDGMMPSDTS G A+D+FNTFFSET SGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHDIQPDGMMPSDTSPGAAHDAFNTFFSETSSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQL+SGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLMSGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_011021469.1| PREDICTED: tubulin alpha-3 chain-like [Populus euphratica]
Length=449

 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSDTS+G+ +DSFNTFFSET +GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSIGVEHDSFNTFFSETRAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEP+V+DEVRSG YRQLFHPEQLISGKEDAANNFARGHYTVG++IVDLCLD
Sbjct  61   HVPRAIFVDLEPSVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_011034391.1| PREDICTED: tubulin alpha-3 chain [Populus euphratica]
Length=449

 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSDTSVG+ +DSFNTFFSETG GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSVGVEHDSFNTFFSETGLGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEP+V+DEVR+G YRQLFHPEQL+SGKEDAANNFARGHYTVG++IV+LCLD
Sbjct  61   HVPRAIFVDLEPSVIDEVRTGTYRQLFHPEQLMSGKEDAANNFARGHYTVGREIVELCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|AEG74028.1| alpha-tubulin [Pellia endiviifolia (species B)]
 gb|AEG74032.1| alpha-tubulin [Pellia endiviifolia (species B)]
Length=448

 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEHGIQPDG M SDTSV + +D+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGRMSSDTSVVVGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_008455056.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Cucumis melo]
Length=406

 Score =   310 bits (795),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSDT+VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_006443441.1| hypothetical protein CICLE_v10020128mg [Citrus clementina]
 ref|XP_006479124.1| PREDICTED: tubulin alpha-3 chain-like [Citrus sinensis]
 gb|ESR56681.1| hypothetical protein CICLE_v10020128mg [Citrus clementina]
Length=449

 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSDTSVG  +D+FNTFFSETGSG+
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSVGACHDAFNTFFSETGSGQ  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEP+V+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVG++IVDLCLD
Sbjct  61   HVPRAVFVDLEPSVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|AGG37288.1| alpha-tubulin 6 [Salix arbutifolia]
Length=449

 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHG+QPDG MP DTSVG+ +DSFNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGMQPDGTMPGDTSVGMEHDSFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEP+V+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVG++IV+LCLD
Sbjct  61   HVPRAIFVDLEPSVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CAD26888.1| alpha-tubulin [Miscanthus transmorrisonensis]
Length=450

 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQ GNACWELYCLEH I+PDG MPSDTSVG A+D+FNTFFSETGSG+
Sbjct  1    MREIISIHIGQAGIQGGNACWELYCLEHSIEPDGTMPSDTSVGAAHDAFNTFFSETGSGQ  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGLYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|AAX21196.1| putative alpha-tubulin [Solanum betaceum]
Length=204

 Score =   303 bits (776),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGI+PDG MP D +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPGDVTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CAD24768.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   311 bits (798),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGI+PDG  PSDTSVG+A+D+FNTFFSETGSGK
Sbjct  1    MREFISIHIGQAGIQVGNACWELYCLEHGIEPDGTTPSDTSVGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADN TGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNRTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CAD24767.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   311 bits (798),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLE+GI+PDG MPSDTSVG  +D+FNTFFSETGSG+
Sbjct  1    MREFISIHIGQAGIQVGNACWELYCLEYGIEPDGTMPSDTSVGADDDAFNTFFSETGSGQ  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G+YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|KDO78780.1| hypothetical protein CISIN_1g037616mg, partial [Citrus sinensis]
Length=383

 Score =   309 bits (792),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE ISVHIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_006578253.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Glycine max]
Length=432

 Score =   311 bits (796),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_007047652.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX91809.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=501

 Score =   313 bits (801),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = +1

Query  7    EMREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSG  186
            +MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSDT+VG  +D+FNTFFSETGSG
Sbjct  50   KMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGSG  109

Query  187  KHVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCL  366
            KHVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCL
Sbjct  110  KHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  169

Query  367  DRVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVL  546
            DR+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  
Sbjct  170  DRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVST  229

Query  547  AMI  555
            +++
Sbjct  230  SVV  232



>ref|XP_008440460.1| PREDICTED: tubulin alpha chain-like isoform X2 [Cucumis melo]
Length=437

 Score =   310 bits (795),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE ISVHIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|AGV54497.1| tubulin alpha-3 chain-like protein [Phaseolus vulgaris]
Length=449

 Score =   311 bits (796),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGI  DG MPSDT+VGIA+D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGINTDGTMPSDTTVGIAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEP+V+DEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVG++IV+LCLD
Sbjct  61   HVPRALFVDLEPSVIDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|KHN46768.1| Tubulin alpha-3 chain [Glycine soja]
Length=443

 Score =   311 bits (796),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGI PDG MPSDTSVGIA+D+FNTFFSETG GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGINPDGTMPSDTSVGIAHDAFNTFFSETGFGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEP+V+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVG++IV+LCLD
Sbjct  61   HVPRALFVDLEPSVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_010664458.1| PREDICTED: tubulin alpha-4 chain [Vitis vinifera]
 emb|CAN77412.1| hypothetical protein VITISV_000470 [Vitis vinifera]
Length=451

 Score =   311 bits (796),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_008236253.1| PREDICTED: tubulin alpha chain isoform X2 [Prunus mume]
Length=427

 Score =   310 bits (793),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|AAO23139.1| alpha tubulin [Populus tremuloides]
Length=451

 Score =   310 bits (795),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|ABR67425.1| alpha-tubulin 4 [Populus tremuloides]
Length=450

 Score =   310 bits (795),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGNACWELYCLEH IQPDGMMPSDTS G A+D+FNTFFSET SGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHDIQPDGMMPSDTSPGAAHDAFNTFFSETSSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLF+PEQL+SGKEDAANNFARGHYTVGK+IVDLC+D
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFYPEQLMSGKEDAANNFARGHYTVGKEIVDLCVD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>sp|Q6VAG0.1|TBA2_GOSHI RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Gossypium hirsutum]
 gb|AAQ92662.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|ACM89776.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|KJB77616.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
 gb|KJB77617.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
Length=450

 Score =   310 bits (795),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_006581474.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
Length=452

 Score =   310 bits (795),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_009124557.1| PREDICTED: tubulin alpha-6 chain-like isoform X2 [Brassica rapa]
Length=431

 Score =   310 bits (793),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_003522731.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Glycine max]
Length=452

 Score =   310 bits (795),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|ABO47739.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG18532.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=450

 Score =   310 bits (795),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_010104543.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC01144.1| Tubulin alpha chain [Morus notabilis]
Length=448

 Score =   310 bits (794),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_011088040.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   310 bits (795),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE ISVHIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETGSGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score =   310 bits (794),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_008455054.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Cucumis melo]
Length=451

 Score =   310 bits (794),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSDT+VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_010466127.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Camelina sativa]
Length=423

 Score =   309 bits (792),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CBI25125.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   307 bits (787),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD + G  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTPGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>tpg|DAA51110.1| TPA: alpha-tubulin, partial [Zea mays]
 tpg|DAA51116.1| TPA: alpha-tubulin, partial [Zea mays]
Length=240

 Score =   303 bits (775),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQ DG MP D ++G  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score =   310 bits (794),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD SVG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_006486879.1| PREDICTED: tubulin alpha chain-like isoform X2 [Citrus sinensis]
Length=433

 Score =   309 bits (792),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_006581475.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Glycine max]
Length=466

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_002301128.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
 ref|XP_011017025.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017026.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017027.1| PREDICTED: tubulin alpha chain-like isoform X2 [Populus euphratica]
 gb|AAO63781.1| alpha-tubulin 1 [Populus tremuloides]
 gb|ABK96001.1| unknown [Populus trichocarpa]
 gb|EEE80401.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
Length=451

 Score =   310 bits (793),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CDY25017.1| BnaC02g39910D [Brassica napus]
Length=410

 Score =   308 bits (790),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_006466395.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Citrus sinensis]
Length=447

 Score =   310 bits (793),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE ISVHIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|KJB58757.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=403

 Score =   308 bits (789),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE ISVHIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>dbj|BAJ98211.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   310 bits (793),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE+IS+H+GQAGIQ+GNACWELYCLEHGIQPDG MPSD ++G  +D+FNTFFSETG+GK
Sbjct  1    MREVISIHVGQAGIQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVF+DLEPTVVDEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  A
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_010096739.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB65591.1| Tubulin alpha chain [Morus notabilis]
Length=449

 Score =   310 bits (793),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD ++G  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_003558477.1| PREDICTED: tubulin alpha-2 chain [Brachypodium distachyon]
Length=449

 Score =   310 bits (793),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSDTSVG+A D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVAKDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEV++G YRQLFHPEQLIS  EDAANNFARGHYTVG+++VDLCLD
Sbjct  61   HVPRALFVDLEPTVIDEVKTGLYRQLFHPEQLISHNEDAANNFARGHYTVGREVVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYG+KSKLGFTI+PSPQ+  A
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGRKSKLGFTIYPSPQISTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|ABB16994.1| unknown [Solanum tuberosum]
Length=467

 Score =   310 bits (794),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = +1

Query  7    EMREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSG  186
            EMREIISVHIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTS G A+D+FNTFFSETG+G
Sbjct  18   EMREIISVHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSPGAAHDAFNTFFSETGAG  77

Query  187  KHVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCL  366
            K VPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCL
Sbjct  78   KRVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCL  137

Query  367  DRVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVL  546
            D VRKLA NCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  
Sbjct  138  DPVRKLAINCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST  197

Query  547  AMI  555
            A++
Sbjct  198  AVV  200



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE ISVHIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE ISVHIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_004299843.1| PREDICTED: tubulin alpha chain-like [Fragaria vesca subsp. vesca]
 gb|AAK81858.1|AF394915_1 alpha tubulin subunit [Rosa hybrid cultivar]
Length=451

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|KDO81347.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=451

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE ISVHIGQAGIQVGNACWELYCLEHGIQPDG MP DT+VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_006472372.1| PREDICTED: tubulin alpha chain isoform X1 [Citrus sinensis]
Length=451

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE ISVHIGQAGIQVGNACWELYCLEHGIQPDG MP DT+VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_004985171.1| PREDICTED: tubulin alpha-2 chain-like [Setaria italica]
Length=448

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSDTSVG+A D+FNTFFSET +GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVARDAFNTFFSETSAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEV++G YRQLFHPEQLIS KEDAANNFARGHYTVG+++VDLCLD
Sbjct  61   HVPRALFVDLEPTVIDEVKTGTYRQLFHPEQLISHKEDAANNFARGHYTVGREVVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYG+KSKLGFTI+PSPQ+  A
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGRKSKLGFTIYPSPQISTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_009107245.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Brassica rapa]
Length=459

 Score =   310 bits (793),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_002313194.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
 gb|EEE87149.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
Length=451

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_005851144.1| alpha-tubulin [Chlorella variabilis]
 gb|EFN59042.1| alpha-tubulin [Chlorella variabilis]
Length=450

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE+IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD ++G  +D+FNTFFSETG+GK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPR VFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRCVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  A
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CAB66336.1| alpha-tubulin [Betula pendula]
 gb|AJA29683.1| tubulin alpha chain [Betula luminifera]
Length=451

 Score =   309 bits (792),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|ABO47736.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89778.1| alpha-tubulin 6 [Gossypium hirsutum]
Length=450

 Score =   309 bits (792),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE ISVHIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_002675196.1| alpha-tubulin [Naegleria gruberi]
 ref|XP_002677003.1| alpha-tubulin TUBA2 [Naegleria gruberi]
 ref|XP_002680089.1| alpha-tubulin [Naegleria gruberi]
 sp|P11237.1|TBA1_NAEGR RecName: Full=Tubulin alpha-1/2/3 chain [Naegleria gruberi]
 emb|CAA31074.1| unnamed protein product [Naegleria gruberi]
 emb|CAA31075.1| unnamed protein product [Naegleria gruberi]
 emb|CAA31076.1| unnamed protein product [Naegleria gruberi]
 gb|EFC42452.1| alpha-tubulin [Naegleria gruberi]
 gb|EFC44259.1| alpha-tubulin TUBA2 [Naegleria gruberi]
 gb|EFC47345.1| alpha-tubulin [Naegleria gruberi]
Length=453

 Score =   309 bits (792),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE+IS+HIGQAG+QVGNACWELYCLEHGIQPDG+MPSD ++G+ +D+FNTFFSETG+GK
Sbjct  1    MREVISIHIGQAGVQVGNACWELYCLEHGIQPDGLMPSDKTIGVEDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVF+DLEPTVVDEVR+G YRQLFHPEQLI+GKEDAANN+ARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFLDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVF++VGGGTGSGLG+LLLERLSVDYGKKSKLGFT++PSPQV  A
Sbjct  121  RIRKLADNCTGLQGFLVFSSVGGGTGSGLGALLLERLSVDYGKKSKLGFTVYPSPQVATA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   309 bits (792),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score =   309 bits (792),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score =   309 bits (792),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|AGG37287.1| alpha-tubulin 5 [Salix arbutifolia]
Length=451

 Score =   309 bits (792),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|ABK92552.1| unknown [Populus trichocarpa]
Length=451

 Score =   309 bits (792),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|KHG18997.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB32210.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=450

 Score =   309 bits (791),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE ISVHIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   309 bits (791),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CBI22190.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   307 bits (787),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVF+DLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score =   309 bits (792),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   309 bits (791),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|AIX10773.1| alpha tubulin [Panax notoginseng]
Length=451

 Score =   309 bits (791),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MP D +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVRSGAYRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_010531322.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Tarenaya hassleriana]
Length=454

 Score =   309 bits (792),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_010693818.1| PREDICTED: tubulin alpha-3 chain-like [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   309 bits (791),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE+IS+HIGQAGIQVGN+CWEL+CLEHGIQ DGMMPSDTS+G  +DSFNTFFSETGSGK
Sbjct  1    MREVISIHIGQAGIQVGNSCWELFCLEHGIQQDGMMPSDTSIGAEHDSFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVF+DLEPTV+DE+R+G YRQLFHPEQL++GKEDAANNFARGHYTVGKD++DLCLD
Sbjct  61   HVPRAVFIDLEPTVIDEIRTGPYRQLFHPEQLLTGKEDAANNFARGHYTVGKDMIDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLAD+CTGLQGFLVFNAVGGGTGSG GSLLLERLSV+YGKKSKLGFTIFPSPQV  A
Sbjct  121  RVRKLADSCTGLQGFLVFNAVGGGTGSGFGSLLLERLSVEYGKKSKLGFTIFPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_010054663.1| PREDICTED: tubulin alpha-3 chain-like [Eucalyptus grandis]
 gb|KCW89881.1| hypothetical protein EUGRSUZ_A02108 [Eucalyptus grandis]
Length=450

 Score =   309 bits (791),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE+IS+HIGQAGIQVGN+CWELYCLEH I PDG MPSDTSVG+A+D+FNTFFSETGSGK
Sbjct  1    MREVISIHIGQAGIQVGNSCWELYCLEHEIHPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVG++IV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGQYRQLFHPEQLISGKEDAANNFARGHYTVGREIVNLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLE+LSV+YGKKSKLGFTI+PSPQV  A
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLEQLSVEYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   309 bits (791),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_006472373.1| PREDICTED: tubulin alpha chain isoform X2 [Citrus sinensis]
Length=460

 Score =   309 bits (792),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE ISVHIGQAGIQVGNACWELYCLEHGIQPDG MP DT+VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score =   309 bits (791),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>dbj|BAC24800.1| alpha tubulin [Physcomitrella patens]
Length=451

 Score =   309 bits (791),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD SVG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVF+DLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_007042689.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX98520.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   309 bits (791),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score =   309 bits (791),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_002465633.1| hypothetical protein SORBIDRAFT_01g042650 [Sorghum bicolor]
 gb|EER92631.1| hypothetical protein SORBIDRAFT_01g042650 [Sorghum bicolor]
Length=448

 Score =   309 bits (791),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSD SVG+A D+FNTFFSET +GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDNSVGVARDAFNTFFSETSAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEV++GAYRQLFHPEQLIS KEDAANNFARGHYTVG+++VDLCLD
Sbjct  61   HVPRALFVDLEPTVIDEVKTGAYRQLFHPEQLISHKEDAANNFARGHYTVGREVVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYG+KSKLGFTI+PSPQ+  A
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGRKSKLGFTIYPSPQISTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_004493170.1| PREDICTED: tubulin alpha-3 chain-like [Cicer arietinum]
Length=450

 Score =   309 bits (791),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MREIIS+HIGQAGIQ+GN+CWELYCLEHGIQPDG+MPSDTS G+A D+FNTFFSETGSGK
Sbjct  1    MREIISIHIGQAGIQLGNSCWELYCLEHGIQPDGLMPSDTSPGVARDAFNTFFSETGSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVG++IV+LC+D
Sbjct  61   HVPRALFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCID  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKL D+CTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RIRKLTDSCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_008440459.1| PREDICTED: tubulin alpha chain-like isoform X1 [Cucumis melo]
Length=450

 Score =   309 bits (791),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE ISVHIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_004143417.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004160931.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
Length=450

 Score =   309 bits (791),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE ISVHIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>emb|CDY66630.1| BnaCnng51680D [Brassica napus]
Length=435

 Score =   308 bits (789),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score =   309 bits (791),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score =   309 bits (791),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_009407690.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=452

 Score =   309 bits (791),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD ++G  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_007137281.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
 gb|ESW09275.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
Length=451

 Score =   309 bits (791),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVRSG YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRSGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_006404742.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
 gb|ESQ46195.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
Length=451

 Score =   309 bits (791),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|AHJ80818.1| Tua1, partial [Eragrostis tef]
Length=291

 Score =   303 bits (776),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQ DG MP D ++G  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|ABO47740.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89777.1| alpha-tubulin 10 [Gossypium hirsutum]
 gb|KHG24734.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB58758.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=450

 Score =   308 bits (790),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE ISVHIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_007199840.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
 ref|XP_008236252.1| PREDICTED: tubulin alpha chain isoform X1 [Prunus mume]
 gb|EMJ01039.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
Length=450

 Score =   308 bits (790),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_006307493.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
 ref|XP_010418156.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 ref|XP_010430201.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Camelina sativa]
 ref|XP_010430202.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
 ref|XP_010473400.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 gb|EOA40391.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
Length=450

 Score =   308 bits (790),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_010531321.1| PREDICTED: tubulin alpha chain isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   308 bits (790),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_009335355.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
Length=450

 Score =   308 bits (790),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|NP_171974.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 ref|NP_175423.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 ref|XP_002863595.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002891551.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006279139.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 ref|XP_006393188.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 ref|XP_006406473.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 ref|XP_009107244.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Brassica rapa]
 sp|B9DGT7.2|TBA2_ARATH RecName: Full=Tubulin alpha-2 chain [Arabidopsis thaliana]
 sp|Q0WV25.2|TBA4_ARATH RecName: Full=Tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AAF40454.1|AC004809_12 Identical to the alpha-4 tubulin (TUA4) gene from A. thaliana 
gb|M84697. ESTs gb|T46564. gb|T04381, gb|T76028, gb|T21602, 
gb|H37154 gb|H37663 and gb|T21719 come from this gene [Arabidopsis 
thaliana]
 gb|AAF76449.1|AC015445_16 Identical to Tubulin Alpha-6 Chain from Arabidopsis thaliana 
gi|267070 and contains a Tubulin PF|00091 domain. ESTs gb|N37387, 
gb|N37805, gb|R90497, gb|T44684, gb|H36144, gb|N38686, 
gb|AI994844, gb|R90689, gb|T04725, gb|H36928, gb|N96479, gb|H36922, 
gb|R90670, gb|Z17980, gb|T4428, gb|H36248, gb|N65408, 
gb|T46222 come from this gene [Arabidopsis thaliana]
 gb|AAK95316.1|AF410330_1 At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|AAA32889.1| apha-2 tubulin [Arabidopsis thaliana]
 gb|AAA32890.1| alpha-4 tubulin [Arabidopsis thaliana]
 gb|AAL25612.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAL38293.1| Tubulin Alpha-6 Chain [Arabidopsis thaliana]
 gb|AAM98269.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAN31076.1| At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|ABQ01730.1| TUA2 [Eutrema halophilum]
 gb|ABQ01731.1| TUA2-2 [Eutrema halophilum]
 gb|EFH39854.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67810.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|AEE27747.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AEE32507.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 gb|EOA12037.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 gb|ESQ30474.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 gb|ESQ47926.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 gb|KFK35954.1| hypothetical protein AALP_AA4G059800 [Arabis alpina]
 gb|KFK39296.1| alpha tubulin 1 [Arabis alpina]
 emb|CDY45043.1| BnaA08g02320D [Brassica napus]
 emb|CDY03583.1| BnaC03g68420D [Brassica napus]
Length=450

 Score =   308 bits (790),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_002508010.1| alpha tubulin 2 [Micromonas sp. RCC299]
 ref|XP_002506067.1| alpha tubulin 1 [Micromonas sp. RCC299]
 gb|ACO67325.1| alpha tubulin 1 [Micromonas sp. RCC299]
 gb|ACO69268.1| alpha tubulin 2 [Micromonas sp. RCC299]
Length=449

 Score =   308 bits (790),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE+IS+HIGQAGIQ GNACWELYCLEHGIQPDG MPSD ++G  +D+FNTFFSETG+GK
Sbjct  1    MREVISIHIGQAGIQTGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVF+DLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGF+VFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI+PSPQV  A
Sbjct  121  RIRKLADNCTGLQGFMVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_010245599.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=451

 Score =   308 bits (790),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGQYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_009388502.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=451

 Score =   308 bits (790),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MP D +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_009618479.1| PREDICTED: tubulin alpha-3 chain-like [Nicotiana tomentosiformis]
Length=451

 Score =   308 bits (790),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSET SGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETSSGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+GAYRQLFHPEQLISGKEDAANNFARGHYT+G++IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGREIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>dbj|BAE99023.1| tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=450

 Score =   308 bits (790),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|EYU37544.1| hypothetical protein MIMGU_mgv1a007145mg [Erythranthe guttata]
Length=417

 Score =   307 bits (787),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE ISVHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRA+FVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_004288297.1| PREDICTED: tubulin alpha-3 chain [Fragaria vesca subsp. vesca]
Length=451

 Score =   308 bits (790),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_010526692.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   308 bits (790),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>ref|XP_010555432.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   308 bits (790),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



>gb|AID52921.1| tubulin alpha chain [Carthamus tinctorius]
Length=450

 Score =   308 bits (790),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  10   MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGK  189
            MRE IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  190  HVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  369
            HVPRAVFVDLEPTV+DEVR+G YRQLFHPEQLISGKEDAANNFARGHYT+GK+IVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  370  RVRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIFPSPQVVLA  549
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT++PSPQV  +
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  550  MI  555
            ++
Sbjct  181  VV  182



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 751271412925