BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF011D19

Length=492
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006362437.1|  PREDICTED: uncharacterized protein LOC102599991    201   8e-60   Solanum tuberosum [potatoes]
ref|XP_011096427.1|  PREDICTED: protein trichome birefringence-li...    201   3e-59   Sesamum indicum [beniseed]
ref|XP_009599976.1|  PREDICTED: protein trichome birefringence-li...    198   9e-59   Nicotiana tomentosiformis
ref|XP_009781572.1|  PREDICTED: protein trichome birefringence-li...    197   3e-58   Nicotiana sylvestris
ref|XP_004232960.1|  PREDICTED: protein trichome birefringence-li...    195   4e-57   Solanum lycopersicum
ref|XP_007211863.1|  hypothetical protein PRUPE_ppa010079mg             189   1e-56   
gb|ACU21157.1|  unknown                                                 187   5e-56   Glycine max [soybeans]
ref|XP_009599983.1|  PREDICTED: protein trichome birefringence-li...    191   7e-56   Nicotiana tomentosiformis
ref|XP_008225213.1|  PREDICTED: protein trichome birefringence-li...    189   3e-55   Prunus mume [ume]
gb|KDO77824.1|  hypothetical protein CISIN_1g017263mg                   184   4e-55   Citrus sinensis [apfelsine]
ref|XP_007148060.1|  hypothetical protein PHAVU_006G177100g             189   5e-55   Phaseolus vulgaris [French bean]
ref|XP_006377552.1|  hypothetical protein POPTR_0011s07540g             184   8e-55   
ref|XP_010057074.1|  PREDICTED: protein trichome birefringence-li...    188   9e-55   Eucalyptus grandis [rose gum]
gb|KDO77823.1|  hypothetical protein CISIN_1g017263mg                   184   2e-54   Citrus sinensis [apfelsine]
ref|XP_006449479.1|  hypothetical protein CICLE_v10015687mg             187   2e-54   Citrus clementina [clementine]
ref|XP_006597476.1|  PREDICTED: protein YLS7-like                       187   2e-54   Glycine max [soybeans]
ref|XP_010091711.1|  hypothetical protein L484_001474                   180   4e-54   
ref|XP_008371453.1|  PREDICTED: protein trichome birefringence-li...    186   5e-54   Malus domestica [apple tree]
gb|EYU28072.1|  hypothetical protein MIMGU_mgv1a008400mg                186   6e-54   Erythranthe guttata [common monkey flower]
ref|XP_007025417.1|  Trichome birefringence-like 37 isoform 1           185   8e-54   
gb|KHN08449.1|  hypothetical protein glysoja_014214                     185   1e-53   Glycine soja [wild soybean]
ref|XP_006594557.1|  PREDICTED: protein YLS7-like isoform X2            186   1e-53   Glycine max [soybeans]
ref|XP_003542986.1|  PREDICTED: protein YLS7-like isoform X1            185   1e-53   Glycine max [soybeans]
ref|XP_009348409.1|  PREDICTED: protein trichome birefringence-li...    184   2e-53   Pyrus x bretschneideri [bai li]
ref|XP_007211024.1|  hypothetical protein PRUPE_ppa019892mg             177   2e-53   
gb|KDO77819.1|  hypothetical protein CISIN_1g017263mg                   184   2e-53   Citrus sinensis [apfelsine]
ref|XP_011005473.1|  PREDICTED: protein trichome birefringence-li...    184   3e-53   Populus euphratica
gb|KDO77821.1|  hypothetical protein CISIN_1g017263mg                   184   3e-53   Citrus sinensis [apfelsine]
gb|AHN91976.1|  TBL1                                                    184   3e-53   Citrus sinensis [apfelsine]
ref|XP_006467669.1|  PREDICTED: protein YLS7-like                       184   3e-53   
gb|KDO77820.1|  hypothetical protein CISIN_1g017263mg                   184   3e-53   Citrus sinensis [apfelsine]
gb|KDO77822.1|  hypothetical protein CISIN_1g017263mg                   184   3e-53   Citrus sinensis [apfelsine]
ref|XP_002305083.1|  hypothetical protein POPTR_0004s05420g             185   3e-53   
ref|XP_009790075.1|  PREDICTED: protein trichome birefringence-li...    182   8e-53   Nicotiana sylvestris
gb|KHG20284.1|  Enolase                                                 182   9e-53   Gossypium arboreum [tree cotton]
ref|XP_008383643.1|  PREDICTED: protein trichome birefringence-li...    182   1e-52   
gb|KDP21076.1|  hypothetical protein JCGZ_21547                         181   3e-52   Jatropha curcas
ref|XP_004485883.1|  PREDICTED: uncharacterized protein LOC101498973    181   4e-52   Cicer arietinum [garbanzo]
emb|CBI30668.3|  unnamed protein product                                181   7e-52   Vitis vinifera
ref|XP_006305057.1|  hypothetical protein CARUB_v10009422mg             181   7e-52   Capsella rubella
ref|NP_565779.1|  trichome birefringence-like 37 protein                181   8e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007153710.1|  hypothetical protein PHAVU_003G058400g             180   8e-52   Phaseolus vulgaris [French bean]
emb|CAN60202.1|  hypothetical protein VITISV_036403                     180   1e-51   Vitis vinifera
ref|XP_004234094.1|  PREDICTED: protein trichome birefringence-li...    179   1e-51   
ref|XP_010460674.1|  PREDICTED: protein trichome birefringence-li...    180   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010480710.1|  PREDICTED: protein trichome birefringence-li...    180   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010499424.1|  PREDICTED: protein trichome birefringence-li...    179   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_002274664.1|  PREDICTED: protein trichome birefringence-li...    180   3e-51   Vitis vinifera
ref|XP_003593750.1|  hypothetical protein MTR_2g015720                  178   3e-51   Medicago truncatula
ref|XP_009352799.1|  PREDICTED: protein trichome birefringence-li...    178   5e-51   Pyrus x bretschneideri [bai li]
ref|XP_009410826.1|  PREDICTED: protein trichome birefringence-li...    178   6e-51   
gb|KJB69610.1|  hypothetical protein B456_011G033800                    178   6e-51   Gossypium raimondii
ref|XP_003593751.1|  hypothetical protein MTR_2g015720                  178   6e-51   
ref|XP_011045911.1|  PREDICTED: protein trichome birefringence-li...    177   7e-51   Populus euphratica
ref|NP_564318.1|  protein trichome birefringence-like 38                178   8e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893546.1|  hypothetical protein ARALYDRAFT_473111             178   8e-51   
ref|XP_002522557.1|  conserved hypothetical protein                     177   8e-51   Ricinus communis
gb|KJB68384.1|  hypothetical protein B456_010G242200                    177   1e-50   Gossypium raimondii
gb|KJB34893.1|  hypothetical protein B456_006G088800                    177   1e-50   Gossypium raimondii
ref|XP_004149051.1|  PREDICTED: uncharacterized protein LOC101203509    177   1e-50   Cucumis sativus [cucumbers]
gb|KFK44758.1|  hypothetical protein AALP_AA1G299000                    177   2e-50   Arabis alpina [alpine rockcress]
ref|XP_010509796.1|  PREDICTED: protein trichome birefringence-li...    176   3e-50   Camelina sativa [gold-of-pleasure]
ref|XP_006415616.1|  hypothetical protein EUTSA_v10007896mg             176   4e-50   Eutrema salsugineum [saltwater cress]
emb|CAJ40777.1|  alpha galactosidase precursor                          176   4e-50   Coffea arabica [arabica coffee]
emb|CDO96761.1|  unnamed protein product                                176   4e-50   Coffea canephora [robusta coffee]
gb|EPS72531.1|  hypothetical protein M569_02228                         167   5e-50   Genlisea aurea
ref|XP_006294394.1|  hypothetical protein CARUB_v10023411mg             176   8e-50   Capsella rubella
ref|XP_003608141.1|  Alpha galactosidase                                169   1e-49   
ref|XP_010549391.1|  PREDICTED: protein trichome birefringence-li...    174   2e-49   Tarenaya hassleriana [spider flower]
ref|XP_003529365.1|  PREDICTED: protein YLS7-like                       173   3e-49   Glycine max [soybeans]
ref|XP_004134666.1|  PREDICTED: uncharacterized protein LOC101216213    173   5e-49   Cucumis sativus [cucumbers]
ref|XP_011460601.1|  PREDICTED: protein trichome birefringence-li...    173   6e-49   Fragaria vesca subsp. vesca
ref|XP_006410551.1|  hypothetical protein EUTSA_v10016785mg             173   9e-49   Eutrema salsugineum [saltwater cress]
ref|XP_008443074.1|  PREDICTED: protein trichome birefringence-li...    174   9e-49   Cucumis melo [Oriental melon]
ref|XP_002279857.1|  PREDICTED: protein trichome birefringence-li...    172   1e-48   Vitis vinifera
ref|XP_010469399.1|  PREDICTED: protein trichome birefringence-li...    172   2e-48   Camelina sativa [gold-of-pleasure]
ref|XP_008439751.1|  PREDICTED: protein trichome birefringence-li...    171   3e-48   Cucumis melo [Oriental melon]
ref|XP_009411213.1|  PREDICTED: protein trichome birefringence-li...    171   3e-48   
ref|XP_010540499.1|  PREDICTED: protein trichome birefringence-li...    171   3e-48   Tarenaya hassleriana [spider flower]
ref|XP_009102887.1|  PREDICTED: protein trichome birefringence-li...    170   7e-48   Brassica rapa
emb|CDX94643.1|  BnaC07g10150D                                          170   9e-48   
ref|XP_010413780.1|  PREDICTED: protein trichome birefringence-li...    170   9e-48   Camelina sativa [gold-of-pleasure]
ref|XP_008456435.1|  PREDICTED: protein trichome birefringence-li...    164   1e-47   Cucumis melo [Oriental melon]
ref|XP_009141359.1|  PREDICTED: protein trichome birefringence-li...    169   2e-47   Brassica rapa
gb|AFK45250.1|  unknown                                                 168   3e-47   Lotus japonicus
ref|XP_010279090.1|  PREDICTED: protein trichome birefringence-li...    168   3e-47   Nelumbo nucifera [Indian lotus]
ref|XP_003518885.1|  PREDICTED: protein YLS7-like                       168   5e-47   Glycine max [soybeans]
ref|XP_011086013.1|  PREDICTED: protein trichome birefringence-li...    167   5e-47   Sesamum indicum [beniseed]
gb|KHN32337.1|  hypothetical protein glysoja_032520                     167   6e-47   Glycine soja [wild soybean]
ref|XP_010277748.1|  PREDICTED: protein trichome birefringence-li...    167   6e-47   Nelumbo nucifera [Indian lotus]
emb|CDX79555.1|  BnaC03g18910D                                          167   9e-47   
ref|XP_009123178.1|  PREDICTED: protein trichome birefringence-li...    166   2e-46   Brassica rapa
emb|CDY64767.1|  BnaCnng44810D                                          166   2e-46   Brassica napus [oilseed rape]
gb|AES90337.2|  trichome birefringence-like protein                     166   2e-46   Medicago truncatula
ref|XP_009396650.1|  PREDICTED: protein trichome birefringence-li...    166   3e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010911005.1|  PREDICTED: protein trichome birefringence-li...    160   4e-46   
ref|XP_008811067.1|  PREDICTED: protein trichome birefringence-li...    160   4e-46   
emb|CDY30832.1|  BnaC05g22080D                                          164   1e-45   Brassica napus [oilseed rape]
ref|XP_007149752.1|  hypothetical protein PHAVU_005G096200g             164   2e-45   Phaseolus vulgaris [French bean]
ref|XP_002458239.1|  hypothetical protein SORBIDRAFT_03g029700          164   2e-45   Sorghum bicolor [broomcorn]
ref|XP_004149371.1|  PREDICTED: uncharacterized protein LOC101205461    163   2e-45   Cucumis sativus [cucumbers]
emb|CDY17220.1|  BnaA05g09680D                                          163   4e-45   Brassica napus [oilseed rape]
gb|EMS68140.1|  hypothetical protein TRIUR3_18149                       158   4e-45   Triticum urartu
ref|XP_007132901.1|  hypothetical protein PHAVU_011G1346001g            158   8e-45   Phaseolus vulgaris [French bean]
ref|XP_008783904.1|  PREDICTED: protein trichome birefringence-li...    161   1e-44   Phoenix dactylifera
emb|CDX84658.1|  BnaA03g15720D                                          161   2e-44   
ref|XP_009132974.1|  PREDICTED: protein trichome birefringence-li...    161   2e-44   Brassica rapa
ref|XP_009394133.1|  PREDICTED: protein trichome birefringence-li...    160   3e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010272740.1|  PREDICTED: protein trichome birefringence-li...    160   3e-44   Nelumbo nucifera [Indian lotus]
ref|XP_004969334.1|  PREDICTED: uncharacterized protein LOC101766252    160   4e-44   Setaria italica
emb|CDY17219.1|  BnaA05g09690D                                          160   7e-44   Brassica napus [oilseed rape]
ref|XP_004487169.1|  PREDICTED: uncharacterized protein LOC101503983    159   7e-44   Cicer arietinum [garbanzo]
ref|XP_009591836.1|  PREDICTED: protein trichome birefringence-li...    159   9e-44   Nicotiana tomentosiformis
gb|ACJ84951.1|  unknown                                                 155   9e-44   Medicago truncatula
ref|XP_003540392.1|  PREDICTED: protein YLS7 isoform 1                  159   9e-44   Glycine max [soybeans]
ref|XP_010099368.1|  hypothetical protein L484_004794                   159   1e-43   Morus notabilis
gb|AAC63839.1|  unknown protein                                         153   1e-43   Arabidopsis thaliana [mouse-ear cress]
gb|KHN36688.1|  hypothetical protein glysoja_001419                     159   1e-43   Glycine soja [wild soybean]
ref|XP_010915618.1|  PREDICTED: protein trichome birefringence-li...    159   1e-43   Elaeis guineensis
ref|XP_010912702.1|  PREDICTED: protein trichome birefringence-li...    159   1e-43   Elaeis guineensis
ref|XP_003543309.1|  PREDICTED: protein YLS7                            159   1e-43   Glycine max [soybeans]
ref|XP_003607566.1|  hypothetical protein MTR_4g079700                  155   2e-43   
ref|XP_009784314.1|  PREDICTED: protein trichome birefringence-li...    158   2e-43   Nicotiana sylvestris
gb|ABA29157.1|  unknown                                                 157   4e-43   Pisum sativum [garden pea]
ref|XP_010273483.1|  PREDICTED: protein trichome birefringence-li...    157   4e-43   Nelumbo nucifera [Indian lotus]
gb|ABA29158.1|  unknown                                                 157   5e-43   Pisum sativum [garden pea]
ref|XP_009143811.1|  PREDICTED: protein trichome birefringence-li...    157   5e-43   Brassica rapa
emb|CDM83556.1|  unnamed protein product                                157   5e-43   Triticum aestivum [Canadian hard winter wheat]
gb|KCW89619.1|  hypothetical protein EUGRSUZ_A01902                     157   7e-43   Eucalyptus grandis [rose gum]
ref|XP_010272738.1|  PREDICTED: protein trichome birefringence-li...    157   7e-43   Nelumbo nucifera [Indian lotus]
ref|XP_010070349.1|  PREDICTED: protein trichome birefringence-li...    157   7e-43   Eucalyptus grandis [rose gum]
ref|XP_010052537.1|  PREDICTED: protein trichome birefringence-li...    157   7e-43   Eucalyptus grandis [rose gum]
ref|XP_006442366.1|  hypothetical protein CICLE_v10024135mg             157   1e-42   Citrus clementina [clementine]
ref|XP_010272737.1|  PREDICTED: protein trichome birefringence-li...    156   1e-42   Nelumbo nucifera [Indian lotus]
ref|XP_003608110.1|  hypothetical protein MTR_4g087730                  156   1e-42   Medicago truncatula
ref|XP_010915621.1|  PREDICTED: protein trichome birefringence-li...    154   1e-42   
ref|XP_010272739.1|  PREDICTED: protein trichome birefringence-li...    156   1e-42   Nelumbo nucifera [Indian lotus]
ref|XP_011100405.1|  PREDICTED: protein trichome birefringence-li...    157   1e-42   
ref|XP_006477896.1|  PREDICTED: protein YLS7-like                       156   1e-42   
ref|XP_004303168.1|  PREDICTED: protein trichome birefringence-li...    156   2e-42   Fragaria vesca subsp. vesca
ref|XP_010517784.1|  PREDICTED: protein trichome birefringence-li...    155   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010506087.1|  PREDICTED: protein trichome birefringence-li...    155   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010552884.1|  PREDICTED: protein trichome birefringence-li...    155   2e-42   Tarenaya hassleriana [spider flower]
ref|XP_010552824.1|  PREDICTED: protein trichome birefringence-li...    155   2e-42   Tarenaya hassleriana [spider flower]
emb|CDY55393.1|  BnaA05g34290D                                          155   2e-42   Brassica napus [oilseed rape]
gb|EPS71829.1|  hypothetical protein M569_02929                         152   3e-42   Genlisea aurea
ref|NP_001043736.1|  Os01g0652100                                       155   3e-42   
ref|XP_009142851.1|  PREDICTED: protein trichome birefringence-li...    155   4e-42   Brassica rapa
gb|EYU41140.1|  hypothetical protein MIMGU_mgv1a008520mg                155   4e-42   Erythranthe guttata [common monkey flower]
dbj|BAJ89025.1|  predicted protein                                      155   5e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB71444.1|  hypothetical protein B456_011G124000                    152   6e-42   Gossypium raimondii
ref|XP_009143809.1|  PREDICTED: protein trichome birefringence-li...    155   6e-42   Brassica rapa
ref|XP_003607565.1|  hypothetical protein MTR_4g079700                  154   6e-42   Medicago truncatula
ref|XP_002881861.1|  hypothetical protein ARALYDRAFT_483351             154   7e-42   
ref|XP_010915620.1|  PREDICTED: protein trichome birefringence-li...    154   7e-42   
ref|XP_010552766.1|  PREDICTED: protein trichome birefringence-li...    154   7e-42   Tarenaya hassleriana [spider flower]
ref|XP_010552686.1|  PREDICTED: protein trichome birefringence-li...    154   7e-42   Tarenaya hassleriana [spider flower]
ref|NP_565975.1|  protein trichome birefringence-like 39                154   8e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002325581.2|  hypothetical protein POPTR_0019s11990g             154   9e-42   Populus trichocarpa [western balsam poplar]
ref|XP_003599941.1|  hypothetical protein MTR_3g049330                  154   9e-42   Medicago truncatula
ref|XP_011002532.1|  PREDICTED: protein trichome birefringence-li...    154   1e-41   Populus euphratica
emb|CDY51515.1|  BnaC04g02360D                                          154   1e-41   Brassica napus [oilseed rape]
ref|XP_010686317.1|  PREDICTED: protein trichome birefringence-li...    154   1e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006646157.1|  PREDICTED: protein YLS7-like                       155   1e-41   
gb|KEH39261.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    154   1e-41   Medicago truncatula
gb|KHG02694.1|  putative C7orf58                                        153   1e-41   Gossypium arboreum [tree cotton]
gb|KFK37109.1|  hypothetical protein AALP_AA4G214000                    153   2e-41   Arabis alpina [alpine rockcress]
gb|KDO63327.1|  hypothetical protein CISIN_1g017063mg                   150   2e-41   Citrus sinensis [apfelsine]
gb|KJB74418.1|  hypothetical protein B456_011G293800                    153   2e-41   Gossypium raimondii
gb|EMT21950.1|  hypothetical protein F775_18320                         154   2e-41   
ref|XP_003569466.1|  PREDICTED: protein trichome birefringence-li...    154   2e-41   Brachypodium distachyon [annual false brome]
ref|XP_006411518.1|  hypothetical protein EUTSA_v10016832mg             153   2e-41   Eutrema salsugineum [saltwater cress]
gb|KCW67609.1|  hypothetical protein EUGRSUZ_F01364                     155   2e-41   Eucalyptus grandis [rose gum]
gb|AFK49604.1|  unknown                                                 153   2e-41   Lotus japonicus
gb|KDO58610.1|  hypothetical protein CISIN_1g018353mg                   151   2e-41   Citrus sinensis [apfelsine]
ref|XP_010106402.1|  hypothetical protein L484_008607                   153   2e-41   Morus notabilis
ref|XP_002285609.1|  PREDICTED: protein trichome birefringence-li...    153   2e-41   Vitis vinifera
gb|KJB67475.1|  hypothetical protein B456_010G192400                    153   2e-41   Gossypium raimondii
ref|XP_004505509.1|  PREDICTED: uncharacterized protein LOC101514285    152   3e-41   Cicer arietinum [garbanzo]
emb|CAN82331.1|  hypothetical protein VITISV_007322                     152   3e-41   Vitis vinifera
gb|KDP31782.1|  hypothetical protein JCGZ_12243                         152   3e-41   Jatropha curcas
ref|XP_009142074.1|  PREDICTED: protein trichome birefringence-li...    152   3e-41   
tpg|DAA58322.1|  TPA: putative DUF231 domain containing family pr...    153   3e-41   
ref|XP_009593637.1|  PREDICTED: protein trichome birefringence-li...    152   3e-41   Nicotiana tomentosiformis
ref|XP_003537664.1|  PREDICTED: protein YLS7-like                       152   3e-41   Glycine max [soybeans]
gb|ACU19344.1|  unknown                                                 152   4e-41   Glycine max [soybeans]
ref|XP_004243406.1|  PREDICTED: protein trichome birefringence-li...    152   5e-41   Solanum lycopersicum
ref|XP_006448024.1|  hypothetical protein CICLE_v10015743mg             152   5e-41   Citrus clementina [clementine]
gb|KDO63326.1|  hypothetical protein CISIN_1g017063mg                   150   5e-41   Citrus sinensis [apfelsine]
ref|XP_010670501.1|  PREDICTED: protein trichome birefringence-li...    152   6e-41   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO58611.1|  hypothetical protein CISIN_1g018353mg                   152   6e-41   Citrus sinensis [apfelsine]
ref|XP_006492255.1|  PREDICTED: protein YLS7-like                       152   6e-41   Citrus sinensis [apfelsine]
emb|CDY47981.1|  BnaA04g24590D                                          152   6e-41   Brassica napus [oilseed rape]
ref|XP_006294317.1|  hypothetical protein CARUB_v10023325mg             152   6e-41   
ref|XP_007022285.1|  Trichome birefringence-like 38                     152   6e-41   
emb|CDY14846.1|  BnaC04g48430D                                          152   7e-41   Brassica napus [oilseed rape]
gb|KJB71443.1|  hypothetical protein B456_011G124000                    151   7e-41   Gossypium raimondii
ref|XP_004967058.1|  PREDICTED: uncharacterized protein LOC101773522    151   8e-41   
ref|XP_010557124.1|  PREDICTED: protein trichome birefringence-li...    152   8e-41   Tarenaya hassleriana [spider flower]
ref|XP_008781517.1|  PREDICTED: protein trichome birefringence-li...    151   8e-41   
ref|XP_008449501.1|  PREDICTED: protein trichome birefringence-li...    151   1e-40   Cucumis melo [Oriental melon]
ref|XP_002525125.1|  conserved hypothetical protein                     150   1e-40   
ref|NP_001144145.1|  uncharacterized protein LOC100276997 precursor     151   1e-40   
ref|XP_009359359.1|  PREDICTED: protein trichome birefringence-li...    150   2e-40   Pyrus x bretschneideri [bai li]
ref|XP_008675272.1|  PREDICTED: LOW QUALITY PROTEIN: protein tric...    151   2e-40   
gb|KJB24278.1|  hypothetical protein B456_004G138200                    148   2e-40   Gossypium raimondii
ref|XP_004248190.1|  PREDICTED: protein trichome birefringence-li...    150   2e-40   Solanum lycopersicum
gb|AAO42294.1|  unknown protein                                         150   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010469762.1|  PREDICTED: protein trichome birefringence-li...    150   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_009787170.1|  PREDICTED: protein trichome birefringence-li...    150   2e-40   Nicotiana sylvestris
ref|XP_006410237.1|  hypothetical protein EUTSA_v10016834mg             150   2e-40   Eutrema salsugineum [saltwater cress]
ref|XP_010273481.1|  PREDICTED: protein trichome birefringence-li...    150   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_004500006.1|  PREDICTED: uncharacterized protein LOC101510811    150   2e-40   Cicer arietinum [garbanzo]
ref|XP_004305456.2|  PREDICTED: protein trichome birefringence-li...    150   2e-40   Fragaria vesca subsp. vesca
ref|XP_010273482.1|  PREDICTED: protein trichome birefringence-li...    150   2e-40   Nelumbo nucifera [Indian lotus]
gb|AAM65091.1|  unknown                                                 150   2e-40   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD44658.1|  unnamed protein product                                150   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008342762.1|  PREDICTED: protein trichome birefringence-li...    150   2e-40   
ref|NP_001077985.1|  protein TRICHOME BIREFRINGENCE-LIKE 40             150   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010414182.1|  PREDICTED: protein trichome birefringence-li...    150   3e-40   Camelina sativa [gold-of-pleasure]
ref|XP_006446762.1|  hypothetical protein CICLE_v10015634mg             150   3e-40   Citrus clementina [clementine]
ref|XP_006348847.1|  PREDICTED: uncharacterized protein LOC102593679    150   3e-40   Solanum tuberosum [potatoes]
ref|XP_006376352.1|  hypothetical protein POPTR_0013s12290g             150   3e-40   Populus trichocarpa [western balsam poplar]
ref|XP_008437676.1|  PREDICTED: protein trichome birefringence-li...    149   3e-40   Cucumis melo [Oriental melon]
ref|XP_004143813.1|  PREDICTED: uncharacterized protein LOC101214809    149   3e-40   
gb|KFK31236.1|  hypothetical protein AALP_AA6G086200                    150   3e-40   Arabis alpina [alpine rockcress]
ref|XP_009132768.1|  PREDICTED: protein trichome birefringence-li...    149   4e-40   Brassica rapa
ref|XP_004295668.1|  PREDICTED: protein trichome birefringence-li...    150   4e-40   Fragaria vesca subsp. vesca
ref|XP_011464795.1|  PREDICTED: protein trichome birefringence-li...    149   4e-40   Fragaria vesca subsp. vesca
ref|XP_011080615.1|  PREDICTED: protein trichome birefringence-li...    149   4e-40   Sesamum indicum [beniseed]
emb|CDP06046.1|  unnamed protein product                                145   5e-40   Coffea canephora [robusta coffee]
emb|CDY23962.1|  BnaC03g17290D                                          149   5e-40   Brassica napus [oilseed rape]
ref|XP_006582288.1|  PREDICTED: protein YLS7-like                       149   6e-40   Glycine max [soybeans]
ref|XP_009354245.1|  PREDICTED: protein trichome birefringence-li...    149   6e-40   Pyrus x bretschneideri [bai li]
ref|XP_010064517.1|  PREDICTED: protein trichome birefringence-li...    151   7e-40   
emb|CDP15911.1|  unnamed protein product                                149   7e-40   Coffea canephora [robusta coffee]
ref|XP_004295669.1|  PREDICTED: protein trichome birefringence-li...    149   7e-40   Fragaria vesca subsp. vesca
gb|AAF88130.1|AC021043_23  Unknown protein                              149   7e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006469036.1|  PREDICTED: protein YLS7-like                       149   7e-40   Citrus sinensis [apfelsine]
gb|EYU43352.1|  hypothetical protein MIMGU_mgv1a017695mg                149   7e-40   Erythranthe guttata [common monkey flower]
ref|XP_010052993.1|  PREDICTED: protein trichome birefringence-li...    149   8e-40   Eucalyptus grandis [rose gum]
ref|XP_008783903.1|  PREDICTED: protein trichome birefringence-li...    149   8e-40   Phoenix dactylifera
ref|XP_010670414.1|  PREDICTED: protein trichome birefringence-li...    148   1e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008345148.1|  PREDICTED: protein trichome birefringence-li...    148   1e-39   
ref|XP_010068952.1|  PREDICTED: protein trichome birefringence-li...    149   1e-39   Eucalyptus grandis [rose gum]
gb|AFK40281.1|  unknown                                                 148   1e-39   Lotus japonicus
ref|XP_007214202.1|  hypothetical protein PRUPE_ppa022459mg             147   1e-39   
ref|XP_007050058.1|  Trichome birefringence-like 39                     148   1e-39   
ref|XP_010524990.1|  PREDICTED: protein trichome birefringence-li...    148   2e-39   Tarenaya hassleriana [spider flower]
ref|XP_009357163.1|  PREDICTED: protein trichome birefringence-li...    148   2e-39   
ref|XP_008228902.1|  PREDICTED: protein trichome birefringence-li...    147   2e-39   Prunus mume [ume]
ref|XP_010689958.1|  PREDICTED: protein trichome birefringence-li...    147   2e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010510241.1|  PREDICTED: protein trichome birefringence-li...    147   3e-39   Camelina sativa [gold-of-pleasure]
ref|XP_006294476.1|  hypothetical protein CARUB_v10023492mg             147   3e-39   Capsella rubella
ref|NP_001241538.1|  uncharacterized protein LOC100786668 precursor     147   3e-39   Glycine max [soybeans]
ref|XP_004294162.2|  PREDICTED: protein trichome birefringence-li...    147   3e-39   Fragaria vesca subsp. vesca
ref|XP_009370963.1|  PREDICTED: protein trichome birefringence-li...    147   3e-39   Pyrus x bretschneideri [bai li]
ref|XP_007211478.1|  hypothetical protein PRUPE_ppa007592mg             147   3e-39   Prunus persica
ref|XP_010675348.1|  PREDICTED: protein trichome birefringence-li...    146   3e-39   
gb|KJB24277.1|  hypothetical protein B456_004G138200                    147   3e-39   Gossypium raimondii
ref|XP_010675282.1|  PREDICTED: protein trichome birefringence-li...    147   3e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010273288.1|  PREDICTED: protein trichome birefringence-li...    147   3e-39   Nelumbo nucifera [Indian lotus]
ref|XP_002881157.1|  hypothetical protein ARALYDRAFT_482040             147   4e-39   Arabidopsis lyrata subsp. lyrata
ref|XP_004505135.1|  PREDICTED: uncharacterized protein LOC101503421    147   4e-39   Cicer arietinum [garbanzo]
gb|KHG17132.1|  CAS1 domain-containing 1                                147   4e-39   Gossypium arboreum [tree cotton]
ref|XP_008245551.1|  PREDICTED: protein trichome birefringence-li...    147   5e-39   Prunus mume [ume]
ref|XP_008245553.1|  PREDICTED: protein trichome birefringence-li...    147   5e-39   Prunus mume [ume]
ref|XP_003545134.1|  PREDICTED: protein YLS7-like                       146   5e-39   Glycine max [soybeans]
ref|XP_008381569.1|  PREDICTED: protein trichome birefringence-li...    147   6e-39   Malus domestica [apple tree]
ref|XP_008348566.1|  PREDICTED: protein trichome birefringence-li...    140   7e-39   
ref|XP_009790373.1|  PREDICTED: protein trichome birefringence-li...    146   7e-39   Nicotiana sylvestris
gb|KHN13696.1|  hypothetical protein glysoja_034006                     145   1e-38   Glycine soja [wild soybean]
ref|XP_006591157.1|  PREDICTED: protein YLS7-like                       145   1e-38   Glycine max [soybeans]
ref|XP_008226367.1|  PREDICTED: protein trichome birefringence-li...    145   1e-38   Prunus mume [ume]
ref|XP_004499843.1|  PREDICTED: uncharacterized protein LOC101491454    145   1e-38   Cicer arietinum [garbanzo]
emb|CDX97749.1|  BnaC04g41900D                                          145   2e-38   
ref|XP_010925980.1|  PREDICTED: protein trichome birefringence-li...    144   2e-38   
ref|XP_002283620.1|  PREDICTED: protein trichome birefringence-li...    144   2e-38   Vitis vinifera
ref|XP_006602443.1|  PREDICTED: protein YLS7-like                       145   2e-38   
gb|KJB12977.1|  hypothetical protein B456_002G048200                    145   2e-38   
gb|KJB12978.1|  hypothetical protein B456_002G048200                    145   3e-38   
ref|XP_002317442.1|  hypothetical protein POPTR_0011s10730g             144   3e-38   
ref|XP_008783902.1|  PREDICTED: protein trichome birefringence-li...    144   4e-38   
ref|XP_002516811.1|  conserved hypothetical protein                     144   4e-38   
ref|XP_003552077.1|  PREDICTED: protein YLS7-like                       144   4e-38   
ref|XP_003552076.2|  PREDICTED: protein YLS7-like                       144   4e-38   
ref|XP_010685528.1|  PREDICTED: protein PMR5-like                       145   4e-38   
ref|XP_006657022.1|  PREDICTED: protein YLS7-like                       144   4e-38   
ref|XP_011044588.1|  PREDICTED: protein trichome birefringence-li...    144   5e-38   
ref|XP_004145251.1|  PREDICTED: uncharacterized protein LOC101208082    144   5e-38   
ref|XP_004171432.1|  PREDICTED: uncharacterized LOC101219162            140   5e-38   
ref|XP_006442365.1|  hypothetical protein CICLE_v10023594mg             143   6e-38   
ref|XP_007149000.1|  hypothetical protein PHAVU_005G032100g             144   6e-38   
ref|XP_007211411.1|  hypothetical protein PRUPE_ppa007013mg             144   6e-38   
ref|XP_007212437.1|  hypothetical protein PRUPE_ppa016768mg             143   6e-38   
ref|XP_004170379.1|  PREDICTED: uncharacterized LOC101217703            143   7e-38   
ref|XP_007216008.1|  hypothetical protein PRUPE_ppa014688mg             143   7e-38   
ref|XP_010547337.1|  PREDICTED: protein trichome birefringence-li...    144   8e-38   
ref|XP_004137309.1|  PREDICTED: uncharacterized protein LOC101211401    143   8e-38   
ref|XP_002437078.1|  hypothetical protein SORBIDRAFT_10g020920          144   9e-38   
ref|XP_008244484.1|  PREDICTED: protein trichome birefringence-li...    143   1e-37   
ref|XP_007146400.1|  hypothetical protein PHAVU_006G037200g             143   1e-37   
ref|XP_008228904.1|  PREDICTED: protein trichome birefringence-li...    143   1e-37   
gb|AFW76573.1|  putative DUF231 domain containing family protein        143   1e-37   
ref|XP_002282459.1|  PREDICTED: protein trichome birefringence-li...    142   2e-37   
ref|XP_007021951.1|  Trichome birefringence-like 37                     142   2e-37   
ref|XP_006348927.1|  PREDICTED: uncharacterized protein LOC102592...    140   2e-37   
ref|XP_009769816.1|  PREDICTED: protein trichome birefringence-li...    142   2e-37   
ref|XP_008451728.1|  PREDICTED: protein trichome birefringence-li...    142   2e-37   
ref|XP_011082791.1|  PREDICTED: protein trichome birefringence-li...    142   2e-37   
ref|XP_007213066.1|  hypothetical protein PRUPE_ppa020515mg             142   2e-37   
ref|XP_010915622.1|  PREDICTED: protein trichome birefringence-li...    142   2e-37   
gb|KDP41035.1|  hypothetical protein JCGZ_03567                         142   2e-37   
ref|XP_008649169.1|  PREDICTED: protein trichome birefringence-li...    143   2e-37   
ref|XP_003551901.1|  PREDICTED: protein YLS7-like                       142   2e-37   
ref|XP_006477834.1|  PREDICTED: protein YLS7-like                       142   2e-37   
gb|ACU18958.1|  unknown                                                 142   2e-37   
ref|XP_008457360.1|  PREDICTED: protein PMR5-like                       142   2e-37   
ref|XP_009783768.1|  PREDICTED: protein trichome birefringence-li...    142   2e-37   
ref|XP_002283640.1|  PREDICTED: protein trichome birefringence-li...    142   2e-37   
ref|XP_006852467.1|  hypothetical protein AMTR_s00021p00122990          143   3e-37   
gb|KJB45823.1|  hypothetical protein B456_007G331200                    142   3e-37   
ref|XP_009376740.1|  PREDICTED: protein trichome birefringence-li...    141   3e-37   
ref|XP_009802920.1|  PREDICTED: protein trichome birefringence-li...    141   3e-37   
gb|EEE65823.1|  hypothetical protein OsJ_21562                          142   3e-37   
ref|XP_008792962.1|  PREDICTED: protein PMR5                            142   4e-37   
ref|XP_009354272.1|  PREDICTED: protein trichome birefringence-li...    142   4e-37   
ref|XP_008381178.1|  PREDICTED: protein trichome birefringence-li...    141   4e-37   
ref|XP_003598798.1|  hypothetical protein MTR_3g021060                  141   4e-37   
emb|CBI20116.3|  unnamed protein product                                140   4e-37   
ref|XP_009334009.1|  PREDICTED: protein trichome birefringence-li...    141   5e-37   
emb|CBI20118.3|  unnamed protein product                                147   5e-37   
gb|EMS46405.1|  hypothetical protein TRIUR3_26771                       142   5e-37   
ref|XP_009631911.1|  PREDICTED: protein trichome birefringence-li...    141   5e-37   
ref|NP_001057784.2|  Os06g0531400                                       142   6e-37   
ref|XP_009587076.1|  PREDICTED: protein trichome birefringence-li...    141   6e-37   
ref|XP_009365265.1|  PREDICTED: protein trichome birefringence-li...    141   6e-37   
ref|XP_004305820.2|  PREDICTED: protein trichome birefringence-li...    141   6e-37   
ref|XP_010229738.1|  PREDICTED: protein trichome birefringence-li...    141   6e-37   
ref|XP_010320724.1|  PREDICTED: protein trichome birefringence-li...    140   6e-37   
ref|XP_002513104.1|  conserved hypothetical protein                     140   8e-37   
ref|XP_009590818.1|  PREDICTED: protein trichome birefringence-li...    141   8e-37   
ref|XP_007021952.1|  Lustrin A-like, putative                           140   9e-37   
ref|XP_010999583.1|  PREDICTED: protein trichome birefringence-li...    140   9e-37   
ref|XP_002304780.1|  hypothetical protein POPTR_0003s20060g             140   9e-37   
ref|XP_009590824.1|  PREDICTED: protein trichome birefringence-li...    140   9e-37   
ref|XP_011042150.1|  PREDICTED: protein trichome birefringence-li...    140   1e-36   
ref|XP_004140246.1|  PREDICTED: uncharacterized protein LOC101219162    140   1e-36   
ref|XP_010064516.1|  PREDICTED: protein trichome birefringence-li...    140   1e-36   
ref|XP_008226366.1|  PREDICTED: protein trichome birefringence-li...    140   1e-36   
ref|XP_006387085.1|  hypothetical protein POPTR_1908s00200g             140   1e-36   
gb|KDP39802.1|  hypothetical protein JCGZ_03938                         140   1e-36   
ref|XP_006480514.1|  PREDICTED: protein YLS7-like                       140   1e-36   
ref|XP_008381176.1|  PREDICTED: protein trichome birefringence-li...    140   1e-36   
gb|KGN47983.1|  hypothetical protein Csa_6G421770                       140   1e-36   
ref|XP_004229288.2|  PREDICTED: protein trichome birefringence-li...    140   2e-36   
ref|XP_006348926.1|  PREDICTED: uncharacterized protein LOC102592...    139   2e-36   
ref|XP_010323651.1|  PREDICTED: protein trichome birefringence-li...    138   2e-36   
ref|XP_007021953.1|  Trichome birefringence-like 42                     140   2e-36   
dbj|BAJ97035.1|  predicted protein                                      140   2e-36   
gb|EEC80749.1|  hypothetical protein OsI_23232                          140   2e-36   
gb|KDO42403.1|  hypothetical protein CISIN_1g017556mg                   140   2e-36   
ref|XP_010920821.1|  PREDICTED: protein PMR5                            140   2e-36   
ref|XP_006360069.1|  PREDICTED: uncharacterized protein LOC102593192    139   2e-36   
ref|XP_009603133.1|  PREDICTED: protein trichome birefringence-li...    139   2e-36   
ref|XP_010675285.1|  PREDICTED: protein trichome birefringence-li...    140   2e-36   
ref|XP_011042149.1|  PREDICTED: protein trichome birefringence-li...    139   3e-36   
emb|CBI22044.3|  unnamed protein product                                143   3e-36   
ref|XP_011042148.1|  PREDICTED: protein trichome birefringence-li...    139   3e-36   
ref|XP_010323652.1|  PREDICTED: protein trichome birefringence-li...    137   3e-36   
ref|XP_010273484.1|  PREDICTED: protein trichome birefringence-li...    139   3e-36   
ref|XP_002304779.2|  hypothetical protein POPTR_0003s20070g             139   3e-36   
ref|XP_010264606.1|  PREDICTED: protein PMR5-like                       139   4e-36   
ref|XP_007146779.1|  hypothetical protein PHAVU_006G069200g             139   4e-36   
ref|XP_008673993.1|  PREDICTED: protein trichome birefringence-li...    139   4e-36   
ref|XP_007142244.1|  hypothetical protein PHAVU_008G264500g             139   4e-36   
ref|XP_006448025.1|  hypothetical protein CICLE_v10018196mg             138   4e-36   
ref|XP_011098189.1|  PREDICTED: protein trichome birefringence-li...    139   4e-36   
gb|KDO58612.1|  hypothetical protein CISIN_1g018724mg                   139   4e-36   
ref|XP_004244290.1|  PREDICTED: protein trichome birefringence-li...    139   4e-36   
ref|XP_002278078.2|  PREDICTED: protein trichome birefringence-li...    139   5e-36   
ref|XP_004497100.1|  PREDICTED: uncharacterized protein LOC101501368    138   5e-36   
ref|XP_009359366.1|  PREDICTED: protein trichome birefringence-li...    139   5e-36   
ref|XP_009790315.1|  PREDICTED: protein trichome birefringence-li...    139   6e-36   
ref|XP_006348399.1|  PREDICTED: uncharacterized protein LOC102583199    139   6e-36   
ref|XP_006407039.1|  hypothetical protein EUTSA_v10021040mg             138   6e-36   
dbj|BAB02651.1|  unnamed protein product                                137   6e-36   
ref|XP_006852470.1|  hypothetical protein AMTR_s00021p00125740          134   8e-36   
ref|XP_009778320.1|  PREDICTED: protein trichome birefringence-li...    138   8e-36   
ref|XP_006368594.1|  hypothetical protein POPTR_0001s06130g             137   9e-36   
ref|XP_007216516.1|  hypothetical protein PRUPE_ppa024241mg             137   9e-36   
ref|XP_004243780.1|  PREDICTED: protein trichome birefringence-li...    137   9e-36   
ref|XP_009610283.1|  PREDICTED: protein trichome birefringence-li...    138   9e-36   
ref|XP_008386343.1|  PREDICTED: protein trichome birefringence-li...    135   1e-35   
ref|XP_008228905.1|  PREDICTED: protein trichome birefringence-li...    137   1e-35   
ref|XP_009769585.1|  PREDICTED: protein trichome birefringence-li...    137   1e-35   
ref|XP_007216490.1|  hypothetical protein PRUPE_ppa025085mg             132   1e-35   
ref|XP_011044590.1|  PREDICTED: protein trichome birefringence-li...    135   1e-35   
ref|XP_009365268.1|  PREDICTED: protein trichome birefringence-li...    138   1e-35   
ref|XP_006359475.1|  PREDICTED: uncharacterized protein LOC102598428    137   1e-35   
ref|XP_002887755.1|  hypothetical protein ARALYDRAFT_316771             137   1e-35   
ref|XP_009370960.1|  PREDICTED: protein trichome birefringence-li...    137   1e-35   
ref|XP_011010610.1|  PREDICTED: protein trichome birefringence-li...    137   2e-35   
ref|XP_008245550.1|  PREDICTED: protein trichome birefringence-li...    137   2e-35   
ref|XP_003551258.1|  PREDICTED: protein YLS7-like                       137   2e-35   
emb|CDP06048.1|  unnamed protein product                                137   2e-35   
gb|KHN02079.1|  hypothetical protein glysoja_028282                     137   2e-35   
ref|XP_004295667.1|  PREDICTED: protein trichome birefringence-li...    137   2e-35   
ref|XP_010487295.1|  PREDICTED: protein trichome birefringence-li...    136   3e-35   
ref|XP_003634905.1|  PREDICTED: protein trichome birefringence-li...    137   3e-35   
gb|KHN19842.1|  hypothetical protein glysoja_043771                     137   3e-35   
ref|XP_010327259.1|  PREDICTED: protein trichome birefringence-li...    136   3e-35   
ref|XP_009354247.1|  PREDICTED: protein trichome birefringence-li...    136   3e-35   
ref|XP_004229160.1|  PREDICTED: protein trichome birefringence-li...    136   3e-35   
ref|XP_006365454.1|  PREDICTED: uncharacterized protein LOC102604606    137   3e-35   
emb|CBI17734.3|  unnamed protein product                                137   4e-35   
ref|XP_006492301.1|  PREDICTED: protein YLS7-like                       136   4e-35   
ref|XP_009135400.1|  PREDICTED: protein trichome birefringence-li...    136   4e-35   
ref|XP_010502205.1|  PREDICTED: protein trichome birefringence-li...    136   4e-35   
emb|CDX75793.1|  BnaC03g38760D                                          135   5e-35   
dbj|BAH20432.1|  AT3G14850                                              136   5e-35   
gb|KDO54062.1|  hypothetical protein CISIN_1g036968mg                   135   5e-35   
ref|XP_003539337.1|  PREDICTED: protein YLS7-like                       136   5e-35   
ref|NP_974314.2|  protein trichome birefringence-like 41                136   5e-35   
ref|XP_003613275.1|  hypothetical protein MTR_5g034810                  135   5e-35   
ref|XP_009766231.1|  PREDICTED: protein PMR5-like                       136   5e-35   
ref|XP_010032987.1|  PREDICTED: protein trichome birefringence-li...    135   5e-35   
ref|XP_010465402.1|  PREDICTED: protein trichome birefringence-li...    135   5e-35   
ref|XP_002277229.1|  PREDICTED: protein PMR5                            136   6e-35   
ref|XP_010032986.1|  PREDICTED: protein trichome birefringence-li...    135   7e-35   
ref|XP_009409697.1|  PREDICTED: protein trichome birefringence-li...    135   7e-35   
ref|XP_010323662.1|  PREDICTED: protein trichome birefringence-li...    135   8e-35   
gb|KDP45792.1|  hypothetical protein JCGZ_17399                         135   8e-35   
ref|XP_009340027.1|  PREDICTED: protein trichome birefringence-li...    135   8e-35   
ref|XP_010093461.1|  hypothetical protein L484_017522                   135   9e-35   
dbj|BAD73018.1|  unknown protein                                        135   9e-35   
ref|XP_002882897.1|  hypothetical protein ARALYDRAFT_478900             135   9e-35   
emb|CDM82173.1|  unnamed protein product                                135   9e-35   
gb|KCW52497.1|  hypothetical protein EUGRSUZ_J01893                     135   9e-35   
ref|NP_001154476.1|  trichome birefringence-like 42                     134   1e-34   
gb|EYU31623.1|  hypothetical protein MIMGU_mgv1a017870mg                134   1e-34   
gb|KCW52496.1|  hypothetical protein EUGRSUZ_J01893                     135   1e-34   
ref|XP_010531925.1|  PREDICTED: protein trichome birefringence-li...    135   1e-34   
ref|NP_001042402.1|  Os01g0217000                                       135   1e-34   
gb|EEE54114.1|  hypothetical protein OsJ_00883                          136   1e-34   
emb|CDY20089.1|  BnaA01g29130D                                          134   2e-34   
emb|CDY32336.1|  BnaC01g36550D                                          134   2e-34   
gb|KDP40076.1|  hypothetical protein JCGZ_02074                         134   2e-34   
ref|XP_004491381.1|  PREDICTED: uncharacterized protein LOC101498345    134   2e-34   
ref|XP_010035886.1|  PREDICTED: protein trichome birefringence-li...    134   2e-34   
ref|XP_009626454.1|  PREDICTED: protein trichome birefringence-li...    134   2e-34   
gb|EYU46053.1|  hypothetical protein MIMGU_mgv1a008647mg                134   2e-34   
ref|XP_011044589.1|  PREDICTED: protein trichome birefringence-li...    134   3e-34   
ref|XP_006298019.1|  hypothetical protein CARUB_v10014063mg             134   3e-34   
ref|XP_009116583.1|  PREDICTED: protein trichome birefringence-li...    134   3e-34   
ref|XP_003599590.1|  hypothetical protein MTR_3g035830                  134   3e-34   
ref|NP_177992.1|  trichome birefringence-like 42                        134   3e-34   
ref|XP_009783123.1|  PREDICTED: protein trichome birefringence-li...    134   4e-34   
gb|KEH44227.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    133   4e-34   
gb|AFK42120.1|  unknown                                                 133   4e-34   
ref|XP_002526381.1|  conserved hypothetical protein                     134   4e-34   
ref|XP_004137221.1|  PREDICTED: uncharacterized protein LOC101208056    133   5e-34   
ref|XP_009622720.1|  PREDICTED: protein PMR5-like                       133   5e-34   
ref|XP_003637437.1|  hypothetical protein MTR_085s0040                  133   6e-34   
ref|XP_006346586.1|  PREDICTED: uncharacterized protein LOC102604720    132   6e-34   
ref|XP_009380694.1|  PREDICTED: protein PMR5 isoform X1                 134   6e-34   
ref|XP_006410189.1|  hypothetical protein EUTSA_v10017902mg             132   6e-34   
emb|CDP09209.1|  unnamed protein product                                132   6e-34   
gb|AAP22495.1|  hypothetical protein At2g30900                          129   6e-34   
emb|CDX84181.1|  BnaC04g09430D                                          133   6e-34   
ref|XP_009380695.1|  PREDICTED: protein PMR5 isoform X2                 133   7e-34   
ref|XP_006477835.1|  PREDICTED: protein YLS7-like                       133   7e-34   
ref|XP_009380696.1|  PREDICTED: protein PMR5 isoform X3                 133   8e-34   
gb|AFK41428.1|  unknown                                                 132   8e-34   
ref|XP_010535369.1|  PREDICTED: protein PMR5                            133   8e-34   
gb|KJB33739.1|  hypothetical protein B456_006G028300                    132   8e-34   
ref|XP_006442367.1|  hypothetical protein CICLE_v10020789mg             132   9e-34   
ref|XP_007149522.1|  hypothetical protein PHAVU_005G077300g             132   9e-34   
ref|XP_007048773.1|  Trichome birefringence-like 43, putative iso...    132   9e-34   
ref|XP_009631156.1|  PREDICTED: protein trichome birefringence-li...    132   1e-33   
ref|XP_008451727.1|  PREDICTED: protein trichome birefringence-li...    132   1e-33   
ref|XP_010314298.1|  PREDICTED: protein trichome birefringence-li...    132   1e-33   
ref|XP_010483461.1|  PREDICTED: protein PMR5-like                       133   1e-33   
ref|XP_009143638.1|  PREDICTED: protein trichome birefringence-li...    132   1e-33   
gb|KEH38565.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    132   1e-33   
ref|XP_008783972.1|  PREDICTED: protein trichome birefringence-li...    132   1e-33   
ref|XP_006344054.1|  PREDICTED: uncharacterized protein LOC102598924    132   1e-33   
ref|XP_009380697.1|  PREDICTED: protein PMR5 isoform X4                 132   1e-33   
ref|XP_006419433.1|  hypothetical protein CICLE_v10006676mg             133   1e-33   
ref|XP_010535032.1|  PREDICTED: protein trichome birefringence-li...    132   1e-33   
gb|EPS67963.1|  hypothetical protein M569_06809                         131   1e-33   
ref|XP_003598800.1|  GRAS family transcription factor                   133   1e-33   
ref|XP_002515611.1|  conserved hypothetical protein                     130   1e-33   
ref|XP_008354275.1|  PREDICTED: protein PMR5-like                       132   1e-33   
ref|XP_010453963.1|  PREDICTED: protein PMR5-like                       132   1e-33   
ref|XP_010443601.1|  PREDICTED: protein PMR5                            132   2e-33   
ref|XP_010665974.1|  PREDICTED: protein trichome birefringence-li...    132   2e-33   
gb|AES69051.2|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    132   2e-33   
ref|XP_008343824.1|  PREDICTED: protein PMR5-like                       132   2e-33   
ref|XP_002317443.1|  hypothetical protein POPTR_0011s10740g             132   2e-33   



>ref|XP_006362437.1| PREDICTED: uncharacterized protein LOC102599991 [Solanum tuberosum]
Length=370

 Score =   201 bits (511),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 115/150 (77%), Gaps = 10/150 (7%)
 Frame = +3

Query  63   VMWSGVVIIAVLLLVQ-----GHGGRA---AQNNVSHLLSWGGKEIVSSGGCNLFRGRWV  218
            V+WS +VI +VLL+        H GRA    QN   H  SW  K +VS+  CNLF+GRW 
Sbjct  2    VLWSQLVIKSVLLVCSITSLFLHTGRAELIVQNLSGH--SWENKGVVSNSKCNLFQGRWA  59

Query  219  VDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKK  398
            +D S+PLY  S CPFIDPEFDC+KYGRPDKQYLKYAWKPDSC++PRF+G + L+RW GKK
Sbjct  60   IDPSFPLYDSSTCPFIDPEFDCLKYGRPDKQYLKYAWKPDSCNMPRFNGKDFLQRWSGKK  119

Query  399  VMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            +MF+GDSLSLNMWNSLACM+HASVP +K T
Sbjct  120  IMFIGDSLSLNMWNSLACMLHASVPNAKTT  149



>ref|XP_011096427.1| PREDICTED: protein trichome birefringence-like 38 [Sesamum indicum]
Length=409

 Score =   201 bits (510),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 116/143 (81%), Gaps = 2/143 (1%)
 Frame = +3

Query  69   WSGVVIIAV-LLLVQGHGGRAAQNNVSHLLSWG-GKEIVSSGGCNLFRGRWVVDSSYPLY  242
            + G++  A+ L+LV+    +  +NN +   S    +E++++GGCNLF+GRWVVD SYPLY
Sbjct  47   YKGLIFQALYLVLVEYAASQLVRNNFTTSSSITRSREVLAAGGCNLFQGRWVVDPSYPLY  106

Query  243  QPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSL  422
            + S+CPFIDPEFDCIKYGRPDKQYLK++WKPDSCDLPRF+G + LKRW GKK+MFVGDSL
Sbjct  107  ESSSCPFIDPEFDCIKYGRPDKQYLKFSWKPDSCDLPRFNGVDFLKRWSGKKIMFVGDSL  166

Query  423  SLNMWNSLACMIHASVPTSKITY  491
            SLN W SLACMIHASVP SK +Y
Sbjct  167  SLNQWESLACMIHASVPNSKTSY  189



>ref|XP_009599976.1| PREDICTED: protein trichome birefringence-like 37 [Nicotiana 
tomentosiformis]
Length=373

 Score =   198 bits (504),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 115/152 (76%), Gaps = 9/152 (6%)
 Frame = +3

Query  63   VMWSGVVIIAVLLL-------VQGHGGRAAQNNVSHL--LSWGGKEIVSSGGCNLFRGRW  215
            V+WS +VI + LLL       V  H    A+  V ++  LSW  K +VSS  CNLF+GRW
Sbjct  2    VLWSQLVISSTLLLHLVSIISVFLHTTARAELVVQNVSGLSWKSKGVVSSSRCNLFQGRW  61

Query  216  VVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGK  395
            V+D S+PLY  S CPFIDPEFDC KYGRPDKQY+KYAWKPDSC+LPRF+G + LKRW GK
Sbjct  62   VIDPSFPLYDSSTCPFIDPEFDCQKYGRPDKQYMKYAWKPDSCNLPRFNGKDFLKRWTGK  121

Query  396  KVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            K+MF+GDSLSLNMW SLACM+HASVP +K ++
Sbjct  122  KIMFIGDSLSLNMWESLACMLHASVPNAKTSF  153



>ref|XP_009781572.1| PREDICTED: protein trichome birefringence-like 37 [Nicotiana 
sylvestris]
 ref|XP_009781580.1| PREDICTED: protein trichome birefringence-like 37 [Nicotiana 
sylvestris]
Length=373

 Score =   197 bits (501),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 115/152 (76%), Gaps = 9/152 (6%)
 Frame = +3

Query  63   VMWSGVVIIAVLLL-------VQGHGGRAAQNNVSHL--LSWGGKEIVSSGGCNLFRGRW  215
            V+WS +VI + LLL       +  H    A+  V ++  LSW  K +VSS  CNLF+GRW
Sbjct  2    VLWSQLVISSTLLLQLVSVISLLLHTAARAELVVQNVSGLSWKSKGVVSSSRCNLFQGRW  61

Query  216  VVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGK  395
            V+D S+PLY  S CPFIDPEFDC KYGRPDKQY+KY+WKPDSC+LPRF+G + LKRW GK
Sbjct  62   VIDPSFPLYDSSTCPFIDPEFDCQKYGRPDKQYMKYSWKPDSCNLPRFNGKDFLKRWTGK  121

Query  396  KVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            K+MF+GDSLSLNMW SLACM+HASVP +K ++
Sbjct  122  KIMFIGDSLSLNMWESLACMLHASVPNAKTSF  153



>ref|XP_004232960.1| PREDICTED: protein trichome birefringence-like 38 [Solanum lycopersicum]
Length=405

 Score =   195 bits (495),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 113/147 (77%), Gaps = 7/147 (5%)
 Frame = +3

Query  63   VMWSGVVIIAVLLLVQ-----GHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDS  227
            V+WS +VI +VLL+        + GRA     +  L    K +VS+  CNLF+GRW +D 
Sbjct  3    VLWSQLVIKSVLLVCSIISLCLYSGRAEVKVENFSLE--NKGVVSNSKCNLFQGRWAIDP  60

Query  228  SYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMF  407
            S+PLY  S CPFIDPEFDC+KYGRPDKQYLKYAWKPDSC+LPRF+G +LL+RW GKK+MF
Sbjct  61   SFPLYDSSKCPFIDPEFDCLKYGRPDKQYLKYAWKPDSCNLPRFNGKDLLQRWSGKKIMF  120

Query  408  VGDSLSLNMWNSLACMIHASVPTSKIT  488
            +GDSLSLNMWNSLACM+HASVP +K T
Sbjct  121  IGDSLSLNMWNSLACMLHASVPNAKTT  147



>ref|XP_007211863.1| hypothetical protein PRUPE_ppa010079mg [Prunus persica]
 gb|EMJ13062.1| hypothetical protein PRUPE_ppa010079mg [Prunus persica]
Length=265

 Score =   189 bits (481),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 106/140 (76%), Gaps = 4/140 (3%)
 Frame = +3

Query  72   SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPS  251
            S +V + VL+L       A   + + +     ++   + GCNLF+G W  D+SYPLY  S
Sbjct  9    SCLVALQVLVLFSDEASSAGHGHGARI----SRQRKQATGCNLFQGNWAFDASYPLYDSS  64

Query  252  NCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLN  431
            +CPFIDPEFDCIKYGRPDKQ+LKYAWKPDSCDLPRFDG + L+RW+GKK+MFVGDSLSLN
Sbjct  65   SCPFIDPEFDCIKYGRPDKQFLKYAWKPDSCDLPRFDGLDFLRRWKGKKIMFVGDSLSLN  124

Query  432  MWNSLACMIHASVPTSKITY  491
            MW SL+CMIHASVP +K T+
Sbjct  125  MWESLSCMIHASVPNAKTTF  144



>gb|ACU21157.1| unknown [Glycine max]
Length=232

 Score =   187 bits (475),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 100/127 (79%), Gaps = 4/127 (3%)
 Frame = +3

Query  114  HGGRAAQ-NNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIK  290
            H  RAA+ +NVS L    GK+ V + GCNLF G WVVD+SYPLY  S CPFIDPEFDC K
Sbjct  21   HQARAAKFHNVSGLR---GKKPVVANGCNLFLGSWVVDTSYPLYDSSTCPFIDPEFDCQK  77

Query  291  YGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASV  470
            YGRPDKQYLKYAWKPDSC +PRFDG   L  WRGKK+MFVGDSLSLNMW SL+CMIHASV
Sbjct  78   YGRPDKQYLKYAWKPDSCAIPRFDGAAFLNSWRGKKIMFVGDSLSLNMWESLSCMIHASV  137

Query  471  PTSKITY  491
            P +K  +
Sbjct  138  PNAKTGF  144



>ref|XP_009599983.1| PREDICTED: protein trichome birefringence-like 37 [Nicotiana 
tomentosiformis]
Length=363

 Score =   191 bits (484),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 111/145 (77%), Gaps = 8/145 (6%)
 Frame = +3

Query  63   VMWSGVVIIAVLLLVQGHGGRA--AQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYP  236
            ++ S  ++I++ L +Q    +A     NVS       +  +SS  CNLF+G+WV+D+S+P
Sbjct  5    LLQSIALVISISLFLQAETAKAELVLKNVS------SRGKMSSSNCNLFQGKWVIDTSFP  58

Query  237  LYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGD  416
            LYQ SNCPFIDPEFDC KYGRPDK+YLKYAWKPDSC+LPRFDG + LKRW GKK+MFVGD
Sbjct  59   LYQSSNCPFIDPEFDCQKYGRPDKEYLKYAWKPDSCNLPRFDGKDFLKRWLGKKIMFVGD  118

Query  417  SLSLNMWNSLACMIHASVPTSKITY  491
            SLSLNMW SLACM+H+SVP +  ++
Sbjct  119  SLSLNMWESLACMLHSSVPNTTTSF  143



>ref|XP_008225213.1| PREDICTED: protein trichome birefringence-like 37 [Prunus mume]
Length=361

 Score =   189 bits (480),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 106/140 (76%), Gaps = 4/140 (3%)
 Frame = +3

Query  72   SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPS  251
            S +V + VL+L       A   + + +     ++   + GCNLF+G W  D+SYPLY  S
Sbjct  9    SCLVALQVLVLFSDEASSAGHGHGTRI----SRQRKQATGCNLFQGNWAFDASYPLYDSS  64

Query  252  NCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLN  431
            +CPFIDPEFDCIKYGRPDKQ+LKYAWKPDSCDLPRFDG + L+RW+GKK+MFVGDSLSLN
Sbjct  65   SCPFIDPEFDCIKYGRPDKQFLKYAWKPDSCDLPRFDGLDFLRRWKGKKIMFVGDSLSLN  124

Query  432  MWNSLACMIHASVPTSKITY  491
            MW SL+CMIHASVP +K T+
Sbjct  125  MWESLSCMIHASVPNAKTTF  144



>gb|KDO77824.1| hypothetical protein CISIN_1g017263mg [Citrus sinensis]
 gb|KDO77825.1| hypothetical protein CISIN_1g017263mg [Citrus sinensis]
Length=217

 Score =   184 bits (468),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 117/152 (77%), Gaps = 9/152 (6%)
 Frame = +3

Query  45   MGVGQKVM--W-SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRW  215
            MG G  V+  W    V+++ +LL +      A+ ++ ++ S  G++ VS  GCNLF+GRW
Sbjct  1    MGFGSHVLLFWLFQFVLLSSMLLKEAE----AEQHLYNVTSLRGRKQVS--GCNLFQGRW  54

Query  216  VVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGK  395
            V+D SYPLY  S+CPFID EFDC+KYGRPDKQYLKY+W+P SC +PRFDGG+ L+R+RGK
Sbjct  55   VIDPSYPLYDSSSCPFIDAEFDCLKYGRPDKQYLKYSWQPASCAVPRFDGGDFLRRYRGK  114

Query  396  KVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            ++MFVGDSLSLNMW SL+CMIHASVP +K ++
Sbjct  115  RIMFVGDSLSLNMWESLSCMIHASVPNAKTSF  146



>ref|XP_007148060.1| hypothetical protein PHAVU_006G177100g [Phaseolus vulgaris]
 gb|ESW20054.1| hypothetical protein PHAVU_006G177100g [Phaseolus vulgaris]
Length=364

 Score =   189 bits (479),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 101/125 (81%), Gaps = 4/125 (3%)
 Frame = +3

Query  120  GRAAQ-NNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYG  296
             RAA+ +NVS L   GGK+ V   GCNLF G WVVD SYPLY  S CPFIDPEFDC KYG
Sbjct  23   ARAAKFHNVSGL---GGKKAVIVNGCNLFMGSWVVDPSYPLYDSSACPFIDPEFDCQKYG  79

Query  297  RPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPT  476
            RPDKQYLKYAWKPDSC LPRFDG + L RW+GKK+MFVGDSLSLNMW SL+CMIHASVP 
Sbjct  80   RPDKQYLKYAWKPDSCALPRFDGADFLNRWKGKKIMFVGDSLSLNMWESLSCMIHASVPN  139

Query  477  SKITY  491
            +K ++
Sbjct  140  TKSSF  144



>ref|XP_006377552.1| hypothetical protein POPTR_0011s07540g [Populus trichocarpa]
 gb|ERP55349.1| hypothetical protein POPTR_0011s07540g [Populus trichocarpa]
Length=232

 Score =   184 bits (467),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 109/149 (73%), Gaps = 6/149 (4%)
 Frame = +3

Query  45   MGVGQKVMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVD  224
            MG   +V+     ++ +L L +   G    +N S L    G++ VS  GCNLFRGRWVVD
Sbjct  1    MGFKCQVLVCTFCLVMLLFLQETRAG-IHSSNASRL---NGRKKVS--GCNLFRGRWVVD  54

Query  225  SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVM  404
            +SYPLY  S CPFID EF+C KYGR D QYLKY+W+PDSC +PRF+G + L+RWRGKK+M
Sbjct  55   TSYPLYDSSGCPFIDDEFNCQKYGRRDNQYLKYSWQPDSCKIPRFNGADFLRRWRGKKIM  114

Query  405  FVGDSLSLNMWNSLACMIHASVPTSKITY  491
            FVGDSLSLNMW SL+CMIHA+VP +K T+
Sbjct  115  FVGDSLSLNMWESLSCMIHAAVPKAKTTF  143



>ref|XP_010057074.1| PREDICTED: protein trichome birefringence-like 38 [Eucalyptus 
grandis]
 gb|KCW74075.1| hypothetical protein EUGRSUZ_E02713 [Eucalyptus grandis]
Length=373

 Score =   188 bits (477),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 107/138 (78%), Gaps = 2/138 (1%)
 Frame = +3

Query  78   VVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNC  257
            + I  +  LV+     + Q   +   +  G++   +GGCNLF+G WVVD+SYP Y+ S+C
Sbjct  18   LTIFFLFFLVRPQRASSEQQLWNTTAALRGRK--QTGGCNLFQGNWVVDASYPFYESSSC  75

Query  258  PFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMW  437
            PFIDPEFDC KYGRPD QYLKYAW+PDSC +PRF+GGELL+RWRGKK+MFVGDSLSLNMW
Sbjct  76   PFIDPEFDCQKYGRPDTQYLKYAWRPDSCAIPRFNGGELLRRWRGKKIMFVGDSLSLNMW  135

Query  438  NSLACMIHASVPTSKITY  491
             SL+CMIHASVP +K ++
Sbjct  136  ESLSCMIHASVPGAKTSF  153



>gb|KDO77823.1| hypothetical protein CISIN_1g017263mg [Citrus sinensis]
Length=270

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 117/152 (77%), Gaps = 9/152 (6%)
 Frame = +3

Query  45   MGVGQKVM--W-SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRW  215
            MG G  V+  W    V+++ +LL +      A+ ++ ++ S  G++ VS  GCNLF+GRW
Sbjct  1    MGFGSHVLLFWLFQFVLLSSMLLKEAE----AEQHLYNVTSLRGRKQVS--GCNLFQGRW  54

Query  216  VVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGK  395
            V+D SYPLY  S+CPFID EFDC+KYGRPDKQYLKY+W+P SC +PRFDGG+ L+R+RGK
Sbjct  55   VIDPSYPLYDSSSCPFIDAEFDCLKYGRPDKQYLKYSWQPASCAVPRFDGGDFLRRYRGK  114

Query  396  KVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            ++MFVGDSLSLNMW SL+CMIHASVP +K ++
Sbjct  115  RIMFVGDSLSLNMWESLSCMIHASVPNAKTSF  146



>ref|XP_006449479.1| hypothetical protein CICLE_v10015687mg [Citrus clementina]
 gb|ESR62719.1| hypothetical protein CICLE_v10015687mg [Citrus clementina]
Length=366

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 118/152 (78%), Gaps = 9/152 (6%)
 Frame = +3

Query  45   MGVGQKVM--W-SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRW  215
            MG G  V+  W   VV+++ +LL +      A+ ++ ++ S  G++ VS  GCNLF+GRW
Sbjct  1    MGFGSHVLLFWLFQVVLLSSMLLKEAE----AEQHLYNVTSLRGRKQVS--GCNLFQGRW  54

Query  216  VVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGK  395
            V+D SYPLY  S+CPFID EFDC+KYGRPDKQYLKY+W+P SC LPRFDGG+ L+R+RGK
Sbjct  55   VIDPSYPLYDSSSCPFIDAEFDCLKYGRPDKQYLKYSWQPASCALPRFDGGDFLRRYRGK  114

Query  396  KVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            ++MFVGDSLSLNMW SL+CMIHASVP +K ++
Sbjct  115  RIMFVGDSLSLNMWESLSCMIHASVPNAKTSF  146



>ref|XP_006597476.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN18917.1| hypothetical protein glysoja_036096 [Glycine soja]
Length=364

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 100/127 (79%), Gaps = 4/127 (3%)
 Frame = +3

Query  114  HGGRAAQ-NNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIK  290
            H  RAA+ +NVS L    GK+ V + GCNLF G WVVD+SYPLY  S CPFIDPEFDC K
Sbjct  21   HQARAAKFHNVSGLR---GKKPVVANGCNLFLGSWVVDTSYPLYDSSTCPFIDPEFDCQK  77

Query  291  YGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASV  470
            YGRPDKQYLKYAWKPDSC +PRFDG   L  WRGKK+MFVGDSLSLNMW SL+CMIHASV
Sbjct  78   YGRPDKQYLKYAWKPDSCAIPRFDGAAFLNSWRGKKIMFVGDSLSLNMWESLSCMIHASV  137

Query  471  PTSKITY  491
            P +K  +
Sbjct  138  PNAKTGF  144



>ref|XP_010091711.1| hypothetical protein L484_001474 [Morus notabilis]
 gb|EXB44995.1| hypothetical protein L484_001474 [Morus notabilis]
Length=166

 Score =   180 bits (457),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 98/118 (83%), Gaps = 5/118 (4%)
 Frame = +3

Query  135  NNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQY  314
            +NVS L    G++ VS  GC+LF+G+WV D+SYPLY  S+CP IDPEFDC KYGRPDKQY
Sbjct  30   HNVSGLR---GRKQVS--GCDLFQGKWVFDASYPLYDSSSCPLIDPEFDCQKYGRPDKQY  84

Query  315  LKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            LKYAWKPDSCDLPRF+G + L RWRGKK+MFVGDSLSLNMW SLACMIH SVP SK +
Sbjct  85   LKYAWKPDSCDLPRFNGVDFLARWRGKKIMFVGDSLSLNMWQSLACMIHESVPNSKTS  142



>ref|XP_008371453.1| PREDICTED: protein trichome birefringence-like 38 [Malus domestica]
Length=361

 Score =   186 bits (471),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  189  GCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGG  368
            GCNLF+G WV D+SYPLY  ++CPFIDPEFDCIKYGRPDKQ+LKYAWKPDSC+LPRFDG 
Sbjct  44   GCNLFQGNWVFDASYPLYDSASCPFIDPEFDCIKYGRPDKQFLKYAWKPDSCNLPRFDGV  103

Query  369  ELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            + L+RWRGKK+MFVGDSLSLNMW SL+CMIHASVP +K T+
Sbjct  104  DFLRRWRGKKIMFVGDSLSLNMWESLSCMIHASVPNAKTTF  144



>gb|EYU28072.1| hypothetical protein MIMGU_mgv1a008400mg [Erythranthe guttata]
Length=375

 Score =   186 bits (472),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 101/122 (83%), Gaps = 1/122 (1%)
 Frame = +3

Query  126  AAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPD  305
            A  NN +       ++I+SSG CNLF+G+WVVDS+YP Y+ S CPFIDPEFDCIK+GRPD
Sbjct  33   AVPNNFNSSNIIRSRDIISSG-CNLFQGKWVVDSTYPFYESSTCPFIDPEFDCIKFGRPD  91

Query  306  KQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKI  485
            KQYLK++WKPDSC+LPRF+G + LKRW GKK+MFVGDSLSLN W SLACMIHASVP SK 
Sbjct  92   KQYLKFSWKPDSCNLPRFNGVDFLKRWSGKKIMFVGDSLSLNQWQSLACMIHASVPNSKT  151

Query  486  TY  491
            +Y
Sbjct  152  SY  153



>ref|XP_007025417.1| Trichome birefringence-like 37 isoform 1 [Theobroma cacao]
 ref|XP_007025418.1| Trichome birefringence-like 37 isoform 1 [Theobroma cacao]
 gb|EOY28039.1| Trichome birefringence-like 37 isoform 1 [Theobroma cacao]
 gb|EOY28040.1| Trichome birefringence-like 37 isoform 1 [Theobroma cacao]
Length=363

 Score =   185 bits (470),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
              GCNLF+G+WV D SYP Y  S CPFIDPEFDC+KYGRPDKQYLKY+WKPD+CDLPRFD
Sbjct  41   ENGCNLFQGKWVFDPSYPFYDSSGCPFIDPEFDCLKYGRPDKQYLKYSWKPDACDLPRFD  100

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            G   L +WRGKK+MFVGDSLSLNMW SLACMIHASVP SK TY
Sbjct  101  GASFLAKWRGKKIMFVGDSLSLNMWESLACMIHASVPNSKTTY  143



>gb|KHN08449.1| hypothetical protein glysoja_014214 [Glycine soja]
Length=364

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 106/141 (75%), Gaps = 4/141 (3%)
 Frame = +3

Query  72   SGVVIIAVLLLVQGHGGRAAQ-NNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQP  248
            + + ++ +   +  H  RAA+ +NVS L    G  +V + GCNLF G WVVD+SYPLY  
Sbjct  7    TTLSLLCLFWFLSLHQARAAKFHNVSGL---RGNNLVVANGCNLFLGSWVVDTSYPLYNS  63

Query  249  SNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSL  428
            S CPFIDP+FDC KYGRPDKQYLKYAWKP+SC LPRFDG + L RWRGKK+MFVGDSLSL
Sbjct  64   STCPFIDPQFDCQKYGRPDKQYLKYAWKPESCALPRFDGVDFLNRWRGKKIMFVGDSLSL  123

Query  429  NMWNSLACMIHASVPTSKITY  491
            NMW SL C+IHASVP +K  +
Sbjct  124  NMWRSLTCVIHASVPNAKTGF  144



>ref|XP_006594557.1| PREDICTED: protein YLS7-like isoform X2 [Glycine max]
Length=390

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 106/141 (75%), Gaps = 4/141 (3%)
 Frame = +3

Query  72   SGVVIIAVLLLVQGHGGRAAQ-NNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQP  248
            + + ++ +   +  H  RAA+ +NVS L    G  +V + GCNLF G WVVD+SYPLY  
Sbjct  33   TTLSLLCLFWFLSLHQARAAKFHNVSGL---RGNNLVVANGCNLFLGSWVVDTSYPLYNS  89

Query  249  SNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSL  428
            S CPFIDP+FDC KYGRPDKQYLKYAWKP+SC LPRFDG + L RWRGKK+MFVGDSLSL
Sbjct  90   STCPFIDPQFDCQKYGRPDKQYLKYAWKPESCALPRFDGVDFLNRWRGKKIMFVGDSLSL  149

Query  429  NMWNSLACMIHASVPTSKITY  491
            NMW SL C+IHASVP +K  +
Sbjct  150  NMWRSLTCVIHASVPNAKTGF  170



>ref|XP_003542986.1| PREDICTED: protein YLS7-like isoform X1 [Glycine max]
Length=375

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 106/141 (75%), Gaps = 4/141 (3%)
 Frame = +3

Query  72   SGVVIIAVLLLVQGHGGRAAQ-NNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQP  248
            + + ++ +   +  H  RAA+ +NVS L    G  +V + GCNLF G WVVD+SYPLY  
Sbjct  18   TTLSLLCLFWFLSLHQARAAKFHNVSGL---RGNNLVVANGCNLFLGSWVVDTSYPLYNS  74

Query  249  SNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSL  428
            S CPFIDP+FDC KYGRPDKQYLKYAWKP+SC LPRFDG + L RWRGKK+MFVGDSLSL
Sbjct  75   STCPFIDPQFDCQKYGRPDKQYLKYAWKPESCALPRFDGVDFLNRWRGKKIMFVGDSLSL  134

Query  429  NMWNSLACMIHASVPTSKITY  491
            NMW SL C+IHASVP +K  +
Sbjct  135  NMWRSLTCVIHASVPNAKTGF  155



>ref|XP_009348409.1| PREDICTED: protein trichome birefringence-like 38 [Pyrus x bretschneideri]
Length=361

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 106/138 (77%), Gaps = 4/138 (3%)
 Frame = +3

Query  78   VVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNC  257
            +V + VL+        A Q++ S L     ++ VS  GCNLF+G WV D+SY LY  ++C
Sbjct  11   LVALQVLVFFSEEAEAAEQSHGSSLRV--HRKQVS--GCNLFQGNWVFDASYTLYDSASC  66

Query  258  PFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMW  437
            PFIDPEFDCIKYGRPDKQ+LKYAWKPDSC+LPRFDG + L RWRGKK+MFVGDSLSLNMW
Sbjct  67   PFIDPEFDCIKYGRPDKQFLKYAWKPDSCNLPRFDGVDFLTRWRGKKIMFVGDSLSLNMW  126

Query  438  NSLACMIHASVPTSKITY  491
             SL+CMIHASVP +K T+
Sbjct  127  ESLSCMIHASVPNAKTTF  144



>ref|XP_007211024.1| hypothetical protein PRUPE_ppa019892mg, partial [Prunus persica]
 gb|EMJ12223.1| hypothetical protein PRUPE_ppa019892mg, partial [Prunus persica]
Length=137

 Score =   177 bits (449),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 98/128 (77%), Gaps = 12/128 (9%)
 Frame = +3

Query  108  QGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCI  287
             GHG R +            ++   + GCNLF+G W  D+SYPLY  S+CPFIDP+F+CI
Sbjct  6    HGHGTRIS------------RQRKQATGCNLFQGNWAFDASYPLYDSSSCPFIDPKFNCI  53

Query  288  KYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHAS  467
            KYGRPDKQ+LKYAWKPDSCDLPRFDG + L+R +GKK+MFVGDSLSLNMW SL+CMIHAS
Sbjct  54   KYGRPDKQFLKYAWKPDSCDLPRFDGLDFLRRRKGKKIMFVGDSLSLNMWESLSCMIHAS  113

Query  468  VPTSKITY  491
            VP +K T+
Sbjct  114  VPNAKTTF  121



>gb|KDO77819.1| hypothetical protein CISIN_1g017263mg [Citrus sinensis]
Length=372

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 117/152 (77%), Gaps = 9/152 (6%)
 Frame = +3

Query  45   MGVGQKVM--W-SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRW  215
            MG G  V+  W    V+++ +LL +      A+ ++ ++ S  G++ VS  GCNLF+GRW
Sbjct  1    MGFGSHVLLFWLFQFVLLSSMLLKEAE----AEQHLYNVTSLRGRKQVS--GCNLFQGRW  54

Query  216  VVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGK  395
            V+D SYPLY  S+CPFID EFDC+KYGRPDKQYLKY+W+P SC +PRFDGG+ L+R+RGK
Sbjct  55   VIDPSYPLYDSSSCPFIDAEFDCLKYGRPDKQYLKYSWQPASCAVPRFDGGDFLRRYRGK  114

Query  396  KVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            ++MFVGDSLSLNMW SL+CMIHASVP +K ++
Sbjct  115  RIMFVGDSLSLNMWESLSCMIHASVPNAKTSF  146



>ref|XP_011005473.1| PREDICTED: protein trichome birefringence-like 37 [Populus euphratica]
Length=359

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 111/149 (74%), Gaps = 6/149 (4%)
 Frame = +3

Query  45   MGVGQKVMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVD  224
            MG   +V++S      +LLL +   G+    NVS L    G++ VS  GC+LF+GRWVVD
Sbjct  1    MGFKCRVLFSIFCQCMLLLLQEAIAGQH-HYNVSRL---KGRKQVS--GCDLFQGRWVVD  54

Query  225  SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVM  404
            +SYPLY  S CPFID EFDC  YGRPD QYLKY+W+PDSC++PRF G + L RWRGKK+M
Sbjct  55   TSYPLYDSSGCPFIDAEFDCQGYGRPDTQYLKYSWQPDSCNIPRFSGADFLARWRGKKIM  114

Query  405  FVGDSLSLNMWNSLACMIHASVPTSKITY  491
            FVGDSLSLNMW SLACMIHA+VPT+K T+
Sbjct  115  FVGDSLSLNMWESLACMIHAAVPTAKTTF  143



>gb|KDO77821.1| hypothetical protein CISIN_1g017263mg [Citrus sinensis]
Length=374

 Score =   184 bits (468),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 117/152 (77%), Gaps = 9/152 (6%)
 Frame = +3

Query  45   MGVGQKVM--W-SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRW  215
            MG G  V+  W    V+++ +LL +      A+ ++ ++ S  G++ VS  GCNLF+GRW
Sbjct  1    MGFGSHVLLFWLFQFVLLSSMLLKEAE----AEQHLYNVTSLRGRKQVS--GCNLFQGRW  54

Query  216  VVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGK  395
            V+D SYPLY  S+CPFID EFDC+KYGRPDKQYLKY+W+P SC +PRFDGG+ L+R+RGK
Sbjct  55   VIDPSYPLYDSSSCPFIDAEFDCLKYGRPDKQYLKYSWQPASCAVPRFDGGDFLRRYRGK  114

Query  396  KVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            ++MFVGDSLSLNMW SL+CMIHASVP +K ++
Sbjct  115  RIMFVGDSLSLNMWESLSCMIHASVPNAKTSF  146



>gb|AHN91976.1| TBL1 [Citrus sinensis]
Length=366

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 117/152 (77%), Gaps = 9/152 (6%)
 Frame = +3

Query  45   MGVGQKVM--W-SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRW  215
            MG G  V+  W    V+++ +LL +      A+ ++ ++ S  G++ VS  GCNLF+GRW
Sbjct  1    MGFGSHVLLFWLFQFVLLSSMLLKEAE----AEQHLYNVTSLRGRKQVS--GCNLFQGRW  54

Query  216  VVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGK  395
            V+D SYPLY  S+CPFID EFDC+KYGRPDKQYLKY+W+P SC +PRFDGG+ L+R+RGK
Sbjct  55   VIDPSYPLYDSSSCPFIDAEFDCLKYGRPDKQYLKYSWRPASCAVPRFDGGDFLRRYRGK  114

Query  396  KVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            ++MFVGDSLSLNMW SL+CMIHASVP +K ++
Sbjct  115  RIMFVGDSLSLNMWESLSCMIHASVPNAKTSF  146



>ref|XP_006467669.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=366

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 117/152 (77%), Gaps = 9/152 (6%)
 Frame = +3

Query  45   MGVGQKVM--W-SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRW  215
            MG G  V+  W    V+++ +LL +      A+ ++ ++ S  G++ VS  GCNLF+GRW
Sbjct  1    MGFGSHVLLFWLFQFVLLSSMLLKEAE----AEQHLYNVTSLRGRKQVS--GCNLFQGRW  54

Query  216  VVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGK  395
            V+D SYPLY  S+CPFID EFDC+KYGRPDKQYLKY+W+P SC +PRFDGG+ L+R+RGK
Sbjct  55   VIDPSYPLYDSSSCPFIDAEFDCLKYGRPDKQYLKYSWQPASCAVPRFDGGDFLRRYRGK  114

Query  396  KVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            ++MFVGDSLSLNMW SL+CMIHASVP +K ++
Sbjct  115  RIMFVGDSLSLNMWESLSCMIHASVPNAKTSF  146



>gb|KDO77820.1| hypothetical protein CISIN_1g017263mg [Citrus sinensis]
Length=366

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 117/152 (77%), Gaps = 9/152 (6%)
 Frame = +3

Query  45   MGVGQKVM--W-SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRW  215
            MG G  V+  W    V+++ +LL +      A+ ++ ++ S  G++ VS  GCNLF+GRW
Sbjct  1    MGFGSHVLLFWLFQFVLLSSMLLKEAE----AEQHLYNVTSLRGRKQVS--GCNLFQGRW  54

Query  216  VVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGK  395
            V+D SYPLY  S+CPFID EFDC+KYGRPDKQYLKY+W+P SC +PRFDGG+ L+R+RGK
Sbjct  55   VIDPSYPLYDSSSCPFIDAEFDCLKYGRPDKQYLKYSWQPASCAVPRFDGGDFLRRYRGK  114

Query  396  KVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            ++MFVGDSLSLNMW SL+CMIHASVP +K ++
Sbjct  115  RIMFVGDSLSLNMWESLSCMIHASVPNAKTSF  146



>gb|KDO77822.1| hypothetical protein CISIN_1g017263mg [Citrus sinensis]
Length=368

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 117/152 (77%), Gaps = 9/152 (6%)
 Frame = +3

Query  45   MGVGQKVM--W-SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRW  215
            MG G  V+  W    V+++ +LL +      A+ ++ ++ S  G++ VS  GCNLF+GRW
Sbjct  1    MGFGSHVLLFWLFQFVLLSSMLLKEAE----AEQHLYNVTSLRGRKQVS--GCNLFQGRW  54

Query  216  VVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGK  395
            V+D SYPLY  S+CPFID EFDC+KYGRPDKQYLKY+W+P SC +PRFDGG+ L+R+RGK
Sbjct  55   VIDPSYPLYDSSSCPFIDAEFDCLKYGRPDKQYLKYSWQPASCAVPRFDGGDFLRRYRGK  114

Query  396  KVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            ++MFVGDSLSLNMW SL+CMIHASVP +K ++
Sbjct  115  RIMFVGDSLSLNMWESLSCMIHASVPNAKTSF  146



>ref|XP_002305083.1| hypothetical protein POPTR_0004s05420g [Populus trichocarpa]
 gb|EEE85594.1| hypothetical protein POPTR_0004s05420g [Populus trichocarpa]
Length=411

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 111/149 (74%), Gaps = 6/149 (4%)
 Frame = +3

Query  45   MGVGQKVMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVD  224
            MG   +V++S      +LLL +   G+   N VS L    G++ VS  GC+LF+GRWVVD
Sbjct  1    MGFKCRVLFSIFCQCMLLLLQEAIAGQHYYN-VSRL---KGRKQVS--GCDLFQGRWVVD  54

Query  225  SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVM  404
            SSYPLY  S CPFID EFDC  YGRPD QYLKY+W+PDSC++PRF G + L RWRGKK+M
Sbjct  55   SSYPLYDSSGCPFIDAEFDCQGYGRPDTQYLKYSWQPDSCNIPRFSGADFLARWRGKKIM  114

Query  405  FVGDSLSLNMWNSLACMIHASVPTSKITY  491
            FVGDSLSLNMW SLACMIHA+VPT+K T+
Sbjct  115  FVGDSLSLNMWESLACMIHAAVPTAKTTF  143



>ref|XP_009790075.1| PREDICTED: protein trichome birefringence-like 38 [Nicotiana 
sylvestris]
 ref|XP_009790076.1| PREDICTED: protein trichome birefringence-like 38 [Nicotiana 
sylvestris]
Length=360

 Score =   182 bits (463),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 104/138 (75%), Gaps = 9/138 (7%)
 Frame = +3

Query  78   VVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNC  257
            V++I++ L  +         NVS      GK       CNLF+G+WV+D+S+PLYQ S+C
Sbjct  12   VIVISLFLQTETVKAEFVVKNVSS----RGKM-----SCNLFQGKWVIDTSFPLYQSSSC  62

Query  258  PFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMW  437
            PFIDPEFDC KYGRPDK+YLKYAWKPDSC+LPRFDG + LKRW GKK+MFVGDSLSLNMW
Sbjct  63   PFIDPEFDCQKYGRPDKEYLKYAWKPDSCNLPRFDGKDFLKRWLGKKIMFVGDSLSLNMW  122

Query  438  NSLACMIHASVPTSKITY  491
             SLACM+H+SVP +  ++
Sbjct  123  ESLACMLHSSVPNATTSF  140



>gb|KHG20284.1| Enolase [Gossypium arboreum]
Length=365

 Score =   182 bits (463),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 109/151 (72%), Gaps = 8/151 (5%)
 Frame = +3

Query  45   MGVGQKVMWSGVVIIAVLLLVQGHGGRAAQN--NVSHLLSWGGKEIVSSGGCNLFRGRWV  218
            MG G K +   +    V++L+Q    R  Q   NVS L +   ++ VS  GCNLF+G+WV
Sbjct  1    MGFGCKTLLC-LFFTVVVVLLQEASARQQQYYYNVSGLRN---RKQVS--GCNLFQGQWV  54

Query  219  VDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKK  398
             D SYP Y  S CPFID EFDC+KYGRPDKQYLKY+WKPD C+LPRFDG   L +WRGKK
Sbjct  55   FDPSYPYYDSSGCPFIDAEFDCLKYGRPDKQYLKYSWKPDGCNLPRFDGASFLAKWRGKK  114

Query  399  VMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            +MFVGDSLSLNMW S+ACMIHASVP SK T+
Sbjct  115  IMFVGDSLSLNMWESMACMIHASVPNSKTTF  145



>ref|XP_008383643.1| PREDICTED: protein trichome birefringence-like 38 [Malus domestica]
Length=361

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  192  CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGE  371
            CNLF G WV D+SYPLY  + CPFIDPEFDCIKYGRPD Q+LKYAWKPDSCDLPRFDG +
Sbjct  45   CNLFEGNWVFDASYPLYDSATCPFIDPEFDCIKYGRPDTQFLKYAWKPDSCDLPRFDGVD  104

Query  372  LLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
             L+RWRGKK+MFVGDSLSLNMW SL+CMIHASVP +K T+
Sbjct  105  FLRRWRGKKIMFVGDSLSLNMWESLSCMIHASVPDAKTTF  144



>gb|KDP21076.1| hypothetical protein JCGZ_21547 [Jatropha curcas]
Length=367

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 110/150 (73%), Gaps = 6/150 (4%)
 Frame = +3

Query  45   MGVGQKVMWSGVVIIAVLLLVQGHGGRAAQN--NVSHLLSWGGKEIVSSGGCNLFRGRWV  218
            MG   KV+ S +  + ++L       R  Q   NV+ LL   G++ VS  GCNLF+G+WV
Sbjct  1    MGYRCKVLSSVLFQVILVLAAFFKEARTEQQVYNVTRLLR--GRKQVS--GCNLFQGKWV  56

Query  219  VDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKK  398
            VDSSYP Y  S CPFID EFDC KYGRPD QYLKY+W+PDSC+LPRFDG + L+RW GK+
Sbjct  57   VDSSYPFYDSSACPFIDAEFDCQKYGRPDTQYLKYSWQPDSCNLPRFDGVDFLRRWSGKQ  116

Query  399  VMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            +MFVGDSLSLNMW SL+CMIHASVP +K +
Sbjct  117  IMFVGDSLSLNMWESLSCMIHASVPNAKTS  146



>ref|XP_004485883.1| PREDICTED: uncharacterized protein LOC101498973 [Cicer arietinum]
Length=366

 Score =   181 bits (459),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 105/133 (79%), Gaps = 4/133 (3%)
 Frame = +3

Query  96   LLLVQGHGGRAAQ-NNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDP  272
            +L V  H   A++ +NVS++    GK+ V+S GCNLF G WVV+ SYPLY  S CPFID 
Sbjct  17   VLFVSLHQATASKFHNVSNI---KGKKSVASSGCNLFIGSWVVNPSYPLYDYSTCPFIDA  73

Query  273  EFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLAC  452
            EF+C KYGRPDKQYLKY+WKPDSC LPRFDG + L +W+GKK+MFVGDSLSLNMW SL+C
Sbjct  74   EFNCQKYGRPDKQYLKYSWKPDSCALPRFDGVDFLNKWKGKKIMFVGDSLSLNMWESLSC  133

Query  453  MIHASVPTSKITY  491
            MIHASVP +K ++
Sbjct  134  MIHASVPNAKTSF  146



>emb|CBI30668.3| unnamed protein product [Vitis vinifera]
Length=377

 Score =   181 bits (458),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 108/153 (71%), Gaps = 15/153 (10%)
 Frame = +3

Query  63   VMWSGVVIIAVLLLVQG--------HGGRAAQN--NVSHLLSWGGKEIVSSGGCNLFRGR  212
             ++ GV  +   L+VQG           RA     NVS L S   ++ VSS  CNLF+G+
Sbjct  8    TIYMGVSTVRCHLVVQGLLFLILLLQQARADHQVYNVSGLRS---RKQVSS--CNLFQGK  62

Query  213  WVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRG  392
            WV D+SYP Y  SNCPFIDPEFDC KYGRPDKQYLKY+WKPDSCDLPRFDG + L+RWRG
Sbjct  63   WVFDASYPFYDASNCPFIDPEFDCQKYGRPDKQYLKYSWKPDSCDLPRFDGLDFLRRWRG  122

Query  393  KKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            K++MFVGDSLSLN W SL CMIH S P +K ++
Sbjct  123  KRIMFVGDSLSLNQWESLVCMIHQSAPNAKASF  155



>ref|XP_006305057.1| hypothetical protein CARUB_v10009422mg [Capsella rubella]
 gb|EOA37955.1| hypothetical protein CARUB_v10009422mg [Capsella rubella]
Length=384

 Score =   181 bits (458),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 101/133 (76%), Gaps = 1/133 (1%)
 Frame = +3

Query  93   VLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDP  272
             +LLV GH   A   +   + S  GK+   + GCNLF+GRWV D+SYP Y  S CPFID 
Sbjct  33   TVLLVNGHNSTAGSGD-GGMSSLRGKKQRGASGCNLFQGRWVFDASYPFYDSSTCPFIDG  91

Query  273  EFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLAC  452
            EFDC+K+GRPDKQ+LKY+W+P+SC +PRFDG   L+++RGK+VMFVGDSLSLNMW SL C
Sbjct  92   EFDCLKFGRPDKQFLKYSWQPESCTIPRFDGAAFLRKYRGKRVMFVGDSLSLNMWESLGC  151

Query  453  MIHASVPTSKITY  491
            MIHASVP +K T+
Sbjct  152  MIHASVPNAKTTF  164



>ref|NP_565779.1| trichome birefringence-like 37 protein [Arabidopsis thaliana]
 sp|O22960.2|TBL37_ARATH RecName: Full=Protein trichome birefringence-like 37 [Arabidopsis 
thaliana]
 gb|AAB67625.2| expressed protein [Arabidopsis thaliana]
 gb|AAM63505.1| unknown [Arabidopsis thaliana]
 gb|AEC08913.1| trichome birefringence-like 37 protein [Arabidopsis thaliana]
Length=385

 Score =   181 bits (458),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 95/114 (83%), Gaps = 4/114 (4%)
 Frame = +3

Query  162  GGKEIV----SSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAW  329
            GGKE++     + GCNLF+GRWV D+SYP Y  S CPFID EFDC+K+GRPDKQ+LKY+W
Sbjct  51   GGKEMLKGRKQTSGCNLFQGRWVFDASYPFYDSSTCPFIDGEFDCLKFGRPDKQFLKYSW  110

Query  330  KPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            +PDSC +PRFDG   LK+WRGK+VMFVGDSLSLNMW SLACMIH+SVP +K T+
Sbjct  111  QPDSCTVPRFDGEAFLKKWRGKRVMFVGDSLSLNMWESLACMIHSSVPNTKTTF  164



>ref|XP_007153710.1| hypothetical protein PHAVU_003G058400g [Phaseolus vulgaris]
 gb|ESW25704.1| hypothetical protein PHAVU_003G058400g [Phaseolus vulgaris]
Length=364

 Score =   180 bits (457),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 101/129 (78%), Gaps = 7/129 (5%)
 Frame = +3

Query  114  HGGRAAQN---NVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDC  284
            H  RAA++   NV+ L   G KEI+S   CNLF G WV+D S+PLY  S+CPFIDPEFDC
Sbjct  20   HQARAAKSGNYNVTRLK--GRKEIISR--CNLFLGSWVIDPSHPLYDSSSCPFIDPEFDC  75

Query  285  IKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHA  464
             KYGRPDKQYLKY+WKPDSC LPRFDG   L +WRGK++MFVGDSLSLNMW SL+CM+HA
Sbjct  76   QKYGRPDKQYLKYSWKPDSCALPRFDGVNFLNKWRGKRIMFVGDSLSLNMWESLSCMLHA  135

Query  465  SVPTSKITY  491
            SVP +  T+
Sbjct  136  SVPNATTTF  144



>emb|CAN60202.1| hypothetical protein VITISV_036403 [Vitis vinifera]
Length=367

 Score =   180 bits (456),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 106/149 (71%), Gaps = 15/149 (10%)
 Frame = +3

Query  75   GVVIIAVLLLVQG--------HGGRAAQN--NVSHLLSWGGKEIVSSGGCNLFRGRWVVD  224
            GV  +   L+VQG           RA     NVS L S   ++ VSS  CNLF+G+WV D
Sbjct  2    GVSTVRCHLVVQGLLFLILLLQQARADHQVYNVSGLRS---RKQVSS--CNLFQGKWVFD  56

Query  225  SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVM  404
            +SYP Y  SNCPFIDPEFDC KYGRPDKQYLKY+WKPDSCDLPRFDG + L+RWRGK++M
Sbjct  57   ASYPFYDASNCPFIDPEFDCQKYGRPDKQYLKYSWKPDSCDLPRFDGLDFLRRWRGKRIM  116

Query  405  FVGDSLSLNMWNSLACMIHASVPTSKITY  491
            FVGDSLSLN W SL CMIH S P +K ++
Sbjct  117  FVGDSLSLNQWESLVCMIHQSAPNAKASF  145



>ref|XP_004234094.1| PREDICTED: protein trichome birefringence-like 38 [Solanum lycopersicum]
Length=357

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +3

Query  165  GKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSC  344
               I S   CNLF+G+WV+D S+PLYQ SNCPFIDPEFDC KYGRPDK+YLKYAWKP+SC
Sbjct  29   NNNIESLSNCNLFQGQWVIDPSFPLYQSSNCPFIDPEFDCQKYGRPDKEYLKYAWKPNSC  88

Query  345  DLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            +LPRFDG + LKRW GKK+MFVGDSLSLNMW SLACM+H+S+P +  ++
Sbjct  89   NLPRFDGIDFLKRWNGKKIMFVGDSLSLNMWESLACMLHSSMPNATTSF  137



>ref|XP_010460674.1| PREDICTED: protein trichome birefringence-like 38 [Camelina sativa]
Length=384

 Score =   180 bits (456),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 101/133 (76%), Gaps = 1/133 (1%)
 Frame = +3

Query  93   VLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDP  272
             +LLV GH   A   +   + S  GK+   + GCNLF+GRWV D+SYP Y  S CPFID 
Sbjct  33   TVLLVNGHNSTAGSGD-GGMSSLRGKKQRRASGCNLFQGRWVFDASYPFYDSSTCPFIDG  91

Query  273  EFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLAC  452
            EFDC+K+GRPDKQ+LKY+W+P+SC +PRFDG   L+++RGK++MFVGDSLSLNMW SL C
Sbjct  92   EFDCLKFGRPDKQFLKYSWQPESCAIPRFDGAAFLRKYRGKRIMFVGDSLSLNMWESLGC  151

Query  453  MIHASVPTSKITY  491
            MIHASVP +K T+
Sbjct  152  MIHASVPNAKTTF  164



>ref|XP_010480710.1| PREDICTED: protein trichome birefringence-like 38, partial [Camelina 
sativa]
Length=406

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 101/133 (76%), Gaps = 1/133 (1%)
 Frame = +3

Query  93   VLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDP  272
             +LLV GH   A   +   + S  GK+   + GCNLF+GRWV D+SYP Y  S CPFID 
Sbjct  55   TVLLVNGHNSTAGSGD-GGMSSLRGKKQRRASGCNLFQGRWVFDASYPFYDSSTCPFIDG  113

Query  273  EFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLAC  452
            EFDC+K+GRPDKQ+LKY+W+P+SC +PRFDG   L+++RGK++MFVGDSLSLNMW SL C
Sbjct  114  EFDCLKFGRPDKQFLKYSWQPESCAIPRFDGAAFLRKYRGKRIMFVGDSLSLNMWESLGC  173

Query  453  MIHASVPTSKITY  491
            MIHASVP +K T+
Sbjct  174  MIHASVPNAKTTF  186



>ref|XP_010499424.1| PREDICTED: protein trichome birefringence-like 38 [Camelina sativa]
Length=383

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 102/133 (77%), Gaps = 2/133 (2%)
 Frame = +3

Query  93   VLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDP  272
             +LLV GH   +  +N   + S  GK+   + GCNLF+GRWV D+SYP Y  S CPFID 
Sbjct  33   TVLLVNGH--NSTGSNDGGMSSLRGKKQRRASGCNLFQGRWVFDASYPFYDSSTCPFIDG  90

Query  273  EFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLAC  452
            EFDC+K+GRPDKQ+LKY+W+P+SC +PRFDG   L+++RGK++MFVGDSLSLNMW SL C
Sbjct  91   EFDCLKFGRPDKQFLKYSWQPESCAIPRFDGAAFLRKYRGKRIMFVGDSLSLNMWESLGC  150

Query  453  MIHASVPTSKITY  491
            MIHASVP +K T+
Sbjct  151  MIHASVPNAKTTF  163



>ref|XP_002274664.1| PREDICTED: protein trichome birefringence-like 38 [Vitis vinifera]
Length=409

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 106/149 (71%), Gaps = 15/149 (10%)
 Frame = +3

Query  75   GVVIIAVLLLVQG--------HGGRAAQN--NVSHLLSWGGKEIVSSGGCNLFRGRWVVD  224
            GV  +   L+VQG           RA     NVS L S   ++ VSS  CNLF+G+WV D
Sbjct  44   GVSTVRCHLVVQGLLFLILLLQQARADHQVYNVSGLRS---RKQVSS--CNLFQGKWVFD  98

Query  225  SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVM  404
            +SYP Y  SNCPFIDPEFDC KYGRPDKQYLKY+WKPDSCDLPRFDG + L+RWRGK++M
Sbjct  99   ASYPFYDASNCPFIDPEFDCQKYGRPDKQYLKYSWKPDSCDLPRFDGLDFLRRWRGKRIM  158

Query  405  FVGDSLSLNMWNSLACMIHASVPTSKITY  491
            FVGDSLSLN W SL CMIH S P +K ++
Sbjct  159  FVGDSLSLNQWESLVCMIHQSAPNAKASF  187



>ref|XP_003593750.1| hypothetical protein MTR_2g015720 [Medicago truncatula]
 gb|AES64001.1| trichome birefringence-like protein [Medicago truncatula]
Length=360

 Score =   178 bits (452),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 105/143 (73%), Gaps = 8/143 (6%)
 Frame = +3

Query  75   GVVIIAVLLLV----QGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLY  242
            G   I +LLL     Q   G A  +NVS L    GK+ V + GCNLF G WVVD SYPLY
Sbjct  2    GFRAITLLLLFSLFHQLLLGEAKFHNVSSL---RGKKPVVTNGCNLFIGSWVVDPSYPLY  58

Query  243  QPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSL  422
              S+CPFIDPEF+C KYGRPDKQYLKY+WKPDSC LP FDG + L +WRGKK+MFVGDSL
Sbjct  59   D-SSCPFIDPEFNCQKYGRPDKQYLKYSWKPDSCALPSFDGKDFLNKWRGKKIMFVGDSL  117

Query  423  SLNMWNSLACMIHASVPTSKITY  491
            SLNMW SL+CMIHASVP  K ++
Sbjct  118  SLNMWESLSCMIHASVPNVKTSF  140



>ref|XP_009352799.1| PREDICTED: protein trichome birefringence-like 37 [Pyrus x bretschneideri]
Length=361

 Score =   178 bits (451),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 101/138 (73%), Gaps = 4/138 (3%)
 Frame = +3

Query  78   VVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNC  257
            +V + VL+        A  ++ S L     ++ VS   CNLF G WV D+SYPLY  + C
Sbjct  11   LVALQVLVFFSEEAESAGHSHGSSLRV--HRKQVSR--CNLFEGNWVFDASYPLYDSATC  66

Query  258  PFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMW  437
            PFIDPEFDCIKYGRPD Q+LKYAWKP SCDLPRFDG + L+RW GKK+MFVGDSLSLNMW
Sbjct  67   PFIDPEFDCIKYGRPDTQFLKYAWKPASCDLPRFDGVDFLRRWSGKKIMFVGDSLSLNMW  126

Query  438  NSLACMIHASVPTSKITY  491
             SL+CMIHASVP +K T+
Sbjct  127  ESLSCMIHASVPNAKTTF  144



>ref|XP_009410826.1| PREDICTED: protein trichome birefringence-like 38 [Musa acuminata 
subsp. malaccensis]
Length=373

 Score =   178 bits (452),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 110/153 (72%), Gaps = 6/153 (4%)
 Frame = +3

Query  51   VGQKVMWSGVVIIAVL-LLVQGHGGRAAQN--NVSHL---LSWGGKEIVSSGGCNLFRGR  212
            +G +  WS V++ A+L +L+    G A ++  +  HL    S G +E  S   CN+FRG 
Sbjct  1    MGSRAQWSFVLLCALLSVLIASLNGTATESFGHTHHLGNGTSPGRREGASGISCNMFRGS  60

Query  213  WVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRG  392
            WV D SYPLY  S CP +DPEFDC +YGRPDK YLKY WKPD+C+LPRF+G +LL+RW+G
Sbjct  61   WVYDQSYPLYDSSTCPILDPEFDCQRYGRPDKSYLKYRWKPDACELPRFNGLDLLRRWKG  120

Query  393  KKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            KK+MFVGDS+S+N W SL CM+HA+VP +K TY
Sbjct  121  KKIMFVGDSISINQWQSLVCMLHAAVPDAKTTY  153



>gb|KJB69610.1| hypothetical protein B456_011G033800 [Gossypium raimondii]
Length=365

 Score =   178 bits (451),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +3

Query  189  GCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGG  368
            GCNLF+G+WV D SYP Y  S CPFID EFDC+KYGRPDKQYLKY+WKPD C+LPRFDG 
Sbjct  45   GCNLFQGQWVFDPSYPYYDSSGCPFIDAEFDCLKYGRPDKQYLKYSWKPDGCNLPRFDGA  104

Query  369  ELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
              L +WRGKK+MFVGDSLSLNMW S+ACMIHASVP SK T+
Sbjct  105  SFLAKWRGKKIMFVGDSLSLNMWESMACMIHASVPNSKTTF  145



>ref|XP_003593751.1| hypothetical protein MTR_2g015720 [Medicago truncatula]
Length=376

 Score =   178 bits (452),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 105/143 (73%), Gaps = 8/143 (6%)
 Frame = +3

Query  75   GVVIIAVLLLV----QGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLY  242
            G   I +LLL     Q   G A  +NVS L    GK+ V + GCNLF G WVVD SYPLY
Sbjct  2    GFRAITLLLLFSLFHQLLLGEAKFHNVSSL---RGKKPVVTNGCNLFIGSWVVDPSYPLY  58

Query  243  QPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSL  422
              S+CPFIDPEF+C KYGRPDKQYLKY+WKPDSC LP FDG + L +WRGKK+MFVGDSL
Sbjct  59   D-SSCPFIDPEFNCQKYGRPDKQYLKYSWKPDSCALPSFDGKDFLNKWRGKKIMFVGDSL  117

Query  423  SLNMWNSLACMIHASVPTSKITY  491
            SLNMW SL+CMIHASVP  K ++
Sbjct  118  SLNMWESLSCMIHASVPNVKTSF  140



>ref|XP_011045911.1| PREDICTED: protein trichome birefringence-like 38 [Populus euphratica]
Length=362

 Score =   177 bits (450),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 110/149 (74%), Gaps = 6/149 (4%)
 Frame = +3

Query  45   MGVGQKVMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVD  224
            MG   +V+     ++ +L L +   G    +N S L    G++ VS  GCNLF+GRWVVD
Sbjct  1    MGFKCQVLVCTFCLVMLLFLQETRAG-IHSSNASRL---NGRKKVS--GCNLFQGRWVVD  54

Query  225  SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVM  404
            +SYPLY  S+CPFID +F+C KYGR D QYLKY+W+PDSC +PRF+G + L+RWRGKK+M
Sbjct  55   TSYPLYDSSSCPFIDDQFNCQKYGRRDNQYLKYSWQPDSCKIPRFNGADFLRRWRGKKIM  114

Query  405  FVGDSLSLNMWNSLACMIHASVPTSKITY  491
            FVGDSLSLNMW SL+CMIHA+VP +K T+
Sbjct  115  FVGDSLSLNMWESLSCMIHAAVPKAKTTF  143



>ref|NP_564318.1| protein trichome birefringence-like 38 [Arabidopsis thaliana]
 sp|Q8VY22.1|TBL38_ARATH RecName: Full=Protein trichome birefringence-like 38 [Arabidopsis 
thaliana]
 gb|AAL66969.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20296.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99289.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE31037.1| protein trichome birefringence-like 38 [Arabidopsis thaliana]
Length=380

 Score =   178 bits (451),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +3

Query  165  GKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSC  344
            GK+   + GCNLF+GRWV D+SYP Y  S CPFID EFDC+K+GRPDKQ+LKY+W+P+SC
Sbjct  52   GKKQRRASGCNLFQGRWVFDASYPFYDSSKCPFIDGEFDCLKFGRPDKQFLKYSWQPESC  111

Query  345  DLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
             +PRFDGG  L+++RGK+VMFVGDSLSLNMW SLACMIHASVP +K T+
Sbjct  112  TIPRFDGGAFLRKYRGKRVMFVGDSLSLNMWESLACMIHASVPNAKTTF  160



>ref|XP_002893546.1| hypothetical protein ARALYDRAFT_473111 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69805.1| hypothetical protein ARALYDRAFT_473111 [Arabidopsis lyrata subsp. 
lyrata]
Length=380

 Score =   178 bits (451),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +3

Query  165  GKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSC  344
            GK+   + GCNLF+GRWV D+SYP Y  S CPFID EFDC+K+GRPDKQ+LKY+W+P+SC
Sbjct  52   GKKQGRASGCNLFQGRWVFDASYPFYDSSTCPFIDGEFDCLKFGRPDKQFLKYSWQPESC  111

Query  345  DLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
             +PRFDGG  L+++RGK+VMFVGDSLSLNMW SLACMIHASVP +K T+
Sbjct  112  TIPRFDGGAFLRKYRGKRVMFVGDSLSLNMWESLACMIHASVPNAKTTF  160



>ref|XP_002522557.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39857.1| conserved hypothetical protein [Ricinus communis]
Length=370

 Score =   177 bits (450),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 105/135 (78%), Gaps = 3/135 (2%)
 Frame = +3

Query  84   IIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPF  263
            ++ +   +Q    +    NV+ LL  G K++ S+  CNLF+G+WVVD +YPLY  S CPF
Sbjct  19   LVLLFTFLQETTAQQHYYNVTRLLK-GRKQVSST--CNLFQGKWVVDPAYPLYDASGCPF  75

Query  264  IDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNS  443
            IDPEF+C K+GRPD QYLKY+W+PDSC++PRF+G + L+RWRGKK+MFVGDSLSLNMW S
Sbjct  76   IDPEFNCQKFGRPDTQYLKYSWQPDSCNVPRFNGVDFLRRWRGKKIMFVGDSLSLNMWES  135

Query  444  LACMIHASVPTSKIT  488
            L+CMIHASVP +K +
Sbjct  136  LSCMIHASVPNAKTS  150



>gb|KJB68384.1| hypothetical protein B456_010G242200 [Gossypium raimondii]
Length=373

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 101/151 (67%), Gaps = 11/151 (7%)
 Frame = +3

Query  39   PKMGVGQKVMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWV  218
            PKMG   ++ +       +  L       A++ N S LL           GCNLF+G+WV
Sbjct  14   PKMGFNSQISFYFFFFFFIASLDFIQETNASEYNESRLLM---------KGCNLFQGKWV  64

Query  219  VDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKK  398
             D SYP Y PS CPF+DPEFDC  +GRPDKQYLKYAWKPD+C LPRF+G   L +WRGKK
Sbjct  65   FDPSYPFYLPSKCPFVDPEFDC--HGRPDKQYLKYAWKPDACSLPRFNGASFLGKWRGKK  122

Query  399  VMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            +MFVGDSLSLNMW SL CMIHASVP SK TY
Sbjct  123  IMFVGDSLSLNMWESLVCMIHASVPNSKTTY  153



>gb|KJB34893.1| hypothetical protein B456_006G088800 [Gossypium raimondii]
Length=380

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 108/150 (72%), Gaps = 5/150 (3%)
 Frame = +3

Query  45   MGVGQKVMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVD  224
            MG   K + S   ++ V+L+ +  G R   N  +++   G K+  +  GCNLF+G WV+D
Sbjct  1    MGFSFKTLLSLFPLVWVMLMQETSGSRHYYNVSNNIK--GRKQ--AKNGCNLFQGNWVLD  56

Query  225  -SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKV  401
             SSYP Y  S CPFID EFDC+KYGRPDKQ+L Y+WKPDSC+LPRFDG   L +W+GKK+
Sbjct  57   LSSYPFYNSSQCPFIDSEFDCLKYGRPDKQFLHYSWKPDSCNLPRFDGVNFLGKWKGKKI  116

Query  402  MFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            MFVGDSLSLNMW SLACM+ ASVP SK TY
Sbjct  117  MFVGDSLSLNMWESLACMVQASVPNSKTTY  146



>ref|XP_004149051.1| PREDICTED: uncharacterized protein LOC101203509 [Cucumis sativus]
 ref|XP_004163473.1| PREDICTED: uncharacterized LOC101203509 [Cucumis sativus]
 gb|KGN65647.1| hypothetical protein Csa_1G478060 [Cucumis sativus]
Length=373

 Score =   177 bits (449),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 108/150 (72%), Gaps = 15/150 (10%)
 Frame = +3

Query  75   GVVIIAVLLLVQG-----------HGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVV  221
            G VI+++ LL+Q                 AQ N   +L  G K+   + GCNLF+GRWV+
Sbjct  7    GRVILSLFLLLQASSSWLPFLQQAEAAVTAQPNKRSMLK-GRKQ---ANGCNLFQGRWVI  62

Query  222  DSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKV  401
            D S+PLY  S+CPFID EFDC KYGRPD  YLKY+W+PDSC+LPRFDG ++LKRW GKK+
Sbjct  63   DPSFPLYNSSSCPFIDSEFDCQKYGRPDSLYLKYSWRPDSCNLPRFDGVDVLKRWSGKKI  122

Query  402  MFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            MFVGDSLSLNMW SL+CM+HASVP +K ++
Sbjct  123  MFVGDSLSLNMWESLSCMLHASVPDAKTSF  152



>gb|KFK44758.1| hypothetical protein AALP_AA1G299000 [Arabis alpina]
Length=380

 Score =   177 bits (448),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 99/129 (77%), Gaps = 11/129 (9%)
 Frame = +3

Query  105  VQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDC  284
            V GHGG +         S  GK+   + GCNLF+GRWV D+SYP Y  S CPFID EFDC
Sbjct  46   VSGHGGTS---------SLRGKK--QTRGCNLFQGRWVFDASYPFYDSSTCPFIDGEFDC  94

Query  285  IKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHA  464
            +K+GRPDKQ+LKY+W+P++C +PRFDG   L++WRGK+VMFVGDSLSLNMW SLACMIHA
Sbjct  95   LKFGRPDKQFLKYSWQPEACTIPRFDGAAFLRKWRGKQVMFVGDSLSLNMWESLACMIHA  154

Query  465  SVPTSKITY  491
            SVP +K T+
Sbjct  155  SVPNAKTTF  163



>ref|XP_010509796.1| PREDICTED: protein trichome birefringence-like 37 [Camelina sativa]
Length=385

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 94/114 (82%), Gaps = 4/114 (4%)
 Frame = +3

Query  162  GGKEIV----SSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAW  329
            GGKE++     + GCNLF+G+WV D SYP Y  S CPFID EFDC+K+GRPDKQ+LKY+W
Sbjct  51   GGKEVMKGRKQTSGCNLFQGKWVFDPSYPFYNYSTCPFIDGEFDCLKFGRPDKQFLKYSW  110

Query  330  KPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            +PDSC +PRFDG   L+RWRGK+VMFVGDSLSLNMW SLACMI++SVP +K T+
Sbjct  111  QPDSCTVPRFDGAAFLRRWRGKRVMFVGDSLSLNMWESLACMIYSSVPDTKTTF  164



>ref|XP_006415616.1| hypothetical protein EUTSA_v10007896mg [Eutrema salsugineum]
 gb|ESQ33969.1| hypothetical protein EUTSA_v10007896mg [Eutrema salsugineum]
Length=386

 Score =   176 bits (447),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 98/134 (73%), Gaps = 0/134 (0%)
 Frame = +3

Query  90   AVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFID  269
             +L+    H    A +    + S  GK+   S  CNLF+GRWV D+SYP Y  S CPFID
Sbjct  33   TLLVNSHHHHNSTAVSGNGGMSSLRGKKQRRSSSCNLFQGRWVFDASYPFYGSSTCPFID  92

Query  270  PEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLA  449
             EFDC+K+GRPDKQ+LKY+W+P+SC +PRFDG   L++WRGK+VMFVGDSLSLNMW SL 
Sbjct  93   GEFDCLKFGRPDKQFLKYSWQPESCSIPRFDGAAFLRKWRGKRVMFVGDSLSLNMWESLG  152

Query  450  CMIHASVPTSKITY  491
            CMIHASVP +K T+
Sbjct  153  CMIHASVPNAKTTF  166



>emb|CAJ40777.1| alpha galactosidase precursor [Coffea arabica]
Length=365

 Score =   176 bits (445),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 101/134 (75%), Gaps = 3/134 (2%)
 Frame = +3

Query  90   AVLLLVQGHGGRAAQNNVSH-LLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFI  266
            A++L    H   ++   V + +  + G+ +   GGCNLF+G+WVVDSS+P Y+ S CPFI
Sbjct  14   AIVLFAVQHANSSSVETVHYNVTGYRGRHL--GGGCNLFQGKWVVDSSFPPYESSGCPFI  71

Query  267  DPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSL  446
            D EFDC KYGRPDKQYLKYAWKPDSC+LPRFDG + LKRW+GKK+MFVGDSLSLN W S 
Sbjct  72   DYEFDCQKYGRPDKQYLKYAWKPDSCNLPRFDGLDFLKRWKGKKIMFVGDSLSLNQWQSF  131

Query  447  ACMIHASVPTSKIT  488
             C+IHASVP++   
Sbjct  132  LCLIHASVPSANTN  145



>emb|CDO96761.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   176 bits (445),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 101/134 (75%), Gaps = 3/134 (2%)
 Frame = +3

Query  90   AVLLLVQGHGGRAAQNNVSH-LLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFI  266
            A++L    H   ++   V + +  + G+ +   GGCNLF+G+WVVDSS+P Y+ S CPFI
Sbjct  14   AIVLFAVQHANSSSVETVHYNVTGYRGRHL--GGGCNLFQGKWVVDSSFPPYESSGCPFI  71

Query  267  DPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSL  446
            D EFDC KYGRPDKQYLKYAWKPDSC+LPRFDG + LKRW+GKK+MFVGDSLSLN W S 
Sbjct  72   DYEFDCQKYGRPDKQYLKYAWKPDSCNLPRFDGLDFLKRWKGKKIMFVGDSLSLNQWQSF  131

Query  447  ACMIHASVPTSKIT  488
             C+IHASVP++   
Sbjct  132  LCLIHASVPSANTN  145



>gb|EPS72531.1| hypothetical protein M569_02228, partial [Genlisea aurea]
Length=105

 Score =   167 bits (424),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            S GC++F+G+WV DSSYPLY  S CPFIDPEFDCIKYGRPD+ YL+Y+WKPD+CD+PRFD
Sbjct  1    SAGCDVFQGKWVPDSSYPLYPSSGCPFIDPEFDCIKYGRPDRDYLQYSWKPDACDVPRFD  60

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            G +LL+RW GKKVMFVGDSLSLN W SL CMIH S P SK  
Sbjct  61   GVDLLRRWSGKKVMFVGDSLSLNQWESLGCMIHESSPGSKFA  102



>ref|XP_006294394.1| hypothetical protein CARUB_v10023411mg [Capsella rubella]
 gb|EOA27292.1| hypothetical protein CARUB_v10023411mg [Capsella rubella]
Length=385

 Score =   176 bits (445),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 92/114 (81%), Gaps = 4/114 (4%)
 Frame = +3

Query  162  GGKEIV----SSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAW  329
            GGKE++     + GCNLF+G+WV D SYP Y  S CPFID EFDC+K+GRPDKQ+LKY+W
Sbjct  51   GGKEVLKGRKQTSGCNLFQGKWVFDPSYPFYDSSTCPFIDGEFDCLKFGRPDKQFLKYSW  110

Query  330  KPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
             PDSC +PRFDG   LKRWRGK+VMFVGDSLSLNMW SL CMI++SVP +K T+
Sbjct  111  LPDSCTVPRFDGAAFLKRWRGKRVMFVGDSLSLNMWESLGCMIYSSVPNTKTTF  164



>ref|XP_003608141.1| Alpha galactosidase [Medicago truncatula]
Length=176

 Score =   169 bits (428),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 95/136 (70%), Gaps = 16/136 (12%)
 Frame = +3

Query  84   IIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPF  263
            + ++ LLV  H   A ++N                 CNLF G WV+DSSYPLY  S+CPF
Sbjct  13   LFSIALLVSMHPATAQKSN----------------NCNLFFGSWVIDSSYPLYDSSSCPF  56

Query  264  IDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNS  443
            ++ +FDC ++GRPD QYLKY+WKPDSCDLPRF+G + L RW+ KK+MFVGDSLSLNMW S
Sbjct  57   VEAQFDCQQFGRPDNQYLKYSWKPDSCDLPRFNGEDFLNRWKDKKIMFVGDSLSLNMWES  116

Query  444  LACMIHASVPTSKITY  491
            L+CMIHASVP    ++
Sbjct  117  LSCMIHASVPNVTTSF  132



>ref|XP_010549391.1| PREDICTED: protein trichome birefringence-like 37 [Tarenaya hassleriana]
Length=387

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            + GCNLF+GRW +D SYPLY  S+CPFID +F+C+K+GRPDKQ+LKY+W+PDSCD+PRF+
Sbjct  64   TSGCNLFQGRWSIDISYPLYDSSSCPFIDDKFNCLKFGRPDKQFLKYSWQPDSCDIPRFN  123

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            G E L+RWRGK+V+FVGDSLSLNMW SL CMIHASVP +K T+
Sbjct  124  GTEFLRRWRGKRVLFVGDSLSLNMWESLGCMIHASVPNAKTTF  166



>ref|XP_003529365.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN31006.1| hypothetical protein glysoja_020304 [Glycine soja]
Length=368

 Score =   173 bits (439),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 109/150 (73%), Gaps = 6/150 (4%)
 Frame = +3

Query  51   VGQKVMWSGVVIIAVLLLVQG-HGGRAAQNNVSHLLSW--GGKEIVSSGGCNLFRGRWVV  221
            +G KV    ++ +  L L +  H  RAA+++ +H ++   G KE+     CNLF G WV+
Sbjct  1    MGSKVKTLVLLSLFCLALFESLHQARAAKSHNNHNVTRLKGRKEL---NRCNLFIGSWVI  57

Query  222  DSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKV  401
            D S+PLY  S+CPFID EFDC KYGRPDKQYLKY+WKPDSC LPRFDG   L +W+GKK+
Sbjct  58   DPSHPLYDSSSCPFIDAEFDCQKYGRPDKQYLKYSWKPDSCALPRFDGVNFLNKWKGKKI  117

Query  402  MFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            MFVGDSLSLNMW SL+CM+HASVP +  ++
Sbjct  118  MFVGDSLSLNMWESLSCMLHASVPNATTSF  147



>ref|XP_004134666.1| PREDICTED: uncharacterized protein LOC101216213 [Cucumis sativus]
 ref|XP_004155544.1| PREDICTED: uncharacterized protein LOC101228403 [Cucumis sativus]
 gb|KGN49297.1| hypothetical protein Csa_6G519500 [Cucumis sativus]
Length=362

 Score =   173 bits (438),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 102/137 (74%), Gaps = 6/137 (4%)
 Frame = +3

Query  81   VIIAVLLLVQGHGGRAAQ-NNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNC  257
            +++ VL  +     +A    N+S++ S  GK++ +   CNLF G+WV D S PLY+ S+C
Sbjct  11   LLLQVLFFISLESAKAEDFYNISNVGS--GKQVRT---CNLFEGKWVFDPSLPLYESSSC  65

Query  258  PFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMW  437
            PFIDPEF+C KYGRPD+ YLKY WKPD CDLPRFDG ELL+RWRGKK+MFVGDSLSLNMW
Sbjct  66   PFIDPEFNCQKYGRPDRSYLKYTWKPDFCDLPRFDGLELLRRWRGKKIMFVGDSLSLNMW  125

Query  438  NSLACMIHASVPTSKIT  488
             SL CMI AS P +K +
Sbjct  126  QSLTCMIRASAPKTKTS  142



>ref|XP_011460601.1| PREDICTED: protein trichome birefringence-like 38 [Fragaria vesca 
subsp. vesca]
Length=370

 Score =   173 bits (438),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 101/128 (79%), Gaps = 5/128 (4%)
 Frame = +3

Query  111  GHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSY-PLYQPSNCPFIDPEFDCI  287
            GH G +  ++   +L  G K++ S   CNLF+G WV D S+ P+Y  S+C FID EFDCI
Sbjct  27   GHHGSSVGHH-GRVLKRGRKQVTS---CNLFQGNWVFDPSWNPMYDSSSCHFIDAEFDCI  82

Query  288  KYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHAS  467
            KYGRPDKQ+LKYAWKPDSC+LPRFDG + L RWRGKK+MFVGDSLSLNMW SL+CMIHAS
Sbjct  83   KYGRPDKQFLKYAWKPDSCNLPRFDGADFLNRWRGKKIMFVGDSLSLNMWESLSCMIHAS  142

Query  468  VPTSKITY  491
            VP++K T+
Sbjct  143  VPSAKNTF  150



>ref|XP_006410551.1| hypothetical protein EUTSA_v10016785mg [Eutrema salsugineum]
 gb|ESQ52004.1| hypothetical protein EUTSA_v10016785mg [Eutrema salsugineum]
Length=385

 Score =   173 bits (438),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            + GCNLF+G+WV D+S P Y  S CPFID EFDC+K+GRPDKQ+LKY+W+PD+C +PRFD
Sbjct  62   TTGCNLFQGKWVFDASKPFYDSSTCPFIDGEFDCLKFGRPDKQFLKYSWQPDACTIPRFD  121

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            G   LK+WRGK+VMFVGDSLSLNMW SL CMIHASVP +KIT+
Sbjct  122  GEAFLKKWRGKRVMFVGDSLSLNMWESLGCMIHASVPDTKITF  164



>ref|XP_008443074.1| PREDICTED: protein trichome birefringence-like 37 [Cucumis melo]
Length=442

 Score =   174 bits (441),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 113/162 (70%), Gaps = 20/162 (12%)
 Frame = +3

Query  42   KMGVGQKVMWSGVVIIAVLLLVQGHG------------GRAAQNNVSHLLSWGGKEIVSS  185
            +MG G    W G VI+A+ LL+Q                  A+ N   +L  G K+   +
Sbjct  68   EMGFG---FW-GRVILALFLLLQASSLWLPFLQQAEAAAATAKPNKRSMLK-GRKQ---A  119

Query  186  GGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDG  365
             GCNLF+GRWV+D S+PLY  S+CPFID EFDC KYGRPD  YLKY+W+PDSC+LPRFDG
Sbjct  120  NGCNLFQGRWVIDPSFPLYNSSSCPFIDSEFDCQKYGRPDSLYLKYSWRPDSCNLPRFDG  179

Query  366  GELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
             ++LKRW GKK+MFVGDSLSLNMW SL+CM+HASVP +K ++
Sbjct  180  VDVLKRWSGKKIMFVGDSLSLNMWESLSCMLHASVPDAKTSF  221



>ref|XP_002279857.1| PREDICTED: protein trichome birefringence-like 39 [Vitis vinifera]
Length=364

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 97/127 (76%), Gaps = 4/127 (3%)
 Frame = +3

Query  108  QGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCI  287
            Q  G   +  N + L     +E+  +G CN FRG+WV DSSYPLY  S+CPFIDPEFDCI
Sbjct  20   QTEGENFSNANTTRLSR--AREL--AGRCNFFRGKWVYDSSYPLYDSSSCPFIDPEFDCI  75

Query  288  KYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHAS  467
            KYGRPDKQYLKY W+P SC+LPRF+G + L+RWRGK++MFVGDSLS N W SL+CMIH+S
Sbjct  76   KYGRPDKQYLKYRWQPLSCNLPRFNGLDFLERWRGKRIMFVGDSLSFNQWQSLSCMIHSS  135

Query  468  VPTSKIT  488
            VP ++ +
Sbjct  136  VPNARTS  142



>ref|XP_010469399.1| PREDICTED: protein trichome birefringence-like 37 [Camelina sativa]
Length=385

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            + GCNLF+G+WV D SYP Y  S CPFID EFDC+K+ RPDKQ+LKY+W+PDSC +PRFD
Sbjct  62   TSGCNLFQGKWVFDPSYPFYNSSTCPFIDGEFDCLKFDRPDKQFLKYSWQPDSCTVPRFD  121

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            G   L+RWRGK+VMFVGDSLSLNMW SLACMIH+SVP +K T+
Sbjct  122  GTAFLRRWRGKRVMFVGDSLSLNMWESLACMIHSSVPDTKSTF  164



>ref|XP_008439751.1| PREDICTED: protein trichome birefringence-like 38 [Cucumis melo]
Length=362

 Score =   171 bits (433),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 100/137 (73%), Gaps = 6/137 (4%)
 Frame = +3

Query  81   VIIAVLLLVQGHGGRAAQ-NNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNC  257
            +++ VL  +     +A    N+S++ S  GK+      CNLF G+WV D S PLY+ S+C
Sbjct  11   LLLQVLFFISLESAKAEDFYNISNVGS--GKQ---ERTCNLFEGKWVFDPSLPLYESSSC  65

Query  258  PFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMW  437
            PFIDPEF+C KYGRPD+ YLKY WKPD CDLPRFDG ELL+RWRGKK+MFVGDSLSLNMW
Sbjct  66   PFIDPEFNCQKYGRPDRSYLKYTWKPDFCDLPRFDGLELLRRWRGKKIMFVGDSLSLNMW  125

Query  438  NSLACMIHASVPTSKIT  488
             SL CMI AS P +K +
Sbjct  126  QSLTCMIRASAPKTKTS  142



>ref|XP_009411213.1| PREDICTED: protein trichome birefringence-like 38 [Musa acuminata 
subsp. malaccensis]
Length=356

 Score =   171 bits (432),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +3

Query  168  KEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCD  347
            KE  S   CN+FRG WV D SYPLY  S CPF+DPEFDC +YGRPDK YLKY WKPD+C+
Sbjct  29   KEGASGISCNMFRGSWVYDQSYPLYDSSTCPFLDPEFDCQRYGRPDKSYLKYRWKPDACE  88

Query  348  LPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            LPRF+G +LL+RW+GKK+MFVGDS+S+N W SL CM+HA+VP +K TY
Sbjct  89   LPRFNGLDLLRRWKGKKIMFVGDSISVNQWQSLVCMLHAAVPDAKTTY  136



>ref|XP_010540499.1| PREDICTED: protein trichome birefringence-like 38 [Tarenaya hassleriana]
Length=380

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = +3

Query  165  GKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSC  344
            GK    + GCNLF+GRW VD S PLY  S CPFID EF+C+K+GRPDKQ+LKY+W+PDSC
Sbjct  51   GKIQRQTSGCNLFQGRWTVDVSNPLYDSSTCPFIDAEFNCLKFGRPDKQFLKYSWQPDSC  110

Query  345  DLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
             +PRF+G E L+RWRGK+VMFVGDSLSLNMW SL CMIHAS P  K T+
Sbjct  111  AVPRFNGIEFLRRWRGKRVMFVGDSLSLNMWESLGCMIHASAPNVKFTF  159



>ref|XP_009102887.1| PREDICTED: protein trichome birefringence-like 38 [Brassica rapa]
 emb|CDY57453.1| BnaA07g36480D [Brassica napus]
Length=378

 Score =   170 bits (431),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 97/133 (73%), Gaps = 5/133 (4%)
 Frame = +3

Query  93   VLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDP  272
             LL    H    A   +S L    GK+  S  GCNLF+GRWV D+SYP Y   +CPFID 
Sbjct  31   TLLKNTNHRNSTADGGMSSLR---GKKQRS--GCNLFQGRWVFDASYPFYDSFSCPFIDG  85

Query  273  EFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLAC  452
            EFDC+K+GRPDKQ+LKY+W+P+SC +PRFDG   L+R RGK+VMFVGDSLSLNMW SL C
Sbjct  86   EFDCLKFGRPDKQFLKYSWQPESCTIPRFDGAAFLRRLRGKRVMFVGDSLSLNMWESLGC  145

Query  453  MIHASVPTSKITY  491
            MIHASVP +K T+
Sbjct  146  MIHASVPKTKTTF  158



>emb|CDX94643.1| BnaC07g10150D [Brassica napus]
Length=378

 Score =   170 bits (430),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 97/133 (73%), Gaps = 5/133 (4%)
 Frame = +3

Query  93   VLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDP  272
             LL    H    A   +S L    GK+  S  GCNLF+GRWV D+SYP Y   +CPFID 
Sbjct  31   TLLENTNHRNSTADGGMSSLR---GKKQRS--GCNLFQGRWVFDASYPFYDSLSCPFIDG  85

Query  273  EFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLAC  452
            EFDC+K+GRPDKQ+LKY+W+P+SC +PRFDG   L+R RGK+VMFVGDSLSLNMW SL C
Sbjct  86   EFDCLKFGRPDKQFLKYSWQPESCTIPRFDGAAFLRRLRGKRVMFVGDSLSLNMWESLGC  145

Query  453  MIHASVPTSKITY  491
            MIHASVP +K T+
Sbjct  146  MIHASVPKTKTTF  158



>ref|XP_010413780.1| PREDICTED: protein trichome birefringence-like 37 [Camelina sativa]
Length=385

 Score =   170 bits (431),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            + GCNLF+G+WV D SYP Y  S CPFID E DC+K+GRPDKQ+LKY+W+PDSC +PRFD
Sbjct  62   TSGCNLFQGKWVFDPSYPFYNSSTCPFIDGELDCLKFGRPDKQFLKYSWQPDSCTVPRFD  121

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            G   L+RWRGK+VMFVGDSLSLNMW SLACMI++SVP +K T+
Sbjct  122  GEAFLRRWRGKRVMFVGDSLSLNMWESLACMIYSSVPDTKTTF  164



>ref|XP_008456435.1| PREDICTED: protein trichome birefringence-like 37 [Cucumis melo]
Length=165

 Score =   164 bits (414),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = +3

Query  177  VSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPR  356
            +++  CNL++G+WV DSSYPLY  S CPF+DP+F+C KYGRPDK YLKY W+P +C +PR
Sbjct  47   LAARKCNLYQGKWVFDSSYPLYDSSTCPFVDPQFNCQKYGRPDKSYLKYRWQPFACGIPR  106

Query  357  FDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            F+G   L++WRGKK+MFVGDSLSLN W SLACMIHASVP SK ++
Sbjct  107  FNGLNFLEKWRGKKIMFVGDSLSLNQWESLACMIHASVPNSKTSF  151



>ref|XP_009141359.1| PREDICTED: protein trichome birefringence-like 37 [Brassica rapa]
Length=384

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +3

Query  192  CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGE  371
            CNLF+GRWV D+SYP Y  S CPFID EFDC+K+GRPD+Q+LKY+W+PDSC +PRFDG  
Sbjct  64   CNLFQGRWVFDASYPFYDSSTCPFIDGEFDCLKFGRPDRQFLKYSWQPDSCTIPRFDGQA  123

Query  372  LLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
             L +WRGK+VMFVGDSLS NMW SL CMIHASVP +K T+
Sbjct  124  FLNKWRGKRVMFVGDSLSQNMWESLGCMIHASVPDTKTTF  163



>gb|AFK45250.1| unknown [Lotus japonicus]
Length=361

 Score =   168 bits (426),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +3

Query  123  RAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRP  302
            +A+  N  ++    GK+ V +GGCN F G WVVD S  LY  S+ PFID EF+C KYGRP
Sbjct  18   QASAQNFHNVTGLRGKKPVVNGGCNFFIGTWVVDPSNHLYDSSSYPFIDSEFNCQKYGRP  77

Query  303  DKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSK  482
            D Q LKYAWKPDSC LPRFDG + L RW+GKK+MFVGDSLSLNMW SLACMIHASVP +K
Sbjct  78   DTQCLKYAWKPDSCALPRFDGKDFLNRWKGKKIMFVGDSLSLNMWESLACMIHASVPNAK  137

Query  483  ITY  491
             ++
Sbjct  138  TSF  140



>ref|XP_010279090.1| PREDICTED: protein trichome birefringence-like 38 [Nelumbo nucifera]
Length=361

 Score =   168 bits (426),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 97/135 (72%), Gaps = 5/135 (4%)
 Frame = +3

Query  84   IIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPF  263
            +I  L +    G      NVS L    G++   +G CNLF+G WV DSSYPLY  S+CPF
Sbjct  11   VICFLFVFLQQGKTEQFYNVSSL---RGRK--PAGSCNLFQGSWVDDSSYPLYDSSSCPF  65

Query  264  IDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNS  443
            IDPEFDC KYGRPDK YL+Y WKP +C+LPRF+G + L RWRGKK+MFVGDSLSLN W S
Sbjct  66   IDPEFDCQKYGRPDKLYLQYRWKPSNCELPRFNGVDFLTRWRGKKIMFVGDSLSLNQWQS  125

Query  444  LACMIHASVPTSKIT  488
            L C++HASVP +K T
Sbjct  126  LTCLLHASVPNAKTT  140



>ref|XP_003518885.1| PREDICTED: protein YLS7-like [Glycine max]
Length=371

 Score =   168 bits (425),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 103/144 (72%), Gaps = 13/144 (9%)
 Frame = +3

Query  84   IIAVLLLVQGHGGRAAQ-------NNVSHLLSWGGKEIVSSGGCNLFRGRWVVD-SSYPL  239
            +  + L V  H  RAA+       +NV+ L   G KE+     CNLF G WV+D SS+PL
Sbjct  13   LFCLALFVSLHQARAAKSHNNDNNHNVARLK--GRKEL---NRCNLFIGSWVIDPSSHPL  67

Query  240  YQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDS  419
            Y  S+CPFID EFDC KYGRPD+QYLKY+WKPDSC LPRFDG   L +W+GKK+MFVGDS
Sbjct  68   YDSSSCPFIDAEFDCQKYGRPDRQYLKYSWKPDSCALPRFDGVSFLNKWKGKKIMFVGDS  127

Query  420  LSLNMWNSLACMIHASVPTSKITY  491
            LSLNMW SL+CM+HASVP +  ++
Sbjct  128  LSLNMWESLSCMLHASVPNATTSF  151



>ref|XP_011086013.1| PREDICTED: protein trichome birefringence-like 38 [Sesamum indicum]
Length=354

 Score =   167 bits (423),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 98/136 (72%), Gaps = 11/136 (8%)
 Frame = +3

Query  87   IAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSS-YPLYQPSNCPF  263
            I ++ LV   G     +NVS +          +GGCNLFRG+W+ DSS +PLY  S+CPF
Sbjct  11   IFIVFLVCAVGNAELFDNVSDV----------AGGCNLFRGQWLYDSSSHPLYDSSSCPF  60

Query  264  IDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNS  443
            I+ EFDC+KYGRPDK YL Y WKPDSC LPRFDG + L+RW+GKK+MFVGDSLSLN WNS
Sbjct  61   INSEFDCLKYGRPDKLYLNYTWKPDSCTLPRFDGADFLRRWKGKKIMFVGDSLSLNQWNS  120

Query  444  LACMIHASVPTSKITY  491
            L CM+HA+ P +  ++
Sbjct  121  LVCMLHAAAPKANTSF  136



>gb|KHN32337.1| hypothetical protein glysoja_032520 [Glycine soja]
Length=371

 Score =   167 bits (424),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 103/144 (72%), Gaps = 13/144 (9%)
 Frame = +3

Query  84   IIAVLLLVQGHGGRAAQ-------NNVSHLLSWGGKEIVSSGGCNLFRGRWVVD-SSYPL  239
            +  + L V  H  RAA+       +NV+ L   G KE+     CNLF G WV+D SS+PL
Sbjct  13   LFCLALFVSLHQARAAKSHNNDNNHNVARLK--GRKEL---NRCNLFIGSWVIDPSSHPL  67

Query  240  YQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDS  419
            Y  S+CPFID EFDC KYGRPD+QYLKY+WKPDSC LPRFDG   L +W+GKK+MFVGDS
Sbjct  68   YDSSSCPFIDAEFDCQKYGRPDRQYLKYSWKPDSCALPRFDGVSFLNKWKGKKIMFVGDS  127

Query  420  LSLNMWNSLACMIHASVPTSKITY  491
            LSLNMW SL+CM+HASVP +  ++
Sbjct  128  LSLNMWESLSCMLHASVPNATTSF  151



>ref|XP_010277748.1| PREDICTED: protein trichome birefringence-like 39 [Nelumbo nucifera]
Length=361

 Score =   167 bits (424),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 97/135 (72%), Gaps = 5/135 (4%)
 Frame = +3

Query  84   IIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPF  263
            +I  LLL           N S L       I  +GGCNLF+G WV D+SYPLY  S+CPF
Sbjct  11   VICFLLLFLKQARTEQFYNESSL-----SNIKLAGGCNLFQGSWVYDASYPLYDSSSCPF  65

Query  264  IDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNS  443
            IDPEFDC KYGRPD+ YLKY WKP+SC++PRF+G + L+RW+GKK+MFVGDSLS+N W S
Sbjct  66   IDPEFDCEKYGRPDRLYLKYRWKPNSCEVPRFNGLDFLRRWKGKKIMFVGDSLSVNQWQS  125

Query  444  LACMIHASVPTSKIT  488
            L C++H+SVP +K T
Sbjct  126  LTCLLHSSVPNAKYT  140



>emb|CDX79555.1| BnaC03g18910D [Brassica napus]
Length=380

 Score =   167 bits (424),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 93/126 (74%), Gaps = 2/126 (2%)
 Frame = +3

Query  114  HGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKY  293
            H  RAA +    +     K    + GCNLF+GRW+ D+SYP Y  S CPFID EF+C  +
Sbjct  36   HRNRAALDAAGGVGKVALKGRKQTSGCNLFQGRWIFDASYPFYDSSMCPFIDSEFNC--F  93

Query  294  GRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVP  473
            GRPDKQ+LKY+W+PDSC +PRFDG   L +WRGK+VMFVGDSLSLNMW SLACMIH+SVP
Sbjct  94   GRPDKQFLKYSWQPDSCSIPRFDGQAFLNKWRGKRVMFVGDSLSLNMWESLACMIHSSVP  153

Query  474  TSKITY  491
             SK T+
Sbjct  154  DSKTTF  159



>ref|XP_009123178.1| PREDICTED: protein trichome birefringence-like 38 [Brassica rapa]
 emb|CDY34081.1| BnaA09g27070D [Brassica napus]
Length=376

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 97/133 (73%), Gaps = 7/133 (5%)
 Frame = +3

Query  93   VLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDP  272
             LL+   H    AQ  +S L    GK+  S  GCNLF+GRWV D+SYP Y  S+CPFID 
Sbjct  31   TLLVNTDHRNSTAQGGLSSLR---GKKQRS--GCNLFQGRWVFDASYPFYDTSSCPFIDG  85

Query  273  EFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLAC  452
            EF+C K  RPDKQ+LKY+W+P SC +PRFDG   L+RWRGK+VMFVGDSLSLNMW SL C
Sbjct  86   EFNCGK--RPDKQFLKYSWQPASCSIPRFDGAAFLRRWRGKRVMFVGDSLSLNMWESLGC  143

Query  453  MIHASVPTSKITY  491
            MIHASVP +K T+
Sbjct  144  MIHASVPNAKYTF  156



>emb|CDY64767.1| BnaCnng44810D [Brassica napus]
Length=381

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 94/128 (73%), Gaps = 5/128 (4%)
 Frame = +3

Query  123  RAAQNNVSHLLSWGGKEIVSSG-----GCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCI  287
            + +  N++ L + GG +    G     GCNLF+G+WV D+SYPLY  S CPFI+ EFDC+
Sbjct  33   QVSHRNITALAATGGGKATLKGRKQTSGCNLFQGKWVFDASYPLYDSSTCPFINGEFDCL  92

Query  288  KYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHAS  467
            K+GRPDK++L Y+W+PDSC +PRFDG   L +WRGK+VMFVGDSLS NMW SL CMIHAS
Sbjct  93   KFGRPDKKFLNYSWQPDSCTIPRFDGEAFLNQWRGKRVMFVGDSLSENMWESLGCMIHAS  152

Query  468  VPTSKITY  491
            VP    T+
Sbjct  153  VPGITTTF  160



>gb|AES90337.2| trichome birefringence-like protein [Medicago truncatula]
Length=352

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 95/136 (70%), Gaps = 16/136 (12%)
 Frame = +3

Query  84   IIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPF  263
            + ++ LLV  H   A ++N                 CNLF G WV+DSSYPLY  S+CPF
Sbjct  13   LFSIALLVSMHPATAQKSN----------------NCNLFFGSWVIDSSYPLYDSSSCPF  56

Query  264  IDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNS  443
            ++ +FDC ++GRPD QYLKY+WKPDSCDLPRF+G + L RW+ KK+MFVGDSLSLNMW S
Sbjct  57   VEAQFDCQQFGRPDNQYLKYSWKPDSCDLPRFNGEDFLNRWKDKKIMFVGDSLSLNMWES  116

Query  444  LACMIHASVPTSKITY  491
            L+CMIHASVP    ++
Sbjct  117  LSCMIHASVPNVTTSF  132



>ref|XP_009396650.1| PREDICTED: protein trichome birefringence-like 37 [Musa acuminata 
subsp. malaccensis]
Length=373

 Score =   166 bits (419),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  195  NLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGEL  374
            N+FRGRWV D +YPLY  S+CPF++PEFDC +YGR DK YLKY WKPD C+LPRFDG +L
Sbjct  55   NMFRGRWVYDETYPLYDSSSCPFLEPEFDCQRYGRTDKMYLKYRWKPDGCELPRFDGQDL  114

Query  375  LKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            LKRW+GKK+MFVGDS+SLN W SL CM+HA+VP ++ TY
Sbjct  115  LKRWKGKKIMFVGDSISLNQWQSLGCMLHAAVPNARTTY  153



>ref|XP_010911005.1| PREDICTED: protein trichome birefringence-like 39, partial [Elaeis 
guineensis]
Length=167

 Score =   160 bits (404),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 92/126 (73%), Gaps = 3/126 (2%)
 Frame = +3

Query  114  HGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKY  293
            H  +  Q N     + G +++     C+ F+G WV D +YP+Y   +CPF++PEFDC KY
Sbjct  33   HKNKNKQQNNG---TAGRRDLTKRISCDFFQGSWVYDDTYPIYDSLSCPFVEPEFDCQKY  89

Query  294  GRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVP  473
            GRPDK YLKY W+P++CDLPRF+G + L+RWRGKK+MFVGDS+S N W SLACM+HASVP
Sbjct  90   GRPDKLYLKYRWRPNACDLPRFNGLDFLERWRGKKIMFVGDSISQNQWESLACMLHASVP  149

Query  474  TSKITY  491
             ++ T+
Sbjct  150  YARTTF  155



>ref|XP_008811067.1| PREDICTED: protein trichome birefringence-like 37 [Phoenix dactylifera]
Length=183

 Score =   160 bits (404),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 93/136 (68%), Gaps = 1/136 (1%)
 Frame = +3

Query  87   IAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSG-GCNLFRGRWVVDSSYPLYQPSNCPF  263
            +A L  +       A  N  H     G+   S    C+ F+G WV D +YPLY  S+CPF
Sbjct  20   VASLHGITTERFHHANKNKQHNNGTAGRRDQSKRISCDFFQGSWVYDDTYPLYDSSSCPF  79

Query  264  IDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNS  443
            ++PEFDC K+GRPDK YLKY W P++CDLPRF+G + L+RWRGKK+MFVGDS+S N W S
Sbjct  80   VEPEFDCQKHGRPDKLYLKYRWMPNACDLPRFNGKDFLERWRGKKIMFVGDSISQNQWES  139

Query  444  LACMIHASVPTSKITY  491
            LACM+HASVP ++ T+
Sbjct  140  LACMLHASVPYARTTF  155



>emb|CDY30832.1| BnaC05g22080D [Brassica napus]
Length=376

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 96/133 (72%), Gaps = 7/133 (5%)
 Frame = +3

Query  93   VLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDP  272
             LL+   H    A   +S L    GK+  S  GCNLF+GRWV D+SYP Y  S+CPFID 
Sbjct  31   TLLVNTDHRNSTAHGGLSSLR---GKKQRS--GCNLFQGRWVFDASYPFYDTSSCPFIDG  85

Query  273  EFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLAC  452
            EF+C K  RPDKQ+LKY+W+P SC +PRFDG   L+RWRGK+VMFVGDSLSLNMW SL C
Sbjct  86   EFNCGK--RPDKQFLKYSWQPASCSIPRFDGAAFLRRWRGKRVMFVGDSLSLNMWESLGC  143

Query  453  MIHASVPTSKITY  491
            MIHASVP +K T+
Sbjct  144  MIHASVPNAKYTF  156



>ref|XP_007149752.1| hypothetical protein PHAVU_005G096200g [Phaseolus vulgaris]
 gb|ESW21746.1| hypothetical protein PHAVU_005G096200g [Phaseolus vulgaris]
Length=367

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 103/144 (72%), Gaps = 5/144 (3%)
 Frame = +3

Query  63   VMWSGVVIIAVLLLVQGHGGRAAQN-NVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPL  239
            ++W  + ++ +    +        N NVS L S  G+++  +G CNLFRG+WV DSSYPL
Sbjct  9    LLWLCLFVVLIFFQTKAEEFDPYFNANVSSLSS--GRKL--AGRCNLFRGKWVYDSSYPL  64

Query  240  YQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDS  419
            Y PS CPFIDP+F+C KYGRPD QY KY W+P SC LPRF+  + L ++RGKK+MFVGDS
Sbjct  65   YDPSTCPFIDPQFNCQKYGRPDTQYQKYRWQPFSCPLPRFNAFDFLSKYRGKKIMFVGDS  124

Query  420  LSLNMWNSLACMIHASVPTSKITY  491
            LSLN +NSLACMIH+ VP ++ T+
Sbjct  125  LSLNQFNSLACMIHSFVPNTRTTF  148



>ref|XP_002458239.1| hypothetical protein SORBIDRAFT_03g029700 [Sorghum bicolor]
 gb|EES03359.1| hypothetical protein SORBIDRAFT_03g029700 [Sorghum bicolor]
Length=398

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  192  CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGE  371
            CNLF+G WV D + P+Y  + CPF++PEFDC KYGRPDK YLKY W+P SCDLPRFDG E
Sbjct  80   CNLFQGSWVYDDTLPMYDTAGCPFVEPEFDCQKYGRPDKLYLKYRWRPTSCDLPRFDGQE  139

Query  372  LLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
             L+RW+GKK++FVGDS+SLN W SLACM+HA+ P SK+ Y
Sbjct  140  FLRRWKGKKILFVGDSISLNQWESLACMLHAAAPASKVAY  179



>ref|XP_004149371.1| PREDICTED: uncharacterized protein LOC101205461 [Cucumis sativus]
 ref|XP_004163488.1| PREDICTED: uncharacterized protein LOC101226154 [Cucumis sativus]
 gb|KGN47239.1| hypothetical protein Csa_6G227020 [Cucumis sativus]
Length=371

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +3

Query  177  VSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPR  356
            +++G CNL++G+WV DSSYPLY  S CPF+DP+F+C KYGRPDK YLKY W+P +C +PR
Sbjct  47   LAAGNCNLYQGKWVFDSSYPLYDSSTCPFVDPQFNCQKYGRPDKSYLKYRWQPFACGIPR  106

Query  357  FDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            F+G   L++WRGKK+MFVGDSLSLN W SLACMIHASVP S+ ++
Sbjct  107  FNGLNFLEKWRGKKIMFVGDSLSLNQWESLACMIHASVPNSQSSF  151



>emb|CDY17220.1| BnaA05g09680D [Brassica napus]
Length=381

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 95/140 (68%), Gaps = 5/140 (4%)
 Frame = +3

Query  87   IAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSG-----GCNLFRGRWVVDSSYPLYQPS  251
            +A   L      + +  N++ L   GG +    G     GCNLF+G+WV D+S PLY  S
Sbjct  21   VADKALTSDKKQQVSHRNITALAVAGGGKATLKGRKQTSGCNLFQGKWVFDASSPLYDSS  80

Query  252  NCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLN  431
             CPFI+ EFDC+K+GRPDK++L Y+W+PDSC +PRFDG   L +WRGK+VMFVGDSLS N
Sbjct  81   TCPFINGEFDCLKFGRPDKKFLNYSWQPDSCTIPRFDGEAFLNQWRGKRVMFVGDSLSEN  140

Query  432  MWNSLACMIHASVPTSKITY  491
            MW SL CMIHASVP    T+
Sbjct  141  MWESLGCMIHASVPGITTTF  160



>gb|EMS68140.1| hypothetical protein TRIUR3_18149 [Triticum urartu]
Length=197

 Score =   158 bits (399),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +3

Query  186  GGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDG  365
              CN+F+G WV D + P+Y  + CPF++PEFDC KYGRPDK YLKY W+P SC+LPRFDG
Sbjct  68   ASCNMFQGSWVYDEAMPMYDAAGCPFVEPEFDCQKYGRPDKLYLKYRWRPASCELPRFDG  127

Query  366  GELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
             +LL RW+GKKV+FVGDS+SLN W SL CM+HA+ P S+ +Y
Sbjct  128  RDLLSRWKGKKVLFVGDSISLNQWESLVCMLHAAAPASRTSY  169



>ref|XP_007132901.1| hypothetical protein PHAVU_011G1346001g, partial [Phaseolus vulgaris]
 gb|ESW04895.1| hypothetical protein PHAVU_011G1346001g, partial [Phaseolus vulgaris]
Length=216

 Score =   158 bits (399),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 98/140 (70%), Gaps = 9/140 (6%)
 Frame = +3

Query  72   SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPS  251
            S V  + + L +  H  +A ++  + +L+           CNLFRG+WV D+SYPLY PS
Sbjct  4    SLVHALFLTLFLLCHQTKAEESGATRMLA---------AECNLFRGKWVYDASYPLYDPS  54

Query  252  NCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLN  431
            +CPFIDP+F+C K+GR DK Y  Y W P SC LPRF+G E L+R+RGKK+MFVGDSLSLN
Sbjct  55   SCPFIDPQFNCQKHGRSDKLYQNYRWTPFSCPLPRFNGLEFLERYRGKKIMFVGDSLSLN  114

Query  432  MWNSLACMIHASVPTSKITY  491
             +NSLACM+HA VP S+ T+
Sbjct  115  QFNSLACMVHAWVPKSRSTF  134



>ref|XP_008783904.1| PREDICTED: protein trichome birefringence-like 38 [Phoenix dactylifera]
Length=373

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 94/137 (69%), Gaps = 4/137 (3%)
 Frame = +3

Query  93   VLLLVQGHG----GRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCP  260
             +L+   HG    G   +N   H  S  GKE  S   CNLF+G WV D+SYPLY  S CP
Sbjct  17   AILVASLHGAFPEGYHHENEQLHHNSTDGKEGTSDISCNLFQGSWVYDNSYPLYDSSRCP  76

Query  261  FIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWN  440
            FIDPEFDC  YGRPDK YLKY WKP+ C+LPRFD  + L RW+GK++MFVGDS+SLN W 
Sbjct  77   FIDPEFDCQNYGRPDKMYLKYRWKPNGCELPRFDAKDFLWRWKGKRIMFVGDSISLNQWV  136

Query  441  SLACMIHASVPTSKITY  491
            SL CM+ A+VP ++ ++
Sbjct  137  SLNCMLLAAVPNARTSF  153



>emb|CDX84658.1| BnaA03g15720D [Brassica napus]
Length=380

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 84/103 (82%), Gaps = 2/103 (2%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            + GCNLF+GRW+ D+SY  Y  S CPFID EF+C  +GRPDKQ+L Y+W+PDSC +PRFD
Sbjct  59   TSGCNLFQGRWIFDASYHFYDSSMCPFIDSEFNC--FGRPDKQFLNYSWQPDSCSIPRFD  116

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            G   L +WRGK+VMFVGDSLSLNMW SLACMIH+SVP SK T+
Sbjct  117  GQAFLNKWRGKRVMFVGDSLSLNMWESLACMIHSSVPDSKTTF  159



>ref|XP_009132974.1| PREDICTED: protein trichome birefringence-like 37 [Brassica rapa]
Length=381

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 84/103 (82%), Gaps = 2/103 (2%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            + GCNLF+GRW+ D+SY  Y  S CPFID EF+C  +GRPDKQ+L Y+W+PDSC +PRFD
Sbjct  60   TSGCNLFQGRWIFDASYHFYDSSMCPFIDSEFNC--FGRPDKQFLNYSWQPDSCSIPRFD  117

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            G   L +WRGK+VMFVGDSLSLNMW SLACMIH+SVP SK T+
Sbjct  118  GQAFLNKWRGKRVMFVGDSLSLNMWESLACMIHSSVPDSKTTF  160



>ref|XP_009394133.1| PREDICTED: protein trichome birefringence-like 38 [Musa acuminata 
subsp. malaccensis]
Length=373

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 100/153 (65%), Gaps = 6/153 (4%)
 Frame = +3

Query  51   VGQKVMWSGVVIIAVL--LLVQGHGGRAAQNNVSHLLSWGG----KEIVSSGGCNLFRGR  212
            +G K  WS  +  A+L  L+   HG         H    G     +E  +   CN+F+G 
Sbjct  1    MGSKTQWSFGLRCALLSVLIASLHGMTTESFRHKHHRGNGTSARRRERANGISCNMFQGS  60

Query  213  WVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRG  392
            WV D SYPLY  S CPF++ EFDC +YGRPDK+YLKY WKPD+C+LPRF+G ++L R +G
Sbjct  61   WVYDDSYPLYDSSTCPFLEAEFDCQRYGRPDKEYLKYRWKPDACELPRFNGQDMLGRLKG  120

Query  393  KKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            KK+MFVGDS+SLN W SL CM+ A+VP +K TY
Sbjct  121  KKIMFVGDSISLNQWESLGCMLRAAVPNAKTTY  153



>ref|XP_010272740.1| PREDICTED: protein trichome birefringence-like 38 [Nelumbo nucifera]
Length=369

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 101/142 (71%), Gaps = 6/142 (4%)
 Frame = +3

Query  63   VMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLY  242
            +++S V  + +L+L       A + ++ ++      + + S GC+LF+G WV D SYPLY
Sbjct  6    LIYSSVFAVVLLILSYAEQTSAEREHIDNV------DRIRSAGCDLFQGSWVFDDSYPLY  59

Query  243  QPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSL  422
               +CPFID +FDC++ GR DKQ+LKY WKP++CDLPRF+G   L+R++GKK+MFVGDSL
Sbjct  60   NSLDCPFIDKQFDCLRNGRADKQFLKYRWKPNACDLPRFNGEYFLRRFKGKKIMFVGDSL  119

Query  423  SLNMWNSLACMIHASVPTSKIT  488
            SLN W SL CM+HA+VP +K T
Sbjct  120  SLNQWQSLICMLHAAVPQAKYT  141



>ref|XP_004969334.1| PREDICTED: uncharacterized protein LOC101766252 [Setaria italica]
Length=392

 Score =   160 bits (406),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +3

Query  186  GGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDG  365
              CNLF+G WV D S P+Y  + CPF++PEFDC KYGRPDK YLKY W+P SC+LPRF+G
Sbjct  72   AACNLFQGSWVYDDSLPMYDTAGCPFVEPEFDCQKYGRPDKMYLKYRWRPASCELPRFNG  131

Query  366  GELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
             + L RW+GKK++FVGDSLSLN W SLACM+HA+ P SK+ Y
Sbjct  132  QDFLSRWKGKKILFVGDSLSLNQWESLACMLHAAAPASKVAY  173



>emb|CDY17219.1| BnaA05g09690D [Brassica napus]
Length=382

 Score =   160 bits (404),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 82/96 (85%), Gaps = 1/96 (1%)
 Frame = +3

Query  189  GCNLFRGRWVVD-SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDG  365
            GCNLF+G+WV D SSYPLY  S CPFID +FDC+K+GRPDK++L Y+W+PDSC +PRFDG
Sbjct  60   GCNLFQGKWVFDASSYPLYDSSTCPFIDGQFDCLKFGRPDKKFLNYSWQPDSCTIPRFDG  119

Query  366  GELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVP  473
               L +WRGK+VMFVGDSLS+NMW SL CMIHASVP
Sbjct  120  AAFLNQWRGKRVMFVGDSLSVNMWESLGCMIHASVP  155



>ref|XP_004487169.1| PREDICTED: uncharacterized protein LOC101503983 [Cicer arietinum]
Length=363

 Score =   159 bits (403),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 96/138 (70%), Gaps = 2/138 (1%)
 Frame = +3

Query  78   VVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNC  257
             +   + L+   H  +A +   +   S   +++  +G CN FRG+WV D SYPLY PS+C
Sbjct  7    TLFFTLFLVFSSHQTKAEEFKFNKTTSSNERKV--AGRCNWFRGKWVYDPSYPLYDPSSC  64

Query  258  PFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMW  437
            PFIDP+F+C KYGRPD QY KY W+P SC LPRF   + L ++RGKK+MFVGDSLSLN +
Sbjct  65   PFIDPQFNCQKYGRPDTQYQKYRWQPLSCSLPRFSALDFLAKYRGKKIMFVGDSLSLNQF  124

Query  438  NSLACMIHASVPTSKITY  491
            NSLACMIH+ VP ++ ++
Sbjct  125  NSLACMIHSWVPKTRTSF  142



>ref|XP_009591836.1| PREDICTED: protein trichome birefringence-like 39 [Nicotiana 
tomentosiformis]
Length=360

 Score =   159 bits (402),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            S GCN+F+G+WV DSSYPLY  S+CPFID EF+C KY RPDK YLKY W+P SC+LPRF+
Sbjct  38   SSGCNIFKGKWVFDSSYPLYDFSSCPFIDNEFNCQKYNRPDKSYLKYRWQPFSCNLPRFN  97

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSK  482
            G   L+++RGK +MFVGDSLSLNMW SLACMIH+SVP +K
Sbjct  98   GLVFLEKYRGKNIMFVGDSLSLNMWESLACMIHSSVPNAK  137



>gb|ACJ84951.1| unknown [Medicago truncatula]
Length=225

 Score =   155 bits (392),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            +G CNLFRG+WV D+SYPLY PS CPFIDP+F+C K+GR DK Y KY W P SC++PRF+
Sbjct  44   AGTCNLFRGKWVYDASYPLYDPSTCPFIDPQFNCQKHGRKDKLYQKYRWMPFSCNMPRFN  103

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            G   LK  +GKK+MFVGDSLSLN +NSLACMIHA+VP S+ T+
Sbjct  104  GLNFLKGNKGKKIMFVGDSLSLNQFNSLACMIHAAVPNSRSTF  146



>ref|XP_003540392.1| PREDICTED: protein YLS7 isoform 1 [Glycine max]
 gb|KHN27931.1| hypothetical protein glysoja_007663 [Glycine soja]
Length=375

 Score =   159 bits (403),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = +3

Query  138  NVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYL  317
            N  ++ S+     + +G CNLFRG+WV D SYPLY PS CPFIDP+F+C KYGRPDKQY 
Sbjct  39   NGKNVSSFSSGRKLGAGRCNLFRGKWVYDPSYPLYDPSTCPFIDPQFNCQKYGRPDKQYQ  98

Query  318  KYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            KY W+P SC LPRF+  + L ++RGKK+MFVGDSLSLN +NSLACMIH+ VP ++ ++
Sbjct  99   KYRWQPFSCPLPRFNAFDFLAKYRGKKIMFVGDSLSLNQFNSLACMIHSWVPNTRTSF  156



>ref|XP_010099368.1| hypothetical protein L484_004794 [Morus notabilis]
 gb|EXB78093.1| hypothetical protein L484_004794 [Morus notabilis]
Length=370

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            +G CN FRG W  D+SYPLY  S CPF+DPEF+C KYGRPDK YLKY W+P SC LPRF+
Sbjct  48   AGKCNWFRGTWKYDASYPLYDSSTCPFVDPEFNCQKYGRPDKSYLKYRWQPLSCSLPRFN  107

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            G   LK+WRGKK+MFVGDSLSLN W SL CMIHA VP SK T
Sbjct  108  GLYFLKKWRGKKIMFVGDSLSLNQWQSLTCMIHAWVPKSKTT  149



>gb|AAC63839.1| unknown protein [Arabidopsis thaliana]
Length=164

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 89/131 (68%), Gaps = 1/131 (1%)
 Frame = +3

Query  96   LLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPE  275
            L+L     G  AQ+   H L      ++S G CNL RG+WV DSSYPLY   +CPFID E
Sbjct  14   LILFSSFPGLLAQSQ-QHFLGQNNTSLLSGGRCNLARGKWVYDSSYPLYSAFSCPFIDSE  72

Query  276  FDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACM  455
            F+C K GRPD  Y  + W+P SC LPRFDG   ++R RGKK+M VGDSLSLNM+ SLAC+
Sbjct  73   FNCQKAGRPDTNYQHFRWQPFSCPLPRFDGANFMRRMRGKKIMMVGDSLSLNMFESLACL  132

Query  456  IHASVPTSKIT  488
            +HAS+P +K +
Sbjct  133  LHASLPNAKYS  143



>gb|KHN36688.1| hypothetical protein glysoja_001419 [Glycine soja]
Length=369

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            +G CNLFRG+WV D SYPLY PS CPFIDP+F+C KYGRPDKQY KY W+P SC LPRF+
Sbjct  48   AGRCNLFRGKWVYDPSYPLYDPSTCPFIDPQFNCQKYGRPDKQYQKYRWQPFSCPLPRFN  107

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
              + L ++RGKK+MFVGDSLSLN +NSLACMIH+ VP ++ ++
Sbjct  108  AFDFLAKYRGKKIMFVGDSLSLNQFNSLACMIHSWVPNTRTSF  150



>ref|XP_010915618.1| PREDICTED: protein trichome birefringence-like 39 [Elaeis guineensis]
Length=373

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = +3

Query  120  GRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGR  299
            G   +N   H  S  GKE  S   CN F+G WV D+SYPLY    CPFIDPEFDC KYGR
Sbjct  30   GYHHENEQLHHNSTDGKEGTSDIRCNWFQGSWVYDNSYPLYDSWRCPFIDPEFDCQKYGR  89

Query  300  PDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTS  479
            PDK YLKY WKP+ C+LPRFDG + L RWRGKK+MFVGDS+SLN W SL CM+ A+VP +
Sbjct  90   PDKVYLKYRWKPNGCELPRFDGKDFLWRWRGKKIMFVGDSISLNQWVSLNCMLLAAVPDT  149

Query  480  KITY  491
            + ++
Sbjct  150  RSSF  153



>ref|XP_010912702.1| PREDICTED: protein trichome birefringence-like 38 [Elaeis guineensis]
Length=375

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +3

Query  162  GGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDS  341
            G +++     C+ F+G WV D +YP+Y   +CPF++PEFDC KYGRPDK YLKY W+P++
Sbjct  46   GRRDLTKRISCDFFQGSWVYDDTYPIYDSLSCPFVEPEFDCQKYGRPDKLYLKYRWRPNA  105

Query  342  CDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            CDLPRF+G + L+RWRGKK+MFVGDS+S N W SLACM+HASVP ++ T+
Sbjct  106  CDLPRFNGLDFLERWRGKKIMFVGDSISQNQWESLACMLHASVPYARTTF  155



>ref|XP_003543309.1| PREDICTED: protein YLS7 [Glycine max]
Length=369

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            +G CNLFRG+WV D SYPLY PS CPFIDP+F+C KYGRPDKQY KY W+P SC LPRF+
Sbjct  48   AGRCNLFRGKWVYDPSYPLYDPSTCPFIDPQFNCQKYGRPDKQYQKYRWQPFSCPLPRFN  107

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
              + L ++RGKK+MFVGDSLSLN +NSLACMIH+ VP ++ ++
Sbjct  108  AFDFLAKYRGKKIMFVGDSLSLNQFNSLACMIHSWVPNTRTSF  150



>ref|XP_003607566.1| hypothetical protein MTR_4g079700 [Medicago truncatula]
Length=270

 Score =   155 bits (393),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            +G CNLFRG+WV D+SYPLY PS CPFIDP+F+C K+GR DK Y KY W P SC++PRF+
Sbjct  44   AGTCNLFRGKWVYDASYPLYDPSTCPFIDPQFNCQKHGRKDKLYQKYRWMPFSCNMPRFN  103

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            G   LK  +GKK+MFVGDSLSLN +NSLACMIHA+VP S+ T+
Sbjct  104  GLNFLKGNKGKKIMFVGDSLSLNQFNSLACMIHAAVPNSRSTF  146



>ref|XP_009784314.1| PREDICTED: protein trichome birefringence-like 39 [Nicotiana 
sylvestris]
Length=360

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            S GCN+F+G+WV DSSYPLY  S+CPFID EF+C KY RPDK YLKY W+P SC+LPRF+
Sbjct  38   SSGCNIFKGKWVFDSSYPLYDFSSCPFIDSEFNCQKYNRPDKSYLKYRWQPFSCNLPRFN  97

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSK  482
            G   L+++RGK +MFVGDSLSLNMW SLACMIH+SVP  K
Sbjct  98   GLVFLEKYRGKNIMFVGDSLSLNMWESLACMIHSSVPNVK  137



>gb|ABA29157.1| unknown [Pisum sativum]
Length=371

 Score =   157 bits (398),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            +G CNLFRG+WV D+SYPLY PS+CPFIDP+F+C KYGRPD QY KY W+P +C LPRF+
Sbjct  50   AGTCNLFRGKWVYDASYPLYDPSSCPFIDPQFNCQKYGRPDTQYQKYRWQPLTCSLPRFN  109

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
              + L ++RGKK+MFVGDSLSLN +NSLACMIH+ VP ++ ++
Sbjct  110  ALDFLAKYRGKKIMFVGDSLSLNQFNSLACMIHSWVPKTRTSF  152



>ref|XP_010273483.1| PREDICTED: protein trichome birefringence-like 38 [Nelumbo nucifera]
Length=365

 Score =   157 bits (397),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 94/135 (70%), Gaps = 9/135 (7%)
 Frame = +3

Query  78   VVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNC  257
            V+I A L      G     +NV         E ++S GC+ + G WV+D S+PLY  S+C
Sbjct  19   VLISAGLRQAMAEGEEDIGHNV---------EGLTSTGCDFYHGSWVLDDSFPLYDTSSC  69

Query  258  PFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMW  437
            PFID EFDC K GRPDKQYLKY WKP +CDLPRF+G + ++R++GKK+MFVGDSLSLN W
Sbjct  70   PFIDKEFDCQKNGRPDKQYLKYRWKPTACDLPRFNGEDFIRRFKGKKIMFVGDSLSLNQW  129

Query  438  NSLACMIHASVPTSK  482
             SL CM+HA+VP +K
Sbjct  130  QSLICMLHAAVPQAK  144



>gb|ABA29158.1| unknown [Pisum sativum]
Length=371

 Score =   157 bits (398),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            +G CNLFRG+WV D+SYPLY PS+CPFIDP+F+C KYGRPD QY KY W+P +C LPRF+
Sbjct  50   AGTCNLFRGKWVYDASYPLYDPSSCPFIDPQFNCQKYGRPDTQYQKYRWQPLTCSLPRFN  109

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
              + L ++RGKK+MFVGDSLSLN +NSLACMIH+ VP ++ ++
Sbjct  110  ALDFLAKYRGKKIMFVGDSLSLNQFNSLACMIHSWVPKTRTSF  152



>ref|XP_009143811.1| PREDICTED: protein trichome birefringence-like 37 [Brassica rapa]
Length=382

 Score =   157 bits (398),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 81/96 (84%), Gaps = 1/96 (1%)
 Frame = +3

Query  189  GCNLFRGRWVVD-SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDG  365
            GC LF+G+WV D SSYPLY  S CPFID +FDC+K+GRPDK++L Y+W+PDSC +PRFDG
Sbjct  60   GCKLFQGKWVFDASSYPLYDSSTCPFIDGQFDCLKFGRPDKKFLNYSWQPDSCTIPRFDG  119

Query  366  GELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVP  473
               L +WRGK+VMFVGDSLS+NMW SL CMIHASVP
Sbjct  120  AAFLNQWRGKRVMFVGDSLSVNMWESLGCMIHASVP  155



>emb|CDM83556.1| unnamed protein product [Triticum aestivum]
Length=388

 Score =   157 bits (398),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  192  CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGE  371
            CN+F+G WV D + P+Y  + CPF++PEFDC KYGRPDK YLKY W+P SC+LPRFDG +
Sbjct  70   CNMFQGSWVYDDALPMYDAAGCPFVEPEFDCQKYGRPDKLYLKYRWRPASCELPRFDGRD  129

Query  372  LLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            LL RW+GKKV+FVGDS+SLN W SL CM+HA+ P+S+ +Y
Sbjct  130  LLSRWKGKKVLFVGDSISLNQWESLVCMLHAAAPSSRTSY  169



>gb|KCW89619.1| hypothetical protein EUGRSUZ_A01902 [Eucalyptus grandis]
Length=365

 Score =   157 bits (396),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = +3

Query  144  SHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKY  323
            S + ++ G+++++ GGCN F+G+WV D+SYPLY  S+CP+I+P+ DCIKYGRPD++YLKY
Sbjct  29   SLIANFSGRKLLA-GGCNFFQGKWVYDASYPLYDSSSCPYINPQNDCIKYGRPDREYLKY  87

Query  324  AWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
             W+P SC+LPRF+   LL  WRGKK++FVGDSLS+N+W SL+C+IHA +P +K +
Sbjct  88   RWQPSSCNLPRFNAVNLLNGWRGKKILFVGDSLSVNIWESLSCLIHAQLPNAKTS  142



>ref|XP_010272738.1| PREDICTED: protein trichome birefringence-like 41 isoform X2 
[Nelumbo nucifera]
Length=357

 Score =   157 bits (396),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 98/139 (71%), Gaps = 8/139 (6%)
 Frame = +3

Query  75   GVVIIAVLLLVQGHGGRAAQNNVSHLLSWG-GKEIVSSGGCNLFRGRWVVDSSYPLYQPS  251
             ++++  L L+Q   G  + NNVS    WG GK+   S GC+LF GRWV D +YPLY PS
Sbjct  13   AILVLNFLFLLQRVHGEHS-NNVSR---WGQGKQ---SWGCDLFDGRWVYDEAYPLYNPS  65

Query  252  NCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLN  431
            +CP I+  FDC K GRPDK YLKY WKP+ CDLPRF+G + L R RGK++MFVGDSLSLN
Sbjct  66   SCPSIESIFDCQKNGRPDKLYLKYRWKPNGCDLPRFNGHDFLWRLRGKRIMFVGDSLSLN  125

Query  432  MWNSLACMIHASVPTSKIT  488
             W SL CM+H S+P SK T
Sbjct  126  QWQSLTCMLHTSLPKSKYT  144



>ref|XP_010070349.1| PREDICTED: protein trichome birefringence-like 40 [Eucalyptus 
grandis]
Length=365

 Score =   157 bits (396),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = +3

Query  144  SHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKY  323
            S + ++ G+++++ GGCN F+G+WV D+SYPLY  S+CP+I+P+ DCIKYGRPD++YLKY
Sbjct  29   SLIANFSGRKLLA-GGCNFFQGKWVYDASYPLYDSSSCPYINPQNDCIKYGRPDREYLKY  87

Query  324  AWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
             W+P SC+LPRF+   LL  WRGKK++FVGDSLS+N+W SL+C+IHA +P +K +
Sbjct  88   RWQPSSCNLPRFNAVNLLNGWRGKKILFVGDSLSVNIWESLSCLIHAQLPNAKTS  142



>ref|XP_010052537.1| PREDICTED: protein trichome birefringence-like 39 [Eucalyptus 
grandis]
 gb|KCW89616.1| hypothetical protein EUGRSUZ_A01900 [Eucalyptus grandis]
 gb|KCW89617.1| hypothetical protein EUGRSUZ_A01900 [Eucalyptus grandis]
Length=365

 Score =   157 bits (396),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            +G CN F G+WV D+SYPLY  S+CPFIDP+F+CIKYGR D+QYLKY W+P SC+LPRF 
Sbjct  42   AGRCNFFHGKWVYDASYPLYDSSSCPFIDPQFNCIKYGRRDRQYLKYRWQPFSCNLPRFS  101

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
                L +WRGKK+MFVGDSLSLN+W SL+CMIHA +P ++  
Sbjct  102  AWNFLNKWRGKKIMFVGDSLSLNIWQSLSCMIHAQMPNARTV  143



>ref|XP_006442366.1| hypothetical protein CICLE_v10024135mg [Citrus clementina]
 gb|ESR55606.1| hypothetical protein CICLE_v10024135mg [Citrus clementina]
Length=379

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 87/112 (78%), Gaps = 3/112 (3%)
 Frame = +3

Query  153  LSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWK  332
            LS G  ++   GGC+ F+G WV D +YPLY  S CPFI+ EFDC+K GRPDK YLKY WK
Sbjct  43   LSLGNSKV---GGCDFFQGSWVRDDTYPLYDTSICPFIEREFDCLKNGRPDKLYLKYKWK  99

Query  333  PDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            P +C+LPRFDG + L+R++GKK++FVGDSLSLN W SLACM+HASVP +  T
Sbjct  100  PTACELPRFDGRDFLRRYKGKKILFVGDSLSLNQWQSLACMLHASVPQTNFT  151



>ref|XP_010272737.1| PREDICTED: protein trichome birefringence-like 41 isoform X1 
[Nelumbo nucifera]
Length=371

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 98/139 (71%), Gaps = 8/139 (6%)
 Frame = +3

Query  75   GVVIIAVLLLVQGHGGRAAQNNVSHLLSWG-GKEIVSSGGCNLFRGRWVVDSSYPLYQPS  251
             ++++  L L+Q   G  + NNVS    WG GK+   S GC+LF GRWV D +YPLY PS
Sbjct  13   AILVLNFLFLLQRVHGEHS-NNVSR---WGQGKQ---SWGCDLFDGRWVYDEAYPLYNPS  65

Query  252  NCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLN  431
            +CP I+  FDC K GRPDK YLKY WKP+ CDLPRF+G + L R RGK++MFVGDSLSLN
Sbjct  66   SCPSIESIFDCQKNGRPDKLYLKYRWKPNGCDLPRFNGHDFLWRLRGKRIMFVGDSLSLN  125

Query  432  MWNSLACMIHASVPTSKIT  488
             W SL CM+H S+P SK T
Sbjct  126  QWQSLTCMLHTSLPKSKYT  144



>ref|XP_003608110.1| hypothetical protein MTR_4g087730 [Medicago truncatula]
 gb|AES90307.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=364

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 95/136 (70%), Gaps = 4/136 (3%)
 Frame = +3

Query  84   IIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPF  263
              ++ LLV  H   A +   SH +S   K       CNLF G WV+ SSY LY  S+CPF
Sbjct  13   FFSLALLVSMHLVGATK---SHKVS-PSKRRKELNNCNLFSGSWVIGSSYTLYDSSSCPF  68

Query  264  IDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNS  443
            ++ +FDC K+GR D QYLKY+WKPDSC LPRF+G + L RW+GKK+MFVGDSLSLNMW S
Sbjct  69   LEAQFDCQKFGRLDNQYLKYSWKPDSCALPRFNGEDFLNRWKGKKIMFVGDSLSLNMWES  128

Query  444  LACMIHASVPTSKITY  491
            L+CMIHASVP +  ++
Sbjct  129  LSCMIHASVPNATTSF  144



>ref|XP_010915621.1| PREDICTED: protein trichome birefringence-like 38 isoform X2 
[Elaeis guineensis]
Length=273

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 88/116 (76%), Gaps = 9/116 (8%)
 Frame = +3

Query  156  SWGGKEIVSSGG-----CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLK  320
            SWG    V++GG     C+LF GRW  D SYPLY  ++CPFI  EFDC++YGRPDK YLK
Sbjct  25   SWG----VTAGGLRPPACDLFDGRWAYDESYPLYDSASCPFIRREFDCLRYGRPDKMYLK  80

Query  321  YAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            Y W P+ CDLPRFDG +LL+RWRGKK+MFVGDSLSLN ++S  C++HA+VP  + +
Sbjct  81   YRWNPNGCDLPRFDGRDLLERWRGKKIMFVGDSLSLNQFDSFLCLLHAAVPDGRTS  136



>ref|XP_010272739.1| PREDICTED: protein trichome birefringence-like 38 [Nelumbo nucifera]
Length=354

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  177  VSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPR  356
            ++S GC+L++G WV+D S+PLY  ++CPFID EF+C KYGRPDKQYLKY WKP  CDLPR
Sbjct  32   LASSGCDLYQGSWVLDDSFPLYDTASCPFIDSEFNCQKYGRPDKQYLKYRWKPTGCDLPR  91

Query  357  FDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            F+  + L+R++GKK+MFVGDSLSLN W SL CM+HA+VP +  T
Sbjct  92   FNAVDFLRRFKGKKIMFVGDSLSLNQWQSLICMLHAAVPQANYT  135



>ref|XP_011100405.1| PREDICTED: protein trichome birefringence-like 39 [Sesamum indicum]
Length=394

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 95/125 (76%), Gaps = 4/125 (3%)
 Frame = +3

Query  120  GRAAQNNVSHL--LSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKY  293
              AA+    HL   ++  +++  +G CN+FRG+WV D+SYPLY  S CPFID EF+C+KY
Sbjct  52   ATAAEEAERHLNGTTYAARKL--AGSCNVFRGKWVYDASYPLYDFSTCPFIDDEFNCLKY  109

Query  294  GRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVP  473
             RPD+ YLKY W+P SC+LPRF+G   L+++RGK +MFVGDSLSLNMW SL+CMIH+SVP
Sbjct  110  KRPDQMYLKYRWQPFSCNLPRFNGVAFLEKFRGKNIMFVGDSLSLNMWESLSCMIHSSVP  169

Query  474  TSKIT  488
             ++ +
Sbjct  170  NARTS  174



>ref|XP_006477896.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=379

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +3

Query  186  GGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDG  365
            GGC+ F+G WV D +YPLY  S CPFI+ EFDC+K GRPDK YLKY WKP +C+LPRFDG
Sbjct  51   GGCDFFQGSWVRDDAYPLYDTSICPFIEREFDCLKNGRPDKLYLKYKWKPTACELPRFDG  110

Query  366  GELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
             + L+R++GKK++FVGDSLSLN W SLACM+HASVP +  T
Sbjct  111  RDFLRRYKGKKILFVGDSLSLNQWQSLACMLHASVPQTNFT  151



>ref|XP_004303168.1| PREDICTED: protein trichome birefringence-like 39 [Fragaria vesca 
subsp. vesca]
Length=377

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = +3

Query  177  VSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPR  356
            ++ G CN FRG WV D+SY  +  SNCPFIDPEF+C KYGRPDK YLKY W+P SC LPR
Sbjct  52   LAGGKCNWFRGSWVYDASYNPHYDSNCPFIDPEFNCQKYGRPDKSYLKYRWQPSSCSLPR  111

Query  357  FDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            F+G  LL++WRGKK+MFVGDSLSLN W SL+CMIH+ VP SK  +
Sbjct  112  FNGLNLLQQWRGKKIMFVGDSLSLNQWQSLSCMIHSWVPNSKYIF  156



>ref|XP_010517784.1| PREDICTED: protein trichome birefringence-like 39 isoform X1 
[Camelina sativa]
 ref|XP_010517785.1| PREDICTED: protein trichome birefringence-like 39 isoform X2 
[Camelina sativa]
Length=369

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 84/113 (74%), Gaps = 4/113 (4%)
 Frame = +3

Query  162  GGKEIV----SSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAW  329
             G+E+V    +SG CN FRG WV D  YPLY P  CPFIDP+F+C KYGRPD  YLKY W
Sbjct  35   NGEEVVRRELASGRCNWFRGNWVYDVKYPLYDPYKCPFIDPQFNCKKYGRPDNAYLKYRW  94

Query  330  KPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            +P SC LPRF+G   L+R RGKK+MFVGDSLS NMW SL+C+IHA VP ++ T
Sbjct  95   QPSSCSLPRFNGLYFLRRMRGKKIMFVGDSLSTNMWQSLSCLIHAWVPNTRYT  147



>ref|XP_010506087.1| PREDICTED: protein trichome birefringence-like 39 isoform X1 
[Camelina sativa]
Length=368

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +3

Query  168  KEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCD  347
            +  ++SG CN FRG WV D  YPLY P  CPFIDP+F+C KYGRPD  YLKY W+P SC 
Sbjct  40   RRELASGRCNWFRGNWVYDVKYPLYDPYKCPFIDPQFNCKKYGRPDNAYLKYRWQPSSCS  99

Query  348  LPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            LPRF+G   L+R RGKK+MFVGDSLS NMW SLAC+IHA VP ++ T
Sbjct  100  LPRFNGLYFLRRMRGKKIMFVGDSLSTNMWQSLACLIHAWVPNTRYT  146



>ref|XP_010552884.1| PREDICTED: protein trichome birefringence-like 39 isoform X4 
[Tarenaya hassleriana]
Length=359

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 84/106 (79%), Gaps = 2/106 (2%)
 Frame = +3

Query  162  GGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDS  341
            GG+++  +G CN FRGRWV D+ YPLY P  CPF+DP+F+C KYGRPD QYLKY W+P S
Sbjct  48   GGRKL--AGKCNWFRGRWVYDAKYPLYDPYKCPFVDPQFNCKKYGRPDSQYLKYRWQPSS  105

Query  342  CDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTS  479
            C LPRF+G   L+R RGKK+MFVGDSLS NMW SLAC+I++ VP S
Sbjct  106  CSLPRFNGLYFLRRMRGKKIMFVGDSLSSNMWQSLACLIYSWVPNS  151



>ref|XP_010552824.1| PREDICTED: protein trichome birefringence-like 39 isoform X3 
[Tarenaya hassleriana]
Length=362

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 84/106 (79%), Gaps = 2/106 (2%)
 Frame = +3

Query  162  GGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDS  341
            GG+++  +G CN FRGRWV D+ YPLY P  CPF+DP+F+C KYGRPD QYLKY W+P S
Sbjct  48   GGRKL--AGKCNWFRGRWVYDAKYPLYDPYKCPFVDPQFNCKKYGRPDSQYLKYRWQPSS  105

Query  342  CDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTS  479
            C LPRF+G   L+R RGKK+MFVGDSLS NMW SLAC+I++ VP S
Sbjct  106  CSLPRFNGLYFLRRMRGKKIMFVGDSLSSNMWQSLACLIYSWVPNS  151



>emb|CDY55393.1| BnaA05g34290D [Brassica napus]
Length=367

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 90/131 (69%), Gaps = 5/131 (4%)
 Frame = +3

Query  96   LLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPE  275
            L  V  +   ++ N V      GG+  ++S  CN FRG WV D +YPLY P  CPFIDP+
Sbjct  21   LSTVSAYTNTSSNNGVE-----GGRRELASWRCNWFRGSWVYDVTYPLYDPYKCPFIDPQ  75

Query  276  FDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACM  455
            F+C KYGRPD  YLKY W+P SC LPRF+G   L++ RGKK+MFVGDSLS NMW SLAC+
Sbjct  76   FNCKKYGRPDNLYLKYRWQPSSCSLPRFNGLYFLRKMRGKKIMFVGDSLSTNMWQSLACL  135

Query  456  IHASVPTSKIT  488
            IHA VP ++ T
Sbjct  136  IHAWVPNARYT  146



>gb|EPS71829.1| hypothetical protein M569_02929 [Genlisea aurea]
Length=257

 Score =   152 bits (385),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 91/132 (69%), Gaps = 12/132 (9%)
 Frame = +3

Query  81   VIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCP  260
            VI+ + LL+  H   A   N + +            GC++F G+WV DSSYPLY PS CP
Sbjct  7    VIVFIPLLLSIHVAAAELFNATAV------------GCDVFEGKWVYDSSYPLYDPSGCP  54

Query  261  FIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWN  440
            +ID  F+C+KY RPD+ YL+Y W+P SCDLPRFDG + L+R RGK++MFVGDSLSLNMW 
Sbjct  55   YIDEGFNCLKYNRPDRDYLRYRWQPSSCDLPRFDGLDFLERSRGKRIMFVGDSLSLNMWQ  114

Query  441  SLACMIHASVPT  476
            SL C+IH++ P 
Sbjct  115  SLICLIHSTAPA  126



>ref|NP_001043736.1| Os01g0652100 [Oryza sativa Japonica Group]
 dbj|BAB86568.1| lustrin A-like [Oryza sativa Japonica Group]
 dbj|BAF05650.1| Os01g0652100 [Oryza sativa Japonica Group]
 gb|EAY75199.1| hypothetical protein OsI_03091 [Oryza sativa Indica Group]
 dbj|BAG91361.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93258.1| unnamed protein product [Oryza sativa Japonica Group]
Length=392

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  192  CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGE  371
            CN+F+G WV D S P+Y  + CPF++ EFDC KYGRPDK YLKY W+P SC+LPRF+G +
Sbjct  74   CNMFQGSWVYDDSLPMYDTAGCPFVEAEFDCQKYGRPDKLYLKYRWRPSSCELPRFNGLD  133

Query  372  LLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
             L +WRGKK++FVGDS+SLN W SLACM+HA+ P+S+ TY
Sbjct  134  FLSKWRGKKILFVGDSISLNQWESLACMLHAAAPSSRTTY  173



>ref|XP_009142851.1| PREDICTED: protein trichome birefringence-like 39 [Brassica rapa]
Length=367

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 90/131 (69%), Gaps = 5/131 (4%)
 Frame = +3

Query  96   LLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPE  275
            L  V  +   ++ N V      GG+  ++S  CN FRG WV D +YPLY P  CPFIDP+
Sbjct  21   LSTVSANTNTSSNNGVE-----GGRRELASWRCNWFRGSWVYDVTYPLYDPYKCPFIDPQ  75

Query  276  FDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACM  455
            F+C KYGRPD  YLKY W+P SC LPRF+G   L++ RGKK+MFVGDSLS NMW SLAC+
Sbjct  76   FNCKKYGRPDNLYLKYRWQPSSCSLPRFNGLYFLRKMRGKKIMFVGDSLSTNMWQSLACL  135

Query  456  IHASVPTSKIT  488
            IHA VP ++ T
Sbjct  136  IHAWVPNARYT  146



>gb|EYU41140.1| hypothetical protein MIMGU_mgv1a008520mg [Erythranthe guttata]
Length=371

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 99/149 (66%), Gaps = 7/149 (5%)
 Frame = +3

Query  63   VMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGG-------KEIVSSGGCNLFRGRWVV  221
            +MW  + I A  L        AA     H  +          +++ ++ GCN+F+G+WV 
Sbjct  3    LMWKALFISAAFLFFHEADAAAAAAAEHHRSNGSSPSAAAVTRKLAAAAGCNIFQGKWVY  62

Query  222  DSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKV  401
            DSSYPLY  S CPFID EF+C+KY RPD+ YLKY W+P SC+LP F+G   L+++RGKK+
Sbjct  63   DSSYPLYDYSTCPFIDDEFNCLKYKRPDRNYLKYRWQPFSCNLPSFNGVSFLEKYRGKKI  122

Query  402  MFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            MFVGDSLSLN+W SL+CMIH+ VP ++ +
Sbjct  123  MFVGDSLSLNIWQSLSCMIHSWVPNARTS  151



>dbj|BAJ89025.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=384

 Score =   155 bits (392),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  192  CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGE  371
            CN+F+G W  D + P+Y  ++CPF++PEFDC KYGRPDK YLKY W+P SC+LPRFDG +
Sbjct  66   CNMFQGSWTYDDALPVYDAASCPFVEPEFDCQKYGRPDKLYLKYRWRPASCELPRFDGRD  125

Query  372  LLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            LL RW+GKK++FVGDS+SLN W SL CM+HA+ P S+ +Y
Sbjct  126  LLSRWKGKKILFVGDSISLNQWESLVCMLHAAAPASRTSY  165



>gb|KJB71444.1| hypothetical protein B456_011G124000 [Gossypium raimondii]
Length=271

 Score =   152 bits (384),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +3

Query  165  GKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSC  344
            G+    +  CN FRG+WV D SYPLY P  CPFI+ EFDC KYGRPD  YLKY W+P SC
Sbjct  39   GRTRSLASNCNWFRGKWVYDPSYPLYDPYKCPFIEGEFDCQKYGRPDNTYLKYRWQPFSC  98

Query  345  DLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
             LPRF+G   L++WRGKK+MFVGDSLSLN + SL CMI A VP S+I+Y
Sbjct  99   SLPRFNGLYFLRKWRGKKIMFVGDSLSLNQFQSLTCMIQAWVPNSQISY  147



>ref|XP_009143809.1| PREDICTED: protein trichome birefringence-like 37 [Brassica rapa]
Length=381

 Score =   155 bits (391),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            + GCNLF+G+WV D+S P+Y  S CPFI+ E DC+K+GRPD ++L Y+W+PDSC +PRFD
Sbjct  58   TSGCNLFQGKWVFDASSPVYDSSTCPFINGEVDCLKFGRPDTKFLNYSWQPDSCTIPRFD  117

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            G   L +WRGK+VMFVGDSLS NMW SL CMIHASVP    T+
Sbjct  118  GEAFLNQWRGKRVMFVGDSLSENMWESLGCMIHASVPGITTTF  160



>ref|XP_003607565.1| hypothetical protein MTR_4g079700 [Medicago truncatula]
 gb|AES89762.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=365

 Score =   154 bits (390),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            +G CNLFRG+WV D+SYPLY PS CPFIDP+F+C K+GR DK Y KY W P SC++PRF+
Sbjct  44   AGTCNLFRGKWVYDASYPLYDPSTCPFIDPQFNCQKHGRKDKLYQKYRWMPFSCNMPRFN  103

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            G   LK  +GKK+MFVGDSLSLN +NSLACMIHA+VP S+ T+
Sbjct  104  GLNFLKGNKGKKIMFVGDSLSLNQFNSLACMIHAAVPNSRSTF  146



>ref|XP_002881861.1| hypothetical protein ARALYDRAFT_483351 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58120.1| hypothetical protein ARALYDRAFT_483351 [Arabidopsis lyrata subsp. 
lyrata]
Length=366

 Score =   154 bits (389),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +3

Query  165  GKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSC  344
             +  ++SG CN FRG WV D+ YPLY P  CPFIDP+F+C KYGRPD  YLK+ W+P SC
Sbjct  37   ARRELASGRCNWFRGNWVYDAKYPLYDPYKCPFIDPQFNCKKYGRPDNAYLKFRWQPSSC  96

Query  345  DLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
             LPRF+G   L+R RGKK+MFVGDSLS NMW SLAC+IH+ VP ++ T
Sbjct  97   SLPRFNGLYFLRRMRGKKIMFVGDSLSTNMWQSLACLIHSWVPNTRYT  144



>ref|XP_010915620.1| PREDICTED: protein trichome birefringence-like 37 isoform X1 
[Elaeis guineensis]
Length=358

 Score =   154 bits (389),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 88/116 (76%), Gaps = 9/116 (8%)
 Frame = +3

Query  156  SWGGKEIVSSGG-----CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLK  320
            SWG    V++GG     C+LF GRW  D SYPLY  ++CPFI  EFDC++YGRPDK YLK
Sbjct  25   SWG----VTAGGLRPPACDLFDGRWAYDESYPLYDSASCPFIRREFDCLRYGRPDKMYLK  80

Query  321  YAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            Y W P+ CDLPRFDG +LL+RWRGKK+MFVGDSLSLN ++S  C++HA+VP  + +
Sbjct  81   YRWNPNGCDLPRFDGRDLLERWRGKKIMFVGDSLSLNQFDSFLCLLHAAVPDGRTS  136



>ref|XP_010552766.1| PREDICTED: protein trichome birefringence-like 39 isoform X2 
[Tarenaya hassleriana]
Length=375

 Score =   154 bits (390),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 85/109 (78%), Gaps = 2/109 (2%)
 Frame = +3

Query  162  GGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDS  341
            GG+++  +G CN FRGRWV D+ YPLY P  CPF+DP+F+C KYGRPD QYLKY W+P S
Sbjct  48   GGRKL--AGKCNWFRGRWVYDAKYPLYDPYKCPFVDPQFNCKKYGRPDSQYLKYRWQPSS  105

Query  342  CDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            C LPRF+G   L+R RGKK+MFVGDSLS NMW SLAC+I++ VP S  +
Sbjct  106  CSLPRFNGLYFLRRMRGKKIMFVGDSLSSNMWQSLACLIYSWVPNSSYS  154



>ref|XP_010552686.1| PREDICTED: protein trichome birefringence-like 39 isoform X1 
[Tarenaya hassleriana]
Length=378

 Score =   154 bits (390),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 85/109 (78%), Gaps = 2/109 (2%)
 Frame = +3

Query  162  GGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDS  341
            GG+++  +G CN FRGRWV D+ YPLY P  CPF+DP+F+C KYGRPD QYLKY W+P S
Sbjct  48   GGRKL--AGKCNWFRGRWVYDAKYPLYDPYKCPFVDPQFNCKKYGRPDSQYLKYRWQPSS  105

Query  342  CDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            C LPRF+G   L+R RGKK+MFVGDSLS NMW SLAC+I++ VP S  +
Sbjct  106  CSLPRFNGLYFLRRMRGKKIMFVGDSLSSNMWQSLACLIYSWVPNSSYS  154



>ref|NP_565975.1| protein trichome birefringence-like 39 [Arabidopsis thaliana]
 sp|Q9SIN2.1|TBL39_ARATH RecName: Full=Protein trichome birefringence-like 39 [Arabidopsis 
thaliana]
 gb|AAD22996.1| expressed protein [Arabidopsis thaliana]
 gb|AAK59473.1| unknown protein [Arabidopsis thaliana]
 gb|AAL34148.1| unknown protein [Arabidopsis thaliana]
 gb|AEC10140.1| protein trichome birefringence-like 39 [Arabidopsis thaliana]
Length=367

 Score =   154 bits (389),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +3

Query  168  KEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCD  347
            +  ++SG CN FRG WV D  YPLY P  CPFIDP+F+C KYGRPD  YLKY W+P SC 
Sbjct  39   RRELASGRCNWFRGNWVYDVKYPLYDPYKCPFIDPQFNCKKYGRPDNAYLKYRWQPSSCS  98

Query  348  LPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            LPRF+G   L+R RGKK+MFVGDSLS NMW SLAC+IH+ VP ++ T
Sbjct  99   LPRFNGLYFLRRMRGKKIMFVGDSLSTNMWQSLACLIHSWVPNTRYT  145



>ref|XP_002325581.2| hypothetical protein POPTR_0019s11990g [Populus trichocarpa]
 gb|EEE99962.2| hypothetical protein POPTR_0019s11990g [Populus trichocarpa]
Length=371

 Score =   154 bits (389),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 81/102 (79%), Gaps = 1/102 (1%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            +G CN FRG+WV D  YPLY  SNCPFIDP+F+C KYGRPD  YLKY W+P +CDLPRF+
Sbjct  50   AGKCNWFRGKWVFDPKYPLYD-SNCPFIDPQFNCQKYGRPDSYYLKYRWQPFACDLPRFN  108

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            G   L++WRGKK+MFVGDSLSLN W SL C+IH+ VP SK T
Sbjct  109  GLYFLEKWRGKKIMFVGDSLSLNQWTSLTCLIHSWVPNSKYT  150



>ref|XP_003599941.1| hypothetical protein MTR_3g049330 [Medicago truncatula]
 gb|AES70192.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=351

 Score =   154 bits (388),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 89/137 (65%), Gaps = 15/137 (11%)
 Frame = +3

Query  78   VVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNC  257
            V +I VLL++  HG                    +  GC+LF+G+WV D SYPLYQ S C
Sbjct  8    VSLIHVLLMIHVHGKTIG---------------FAKSGCDLFQGKWVYDESYPLYQTSQC  52

Query  258  PFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMW  437
            PFI+ EFDC   GRPDK YLKY W+P  CDLPRF+G + L+R+RGK ++FVGDSLSLN W
Sbjct  53   PFIEKEFDCQNNGRPDKFYLKYRWQPTKCDLPRFNGEDFLRRYRGKSILFVGDSLSLNQW  112

Query  438  NSLACMIHASVPTSKIT  488
             SL CM+H +VP +  T
Sbjct  113  QSLTCMLHIAVPQAHYT  129



>ref|XP_011002532.1| PREDICTED: protein trichome birefringence-like 39 [Populus euphratica]
Length=371

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 81/102 (79%), Gaps = 1/102 (1%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            +G CN FRG+WV D  YPLY  SNCPFIDP+F+C KYGRPD  YLKY W+P +CDLPRF+
Sbjct  50   AGKCNWFRGKWVFDPKYPLYD-SNCPFIDPQFNCQKYGRPDSYYLKYRWQPFACDLPRFN  108

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            G   L++WRGKK+MFVGDSLSLN W SL C+IHA VP SK T
Sbjct  109  GLYFLEKWRGKKIMFVGDSLSLNQWISLTCLIHAWVPNSKYT  150



>emb|CDY51515.1| BnaC04g02360D [Brassica napus]
Length=367

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 89/128 (70%), Gaps = 5/128 (4%)
 Frame = +3

Query  105  VQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDC  284
            V  +   ++ N V      GG+  ++S  CN FRG WV D +YPLY P  CPFIDP+F+C
Sbjct  24   VSAYTNTSSNNGVE-----GGRRELASWRCNWFRGSWVYDVTYPLYDPYKCPFIDPQFNC  78

Query  285  IKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHA  464
             KYGRPD  YLKY W+P SC LPRF+G   L++ RGKK+MFVGDSLS NMW SLAC+IH+
Sbjct  79   KKYGRPDNLYLKYRWQPSSCSLPRFNGLYFLRKMRGKKIMFVGDSLSTNMWQSLACLIHS  138

Query  465  SVPTSKIT  488
             VP ++ T
Sbjct  139  WVPNARYT  146



>ref|XP_010686317.1| PREDICTED: protein trichome birefringence-like 37 [Beta vulgaris 
subsp. vulgaris]
Length=368

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 82/101 (81%), Gaps = 1/101 (1%)
 Frame = +3

Query  183  SGGCNLFRGRWVVD-SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRF  359
            +G CNLF+G+WV D S  PLY  + CPFI+PEFDC+KYGRPDK +L+Y+W PD+C +PRF
Sbjct  45   TGTCNLFQGKWVFDISGTPLYDFTTCPFINPEFDCLKYGRPDKLFLQYSWVPDTCSIPRF  104

Query  360  DGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSK  482
            DG E L R+RGK +MFVGDSLSLN WNSL CM+HAS P ++
Sbjct  105  DGMEFLMRFRGKTIMFVGDSLSLNQWNSLTCMVHASAPQAR  145



>ref|XP_006646157.1| PREDICTED: protein YLS7-like [Oryza brachyantha]
Length=423

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +3

Query  186  GGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDG  365
              CN+F+G WV D S P+Y  + CPF++ EFDC KYGRPDK YLKY W+P SC+LPRF+G
Sbjct  103  ASCNMFQGSWVYDDSLPMYDTAGCPFVEAEFDCQKYGRPDKLYLKYRWRPTSCELPRFNG  162

Query  366  GELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
             + L +WRGKK++FVGDS+SLN W SLACM+HA+ P+S+ TY
Sbjct  163  LDFLSKWRGKKILFVGDSISLNQWESLACMLHAAAPSSRTTY  204



>gb|KEH39261.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=368

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            +G CN FRG+WV D SYPLY PS+CPFIDP+F+C KYGRPD QY KY W+P +C +PRF+
Sbjct  47   AGRCNWFRGKWVYDPSYPLYDPSSCPFIDPQFNCQKYGRPDTQYQKYRWQPFTCSIPRFN  106

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
              + L ++RGKK+MFVGDSLSLN +NSLACMIH+ VP ++ T+
Sbjct  107  ALDFLAKYRGKKIMFVGDSLSLNQFNSLACMIHSWVPKTRYTF  149



>gb|KHG02694.1| putative C7orf58 [Gossypium arboreum]
Length=365

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +3

Query  189  GCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGG  368
             CN+++G+WV D+SYPLY  ++CPFI  EFDC+KYGRPD  YLKY W+P +C LPRF+G 
Sbjct  42   NCNMYQGKWVYDNSYPLYNSTDCPFIRKEFDCLKYGRPDHLYLKYRWQPTNCHLPRFNGE  101

Query  369  ELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKI  485
              LKR++GKK+MF+GDSLSLN+W SL CM+HA+VP S+I
Sbjct  102  YFLKRFKGKKIMFIGDSLSLNIWQSLICMLHAAVPNSRI  140



>gb|KFK37109.1| hypothetical protein AALP_AA4G214000 [Arabis alpina]
Length=374

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 89/129 (69%), Gaps = 1/129 (1%)
 Frame = +3

Query  102  LVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFD  281
            +V  +    + +N    +  G +E+VS G CN FRG WV D  YPLY P  CPFIDP+F+
Sbjct  25   IVSAYTTNTSSSNNDVEVESGRRELVS-GRCNWFRGNWVYDVKYPLYDPYKCPFIDPQFN  83

Query  282  CIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIH  461
            C KYGRPD  YLKY W+P SC LPRF+G   L++ RGKK+MFVGDSLS NMW SLAC+IH
Sbjct  84   CKKYGRPDNLYLKYRWQPSSCSLPRFNGLFFLRKMRGKKIMFVGDSLSTNMWESLACLIH  143

Query  462  ASVPTSKIT  488
              VP ++ T
Sbjct  144  DWVPNTRYT  152



>gb|KDO63327.1| hypothetical protein CISIN_1g017063mg [Citrus sinensis]
 gb|KDO63328.1| hypothetical protein CISIN_1g017063mg [Citrus sinensis]
Length=231

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 85/107 (79%), Gaps = 2/107 (2%)
 Frame = +3

Query  168  KEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCD  347
            ++ +  G CN+F+G+WV D+SYPLY  S+CPF+DPEFDC KYGRPD  YLKY W+P SC 
Sbjct  55   RKSLGGGKCNIFQGKWVYDASYPLY--SHCPFVDPEFDCQKYGRPDDIYLKYRWQPFSCS  112

Query  348  LPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            +PRF+G   L+++RGKK+MFVGDSLSLN W SLACMIH+  P +K +
Sbjct  113  IPRFNGLYFLEKFRGKKIMFVGDSLSLNQWQSLACMIHSWAPKTKYS  159



>gb|KJB74418.1| hypothetical protein B456_011G293800 [Gossypium raimondii]
Length=354

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  180  SSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRF  359
            ++G CN+++G+WV DSSYPLY  S CPFI  EF+C+KYGRPD  YLKY W+P  C+LPRF
Sbjct  28   ANGCCNVYKGKWVYDSSYPLYDTSACPFIHKEFNCLKYGRPDHLYLKYRWQPSKCNLPRF  87

Query  360  DGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTS  479
            DG  LL+R +GKK+MF+GDS+S+N W SL CM+HA+VPT+
Sbjct  88   DGTHLLRRLKGKKIMFIGDSISINQWQSLLCMLHAAVPTT  127



>gb|EMT21950.1| hypothetical protein F775_18320 [Aegilops tauschii]
Length=422

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  192  CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGE  371
            CN+F G W  D + P+Y  + CPF++PEFDC KYGRPDK YLKY W+P SC+LPRFDG +
Sbjct  70   CNMFHGSWGYDDALPMYDAAGCPFVEPEFDCQKYGRPDKLYLKYRWRPASCELPRFDGRD  129

Query  372  LLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            LL RW+GKKV+FVGDS+SLN W SL CM+HA+ P S+ +Y
Sbjct  130  LLSRWKGKKVLFVGDSISLNQWESLVCMLHAAAPASRTSY  169



>ref|XP_003569466.1| PREDICTED: protein trichome birefringence-like 38 [Brachypodium 
distachyon]
Length=385

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +3

Query  186  GGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDG  365
              CN+F+G WV D + P+Y  + CPF++PEFDC KYGRPDK YLKY W+P SC+LPRF+G
Sbjct  65   AACNMFQGSWVYDDTLPMYDTARCPFVEPEFDCQKYGRPDKLYLKYRWRPASCELPRFNG  124

Query  366  GELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
             +LL +WRGKK++FVGDS+SLN W SL CM+HA+ P S  T+
Sbjct  125  QDLLSKWRGKKILFVGDSISLNQWQSLVCMLHAAAPASGTTH  166



>ref|XP_006411518.1| hypothetical protein EUTSA_v10016832mg [Eutrema salsugineum]
 gb|ESQ52971.1| hypothetical protein EUTSA_v10016832mg [Eutrema salsugineum]
Length=366

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = +3

Query  162  GGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDS  341
             G+  ++S  CN FRG WV D+ YPLY P  CPFIDP+F+C KYGRPD  YLKY W+P S
Sbjct  37   AGRRELASRRCNWFRGNWVYDAKYPLYNPYKCPFIDPQFNCKKYGRPDNVYLKYRWQPSS  96

Query  342  CDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            C LPRF+G   L++ RGKK+MFVGDSLS NMW SLAC+IH+ VP ++ T
Sbjct  97   CSLPRFNGLYFLRKMRGKKIMFVGDSLSTNMWQSLACLIHSWVPNTRYT  145



>gb|KCW67609.1| hypothetical protein EUGRSUZ_F01364 [Eucalyptus grandis]
Length=537

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +3

Query  177  VSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPR  356
            ++SG CNL+ G W+ D SYP+Y+ SNCPFIDP FDC+K GR DK YLKY WKP  CDLPR
Sbjct  1    MASGNCNLYEGSWLFDDSYPIYEASNCPFIDPAFDCLKNGRTDKDYLKYRWKPSKCDLPR  60

Query  357  FDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTS  479
            FDG + L+R RGK ++FVGDSLS NMW SL CM+H++VP S
Sbjct  61   FDGRDFLERQRGKNILFVGDSLSKNMWQSLTCMLHSAVPES  101



>gb|AFK49604.1| unknown [Lotus japonicus]
Length=367

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 93/144 (65%), Gaps = 7/144 (5%)
 Frame = +3

Query  66   MWSGVVIIAVL---LLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYP  236
            M S   I AVL   LL+Q HG      N    L+ G        GC+LF GRWV D SYP
Sbjct  3    MRSLTTISAVLFLALLIQIHGKDDHDVNYQKQLTAG----FGKSGCDLFEGRWVYDESYP  58

Query  237  LYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGD  416
            LY  S CPF + +FDC K GRPDK +LKY W+P  C+LPRF+G + L+R+RGK +MFVGD
Sbjct  59   LYDSSRCPFFEQQFDCQKNGRPDKFHLKYRWQPTGCNLPRFNGEDFLRRYRGKSIMFVGD  118

Query  417  SLSLNMWNSLACMIHASVPTSKIT  488
            SLSLN W SL CM+H +VP ++ T
Sbjct  119  SLSLNQWQSLTCMLHTAVPQAQYT  142



>gb|KDO58610.1| hypothetical protein CISIN_1g018353mg [Citrus sinensis]
Length=304

 Score =   151 bits (382),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 92/142 (65%), Gaps = 14/142 (10%)
 Frame = +3

Query  63   VMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLY  242
            V  +G +++  L L +G               +G  E+ +   C++F+G+WV D  YPLY
Sbjct  4    VALAGTLLVVALFLHRG--------------VYGAYELKNDNKCDIFQGKWVYDPKYPLY  49

Query  243  QPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSL  422
              SNCPFI+ EFDC K GRPD  YLKY WKP SC LPRF GG  L+R+RGK+++FVGDS+
Sbjct  50   NASNCPFIEQEFDCRKNGRPDNMYLKYRWKPTSCKLPRFRGGVFLERFRGKRILFVGDSI  109

Query  423  SLNMWNSLACMIHASVPTSKIT  488
            SLN W SL CM+H +VP +K T
Sbjct  110  SLNQWQSLTCMLHLAVPKAKYT  131



>ref|XP_010106402.1| hypothetical protein L484_008607 [Morus notabilis]
 gb|EXC10441.1| hypothetical protein L484_008607 [Morus notabilis]
Length=383

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 83/110 (75%), Gaps = 2/110 (2%)
 Frame = +3

Query  159  WGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPD  338
            W  K+ +    CN++ G WV D SYPLY+  +CPFI  EF+CIKYGRPD+ YLKY W+P+
Sbjct  49   WRSKQEIKR--CNMYNGSWVFDDSYPLYESLDCPFIRKEFNCIKYGRPDRLYLKYRWQPN  106

Query  339  SCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
             CDLPRFDG + LKR  GKK+MFVGDS+SLN W SL C++HASVP S IT
Sbjct  107  DCDLPRFDGIDFLKRLEGKKIMFVGDSVSLNQWQSLLCLLHASVPHSNIT  156



>ref|XP_002285609.1| PREDICTED: protein trichome birefringence-like 38 [Vitis vinifera]
 emb|CBI20119.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +3

Query  186  GGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDG  365
             GCNL++G WV+D ++PLYQ S CPFID EFDC K GRPDK YLKY W+P  C LPRF+G
Sbjct  41   AGCNLYQGSWVIDDTFPLYQSSICPFIDKEFDCQKNGRPDKLYLKYRWRPSGCILPRFNG  100

Query  366  GELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
             E L R++GK++MFVGDSLSLN W SL CM+HA+VP S+ T
Sbjct  101  VEFLARYKGKRIMFVGDSLSLNQWQSLTCMLHAAVPRSRYT  141



>gb|KJB67475.1| hypothetical protein B456_010G192400 [Gossypium raimondii]
Length=365

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +3

Query  189  GCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGG  368
             CN+++G+WV D SYPLY  ++CPFI  EFDC+KYGRPD  YLKY W+P +C LPRF+G 
Sbjct  42   NCNMYQGKWVYDDSYPLYNSTDCPFIRKEFDCLKYGRPDHLYLKYRWQPTNCHLPRFNGE  101

Query  369  ELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKI  485
              LKR++GKK+MF+GDSLSLN+W SL CM+HA+VP S+I
Sbjct  102  YFLKRFKGKKIMFIGDSLSLNIWQSLICMLHAAVPNSRI  140



>ref|XP_004505509.1| PREDICTED: uncharacterized protein LOC101514285 [Cicer arietinum]
Length=361

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            +G CNLF G+WV DSSYPLY PS CPFIDP+F+C K+GR D+ Y K+ W P SC LPRF+
Sbjct  40   AGTCNLFHGKWVYDSSYPLYDPSTCPFIDPQFNCQKHGRKDELYQKFRWMPFSCPLPRFN  99

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            G + LK  +GKK+MFVGDSLSLN +NSLACM+HASVP SK T+
Sbjct  100  GLKFLKGHKGKKIMFVGDSLSLNQFNSLACMLHASVPNSKATF  142



>emb|CAN82331.1| hypothetical protein VITISV_007322 [Vitis vinifera]
Length=365

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +3

Query  186  GGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDG  365
             GCNL++G WV+D ++PLYQ S CPFID EFDC K GRPDK YLKY W+P  C LPRF+G
Sbjct  41   AGCNLYQGSWVIDDTFPLYQSSICPFIDKEFDCQKNGRPDKLYLKYRWRPSGCILPRFNG  100

Query  366  GELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
             E L R++GK++MFVGDSLSLN W SL CM+HA+VP S+ T
Sbjct  101  VEFLARYKGKRIMFVGDSLSLNQWQSLTCMLHAAVPRSRYT  141



>gb|KDP31782.1| hypothetical protein JCGZ_12243 [Jatropha curcas]
Length=371

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 90/122 (74%), Gaps = 1/122 (1%)
 Frame = +3

Query  126  AAQNNVSHLLSWGGKEIVSS-GGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRP  302
               ++V++  +   +E++++   CN F+G+WV D  YPLY PS CPF+D EF+C + GR 
Sbjct  31   TVTDSVNNFSTSSTRELLAARSKCNWFQGKWVFDPKYPLYNPSTCPFLDAEFNCQRNGRS  90

Query  303  DKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSK  482
            DK YLKY W+P SC+LPRF+G   L++WRGKK+MFVGDSLSLN W SL CM+HASVP SK
Sbjct  91   DKYYLKYRWQPFSCNLPRFNGRYFLEKWRGKKIMFVGDSLSLNQWQSLTCMLHASVPNSK  150

Query  483  IT  488
             T
Sbjct  151  AT  152



>ref|XP_009142074.1| PREDICTED: protein trichome birefringence-like 39 [Brassica rapa]
Length=371

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +3

Query  168  KEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCD  347
            +  + SG CN FRG WV D  YPLY P  CPFIDP+F+C KYGRPD  YLKY W+P SC 
Sbjct  44   RRELRSGRCNWFRGSWVYDVKYPLYDPYKCPFIDPQFNCKKYGRPDNLYLKYRWQPSSCS  103

Query  348  LPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            LPRF+G   L++ RGKK+MFVGDSLS NMW SLAC+IHA VP ++ T
Sbjct  104  LPRFNGLYFLRKMRGKKIMFVGDSLSTNMWQSLACLIHAWVPNARYT  150



>tpg|DAA58322.1| TPA: putative DUF231 domain containing family protein [Zea mays]
Length=384

 Score =   153 bits (386),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  162  GGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDS  341
            GG        CNLF+G WV D + P+Y  + CPF++PEFDC KYGRPDK YLKY W+P S
Sbjct  54   GGAPGTGMASCNLFQGSWVYDDTLPMYDAAGCPFVEPEFDCQKYGRPDKLYLKYRWRPAS  113

Query  342  CDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVP-TSKITY  491
            C+LPRF+G +LL+RW+GKK++FVGDS+SLN W SLACM+ A+ P +S++ Y
Sbjct  114  CELPRFNGQDLLRRWKGKKILFVGDSISLNQWESLACMLRAAAPASSRVAY  164



>ref|XP_009593637.1| PREDICTED: protein trichome birefringence-like 39 [Nicotiana 
tomentosiformis]
Length=363

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            S GCN+FRG+WV DSSYPLY  S CPFI+ EF+C KY RPD  YLKY W+P SC+LPRF+
Sbjct  42   SSGCNIFRGKWVYDSSYPLYDFSTCPFIENEFNCQKYKRPDNLYLKYRWQPFSCNLPRFN  101

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKI  485
            G   L+++RGK +MFVGDSLSLNMW SLACMIH+ VP ++I
Sbjct  102  GLVFLEKYRGKNIMFVGDSLSLNMWQSLACMIHSWVPKARI  142



>ref|XP_003537664.1| PREDICTED: protein YLS7-like [Glycine max]
Length=364

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 91/137 (66%), Gaps = 3/137 (2%)
 Frame = +3

Query  75   GVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSN  254
            GV+ +  LL V   GG     +V     W   E      CN++ GRW +D SYPLY  S 
Sbjct  9    GVICLCQLLCVVTTGGGG---HVESNFKWQRSEEKHELSCNMYEGRWELDDSYPLYDSST  65

Query  255  CPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNM  434
            CP I  EFDC+KYGRPD+QYLKY W+P+ CDLPRFDG + L + +GK++MF+GDS+SLN 
Sbjct  66   CPHIRKEFDCLKYGRPDQQYLKYRWQPNECDLPRFDGKDFLTKLKGKQIMFIGDSVSLNQ  125

Query  435  WNSLACMIHASVPTSKI  485
            W SL C++ +SVP ++I
Sbjct  126  WQSLICLLRSSVPQTEI  142



>gb|ACU19344.1| unknown [Glycine max]
 gb|KHN41859.1| hypothetical protein glysoja_003599 [Glycine soja]
Length=364

 Score =   152 bits (384),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 91/137 (66%), Gaps = 3/137 (2%)
 Frame = +3

Query  75   GVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSN  254
            GV+ +  LL V   GG     +V     W   E      CN++ GRW +D SYPLY  S 
Sbjct  9    GVICLCQLLCVVTTGGGG---HVESNFKWQRSEEKHELSCNMYEGRWELDDSYPLYDSST  65

Query  255  CPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNM  434
            CP I  EFDC+KYGRPD+QYLKY W+P+ CDLPRFDG + L + +GK++MF+GDS+SLN 
Sbjct  66   CPHIRKEFDCLKYGRPDQQYLKYRWQPNECDLPRFDGKDFLTKLKGKQIMFIGDSVSLNQ  125

Query  435  WNSLACMIHASVPTSKI  485
            W SL C++ +SVP ++I
Sbjct  126  WQSLICLLRSSVPQTEI  142



>ref|XP_004243406.1| PREDICTED: protein trichome birefringence-like 39 [Solanum lycopersicum]
Length=363

 Score =   152 bits (383),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 84/104 (81%), Gaps = 2/104 (2%)
 Frame = +3

Query  171  EIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDL  350
            EI SS  CN++RG+WV DSSYPLY  SNCPFID EF+C KY RPD  YLKY W+P SC+L
Sbjct  40   EIKSS--CNIYRGKWVYDSSYPLYDFSNCPFIDNEFNCQKYKRPDNLYLKYRWQPFSCNL  97

Query  351  PRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSK  482
            PRF+G   L+++RGK +MFVGDSLSLNMW SLACMIH+ VP +K
Sbjct  98   PRFNGLFFLEKYRGKNIMFVGDSLSLNMWESLACMIHSWVPNAK  141



>ref|XP_006448024.1| hypothetical protein CICLE_v10015743mg [Citrus clementina]
 gb|ESR61264.1| hypothetical protein CICLE_v10015743mg [Citrus clementina]
Length=357

 Score =   152 bits (383),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 92/142 (65%), Gaps = 14/142 (10%)
 Frame = +3

Query  63   VMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLY  242
            V  +G +++  L L +G               +G  E+ +   C++F+G+WV D  YPLY
Sbjct  4    VALAGTLLVVALFLHRG--------------VYGAYELKNDNKCDIFQGKWVYDPKYPLY  49

Query  243  QPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSL  422
              SNCPFI+ EFDC K GRPD  YLKY WKP SC LPRF GG  L+R+RGK+++FVGDS+
Sbjct  50   NASNCPFIEQEFDCRKNGRPDNMYLKYRWKPTSCKLPRFRGGVFLERFRGKRILFVGDSI  109

Query  423  SLNMWNSLACMIHASVPTSKIT  488
            SLN W SL CM+H +VP +K T
Sbjct  110  SLNQWQSLTCMLHLAVPKAKYT  131



>gb|KDO63326.1| hypothetical protein CISIN_1g017063mg [Citrus sinensis]
Length=284

 Score =   150 bits (378),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 85/107 (79%), Gaps = 2/107 (2%)
 Frame = +3

Query  168  KEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCD  347
            ++ +  G CN+F+G+WV D+SYPLY  S+CPF+DPEFDC KYGRPD  YLKY W+P SC 
Sbjct  55   RKSLGGGKCNIFQGKWVYDASYPLY--SHCPFVDPEFDCQKYGRPDDIYLKYRWQPFSCS  112

Query  348  LPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            +PRF+G   L+++RGKK+MFVGDSLSLN W SLACMIH+  P +K +
Sbjct  113  IPRFNGLYFLEKFRGKKIMFVGDSLSLNQWQSLACMIHSWAPKTKYS  159



>ref|XP_010670501.1| PREDICTED: protein trichome birefringence-like 38 [Beta vulgaris 
subsp. vulgaris]
Length=374

 Score =   152 bits (384),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 94/142 (66%), Gaps = 6/142 (4%)
 Frame = +3

Query  78   VVIIAVLLLVQGHGGRAAQNNV------SHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPL  239
            +++I ++  +       A  NV       H+++   +  +    CN+F+G WV D+SYP+
Sbjct  11   LLLIGIMSAINSCLSHNATTNVVQNHQLDHVINKFLRPKLELKNCNIFKGHWVWDASYPM  70

Query  240  YQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDS  419
            Y  S CP I  EFDC+KYGRPDK YLKY W+PD CDLPRFDG + L R RGKK+M+VGDS
Sbjct  71   YDSSQCPSIRKEFDCLKYGRPDKFYLKYRWQPDDCDLPRFDGVDFLTRMRGKKIMYVGDS  130

Query  420  LSLNMWNSLACMIHASVPTSKI  485
            LSLN W SL C++HA+VP S I
Sbjct  131  LSLNNWQSLVCLLHAAVPNSNI  152



>gb|KDO58611.1| hypothetical protein CISIN_1g018353mg [Citrus sinensis]
Length=357

 Score =   152 bits (383),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 92/142 (65%), Gaps = 14/142 (10%)
 Frame = +3

Query  63   VMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLY  242
            V  +G +++  L L +G               +G  E+ +   C++F+G+WV D  YPLY
Sbjct  4    VALAGTLLVVALFLHRG--------------VYGAYELKNDNKCDIFQGKWVYDPKYPLY  49

Query  243  QPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSL  422
              SNCPFI+ EFDC K GRPD  YLKY WKP SC LPRF GG  L+R+RGK+++FVGDS+
Sbjct  50   NASNCPFIEQEFDCRKNGRPDNMYLKYRWKPTSCKLPRFRGGVFLERFRGKRILFVGDSI  109

Query  423  SLNMWNSLACMIHASVPTSKIT  488
            SLN W SL CM+H +VP +K T
Sbjct  110  SLNQWQSLTCMLHLAVPKAKYT  131



>ref|XP_006492255.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=361

 Score =   152 bits (383),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 92/142 (65%), Gaps = 14/142 (10%)
 Frame = +3

Query  63   VMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLY  242
            V  +G +++  L L +G               +G  E+ +   C++F+G+WV D  YPLY
Sbjct  4    VALAGTLLVVALFLHRG--------------VYGAYELKNDNKCDIFQGKWVYDPKYPLY  49

Query  243  QPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSL  422
              SNCPFI+ EFDC K GRPD  YLKY WKP SC LPRF GG  L+R+RGK+++FVGDS+
Sbjct  50   NASNCPFIEQEFDCRKNGRPDNMYLKYRWKPTSCKLPRFRGGVFLERFRGKRILFVGDSI  109

Query  423  SLNMWNSLACMIHASVPTSKIT  488
            SLN W SL CM+H +VP +K T
Sbjct  110  SLNQWQSLTCMLHLAVPKAKYT  131



>emb|CDY47981.1| BnaA04g24590D [Brassica napus]
Length=366

 Score =   152 bits (383),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +3

Query  168  KEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCD  347
            +  + SG CN FRG WV D  YPLY P  CPF+DP+F+C KYGRPD  YLKY W+P SC 
Sbjct  39   RRELRSGRCNWFRGSWVYDVKYPLYDPYKCPFVDPQFNCKKYGRPDNLYLKYRWQPSSCS  98

Query  348  LPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            LPRF+G   L++ RGKK+MFVGDSLS NMW SLAC+IHA VP ++ T
Sbjct  99   LPRFNGLYFLRKMRGKKIMFVGDSLSTNMWQSLACLIHAWVPNARYT  145



>ref|XP_006294317.1| hypothetical protein CARUB_v10023325mg, partial [Capsella rubella]
 gb|EOA27215.1| hypothetical protein CARUB_v10023325mg, partial [Capsella rubella]
Length=408

 Score =   152 bits (385),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +3

Query  177  VSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPR  356
            ++SG CN FRG WV D+ YPLY P  CPFIDP+F+C KYGRPD  YLK+ W+P SC LPR
Sbjct  83   LASGRCNWFRGNWVYDAKYPLYDPYKCPFIDPQFNCKKYGRPDNAYLKFRWQPSSCSLPR  142

Query  357  FDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            F+G   L++ RGKK+MFVGDSLS NMW SLAC+IH+ VP ++ T
Sbjct  143  FNGLYFLRKMRGKKIMFVGDSLSTNMWQSLACLIHSWVPNARYT  186



>ref|XP_007022285.1| Trichome birefringence-like 38 [Theobroma cacao]
 gb|EOY13810.1| Trichome birefringence-like 38 [Theobroma cacao]
Length=367

 Score =   152 bits (383),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 94/138 (68%), Gaps = 8/138 (6%)
 Frame = +3

Query  72   SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPS  251
            +G VI + + L  G+G +  ++ V        ++  SS  CN+++GRWV D SYPLY  S
Sbjct  14   AGFVIFSCICLANGNGFQRQKSRVD------SRKQQSS--CNVYQGRWVYDESYPLYDSS  65

Query  252  NCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLN  431
             CPFI  EFDC KYGRPD  YLKY W+P +C LPRFDG +LL R+ GKK+MFVGDS+SLN
Sbjct  66   ACPFIRKEFDCHKYGRPDHLYLKYRWQPSNCQLPRFDGQDLLNRFMGKKIMFVGDSVSLN  125

Query  432  MWNSLACMIHASVPTSKI  485
             W SL C++HA+ P S I
Sbjct  126  HWQSLICLLHAAAPNSSI  143



>emb|CDY14846.1| BnaC04g48430D [Brassica napus]
Length=369

 Score =   152 bits (383),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 86/121 (71%), Gaps = 4/121 (3%)
 Frame = +3

Query  126  AAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPD  305
            A+ NN S  +    +  + SG CN F+G WV D  YPLY P  CPFIDP+F+C KYGRPD
Sbjct  32   ASSNNSSEAV----RRELRSGRCNWFKGSWVYDVKYPLYDPYKCPFIDPQFNCKKYGRPD  87

Query  306  KQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKI  485
              YLKY W+P SC LPRF+G   L++ +GKK+MFVGDSLS NMW SLAC+IHA VP ++ 
Sbjct  88   NLYLKYRWQPSSCSLPRFNGLYFLRKMKGKKIMFVGDSLSTNMWQSLACLIHAWVPNARY  147

Query  486  T  488
            T
Sbjct  148  T  148



>gb|KJB71443.1| hypothetical protein B456_011G124000 [Gossypium raimondii]
Length=366

 Score =   151 bits (382),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +3

Query  165  GKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSC  344
            G+    +  CN FRG+WV D SYPLY P  CPFI+ EFDC KYGRPD  YLKY W+P SC
Sbjct  39   GRTRSLASNCNWFRGKWVYDPSYPLYDPYKCPFIEGEFDCQKYGRPDNTYLKYRWQPFSC  98

Query  345  DLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
             LPRF+G   L++WRGKK+MFVGDSLSLN + SL CMI A VP S+I+Y
Sbjct  99   SLPRFNGLYFLRKWRGKKIMFVGDSLSLNQFQSLTCMIQAWVPNSQISY  147



>ref|XP_004967058.1| PREDICTED: uncharacterized protein LOC101773522 [Setaria italica]
Length=371

 Score =   151 bits (382),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +3

Query  177  VSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPR  356
            VSS GC+LF+GRWV D SYPLY  S CPF+   FDC + GRPD  YLK+ W P +C LPR
Sbjct  25   VSSSGCDLFQGRWVADKSYPLYDASTCPFVPDVFDCRRNGRPDDAYLKFRWNPANCRLPR  84

Query  357  FDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPT  476
            FDG + L+RWRGK VMFVGDSLS+N W SLACM+HAS P 
Sbjct  85   FDGADFLRRWRGKTVMFVGDSLSMNQWVSLACMLHASAPA  124



>ref|XP_010557124.1| PREDICTED: protein trichome birefringence-like 40 [Tarenaya hassleriana]
Length=394

 Score =   152 bits (384),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +3

Query  186  GGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDG  365
            G CN  RG+WV DSSYPLY P  CPFIDPEFDC K GRPD  YLKY W+P SCDLPRF+G
Sbjct  73   GRCNWSRGKWVYDSSYPLYSPYKCPFIDPEFDCQKSGRPDSLYLKYRWQPFSCDLPRFNG  132

Query  366  GELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
               L+R RGK++MFVGDSLSLNM+ SLACMIHA VP +K +
Sbjct  133  MIFLRRMRGKRIMFVGDSLSLNMFESLACMIHAWVPNAKYS  173



>ref|XP_008781517.1| PREDICTED: protein trichome birefringence-like 38 [Phoenix dactylifera]
Length=358

 Score =   151 bits (382),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +3

Query  177  VSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPR  356
            +S   C+LF G WV D SYPLY   +CPF   EFDC++YGRPDK YLKY W P+ CDLPR
Sbjct  33   LSPAACDLFNGSWVYDESYPLYDSESCPFNRREFDCLRYGRPDKLYLKYRWSPNGCDLPR  92

Query  357  FDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            FDG +LL+RW+GKK+MFVGDSLSLN ++SL C++HA+VP  K +
Sbjct  93   FDGRDLLRRWKGKKIMFVGDSLSLNQYDSLLCLLHAAVPNGKTS  136



>ref|XP_008449501.1| PREDICTED: protein trichome birefringence-like 43 [Cucumis melo]
Length=362

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 84/108 (78%), Gaps = 2/108 (2%)
 Frame = +3

Query  165  GKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSC  344
            GK ++  GGC+LF+GRW+ D+SYPLY  S CPFI+ +FDC+  GRPDK YL+Y W+P  C
Sbjct  26   GKPVI--GGCDLFQGRWLADTSYPLYDVSTCPFIEKQFDCVGNGRPDKLYLRYRWQPSGC  83

Query  345  DLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            DLPRF+G E L+++RGK +MFVGDSLSLN W SLACM+H  VP +  T
Sbjct  84   DLPRFNGEEFLRQFRGKSIMFVGDSLSLNQWQSLACMLHKFVPQANYT  131



>ref|XP_002525125.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37252.1| conserved hypothetical protein [Ricinus communis]
Length=350

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = +3

Query  162  GGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDS  341
              +++ ++  CN FRG+WV DSSYPLY P +CPF+D +F+C + GRPD+ YLKY W+P S
Sbjct  22   SSRKLAANSKCNWFRGKWVFDSSYPLYDPYSCPFLDKQFNCQENGRPDRYYLKYRWQPFS  81

Query  342  CDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            C LPRF+G   L++WRGKK+MFVGDSLSLN W SL CM+H+ VP SK +
Sbjct  82   CSLPRFNGLYFLEKWRGKKIMFVGDSLSLNQWQSLTCMLHSWVPNSKYS  130



>ref|NP_001144145.1| uncharacterized protein LOC100276997 precursor [Zea mays]
 gb|ACG38244.1| hypothetical protein [Zea mays]
Length=392

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 83/101 (82%), Gaps = 1/101 (1%)
 Frame = +3

Query  192  CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGE  371
            CNLF+G WV D + P+Y  + CPF++PEFDC KYGRPDK YLKY W+P SC+LPRF+G +
Sbjct  72   CNLFQGSWVYDDTLPMYDAAGCPFVEPEFDCQKYGRPDKLYLKYRWRPASCELPRFNGQD  131

Query  372  LLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVP-TSKITY  491
            LL+RW+GKK++FVGDS+SLN W SLACM+ A+ P +S++ Y
Sbjct  132  LLRRWKGKKILFVGDSISLNQWESLACMLRAAAPASSRVAY  172



>ref|XP_009359359.1| PREDICTED: protein trichome birefringence-like 37 isoform X1 
[Pyrus x bretschneideri]
Length=358

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = +3

Query  102  LVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFD  281
            ++QG+G  +    +   L   G+    + GC+ F+G WV D SYPLY  S CPF++ EFD
Sbjct  4    MLQGYGFFSYALLIFLCLHLEGQYYSYAKGCDFFQGSWVYDVSYPLYDTSGCPFVEEEFD  63

Query  282  CIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIH  461
            C K GRPD QYLKY WKPD+C LPRF+G ++L+R +GKK++FVGDSLSLN W SL CM++
Sbjct  64   CQKNGRPDDQYLKYRWKPDACALPRFNGEDMLRRLKGKKIIFVGDSLSLNQWQSLTCMLY  123

Query  462  ASVPTSKIT  488
            A+VP +  T
Sbjct  124  AAVPQTHYT  132



>ref|XP_008675272.1| PREDICTED: LOW QUALITY PROTEIN: protein trichome birefringence-like 
38 [Zea mays]
Length=392

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = +3

Query  186  GGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDG  365
              CNLF+G WV D + P+Y  + CPF++PEFDC KYGRPDK YLKY W+P SC+LPRF+G
Sbjct  70   ASCNLFQGSWVYDDTLPMYDAAGCPFVEPEFDCQKYGRPDKLYLKYRWRPASCELPRFNG  129

Query  366  GELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVP-TSKITY  491
             +LL+RW+GKK++FVGDS+SLN W SLACM+ A+ P +S++ Y
Sbjct  130  QDLLRRWKGKKILFVGDSISLNQWESLACMLRAAAPASSRVAY  172



>gb|KJB24278.1| hypothetical protein B456_004G138200 [Gossypium raimondii]
Length=260

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 90/139 (65%), Gaps = 16/139 (12%)
 Frame = +3

Query  75   GVVIIAVLLL---VQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQ  245
               + AVL L   + GHG +  +              ++  GC+LF+G WV D SYPLYQ
Sbjct  7    AATVFAVLSLSYQLHGHGEKVERG-------------LTVNGCDLFQGSWVYDESYPLYQ  53

Query  246  PSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLS  425
             S+C FI  +FDC+K GRPDK YLKY W+P +C+L RFDG ++L R RGK +MFVGDSLS
Sbjct  54   SSSCSFIQNQFDCLKNGRPDKDYLKYRWQPTTCNLSRFDGEDMLSRIRGKSIMFVGDSLS  113

Query  426  LNMWNSLACMIHASVPTSK  482
            LN W SL CM+H +VP ++
Sbjct  114  LNQWQSLTCMLHTAVPHAQ  132



>ref|XP_004248190.1| PREDICTED: protein trichome birefringence-like 39 [Solanum lycopersicum]
Length=354

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +3

Query  171  EIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDL  350
            + +S+ GCN+F G+WV DSSYP+Y  S CPFID EF+C KY RPD  YLKY W+P SC+L
Sbjct  29   DAISNIGCNIFVGKWVFDSSYPMYDFSKCPFIDNEFNCQKYKRPDNLYLKYRWQPSSCNL  88

Query  351  PRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            PRF+G   L++++GK +MFVGDSLSLNMW SL CMIH+S+P +K +
Sbjct  89   PRFNGLVFLEKYKGKNIMFVGDSLSLNMWESLGCMIHSSLPNAKTS  134



>gb|AAO42294.1| unknown protein [Arabidopsis thaliana]
Length=357

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 89/131 (68%), Gaps = 1/131 (1%)
 Frame = +3

Query  96   LLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPE  275
            L+L     G  AQ+   H L      ++S G CNL RG+WV DSSYPLY   +CPFID E
Sbjct  7    LILFSSFPGLLAQSQ-QHFLGQNNTSLLSGGRCNLARGKWVYDSSYPLYSAFSCPFIDSE  65

Query  276  FDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACM  455
            F+C K GRPD  Y  + W+P SC LPRFDG   ++R RGKK+M VGDSLSLNM+ SLAC+
Sbjct  66   FNCQKAGRPDTNYQHFRWQPFSCPLPRFDGANFMRRMRGKKIMMVGDSLSLNMFESLACL  125

Query  456  IHASVPTSKIT  488
            +HAS+P +K +
Sbjct  126  LHASLPNAKYS  136



>ref|XP_010469762.1| PREDICTED: protein trichome birefringence-like 40 [Camelina sativa]
Length=366

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 87/131 (66%), Gaps = 7/131 (5%)
 Frame = +3

Query  96   LLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPE  275
            +LL Q       QNN S         ++S G CNL RG+WV DSSYPLY    CPFID E
Sbjct  22   VLLAQSQQQFLGQNNTS-------SSLLSGGRCNLSRGKWVYDSSYPLYSAYTCPFIDSE  74

Query  276  FDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACM  455
            F+C K GRPD  Y  + W+P SC LPRFDG   ++R RGKK+M VGDSLSLNM+ SLACM
Sbjct  75   FNCQKAGRPDTNYQHFRWQPFSCPLPRFDGANFMRRMRGKKIMMVGDSLSLNMFESLACM  134

Query  456  IHASVPTSKIT  488
            +HAS+P +K +
Sbjct  135  LHASLPNAKYS  145



>ref|XP_009787170.1| PREDICTED: protein trichome birefringence-like 39 [Nicotiana 
sylvestris]
Length=367

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            S GCN+FRG+WV DSSYPLY  S CPFI+ EF+C KY RPD  YLKY W+P SC+LPRF+
Sbjct  46   SSGCNIFRGKWVYDSSYPLYDFSTCPFIENEFNCQKYKRPDNLYLKYRWQPFSCNLPRFN  105

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSK  482
            G   L+++RGK +MFVGDSLSLNMW SLACMIH+ VP ++
Sbjct  106  GLIFLEKYRGKNIMFVGDSLSLNMWQSLACMIHSWVPKAR  145



>ref|XP_006410237.1| hypothetical protein EUTSA_v10016834mg [Eutrema salsugineum]
 gb|ESQ51690.1| hypothetical protein EUTSA_v10016834mg [Eutrema salsugineum]
Length=365

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 92/137 (67%), Gaps = 1/137 (1%)
 Frame = +3

Query  81   VIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSG-GCNLFRGRWVVDSSYPLYQPSNC  257
            ++ ++ L++     +    +  H L    K ++S    CN FRG+WV DSSYPLY P +C
Sbjct  8    ILASLFLILFSSFSKILAQSQEHFLGQNNKTLLSEERSCNWFRGKWVYDSSYPLYSPFSC  67

Query  258  PFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMW  437
            PFID EF+C K GRPD  Y  + W+P SC LPRFDG   ++R RGKK+M VGDSLSLNM+
Sbjct  68   PFIDSEFNCQKAGRPDTNYQHFRWQPFSCSLPRFDGANFMRRMRGKKIMMVGDSLSLNMF  127

Query  438  NSLACMIHASVPTSKIT  488
             SLAC++HAS+P +K +
Sbjct  128  ESLACLLHASLPNAKYS  144



>ref|XP_010273481.1| PREDICTED: protein trichome birefringence-like 41 [Nelumbo nucifera]
Length=366

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  189  GCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGG  368
            GC+LF+G WV D SYPLY  S CPFI+ EFDC   GRPDK YLKY WKP +CD+PRFDG 
Sbjct  43   GCDLFQGSWVYDDSYPLYNSSGCPFIEKEFDCQGNGRPDKLYLKYRWKPTTCDVPRFDGQ  102

Query  369  ELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            + L+R++GK +MFVGDSLSLN W SL CM+H SVP S  T
Sbjct  103  DFLRRYQGKSIMFVGDSLSLNQWQSLTCMLHKSVPKSNYT  142



>ref|XP_004500006.1| PREDICTED: uncharacterized protein LOC101510811 [Cicer arietinum]
Length=369

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 91/137 (66%), Gaps = 7/137 (5%)
 Frame = +3

Query  78   VVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNC  257
            V++   LL++Q H   A ++ + H        I +  GC+LF+G WV D SYPLY+ S C
Sbjct  16   VLLFHALLMIQVH---AKKDYIYH----NHNRIFAKSGCDLFQGNWVYDESYPLYESSQC  68

Query  258  PFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMW  437
            PFI+ +FDC   GRPD+ YLKY W+P  CDLPRF+G + L R RGK ++FVGDSLSLN W
Sbjct  69   PFIEKQFDCQNNGRPDQFYLKYRWQPTECDLPRFNGEDFLSRQRGKSILFVGDSLSLNQW  128

Query  438  NSLACMIHASVPTSKIT  488
             SL CM+H ++P +  T
Sbjct  129  QSLTCMLHIALPQTHYT  145



>ref|XP_004305456.2| PREDICTED: protein trichome birefringence-like 43 [Fragaria vesca 
subsp. vesca]
Length=363

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 6/139 (4%)
 Frame = +3

Query  72   SGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPS  251
            S V+++  LL    HG    Q++       G +      GC++F GRWV D SYPLY  S
Sbjct  7    SVVLMVLTLLHYHVHGDHQQQHSDEERRDAGNE------GCDIFGGRWVPDESYPLYSSS  60

Query  252  NCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLN  431
             CPFI+ EF CI+ GRPD+ YLK+ W+P  C+L RFDGG+ LKR+RGK  MFVGDSLSLN
Sbjct  61   QCPFIEREFTCIQNGRPDQLYLKFRWQPTGCNLTRFDGGDFLKRYRGKSFMFVGDSLSLN  120

Query  432  MWNSLACMIHASVPTSKIT  488
             W SL CM+H+ VP +  T
Sbjct  121  QWQSLTCMLHSVVPEANYT  139



>ref|XP_010273482.1| PREDICTED: protein trichome birefringence-like 41 [Nelumbo nucifera]
Length=364

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 94/148 (64%), Gaps = 7/148 (5%)
 Frame = +3

Query  45   MGVGQKVMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVD  224
            MG G    W     + +  L Q  G     NNVS    WG ++   S GC+LF+G+WV D
Sbjct  1    MGSGVDAYWCFFAPLIISSLQQVRGEHF--NNVSW---WGQRK--QSQGCDLFQGKWVYD  53

Query  225  SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVM  404
              YPLY PS CPFI+  FDC + GRPDK YLKY WKP+ CDLP F+G + L R RGK +M
Sbjct  54   EVYPLYDPSVCPFIEQLFDCQRNGRPDKLYLKYRWKPNGCDLPSFNGHDFLWRLRGKSIM  113

Query  405  FVGDSLSLNMWNSLACMIHASVPTSKIT  488
            FVGDSLSLN W SL CM+H ++P SK +
Sbjct  114  FVGDSLSLNQWQSLTCMLHTALPNSKYS  141



>gb|AAM65091.1| unknown [Arabidopsis thaliana]
Length=364

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 89/131 (68%), Gaps = 1/131 (1%)
 Frame = +3

Query  96   LLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPE  275
            L+L     G  AQ+   H L      ++S G CNL RG+WV DSSYPLY   +CPFID E
Sbjct  14   LILFSSFPGLLAQSQ-QHFLGQNNTSLLSGGRCNLARGKWVYDSSYPLYSAFSCPFIDSE  72

Query  276  FDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACM  455
            F+C K GRPD  Y  + W+P SC LPRFDG   ++R RGKK+M VGDSLSLNM+ SLAC+
Sbjct  73   FNCQKAGRPDTNYQHFRWQPFSCPLPRFDGANFMRRMRGKKIMMVGDSLSLNMFESLACL  132

Query  456  IHASVPTSKIT  488
            +HAS+P +K +
Sbjct  133  LHASLPNAKYS  143



>dbj|BAD44658.1| unnamed protein product [Arabidopsis thaliana]
Length=364

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 89/131 (68%), Gaps = 1/131 (1%)
 Frame = +3

Query  96   LLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPE  275
            L+L     G  AQ+   H L      ++S G CNL RG+WV DSSYPLY   +CPFID E
Sbjct  14   LILFSSFPGLLAQSQ-QHFLGQNNTSLLSGGRCNLARGKWVYDSSYPLYSAFSCPFIDSE  72

Query  276  FDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACM  455
            F+C K GRPD  Y  + W+P SC LPRFDG   ++R RGKK+M VGDSLSLNM+ SLAC+
Sbjct  73   FNCQKAGRPDTNYQHFRWQPFSCPLPRFDGANFMRRMRGKKIMMVGDSLSLNMFESLACL  132

Query  456  IHASVPTSKIT  488
            +HAS+P +K +
Sbjct  133  LHASLPNAKYS  143



>ref|XP_008342762.1| PREDICTED: protein trichome birefringence-like 43 isoform X1 
[Malus domestica]
Length=367

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 93/146 (64%), Gaps = 5/146 (3%)
 Frame = +3

Query  45   MGVGQKVMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVD  224
            M     V  + V++  +L  +QG       +N++       K +V  G C+LF+G+WV D
Sbjct  1    METSISVSVAAVLVFCLLCQIQGKVAFGGVDNIN-----ATKNVVRIGSCDLFQGKWVYD  55

Query  225  SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVM  404
             SYPLY  ++CPFI+ EF+C  +GRPDK+Y KY W+P SC +PR  G   L+R RGK+++
Sbjct  56   RSYPLYTSTDCPFIEKEFNCQNHGRPDKEYQKYRWQPTSCQIPRITGRSFLQRLRGKRIL  115

Query  405  FVGDSLSLNMWNSLACMIHASVPTSK  482
            FVGDSLSLN W SL CMIH S P +K
Sbjct  116  FVGDSLSLNQWQSLTCMIHKSAPEAK  141



>ref|NP_001077985.1| protein TRICHOME BIREFRINGENCE-LIKE 40 [Arabidopsis thaliana]
 sp|Q67XC4.2|TBL40_ARATH RecName: Full=Protein trichome birefringence-like 40 [Arabidopsis 
thaliana]
 gb|AEC08494.1| uncharacterized protein AT2G31110 [Arabidopsis thaliana]
Length=364

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 89/131 (68%), Gaps = 1/131 (1%)
 Frame = +3

Query  96   LLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPE  275
            L+L     G  AQ+   H L      ++S G CNL RG+WV DSSYPLY   +CPFID E
Sbjct  14   LILFSSFPGLLAQSQ-QHFLGQNNTSLLSGGRCNLARGKWVYDSSYPLYSAFSCPFIDSE  72

Query  276  FDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACM  455
            F+C K GRPD  Y  + W+P SC LPRFDG   ++R RGKK+M VGDSLSLNM+ SLAC+
Sbjct  73   FNCQKAGRPDTNYQHFRWQPFSCPLPRFDGANFMRRMRGKKIMMVGDSLSLNMFESLACL  132

Query  456  IHASVPTSKIT  488
            +HAS+P +K +
Sbjct  133  LHASLPNAKYS  143



>ref|XP_010414182.1| PREDICTED: protein trichome birefringence-like 40 [Camelina sativa]
Length=366

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 87/131 (66%), Gaps = 7/131 (5%)
 Frame = +3

Query  96   LLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPE  275
            +LL Q       QNN S         ++S G CNL RG+WV DSSYPLY    CPFID E
Sbjct  22   VLLAQSQQQFLGQNNTS-------SSLLSGGRCNLSRGKWVYDSSYPLYSAYTCPFIDSE  74

Query  276  FDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACM  455
            F+C K GRPD  Y  + W+P SC LPRFDG   ++R RGKK+M VGDSLSLNM+ SLACM
Sbjct  75   FNCQKAGRPDTNYQHFRWQPFSCPLPRFDGANFMRRMRGKKIMMVGDSLSLNMFESLACM  134

Query  456  IHASVPTSKIT  488
            +HAS+P +K +
Sbjct  135  LHASLPNAKYS  145



>ref|XP_006446762.1| hypothetical protein CICLE_v10015634mg [Citrus clementina]
 gb|ESR60002.1| hypothetical protein CICLE_v10015634mg [Citrus clementina]
Length=375

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 86/107 (80%), Gaps = 2/107 (2%)
 Frame = +3

Query  168  KEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCD  347
            ++ +  G CN+F+G+WV D+SYPLY  S+CPF+DPEFDC KYGRPD  YLKY W+P SC 
Sbjct  52   RKSLGGGKCNIFQGKWVYDASYPLY--SHCPFVDPEFDCQKYGRPDDIYLKYRWQPFSCS  109

Query  348  LPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            +PRF+G   L+++RGKK+MFVGDSLSLN W SLACMIH+ VP +K +
Sbjct  110  IPRFNGLYFLEKFRGKKIMFVGDSLSLNQWQSLACMIHSWVPKTKYS  156



>ref|XP_006348847.1| PREDICTED: uncharacterized protein LOC102593679 [Solanum tuberosum]
Length=362

 Score =   150 bits (378),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +3

Query  186  GGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDG  365
              CN++ G+WV DSSYPLY  SNCPFID EF+C KY RPD  YLKY W+P SC+LPRF+G
Sbjct  42   SSCNIYSGKWVYDSSYPLYDSSNCPFIDNEFNCQKYKRPDNLYLKYRWQPFSCNLPRFNG  101

Query  366  GELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSK  482
               L+++RGK +MFVGDSLSLNMW SLACMIH+ VP +K
Sbjct  102  LVFLEKYRGKNIMFVGDSLSLNMWESLACMIHSWVPNAK  140



>ref|XP_006376352.1| hypothetical protein POPTR_0013s12290g [Populus trichocarpa]
 gb|ERP54149.1| hypothetical protein POPTR_0013s12290g [Populus trichocarpa]
Length=368

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 93/139 (67%), Gaps = 8/139 (6%)
 Frame = +3

Query  81   VIIAVLLLVQGHGGRAAQNNVSHLLSW-----GGKEIVSSGGCNLFRGRWVVDSSYPLYQ  245
            + +++ L +  H    A    +   S+       +E+  +G CN FRG+WV D  YPLY 
Sbjct  9    MFLSLFLFISYHTATEASKLSAQSFSFSNGTSNAREL--AGKCNWFRGKWVFDPKYPLYD  66

Query  246  PSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLS  425
             SNCPFIDP+F+C KYGR D  YLKY W+P +CDLPRF+G   L++WRGKK+MFVGDSLS
Sbjct  67   -SNCPFIDPQFNCQKYGRHDSSYLKYRWQPFACDLPRFNGLYFLEKWRGKKIMFVGDSLS  125

Query  426  LNMWNSLACMIHASVPTSK  482
            LN W SL C+IH+ VP SK
Sbjct  126  LNQWISLTCLIHSWVPNSK  144



>ref|XP_008437676.1| PREDICTED: protein trichome birefringence-like 38 [Cucumis melo]
Length=346

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +3

Query  192  CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGE  371
            C+L+ G+W +DSSYP+Y  S CPFI  EFDCIKYGRPD+ YL + W+P  CDLPRFDG +
Sbjct  33   CDLYSGKWELDSSYPMYNSSECPFIRKEFDCIKYGRPDRLYLHFRWQPLHCDLPRFDGED  92

Query  372  LLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            LL+R+RGKK+MF+GDS+SLN W SL C++HA++P S I 
Sbjct  93   LLERFRGKKIMFIGDSISLNQWQSLICLLHAALPNSTIV  131



>ref|XP_004143813.1| PREDICTED: uncharacterized protein LOC101214809 [Cucumis sativus]
 ref|XP_004164720.1| PREDICTED: uncharacterized LOC101214809 [Cucumis sativus]
Length=351

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +3

Query  192  CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGE  371
            C+++ G+W +DSSYP+Y  S CPFI  EFDCIKYGRPD+ YL + W+P  CDLPRFDG +
Sbjct  14   CDIYSGKWELDSSYPMYNSSECPFIRKEFDCIKYGRPDRLYLHFRWQPLHCDLPRFDGED  73

Query  372  LLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKI  485
            LL+R+RGKK+MF+GDS+S+N W SLAC++HA++P S I
Sbjct  74   LLERFRGKKIMFIGDSISINQWESLACLLHAALPNSTI  111



>gb|KFK31236.1| hypothetical protein AALP_AA6G086200 [Arabis alpina]
Length=361

 Score =   150 bits (378),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 93/148 (63%), Gaps = 8/148 (5%)
 Frame = +3

Query  45   MGVGQKVMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVD  224
            MG+  +   + + +I    L Q       QNN + L             CN FRG+WV D
Sbjct  1    MGLCFQFNLASLFLILFSSLAQSQQHFLGQNNTTLL--------EEERSCNWFRGKWVYD  52

Query  225  SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVM  404
            SSYPLY P +CPFID EF+C K GRPD  Y  + W+P SC LPRFDGG  +++ RGKK+M
Sbjct  53   SSYPLYSPYSCPFIDSEFNCQKAGRPDSNYQHFRWQPFSCSLPRFDGGNFMRKMRGKKIM  112

Query  405  FVGDSLSLNMWNSLACMIHASVPTSKIT  488
             VGDSLSLNM+ SLAC+IHAS+P +K +
Sbjct  113  LVGDSLSLNMFESLACLIHASLPNAKYS  140



>ref|XP_009132768.1| PREDICTED: protein trichome birefringence-like 40 [Brassica rapa]
 emb|CDX84800.1| BnaA03g14300D [Brassica napus]
Length=365

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 89/130 (68%), Gaps = 8/130 (6%)
 Frame = +3

Query  99   LLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEF  278
            LL Q       QNN S L    G+E      CN FRG+WV DSSYPLY P +CPFI+PEF
Sbjct  23   LLAQSQQHFLGQNNTSLL----GEE----RSCNWFRGKWVYDSSYPLYSPFSCPFINPEF  74

Query  279  DCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMI  458
            +C K GRPD  Y  + W+P SC LPRFDG   ++R RGKK+M VGDSLSLNM+ SLAC+I
Sbjct  75   NCQKTGRPDTNYQHFRWQPFSCSLPRFDGVNFMRRMRGKKIMMVGDSLSLNMFESLACLI  134

Query  459  HASVPTSKIT  488
            HAS+P +K +
Sbjct  135  HASLPNAKYS  144



>ref|XP_004295668.1| PREDICTED: protein trichome birefringence-like 43 [Fragaria vesca 
subsp. vesca]
Length=370

 Score =   150 bits (378),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 82/113 (73%), Gaps = 0/113 (0%)
 Frame = +3

Query  150  LLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAW  329
            L ++   E    G C+LF G WV D +YPLY  S+CPFID E DC K GRPDKQYLKY W
Sbjct  35   LKNYKANESQIGGSCDLFDGSWVYDETYPLYDTSSCPFIDREVDCQKNGRPDKQYLKYRW  94

Query  330  KPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            KP  C LPRF+G +LL+R +GKK++FVGDSLS N W SL CM+H++VP +K T
Sbjct  95   KPKGCTLPRFNGQDLLRRLKGKKILFVGDSLSYNQWQSLTCMLHSAVPKAKYT  147



>ref|XP_011464795.1| PREDICTED: protein trichome birefringence-like 43 [Fragaria vesca 
subsp. vesca]
Length=356

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 92/136 (68%), Gaps = 10/136 (7%)
 Frame = +3

Query  81   VIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCP  260
             ++ V+ L       AAQ+++ H ++          GC++ RG WV D SYPLY+ S+CP
Sbjct  5    AVLVVMFLFSLAVASAAQHHIVHGIA----------GCDVSRGNWVHDDSYPLYEASSCP  54

Query  261  FIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWN  440
            FI  EF+C+  GRPD  YLKY W+P  C+LPRF+G +LL+R RGK +MFVGDSLSLN W 
Sbjct  55   FIQKEFNCVNNGRPDMDYLKYRWQPLGCNLPRFNGIDLLRRLRGKSIMFVGDSLSLNQWQ  114

Query  441  SLACMIHASVPTSKIT  488
            SL CM+H +VPT+K T
Sbjct  115  SLTCMLHTAVPTAKYT  130



>ref|XP_011080615.1| PREDICTED: protein trichome birefringence-like 38 [Sesamum indicum]
Length=366

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = +3

Query  177  VSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPR  356
            +   GCNL++G+WV D SYPL+  S CP I  EFDC+KYGRPD QYLKY W+PD CDLPR
Sbjct  37   IKQKGCNLYQGKWVYDESYPLFDSSKCPSIRKEFDCLKYGRPDHQYLKYRWQPDGCDLPR  96

Query  357  FDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            FDGG+ L+R +GKK+MFVGDS+S N W SL C++   VP S I+
Sbjct  97   FDGGDFLRRVKGKKIMFVGDSVSSNHWQSLVCLLSQHVPGSNIS  140



>emb|CDP06046.1| unnamed protein product [Coffea canephora]
Length=220

 Score =   145 bits (367),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 97/147 (66%), Gaps = 3/147 (2%)
 Frame = +3

Query  45   MGVGQ-KVMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVV  221
            MG GQ + + + ++II + ++       A    +SH      + I  S GC++F+G W  
Sbjct  1    MGSGQFRSVNTFLLIICLFVIFVQQSSNALLLELSHNFKRSSESI--SSGCDIFQGSWSY  58

Query  222  DSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKV  401
            D +YPLY  S+CPFI+  FDC + GRPD+ YLK+ WKP+ C+LP+F+    L+++RGKK+
Sbjct  59   DDTYPLYNASSCPFIEKPFDCQRNGRPDQLYLKFKWKPNRCELPQFNAPHFLRKFRGKKI  118

Query  402  MFVGDSLSLNMWNSLACMIHASVPTSK  482
            +FVGDSLSLN W SL CM+HA++P S 
Sbjct  119  LFVGDSLSLNQWQSLTCMLHAALPQSN  145



>emb|CDY23962.1| BnaC03g17290D [Brassica napus]
Length=365

 Score =   149 bits (377),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 89/130 (68%), Gaps = 8/130 (6%)
 Frame = +3

Query  99   LLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEF  278
            LL Q       QNN S L    G+E      CN FRG+WV DSSYPLY P +CPFI+PEF
Sbjct  23   LLAQSQQHFLGQNNTSLL----GEE----RSCNWFRGKWVYDSSYPLYSPFSCPFINPEF  74

Query  279  DCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMI  458
            +C K GRPD  Y  + W+P SC LPRFDG   ++R RGKK+M VGDSLSLNM+ SLAC+I
Sbjct  75   NCQKTGRPDTNYQHFRWQPFSCSLPRFDGVNFMRRMRGKKIMMVGDSLSLNMFESLACLI  134

Query  459  HASVPTSKIT  488
            HAS+P +K +
Sbjct  135  HASLPNAKYS  144



>ref|XP_006582288.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN07756.1| hypothetical protein glysoja_033842 [Glycine soja]
Length=353

 Score =   149 bits (376),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            +G CNLF G+WV D+SYPLY PS CPF+DP+F+C K+GR DK Y KY W P SC LPRF+
Sbjct  32   AGTCNLFSGKWVYDASYPLYDPSTCPFVDPQFNCQKHGRSDKLYQKYRWMPFSCPLPRFN  91

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            G   L+++RGKK+MFVGDSLSLN +NSLACM+HA VP S+  +
Sbjct  92   GLNFLEKYRGKKIMFVGDSLSLNQFNSLACMLHAWVPKSRSIF  134



>ref|XP_009354245.1| PREDICTED: protein trichome birefringence-like 43 [Pyrus x bretschneideri]
Length=366

 Score =   149 bits (376),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 90/136 (66%), Gaps = 5/136 (4%)
 Frame = +3

Query  75   GVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSN  254
             V++  +L  +QG       +N++       K +V  G C+LF+G+WV D SYPLY  ++
Sbjct  10   AVLVFCLLCQIQGKVAYGGVDNIN-----ATKNVVRIGRCDLFQGKWVYDRSYPLYTSTD  64

Query  255  CPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNM  434
            CPFI+ EF+C  +GRPDK+Y KY W+P SC +PR  G   L+R RGK+++FVGDSLSLN 
Sbjct  65   CPFIEKEFNCQNHGRPDKEYQKYRWQPTSCQIPRITGRSFLQRLRGKRILFVGDSLSLNQ  124

Query  435  WNSLACMIHASVPTSK  482
            W SL CMIH S P +K
Sbjct  125  WQSLTCMIHKSAPEAK  140



>ref|XP_010064517.1| PREDICTED: protein trichome birefringence-like 42 [Eucalyptus 
grandis]
Length=548

 Score =   151 bits (382),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +3

Query  192  CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGE  371
            CNL+ G W+ D SYP+Y+ SNCPFIDP FDC+K GR DK YLKY WKP  CDLPRFDG +
Sbjct  29   CNLYEGSWLFDDSYPIYEASNCPFIDPAFDCLKNGRTDKDYLKYRWKPSKCDLPRFDGRD  88

Query  372  LLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTS  479
             L+R RGK ++FVGDSLS NMW SL CM+H++VP S
Sbjct  89   FLERQRGKNILFVGDSLSKNMWQSLTCMLHSAVPES  124



>emb|CDP15911.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   149 bits (376),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 86/117 (74%), Gaps = 2/117 (2%)
 Frame = +3

Query  138  NVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYL  317
            N+S   S G   + S  GCN+FRG+WV D+ YPLY  ++CPFID EF+C+ Y RPDK YL
Sbjct  34   NISTTSSVGATMLAS--GCNIFRGKWVYDAQYPLYDYASCPFIDTEFNCLLYKRPDKLYL  91

Query  318  KYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            KY W+P SC+LPRF+G   L++WRGK +MFVGDSLS NMW SL CMIH+  P ++ +
Sbjct  92   KYRWQPFSCNLPRFNGLYFLEKWRGKNIMFVGDSLSFNMWASLGCMIHSWAPKARYS  148



>ref|XP_004295669.1| PREDICTED: protein trichome birefringence-like 42 [Fragaria vesca 
subsp. vesca]
 ref|XP_011460825.1| PREDICTED: protein trichome birefringence-like 42 [Fragaria vesca 
subsp. vesca]
Length=369

 Score =   149 bits (376),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 80/103 (78%), Gaps = 2/103 (2%)
 Frame = +3

Query  180  SSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRF  359
            S+ GCNLF+G WVVD  YPLY  S+CPFI   F+CIK GRPD+QYLKY WKP  CDLPRF
Sbjct  46   SANGCNLFQGSWVVDDEYPLYNASSCPFIG--FNCIKNGRPDQQYLKYRWKPTGCDLPRF  103

Query  360  DGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            +G + ++R+RGKK+MFVGDSLS NMW SL CM+H +   SK T
Sbjct  104  NGLDFMERYRGKKIMFVGDSLSNNMWQSLTCMLHVAALNSKYT  146



>gb|AAF88130.1|AC021043_23 Unknown protein [Arabidopsis thaliana]
Length=368

 Score =   149 bits (376),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 82/109 (75%), Gaps = 12/109 (11%)
 Frame = +3

Query  165  GKEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSC  344
            GK+   + GCNLF+GRWV D+SYP Y  S CPFID EFDC+K+GRPDKQ+LK        
Sbjct  52   GKKQRRASGCNLFQGRWVFDASYPFYDSSKCPFIDGEFDCLKFGRPDKQFLK--------  103

Query  345  DLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
                FDGG  L+++RGK+VMFVGDSLSLNMW SLACMIHASVP +K T+
Sbjct  104  ----FDGGAFLRKYRGKRVMFVGDSLSLNMWESLACMIHASVPNAKTTF  148



>ref|XP_006469036.1| PREDICTED: protein YLS7-like [Citrus sinensis]
 gb|KDO63325.1| hypothetical protein CISIN_1g017063mg [Citrus sinensis]
Length=378

 Score =   149 bits (376),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 85/107 (79%), Gaps = 2/107 (2%)
 Frame = +3

Query  168  KEIVSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCD  347
            ++ +  G CN+F+G+WV D+SYPLY  S+CPF+DPEFDC KYGRPD  YLKY W+P SC 
Sbjct  55   RKSLGGGKCNIFQGKWVYDASYPLY--SHCPFVDPEFDCQKYGRPDDIYLKYRWQPFSCS  112

Query  348  LPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            +PRF+G   L+++RGKK+MFVGDSLSLN W SLACMIH+  P +K +
Sbjct  113  IPRFNGLYFLEKFRGKKIMFVGDSLSLNQWQSLACMIHSWAPKTKYS  159



>gb|EYU43352.1| hypothetical protein MIMGU_mgv1a017695mg [Erythranthe guttata]
Length=357

 Score =   149 bits (375),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 102/150 (68%), Gaps = 13/150 (9%)
 Frame = +3

Query  45   MGVGQKVMWSGVVIIAVLLLVQGHGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVD  224
            MG  Q+ + S    I +L  V  +     + NV       G  I +   CNLF+G+WV +
Sbjct  1    MGFKQQTLLS----IFLLFTVSANSDLIEEKNVE-----DGDLIANK--CNLFQGQWVYN  49

Query  225  SSY-PLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKV  401
            SS  PLY  S+CP+ID  +DC K+GR DKQYLKY WKP SC+LPRFDG +LL+RW+GK +
Sbjct  50   SSSNPLYDSSSCPYIDT-YDCQKFGRTDKQYLKYTWKPMSCNLPRFDGVDLLRRWKGKNI  108

Query  402  MFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            M+VGDS+SL+ W+S+ACM+HASVP +K TY
Sbjct  109  MYVGDSISLDQWSSIACMLHASVPNAKTTY  138



>ref|XP_010052993.1| PREDICTED: protein trichome birefringence-like 38 [Eucalyptus 
grandis]
 gb|KCW89680.1| hypothetical protein EUGRSUZ_A01950 [Eucalyptus grandis]
Length=362

 Score =   149 bits (375),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 91/140 (65%), Gaps = 9/140 (6%)
 Frame = +3

Query  78   VVIIAVLLLVQGHGGRAA--QNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYPLYQPS  251
            V+ + ++ ++QG  G      NNV         E     GC++F+GRWV DSSYPLY   
Sbjct  7    VICVLLIFILQGVQGEDVDVHNNVE-------IEKHRKRGCDVFQGRWVYDSSYPLYNSF  59

Query  252  NCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLN  431
            NCPF++  FDC K GR D+ YLKY W+P SC+LPRF G   LK +RGK++MFVGDSLSLN
Sbjct  60   NCPFLEQAFDCQKNGRHDRSYLKYRWQPLSCNLPRFSGSNFLKNFRGKRIMFVGDSLSLN  119

Query  432  MWNSLACMIHASVPTSKITY  491
             W S  CM+HASVP +K  +
Sbjct  120  QWQSFTCMLHASVPEAKYAF  139



>ref|XP_008783903.1| PREDICTED: protein trichome birefringence-like 38 [Phoenix dactylifera]
Length=358

 Score =   149 bits (375),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 84/110 (76%), Gaps = 1/110 (1%)
 Frame = +3

Query  156  SWGGKEI-VSSGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWK  332
            SWG     ++   C+LF G WV DSSYPLY  ++CPFI  EFDC+K+GRPD  YLKY W 
Sbjct  25   SWGATVARLNPPACDLFDGSWVYDSSYPLYDSASCPFIRREFDCLKFGRPDMMYLKYRWN  84

Query  333  PDSCDLPRFDGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSK  482
            P+ C LPRFDG +LL+RWRGKK+MFVGDSLSLN ++SL C++HA+VP  +
Sbjct  85   PNGCYLPRFDGRDLLRRWRGKKIMFVGDSLSLNQFDSLLCLLHAAVPNGR  134



>ref|XP_010670414.1| PREDICTED: protein trichome birefringence-like 38 [Beta vulgaris 
subsp. vulgaris]
Length=357

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +3

Query  192  CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGE  371
            CN+++G W  D+SYP+Y  S CP I  EFDC+KYGR DK YLKY W+PD CD+PRFDG +
Sbjct  37   CNIYKGHWAWDASYPMYDSSKCPDIRREFDCLKYGRTDKYYLKYRWQPDDCDIPRFDGVD  96

Query  372  LLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
             L R RGKK+M+VGDSLSLN W SL CM+HA+VP S IT
Sbjct  97   FLTRMRGKKIMYVGDSLSLNNWQSLVCMLHAAVPNSNIT  135



>ref|XP_008345148.1| PREDICTED: protein trichome birefringence-like 38 [Malus domestica]
Length=364

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 99/146 (68%), Gaps = 14/146 (10%)
 Frame = +3

Query  66   MWSGVVIIAVLLLVQG---HGGRAAQNNVSHLLSWGGKEIVSSGGCNLFRGRWVVDSSYP  236
            M S V +++ L+++Q    HG   A  +         K++  S GC+ F+G W++D+SYP
Sbjct  8    MISSVSLLSQLVILQPCKVHGNSDAGED---------KQLKQSNGCDYFQGSWIIDNSYP  58

Query  237  LYQPSNCP-FIDPEFDCIKYGRPDKQYLKYAWKPDS-CDLPRFDGGELLKRWRGKKVMFV  410
            LY  S CP FID EFDC+K GRPDK+YLKY WKP S CDLPRF+G ++L+R +GKK++ V
Sbjct  59   LYDSSKCPLFIDREFDCLKNGRPDKEYLKYRWKPASDCDLPRFNGEDMLRRVKGKKILXV  118

Query  411  GDSLSLNMWNSLACMIHASVPTSKIT  488
            GDSLS N W SL CM+H +VP S  T
Sbjct  119  GDSLSFNQWQSLTCMLHTAVPQSNYT  144



>ref|XP_010068952.1| PREDICTED: protein trichome birefringence-like 38 [Eucalyptus 
grandis]
Length=376

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 96/160 (60%), Gaps = 26/160 (16%)
 Frame = +3

Query  57   QKVMWSGVVIIAVLL----------------LVQGHGGRAAQNNVSHLLSWGGKEIVSSG  188
            Q+++ + +V++A+L+                L+QG G    +          GK+     
Sbjct  6    QRIVLAILVVLAILVAISLALDSCVSSAGAGLLQGEGATGVK----------GKKQEPEE  55

Query  189  GCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGG  368
             CN++ G W  D SYPLY PS CPF+  EFDC KYGRPD+ YLKY W+P+ CDLPRFD  
Sbjct  56   NCNVYEGSWAYDPSYPLYDPSACPFVRKEFDCFKYGRPDRLYLKYRWQPNGCDLPRFDAQ  115

Query  369  ELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
              L R++GKK+M++GDSLSLN W SL C++HA  P S I+
Sbjct  116  GFLSRFQGKKIMYIGDSLSLNNWQSLICLLHAGAPNSSIS  155



>gb|AFK40281.1| unknown [Lotus japonicus]
Length=361

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            +G CN F+G+WV D+SYPLY PS+CPFID +F+C K+GR DK Y KY W P SC LPRF+
Sbjct  40   AGTCNWFQGKWVYDASYPLYDPSSCPFIDQQFNCQKHGRKDKLYQKYRWTPFSCSLPRFN  99

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            G   L R RGKK+MFVGDSLSLN +NSLACM+HA VP S+ T+
Sbjct  100  GLSFLNRNRGKKIMFVGDSLSLNQFNSLACMLHAWVPKSRATF  142



>ref|XP_007214202.1| hypothetical protein PRUPE_ppa022459mg, partial [Prunus persica]
 gb|EMJ15401.1| hypothetical protein PRUPE_ppa022459mg, partial [Prunus persica]
Length=324

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +3

Query  192  CNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFDGGE  371
            C+LF G WV+D SYPLY  S+CPFI+ EFDC   GRPD +YLKY WKPD+C LPRF+G +
Sbjct  1    CDLFHGSWVLDKSYPLYDTSSCPFIEKEFDCQNNGRPDDRYLKYRWKPDACALPRFNGRD  60

Query  372  LLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVP  473
            LLKR +GKK++FVGDSLSLN W SL CM+HA+VP
Sbjct  61   LLKRLKGKKILFVGDSLSLNQWQSLTCMLHAAVP  94



>ref|XP_007050058.1| Trichome birefringence-like 39 [Theobroma cacao]
 gb|EOX94215.1| Trichome birefringence-like 39 [Theobroma cacao]
Length=360

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            +  CN FRG+WV   +YPLY  S CPFID EFDC KYGRPD  YLKY W+P SC +PRF+
Sbjct  38   ASNCNWFRGKWVYYPTYPLYDASKCPFIDGEFDCKKYGRPDNMYLKYRWQPFSCSIPRFN  97

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            G   L++WRGKK+MFVGDSLSLN + SL CMI A VP SKI+Y
Sbjct  98   GLYFLEKWRGKKIMFVGDSLSLNQFQSLTCMIQAWVPNSKISY  140



>ref|XP_010524990.1| PREDICTED: protein trichome birefringence-like 39 [Tarenaya hassleriana]
Length=370

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +3

Query  183  SGGCNLFRGRWVVDSSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRFD  362
            +G CN FRGRWV D+ YPLY P  CPFIDP+F+C KYGRPD  YLKY W+P SC LPRF+
Sbjct  48   AGKCNWFRGRWVYDAKYPLYDPYKCPFIDPQFNCKKYGRPDSLYLKYRWQPFSCSLPRFN  107

Query  363  GGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKIT  488
            G   L++ +GKK+MFVGDSLS NMW SLAC+I++  P S+ T
Sbjct  108  GLYFLRKMKGKKIMFVGDSLSSNMWQSLACLIYSWAPNSRFT  149



>ref|XP_009357163.1| PREDICTED: protein trichome birefringence-like 39 [Pyrus x bretschneideri]
Length=371

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 79/104 (76%), Gaps = 1/104 (1%)
 Frame = +3

Query  183  SGGCNLFRGRWVVD-SSYPLYQPSNCPFIDPEFDCIKYGRPDKQYLKYAWKPDSCDLPRF  359
            +G CN FRG WV D SS P Y  S CPFIDP+FDC+KYGRPD  +LKY W+P SC LPRF
Sbjct  49   AGKCNWFRGTWVYDASSKPPYYSSTCPFIDPQFDCLKYGRPDTAFLKYRWQPFSCALPRF  108

Query  360  DGGELLKRWRGKKVMFVGDSLSLNMWNSLACMIHASVPTSKITY  491
            +G   L++WRGKK+MFVGDSLS N W SL CM+HA VP S+ +Y
Sbjct  109  NGLRFLEKWRGKKIMFVGDSLSFNQWVSLTCMLHAWVPNSRTSY  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555143417780