BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF011B23

Length=399
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006361724.1|  PREDICTED: cellulose synthase A catalytic su...    207   6e-59   Solanum tuberosum [potatoes]
ref|XP_004245031.1|  PREDICTED: cellulose synthase A catalytic su...    205   3e-58   Solanum lycopersicum
emb|CBI21020.3|  unnamed protein product                                203   5e-58   Vitis vinifera
gb|AGC97433.2|  cellulose synthase                                      204   7e-58   Boehmeria nivea [Chinese silk-plant]
ref|XP_009785781.1|  PREDICTED: cellulose synthase A catalytic su...    204   8e-58   Nicotiana sylvestris
ref|XP_010648652.1|  PREDICTED: cellulose synthase A catalytic su...    204   9e-58   Vitis vinifera
emb|CAN60659.1|  hypothetical protein VITISV_018069                     203   1e-57   Vitis vinifera
ref|XP_010110357.1|  Protein radially swollen 1                         203   1e-57   Morus notabilis
ref|XP_009768318.1|  PREDICTED: cellulose synthase A catalytic su...    202   3e-57   Nicotiana sylvestris
ref|XP_009623502.1|  PREDICTED: cellulose synthase A catalytic su...    202   3e-57   Nicotiana tomentosiformis
gb|AGV22109.1|  cellulose synthase 7                                    202   4e-57   Betula luminifera [liang ye hua]
ref|XP_007221583.1|  hypothetical protein PRUPE_ppa000611mg             202   4e-57   Prunus persica
ref|XP_008219478.1|  PREDICTED: cellulose synthase A catalytic su...    200   2e-56   Prunus mume [ume]
ref|XP_008394069.1|  PREDICTED: cellulose synthase A catalytic su...    199   2e-56   
ref|XP_008387657.1|  PREDICTED: cellulose synthase A catalytic su...    197   2e-56   
ref|XP_009597841.1|  PREDICTED: cellulose synthase A catalytic su...    199   5e-56   Nicotiana tomentosiformis
ref|XP_009355721.1|  PREDICTED: cellulose synthase A catalytic su...    198   5e-56   Pyrus x bretschneideri [bai li]
ref|XP_008366693.1|  PREDICTED: cellulose synthase A catalytic su...    198   1e-55   Malus domestica [apple tree]
gb|AAT66940.1|  CesA1                                                   197   2e-55   Acacia mangium
ref|XP_006450469.1|  hypothetical protein CICLE_v10007296mg             196   3e-55   Citrus clementina [clementine]
ref|XP_002308657.1|  cellulose synthase family protein                  196   3e-55   
gb|KDO61693.1|  hypothetical protein CISIN_1g001399mg                   196   3e-55   Citrus sinensis [apfelsine]
emb|CDP13491.1|  unnamed protein product                                196   3e-55   Coffea canephora [robusta coffee]
ref|XP_006483337.1|  PREDICTED: cellulose synthase A catalytic su...    196   4e-55   
gb|AAO25536.1|  cellulose synthase                                      196   4e-55   Populus tremuloides
ref|XP_007013842.1|  Cellulose synthase 1                               195   8e-55   Theobroma cacao [chocolate]
gb|KDP33612.1|  hypothetical protein JCGZ_07183                         194   2e-54   Jatropha curcas
gb|AFZ78556.1|  cellulose synthase                                      193   5e-54   Populus tomentosa [Chinese white poplar]
ref|XP_011039709.1|  PREDICTED: cellulose synthase A catalytic su...    192   9e-54   Populus euphratica
gb|AFZ78558.1|  cellulose synthase                                      191   2e-53   Populus tomentosa [Chinese white poplar]
ref|XP_002324291.1|  TGACG-motif binding family protein                 190   7e-53   Populus trichocarpa [western balsam poplar]
ref|XP_011026459.1|  PREDICTED: cellulose synthase A catalytic su...    189   8e-53   Populus euphratica
ref|XP_002515536.1|  Cellulose synthase A catalytic subunit 6 [UD...    189   1e-52   Ricinus communis
ref|XP_011081578.1|  PREDICTED: cellulose synthase A catalytic su...    189   2e-52   Sesamum indicum [beniseed]
gb|EYU32338.1|  hypothetical protein MIMGU_mgv1a000544mg                188   3e-52   Erythranthe guttata [common monkey flower]
ref|XP_010689561.1|  PREDICTED: cellulose synthase A catalytic su...    188   3e-52   Beta vulgaris subsp. vulgaris [field beet]
gb|KGN60109.1|  hypothetical protein Csa_3G878780                       188   3e-52   Cucumis sativus [cucumbers]
ref|XP_010670651.1|  PREDICTED: cellulose synthase A catalytic su...    188   3e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010250039.1|  PREDICTED: probable cellulose synthase A cat...    187   4e-52   Nelumbo nucifera [Indian lotus]
ref|XP_008466397.1|  PREDICTED: cellulose synthase A catalytic su...    187   4e-52   Cucumis melo [Oriental melon]
ref|XP_004136343.1|  PREDICTED: cellulose synthase A catalytic su...    187   4e-52   Cucumis sativus [cucumbers]
gb|KJB53894.1|  hypothetical protein B456_009G010200                    184   3e-51   Gossypium raimondii
ref|XP_010048223.1|  PREDICTED: cellulose synthase A catalytic su...    185   3e-51   Eucalyptus grandis [rose gum]
gb|KJB53892.1|  hypothetical protein B456_009G010200                    185   3e-51   Gossypium raimondii
gb|AFB18635.1|  CESA6                                                   185   4e-51   Gossypium hirsutum [American cotton]
gb|KHG11461.1|  Cellulose synthase A catalytic subunit 1 [UDP-for...    185   4e-51   Gossypium arboreum [tree cotton]
ref|XP_004291468.1|  PREDICTED: cellulose synthase A catalytic su...    184   8e-51   Fragaria vesca subsp. vesca
ref|XP_011071168.1|  PREDICTED: cellulose synthase A catalytic su...    182   3e-50   Sesamum indicum [beniseed]
gb|AHL45023.1|  cellulose synthase 1A                                   182   3e-50   Linum usitatissimum
gb|AHL45024.1|  cellulose synthase 1B                                   182   3e-50   Linum usitatissimum
ref|XP_010254360.1|  PREDICTED: probable cellulose synthase A cat...    180   2e-49   Nelumbo nucifera [Indian lotus]
ref|XP_011459196.1|  PREDICTED: cellulose synthase A catalytic su...    179   6e-49   Fragaria vesca subsp. vesca
gb|KCW81421.1|  hypothetical protein EUGRSUZ_C02801                     174   2e-47   Eucalyptus grandis [rose gum]
gb|KCW81422.1|  hypothetical protein EUGRSUZ_C02801                     174   2e-47   Eucalyptus grandis [rose gum]
ref|NP_001289657.1|  cellulose synthase A catalytic subunit 1           174   3e-47   Eucalyptus grandis [rose gum]
gb|AEK31219.1|  cellulose synthase A                                    174   3e-47   Eucalyptus camaldulensis
ref|XP_004501313.1|  PREDICTED: cellulose synthase A catalytic su...    173   6e-47   Cicer arietinum [garbanzo]
ref|XP_007137035.1|  hypothetical protein PHAVU_009G094200g             170   5e-46   Phaseolus vulgaris [French bean]
ref|XP_010526207.1|  PREDICTED: cellulose synthase A catalytic su...    170   6e-46   Tarenaya hassleriana [spider flower]
gb|KHN07088.1|  Cellulose synthase A catalytic subunit 1 [UDP-for...    169   1e-45   Glycine soja [wild soybean]
ref|XP_003526416.1|  PREDICTED: cellulose synthase A catalytic su...    169   1e-45   Glycine max [soybeans]
ref|XP_010525969.1|  PREDICTED: cellulose synthase A catalytic su...    169   2e-45   Tarenaya hassleriana [spider flower]
tpg|DAA53227.1|  TPA: cellulose synthase3                               157   2e-45   
gb|KHN08123.1|  Cellulose synthase A catalytic subunit 1 [UDP-for...    168   3e-45   Glycine soja [wild soybean]
ref|XP_003522623.1|  PREDICTED: cellulose synthase A catalytic su...    168   3e-45   Glycine max [soybeans]
ref|XP_010914890.1|  PREDICTED: probable cellulose synthase A cat...    167   8e-45   Elaeis guineensis
dbj|BAJ93596.1|  predicted protein                                      161   2e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS68064.1|  hypothetical protein M569_06709                         165   3e-44   Genlisea aurea
ref|XP_008784981.1|  PREDICTED: probable cellulose synthase A cat...    162   5e-43   Phoenix dactylifera
ref|XP_002455100.1|  hypothetical protein SORBIDRAFT_03g004310          155   9e-43   
ref|XP_008792060.1|  PREDICTED: probable cellulose synthase A cat...    160   3e-42   Phoenix dactylifera
gb|EMT03676.1|  Putative cellulose synthase A catalytic subunit 1...    160   3e-42   
gb|ACS68190.1|  cellulose synthase 1.2 catalytic subunit                159   5e-42   Brassica napus [oilseed rape]
ref|XP_010925238.1|  PREDICTED: probable cellulose synthase A cat...    159   6e-42   Elaeis guineensis
gb|AGT16647.1|  cellulose synthase                                      159   6e-42   Saccharum hybrid cultivar R570
ref|XP_008673642.1|  PREDICTED: probable cellulose synthase A cat...    159   8e-42   
tpg|DAA53225.1|  TPA: cellulose synthase3                               159   8e-42   
emb|CDX72357.1|  BnaC07g43790D                                          158   1e-41   
ref|XP_009138081.1|  PREDICTED: cellulose synthase A catalytic su...    158   1e-41   Brassica rapa
emb|CDY13484.1|  BnaA03g52020D                                          157   2e-41   Brassica napus [oilseed rape]
ref|XP_006412477.1|  hypothetical protein EUTSA_v10024278mg             156   5e-41   Eutrema salsugineum [saltwater cress]
gb|ACS68189.1|  cellulose synthase 1.1 catalytic subunit                156   5e-41   Brassica napus [oilseed rape]
gb|ACZ82297.1|  cellulose synthase                                      156   5e-41   Phyllostachys edulis [kikko-chiku]
gb|AAY43218.1|  cellulose synthase BoCesA2                              156   6e-41   Bambusa oldhamii
gb|EMT20923.1|  Putative cellulose synthase A catalytic subunit 1...    156   7e-41   
gb|AAY43217.1|  cellulose synthase BoCesA1                              155   7e-41   Bambusa oldhamii
gb|ACZ82296.1|  cellulose synthase                                      155   1e-40   Phyllostachys edulis [kikko-chiku]
dbj|BAJ88271.1|  predicted protein                                      155   1e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003568832.2|  PREDICTED: probable cellulose synthase A cat...    155   1e-40   Brachypodium distachyon [annual false brome]
gb|AAC39333.1|  RSW1-like cellulose synthase catalytic subunit          152   1e-40   Oryza sativa Japonica Group [Japonica rice]
gb|AAY43216.1|  cellulose synthase BoCesA8                              154   2e-40   Bambusa oldhamii
ref|XP_009399755.1|  PREDICTED: probable cellulose synthase A cat...    154   2e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACT16001.1|  cellulose synthase                                      154   3e-40   Phyllostachys edulis [kikko-chiku]
gb|AAY43219.2|  cellulose synthase BoCesA3                              154   3e-40   Bambusa oldhamii
gb|AFG25776.1|  cellulose synthase 2                                    154   3e-40   Bambusa emeiensis
gb|AAR29967.1|  putative cellulose synthase catalytic subunit           154   3e-40   Hordeum vulgare [barley]
gb|AAY43225.1|  cellulose synthase BoCesA3                              154   3e-40   Bambusa oldhamii
ref|NP_194967.1|  cellulose synthase A catalytic subunit 1 [UDP-f...    154   4e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867245.1|  hypothetical protein ARALYDRAFT_491486             154   4e-40   
ref|XP_006654097.1|  PREDICTED: probable cellulose synthase A cat...    154   4e-40   Oryza brachyantha
gb|AFW81388.1|  cellulose synthase1                                     153   5e-40   
ref|XP_004968377.1|  PREDICTED: probable cellulose synthase A cat...    152   1e-39   Setaria italica
ref|NP_001054788.1|  Os05g0176100                                       152   1e-39   
ref|XP_010447394.1|  PREDICTED: cellulose synthase A catalytic su...    152   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010432725.1|  PREDICTED: cellulose synthase A catalytic su...    152   1e-39   Camelina sativa [gold-of-pleasure]
ref|NP_001105574.1|  cellulose synthase2                                152   2e-39   Zea mays [maize]
ref|XP_004965873.1|  PREDICTED: probable cellulose synthase A cat...    152   2e-39   Setaria italica
ref|XP_010445007.1|  PREDICTED: cellulose synthase A catalytic su...    152   2e-39   
ref|NP_001104954.1|  cellulose synthase-1                               151   3e-39   Zea mays [maize]
ref|XP_006842872.1|  hypothetical protein AMTR_s00081p00171100          151   3e-39   Amborella trichopoda
gb|ACQ99194.1|  cellulose synthase                                      151   3e-39   Phyllostachys edulis [kikko-chiku]
ref|XP_004960821.1|  PREDICTED: probable cellulose synthase A cat...    150   5e-39   Setaria italica
ref|XP_004960820.1|  PREDICTED: probable cellulose synthase A cat...    150   5e-39   
ref|XP_006285557.1|  hypothetical protein CARUB_v10006999mg             150   7e-39   Capsella rubella
gb|KFK29850.1|  hypothetical protein AALP_AA7G186800                    150   9e-39   Arabis alpina [alpine rockcress]
ref|XP_009389939.1|  PREDICTED: probable cellulose synthase A cat...    150   1e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009126053.1|  PREDICTED: cellulose synthase A catalytic su...    148   3e-38   Brassica rapa
ref|XP_002440694.1|  hypothetical protein SORBIDRAFT_09g005280          147   1e-37   Sorghum bicolor [broomcorn]
emb|CDX68844.1|  BnaC01g06090D                                          146   1e-37   
emb|CDX75242.1|  BnaA01g04600D                                          145   3e-37   
ref|XP_003603419.1|  Cellulose synthase                                 144   1e-36   Medicago truncatula
gb|AFW81389.1|  cellulose synthase1                                     142   7e-36   
ref|XP_006405185.1|  hypothetical protein EUTSA_v10000022mg             139   7e-35   Eutrema salsugineum [saltwater cress]
gb|KEH33342.1|  BZIP transcription factor                               131   2e-34   Medicago truncatula
gb|KEH33341.1|  BZIP transcription factor                               132   4e-34   Medicago truncatula
gb|ACP28170.1|  LONG1                                                   130   2e-33   Pisum sativum [garden pea]
ref|NP_180124.1|  cellulose synthase 10                                 132   1e-32   
gb|AHL38838.1|  glycosyltransferase                                     132   2e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CAA66478.1|  transcription factor                                   126   5e-32   Vicia faba var. minor [tick bean]
gb|AFM37966.1|  cellulose synthase catalytic subunit                    130   7e-32   Cunninghamia lanceolata [China fir]
ref|XP_006601864.1|  PREDICTED: bZIP transcription factor bZIP36 ...    125   1e-31   Glycine max [soybeans]
ref|NP_001237272.1|  bZIP transcription factor bZIP36                   125   1e-31   
gb|KHN28520.1|  Cellulose synthase A catalytic subunit 1 [UDP-for...    125   2e-31   Glycine soja [wild soybean]
ref|XP_007146304.1|  hypothetical protein PHAVU_006G029200g             122   1e-30   Phaseolus vulgaris [French bean]
ref|XP_007146305.1|  hypothetical protein PHAVU_006G029200g             122   1e-30   Phaseolus vulgaris [French bean]
ref|XP_006293591.1|  hypothetical protein CARUB_v10022538mg             126   2e-30   
ref|XP_004513402.1|  PREDICTED: cellulose synthase A catalytic su...    119   2e-29   Cicer arietinum [garbanzo]
gb|AAQ63936.1|  cellulose synthase                                      123   3e-29   Pinus radiata
gb|KHM99690.1|  Cellulose synthase A catalytic subunit 1 [UDP-for...    116   2e-28   Glycine soja [wild soybean]
ref|NP_001238218.1|  TGACG-motif-binding factor                         116   2e-28   
ref|XP_006838305.1|  hypothetical protein AMTR_s00103p00124340          119   5e-28   Amborella trichopoda
ref|XP_007052528.1|  Cellulose synthase family protein isoform 4        117   3e-27   
gb|AIX94076.1|  putative cellulose synthase                             117   3e-27   Lactuca sativa [cultivated lettuce]
ref|XP_007052526.1|  Cellulose synthase family protein isoform 2        117   3e-27   
gb|AIS85978.1|  cellulose synthase 3                                    117   3e-27   Populus tomentosa [Chinese white poplar]
gb|AIS85991.1|  cellulose synthase 3                                    117   3e-27   Populus tomentosa [Chinese white poplar]
gb|AIS85990.1|  cellulose synthase 3                                    117   3e-27   Populus tomentosa [Chinese white poplar]
gb|AIS85987.1|  cellulose synthase 3                                    117   3e-27   Populus tomentosa [Chinese white poplar]
gb|AIS85996.1|  cellulose synthase 3                                    117   3e-27   Populus tomentosa [Chinese white poplar]
gb|AIS86011.1|  cellulose synthase 3                                    117   3e-27   Populus tomentosa [Chinese white poplar]
ref|XP_007052525.1|  Cellulose synthase family protein isoform 1        117   4e-27   
gb|AIA10372.1|  cellulose synthase                                      117   4e-27   Boehmeria nivea [Chinese silk-plant]
ref|XP_007052527.1|  Cellulose synthase family protein isoform 3        117   4e-27   
gb|AAQ63935.1|  cellulose synthase                                      116   6e-27   Pinus radiata
gb|AIS86005.1|  cellulose synthase 3                                    115   8e-27   Populus tomentosa [Chinese white poplar]
ref|XP_010541595.1|  PREDICTED: cellulose synthase A catalytic su...    115   9e-27   Tarenaya hassleriana [spider flower]
gb|AAL23710.2|  cellulose synthase                                      115   2e-26   Populus tremuloides
gb|AIS85977.1|  cellulose synthase 3                                    114   2e-26   Populus tomentosa [Chinese white poplar]
gb|AIS85989.1|  cellulose synthase 3                                    114   2e-26   Populus tomentosa [Chinese white poplar]
gb|AIS86009.1|  cellulose synthase 3                                    114   2e-26   Populus tomentosa [Chinese white poplar]
gb|AFZ78554.1|  cellulose synthase                                      114   2e-26   Populus tomentosa [Chinese white poplar]
gb|AIS86004.1|  cellulose synthase 3                                    114   2e-26   Populus tomentosa [Chinese white poplar]
ref|XP_007220288.1|  hypothetical protein PRUPE_ppa000593mg             114   3e-26   
ref|XP_008231249.1|  PREDICTED: cellulose synthase A catalytic su...    114   3e-26   Prunus mume [ume]
dbj|BAC20318.1|  bZIP with a Ring-finger motif                          110   4e-26   Lotus japonicus
ref|XP_010088232.1|  OsCesA3 protein                                    114   4e-26   Morus notabilis
ref|XP_008375180.1|  PREDICTED: cellulose synthase A catalytic su...    113   6e-26   Malus domestica [apple tree]
ref|XP_009364979.1|  PREDICTED: cellulose synthase A catalytic su...    113   6e-26   Pyrus x bretschneideri [bai li]
ref|XP_009354747.1|  PREDICTED: cellulose synthase A catalytic su...    113   6e-26   Pyrus x bretschneideri [bai li]
ref|XP_011047398.1|  PREDICTED: cellulose synthase A catalytic su...    112   1e-25   Populus euphratica
gb|KHG03009.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    112   1e-25   Gossypium arboreum [tree cotton]
gb|AFI71894.1|  cellulose synthase 3                                    112   2e-25   Paeonia lactiflora [common garden peony]
gb|KDP43475.1|  hypothetical protein JCGZ_16762                         112   2e-25   Jatropha curcas
ref|XP_002298432.1|  hypothetical protein POPTR_0001s27320g             112   2e-25   
ref|XP_007133819.1|  hypothetical protein PHAVU_011G211500g             112   2e-25   Phaseolus vulgaris [French bean]
gb|KJB25016.1|  hypothetical protein B456_004G172400                    111   3e-25   Gossypium raimondii
gb|AEE60898.1|  cellulose synthase                                      111   3e-25   Populus tomentosa [Chinese white poplar]
ref|XP_006369624.1|  hypothetical protein POPTR_0001s27320g             111   3e-25   
ref|XP_006826669.1|  hypothetical protein AMTR_s00137p00043990          111   3e-25   
gb|AEP33538.1|  cellulose synthase catalytic subunit                    111   3e-25   Gossypium schwendimanii
ref|XP_004499886.1|  PREDICTED: cellulose synthase A catalytic su...    110   4e-25   Cicer arietinum [garbanzo]
gb|AFK49023.1|  unknown                                                 107   4e-25   Lotus japonicus
ref|XP_002960719.1|  hypothetical protein SELMODRAFT_73698              110   5e-25   Selaginella moellendorffii
ref|XP_002983952.1|  family 2 glycosyltransferase                       110   5e-25   
gb|AEP33557.1|  cellulose synthase catalytic subunit                    110   6e-25   Gossypium gossypioides
ref|XP_002532166.1|  Cellulose synthase A catalytic subunit 6 [UD...    110   6e-25   Ricinus communis
ref|XP_003533898.2|  PREDICTED: cellulose synthase A catalytic su...    110   7e-25   Glycine max [soybeans]
gb|KHM98952.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    110   7e-25   Glycine soja [wild soybean]
gb|AEP33540.1|  cellulose synthase catalytic subunit                    110   7e-25   Gossypium mustelinum
gb|KHG16921.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    110   7e-25   Gossypium arboreum [tree cotton]
gb|AFZ78557.1|  cellulose synthase                                      110   7e-25   Populus tomentosa [Chinese white poplar]
gb|ADZ16120.1|  cellulose synthase A3                                   110   8e-25   Gossypium herbaceum subsp. africanum
gb|EPS73573.1|  hypothetical protein M569_01183                         110   8e-25   Genlisea aurea
gb|AEP33539.1|  cellulose synthase catalytic subunit                    110   8e-25   Gossypium turneri
gb|AEP33537.1|  cellulose synthase catalytic subunit                    110   9e-25   Gossypium laxum
gb|AAT66941.1|  CesA2                                                   110   9e-25   Acacia mangium
gb|AEP33553.1|  cellulose synthase catalytic subunit                    110   9e-25   Gossypium harknessii
gb|AEP33556.1|  cellulose synthase catalytic subunit                    110   9e-25   Gossypium aridum
gb|ACS94418.1|  cellulose synthase A                                    107   9e-25   Leucaena leucocephala [cassie]
gb|AEP33536.1|  cellulose synthase catalytic subunit                    110   9e-25   Gossypium thurberi
gb|AEP33552.1|  cellulose synthase catalytic subunit                    110   9e-25   Gossypium armourianum
gb|AEP33554.1|  cellulose synthase catalytic subunit                    109   1e-24   Gossypium davidsonii
ref|XP_002314037.1|  cellulose synthase family protein                  109   1e-24   
ref|XP_004306536.1|  PREDICTED: cellulose synthase A catalytic su...    109   1e-24   Fragaria vesca subsp. vesca
ref|NP_001275292.1|  cellulose synthase                                 109   1e-24   Solanum tuberosum [potatoes]
gb|EPS71230.1|  hypothetical protein M569_03522                         109   1e-24   Genlisea aurea
gb|ACC59195.1|  cellulose synthase                                      109   2e-24   Betula platyphylla [Asian white birch]
gb|AGV22107.1|  cellulose synthase 2                                    109   2e-24   Betula luminifera [liang ye hua]
ref|XP_009408434.1|  PREDICTED: probable cellulose synthase A cat...    108   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010257191.1|  PREDICTED: cellulose synthase A catalytic su...    108   3e-24   Nelumbo nucifera [Indian lotus]
ref|XP_006382504.1|  cellulose synthase 6 family protein                108   3e-24   
ref|XP_004229630.1|  PREDICTED: cellulose synthase A catalytic su...    108   3e-24   Solanum lycopersicum
ref|XP_009386450.1|  PREDICTED: probable cellulose synthase A cat...    108   4e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEK31218.1|  cellulose synthase A                                    108   4e-24   Eucalyptus camaldulensis
gb|KDO83418.1|  hypothetical protein CISIN_1g001413mg                   106   4e-24   Citrus sinensis [apfelsine]
ref|XP_011025442.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    108   5e-24   Populus euphratica
gb|AEP33559.1|  cellulose synthase catalytic subunit                    108   5e-24   Gossypium trilobum
gb|ABY25277.1|  cellulose synthase                                      107   6e-24   Eucalyptus grandis [rose gum]
ref|NP_001289668.1|  cellulose synthase A catalytic subunit 3 [UD...    107   6e-24   Eucalyptus grandis [rose gum]
ref|XP_011036833.1|  PREDICTED: probable cellulose synthase A cat...    107   6e-24   Populus euphratica
gb|KHN39939.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    107   6e-24   Glycine soja [wild soybean]
ref|XP_011036830.1|  PREDICTED: probable cellulose synthase A cat...    107   6e-24   Populus euphratica
ref|XP_011087713.1|  PREDICTED: cellulose synthase A catalytic su...    107   8e-24   Sesamum indicum [beniseed]
ref|XP_007148880.1|  hypothetical protein PHAVU_005G022100g             107   9e-24   Phaseolus vulgaris [French bean]
gb|AFZ78563.1|  cellulose synthase                                      107   9e-24   Populus tomentosa [Chinese white poplar]
gb|AAD39534.2|  cellulose synthase catalytic subunit                    107   1e-23   Gossypium hirsutum [American cotton]
gb|AEP33541.1|  cellulose synthase catalytic subunit                    107   1e-23   Gossypium mustelinum
ref|XP_003546888.1|  PREDICTED: cellulose synthase A catalytic su...    107   1e-23   Glycine max [soybeans]
gb|AEP33551.1|  cellulose synthase catalytic subunit                    107   1e-23   Gossypium hirsutum subsp. latifolium
gb|AEP33545.1|  cellulose synthase catalytic subunit                    107   1e-23   Gossypium tomentosum
gb|AEP33547.1|  cellulose synthase catalytic subunit                    107   1e-23   Gossypium barbadense var. brasiliense
gb|KDO83417.1|  hypothetical protein CISIN_1g001413mg                   106   1e-23   Citrus sinensis [apfelsine]
gb|ADZ16119.1|  cellulose synthase A3                                   107   1e-23   Gossypium barbadense [Egyptian cotton]
gb|ADZ16123.1|  cellulose synthase A3                                   107   1e-23   Gossypium hirsutum [American cotton]
ref|XP_006439112.1|  hypothetical protein CICLE_v10030723mg             106   1e-23   
gb|KDO83415.1|  hypothetical protein CISIN_1g001413mg                   106   1e-23   Citrus sinensis [apfelsine]
gb|KDO83416.1|  hypothetical protein CISIN_1g001413mg                   106   1e-23   Citrus sinensis [apfelsine]
gb|AEP33543.1|  cellulose synthase catalytic subunit                    106   1e-23   Gossypium darwinii
ref|XP_006439115.1|  hypothetical protein CICLE_v10030723mg             106   1e-23   
gb|KDO83414.1|  hypothetical protein CISIN_1g001413mg                   106   1e-23   Citrus sinensis [apfelsine]
gb|AGV22108.1|  cellulose synthase 6                                    106   1e-23   Betula luminifera [liang ye hua]
ref|XP_009629755.1|  PREDICTED: cellulose synthase A catalytic su...    106   2e-23   Nicotiana tomentosiformis
gb|ACU87559.2|  cellulose synthase                                      106   2e-23   Leucaena leucocephala [cassie]
ref|XP_011023647.1|  PREDICTED: probable cellulose synthase A cat...    106   2e-23   Populus euphratica
ref|XP_006482874.1|  PREDICTED: cellulose synthase A catalytic su...    106   2e-23   Citrus sinensis [apfelsine]
ref|XP_006439113.1|  hypothetical protein CICLE_v10030723mg             106   2e-23   
gb|AAP40636.1|  cellulose synthase 6                                    106   2e-23   Populus tremuloides
gb|KDO83412.1|  hypothetical protein CISIN_1g001413mg                   106   2e-23   Citrus sinensis [apfelsine]
gb|ACJ38667.1|  cellulose synthase                                      106   2e-23   Betula luminifera [liang ye hua]
gb|KDO83405.1|  hypothetical protein CISIN_1g001413mg                   106   2e-23   Citrus sinensis [apfelsine]
gb|ADR74043.1|  cellulose synthase                                      106   2e-23   Populus ussuriensis
gb|AFZ78555.1|  cellulose synthase                                      106   2e-23   Populus tomentosa [Chinese white poplar]
gb|ADV58936.1|  cellulose synthase                                      106   2e-23   Populus ussuriensis
ref|XP_002278997.1|  PREDICTED: cellulose synthase A catalytic su...    106   2e-23   Vitis vinifera
gb|ACU80553.2|  cellulose synthase                                      106   2e-23   Leucaena leucocephala [cassie]
ref|XP_009385959.1|  PREDICTED: probable cellulose synthase A cat...    106   2e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008796554.1|  PREDICTED: probable cellulose synthase A cat...    105   2e-23   Phoenix dactylifera
emb|CBI24889.3|  unnamed protein product                                105   3e-23   Vitis vinifera
ref|XP_002319002.2|  cellulose synthase 6 family protein                105   3e-23   
gb|KJB49074.1|  hypothetical protein B456_008G100100                    101   3e-23   Gossypium raimondii
ref|XP_010547260.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    105   3e-23   
gb|AII73575.1|  cellulose synthase 3                                    105   3e-23   Medicago sativa [alfalfa]
ref|XP_010088737.1|  Isoxaben-resistant protein 2                       105   3e-23   Morus notabilis
gb|KHN37622.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    105   3e-23   Glycine soja [wild soybean]
ref|XP_003542849.1|  PREDICTED: cellulose synthase A catalytic su...    105   4e-23   Glycine max [soybeans]
ref|XP_010906116.1|  PREDICTED: probable cellulose synthase A cat...    105   4e-23   Elaeis guineensis
ref|XP_002967423.1|  hypothetical protein SELMODRAFT_86720              105   4e-23   
ref|XP_003599196.1|  Cellulose synthase                                 105   4e-23   Medicago truncatula
ref|XP_002960291.1|  family 2 glycosyltransferase                       105   4e-23   
gb|KHN41284.1|  Cellulose synthase A catalytic subunit 6 [UDP-for...    105   4e-23   Glycine soja [wild soybean]
ref|XP_009417280.1|  PREDICTED: probable cellulose synthase A cat...    105   5e-23   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS69824.1|  hypothetical protein M569_04932                         105   5e-23   Genlisea aurea
ref|XP_010241248.1|  PREDICTED: cellulose synthase A catalytic su...    104   7e-23   Nelumbo nucifera [Indian lotus]
gb|ADZ16121.1|  cellulose synthase A3                                   104   7e-23   Gossypium raimondii
gb|KHN19454.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    104   7e-23   Glycine soja [wild soybean]
ref|XP_009407595.1|  PREDICTED: probable cellulose synthase A cat...    104   8e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407580.1|  PREDICTED: probable cellulose synthase A cat...    104   8e-23   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB22792.1|  hypothetical protein B456_004G065900                    104   8e-23   Gossypium raimondii
ref|XP_003540527.1|  PREDICTED: cellulose synthase A catalytic su...    104   8e-23   Glycine max [soybeans]
gb|KJB22794.1|  hypothetical protein B456_004G065900                    104   9e-23   
ref|XP_011079380.1|  PREDICTED: cellulose synthase A catalytic su...    104   9e-23   
ref|XP_009758840.1|  PREDICTED: cellulose synthase A catalytic su...    104   9e-23   
ref|XP_011079382.1|  PREDICTED: cellulose synthase A catalytic su...    104   9e-23   
ref|XP_011079381.1|  PREDICTED: cellulose synthase A catalytic su...    104   9e-23   
gb|EYU29030.1|  hypothetical protein MIMGU_mgv1a000570mg                104   1e-22   
gb|AAY60846.1|  cellulose synthase 4                                    103   1e-22   
gb|EYU31127.1|  hypothetical protein MIMGU_mgv1a000549mg                103   1e-22   
emb|CBI29854.3|  unnamed protein product                                103   2e-22   
ref|XP_007159799.1|  hypothetical protein PHAVU_002G268200g             103   2e-22   
ref|XP_002277635.1|  PREDICTED: cellulose synthase A catalytic su...    103   2e-22   
ref|XP_010653789.1|  PREDICTED: cellulose synthase A catalytic su...    103   2e-22   
ref|XP_008790520.1|  PREDICTED: probable cellulose synthase A cat...    103   2e-22   
emb|CDX81145.1|  BnaC03g03990D                                          103   2e-22   
ref|XP_007138395.1|  hypothetical protein PHAVU_009G205100g             103   2e-22   
gb|ACS68195.1|  cellulose synthase 5.1 catalytic subunit                103   2e-22   
gb|KJB18370.1|  hypothetical protein B456_003G049300                    103   2e-22   
ref|XP_011090445.1|  PREDICTED: cellulose synthase A catalytic su...    103   2e-22   
ref|XP_003522926.1|  PREDICTED: cellulose synthase A catalytic su...    103   2e-22   
gb|KJB18373.1|  hypothetical protein B456_003G049300                    103   2e-22   
gb|KJB18371.1|  hypothetical protein B456_003G049300                    102   2e-22   
ref|XP_006849886.1|  hypothetical protein AMTR_s00022p00086120          103   2e-22   
gb|KJB18372.1|  hypothetical protein B456_003G049300                    102   3e-22   
ref|XP_002864919.1|  hypothetical protein ARALYDRAFT_496689             102   3e-22   
ref|XP_009130469.1|  PREDICTED: cellulose synthase A catalytic su...    102   3e-22   
emb|CDY31305.1|  BnaA02g34360D                                          102   3e-22   
emb|CDY56540.1|  BnaA03g55860D                                          102   3e-22   
ref|XP_009131129.1|  PREDICTED: cellulose synthase A catalytic su...    102   3e-22   
gb|AAC39336.1|  cellulose synthase catalytic subunit                    102   4e-22   
ref|XP_010520165.1|  PREDICTED: cellulose synthase A catalytic su...    102   4e-22   
gb|AGC65585.1|  CESA3ixr1-2                                             102   4e-22   
ref|NP_196136.1|  cellulose synthase A catalytic subunit 3 [UDP-f...    102   4e-22   
ref|XP_007213713.1|  hypothetical protein PRUPE_ppa000567mg             102   4e-22   
ref|XP_002963550.1|  family 2 glycosyltransferase                       102   5e-22   
gb|AGC65584.1|  GFP-CESA3ixr1-2                                         102   5e-22   
emb|CBI21555.3|  unnamed protein product                                102   5e-22   
ref|XP_002873198.1|  hypothetical protein ARALYDRAFT_487306             102   5e-22   
ref|XP_008232182.1|  PREDICTED: cellulose synthase A catalytic su...    102   5e-22   
gb|EPS60781.1|  hypothetical protein M569_14019                         102   5e-22   
gb|KCW70400.1|  hypothetical protein EUGRSUZ_F03635                     102   5e-22   
ref|XP_007213712.1|  hypothetical protein PRUPE_ppa000567mg             102   5e-22   
ref|XP_011021980.1|  PREDICTED: cellulose synthase A catalytic su...    102   5e-22   
gb|AAT09898.1|  cellulose synthase                                      102   5e-22   
gb|KCW70399.1|  hypothetical protein EUGRSUZ_F03635                     102   6e-22   
ref|XP_011021978.1|  PREDICTED: cellulose synthase A catalytic su...    102   6e-22   
gb|AAZ86087.1|  cellulose synthase catalytic subunit                    102   6e-22   
gb|ABI78959.1|  cellulose synthase 6                                    102   6e-22   
gb|ABI78960.1|  cellulose synthase 7                                    102   6e-22   
ref|XP_006453581.1|  hypothetical protein CICLE_v10007321mg             102   6e-22   
gb|AAZ86086.1|  cellulose synthase catalytic subunit                    102   6e-22   
ref|XP_002307145.1|  cellulose synthase family protein                  102   6e-22   
ref|XP_011093547.1|  PREDICTED: cellulose synthase A catalytic su...    102   6e-22   
emb|CDY46820.1|  BnaC02g43280D                                          102   6e-22   
gb|AAO25581.1|  cellulose synthase                                      101   7e-22   
gb|AFP93559.1|  cellulose synthase A1                                   101   7e-22   
gb|ACT67415.1|  cellulose synthase                                      101   7e-22   
ref|XP_010547636.1|  PREDICTED: cellulose synthase A catalytic su...    101   8e-22   
ref|XP_011083940.1|  PREDICTED: cellulose synthase A catalytic su...    101   8e-22   
ref|XP_009799381.1|  PREDICTED: cellulose synthase A catalytic su...    101   8e-22   
ref|XP_010278977.1|  PREDICTED: cellulose synthase A catalytic su...    101   9e-22   
ref|XP_010932185.1|  PREDICTED: probable cellulose synthase A cat...    101   9e-22   
ref|XP_004510986.1|  PREDICTED: cellulose synthase A catalytic su...    101   1e-21   
gb|KDO57138.1|  hypothetical protein CISIN_1g001369mg                   100   1e-21   
ref|XP_011013550.1|  PREDICTED: cellulose synthase A catalytic su...    101   1e-21   
emb|CDP07782.1|  unnamed protein product                                101   1e-21   
ref|XP_011013552.1|  PREDICTED: cellulose synthase A catalytic su...    101   1e-21   
ref|XP_009601834.1|  PREDICTED: cellulose synthase A catalytic su...    100   1e-21   
gb|KDO57137.1|  hypothetical protein CISIN_1g001369mg                   100   1e-21   
ref|XP_010265522.1|  PREDICTED: cellulose synthase A catalytic su...    100   1e-21   
ref|XP_010027732.1|  PREDICTED: cellulose synthase A catalytic su...    100   1e-21   
ref|XP_006427904.1|  hypothetical protein CICLE_v10024766mg             100   1e-21   
ref|XP_006427905.1|  hypothetical protein CICLE_v10024766mg             100   1e-21   
ref|XP_010491630.1|  PREDICTED: cellulose synthase A catalytic su...    100   1e-21   
gb|KFK25282.1|  hypothetical protein AALP_AA8G091900                    100   1e-21   
ref|XP_010472554.1|  PREDICTED: LOW QUALITY PROTEIN: probable cel...    100   2e-21   
ref|XP_004141979.1|  PREDICTED: probable cellulose synthase A cat...    100   2e-21   
ref|XP_008440995.1|  PREDICTED: cellulose synthase A catalytic su...    100   2e-21   
gb|AFR38707.1|  cellulose synthase                                    93.2    2e-21   
ref|XP_006394118.1|  hypothetical protein EUTSA_v100035740mg            100   2e-21   
gb|AFR38732.1|  cellulose synthase                                    93.2    2e-21   
ref|XP_009617930.1|  PREDICTED: probable cellulose synthase A cat...    100   2e-21   
ref|XP_009617929.1|  PREDICTED: probable cellulose synthase A cat...    100   2e-21   
gb|KDO62270.1|  hypothetical protein CISIN_1g039060mg                   100   2e-21   
gb|AFR38730.1|  cellulose synthase                                    93.2    2e-21   
ref|XP_006474028.1|  PREDICTED: cellulose synthase A catalytic su...    100   2e-21   
ref|XP_006474027.1|  PREDICTED: cellulose synthase A catalytic su...    100   2e-21   
ref|XP_006351001.1|  PREDICTED: cellulose synthase A catalytic su...    100   2e-21   
dbj|BAM05571.1|  cellulose synthase 3                                 96.7    2e-21   
gb|KJB07760.1|  hypothetical protein B456_001G044700                    100   2e-21   
emb|CDY08854.1|  BnaA06g23700D                                          100   2e-21   
ref|XP_009150553.1|  PREDICTED: cellulose synthase A catalytic su...    100   2e-21   
emb|CDY14504.1|  BnaC03g49550D                                          100   2e-21   
ref|XP_002310628.1|  cellulose synthase family protein                  100   2e-21   
gb|AFZ78553.1|  cellulose synthase                                      100   2e-21   
ref|XP_004242614.1|  PREDICTED: cellulose synthase A catalytic su...    100   2e-21   
ref|XP_002310629.1|  hypothetical protein POPTR_0007s07120g             100   2e-21   
ref|XP_003527198.1|  PREDICTED: cellulose synthase A catalytic su...    100   2e-21   
gb|AFR38735.1|  cellulose synthase                                    92.8    2e-21   
emb|CDP12843.1|  unnamed protein product                                100   2e-21   
gb|AFB18636.1|  CESA7                                                   100   2e-21   
gb|KHG19749.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    100   3e-21   
gb|EYU35355.1|  hypothetical protein MIMGU_mgv1a000638mg                100   3e-21   
gb|KJB07762.1|  hypothetical protein B456_001G044700                    100   3e-21   
ref|XP_008796456.1|  PREDICTED: probable cellulose synthase A cat...    100   3e-21   
gb|KJB07761.1|  hypothetical protein B456_001G044700                  99.8    3e-21   
ref|XP_010273667.1|  PREDICTED: cellulose synthase A catalytic su...  99.8    3e-21   
emb|CDP02834.1|  unnamed protein product                              99.8    3e-21   
ref|XP_010312466.1|  PREDICTED: cellulose synthase A catalytic su...  99.8    3e-21   
gb|AAC29067.1|  cellulose synthase                                    99.8    4e-21   
ref|NP_201279.1|  cellulose synthase A catalytic subunit 6 [UDP-f...  99.8    4e-21   
gb|AAX18649.1|  cellulose synthase catalytic subunit                  99.8    4e-21   
ref|XP_002960761.1|  cellulose synthase 4-1                           99.8    4e-21   
dbj|BAF01335.1|  cellulose synthase                                   99.4    4e-21   
gb|KHG24947.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...  99.8    4e-21   
gb|AAT57672.1|  cellulose synthase catalytic subunit                  99.8    4e-21   
ref|XP_010437052.1|  PREDICTED: cellulose synthase A catalytic su...  99.8    4e-21   
ref|XP_010431901.1|  PREDICTED: cellulose synthase A catalytic su...  99.8    4e-21   
gb|AFR38724.1|  cellulose synthase                                    92.0    4e-21   
gb|AFR38723.1|  cellulose synthase                                    92.0    4e-21   
gb|AFR38726.1|  cellulose synthase                                    92.0    4e-21   
ref|XP_002866842.1|  hypothetical protein ARALYDRAFT_490712           99.4    5e-21   
ref|XP_006411737.1|  hypothetical protein EUTSA_v10024277mg           99.4    5e-21   
ref|XP_010241683.1|  PREDICTED: cellulose synthase A catalytic su...  99.4    5e-21   
dbj|BAJ33658.1|  unnamed protein product                              99.4    5e-21   
ref|XP_010927484.1|  PREDICTED: probable cellulose synthase A cat...  99.4    5e-21   
ref|XP_010255731.1|  PREDICTED: probable cellulose synthase A cat...  99.4    5e-21   
ref|XP_006660635.1|  PREDICTED: cellulose synthase A catalytic su...  99.4    5e-21   
ref|XP_011466721.1|  PREDICTED: cellulose synthase A catalytic su...  99.0    6e-21   
ref|XP_010255732.1|  PREDICTED: probable cellulose synthase A cat...  99.4    6e-21   
ref|NP_196549.1|  cellulose synthase A catalytic subunit 5 [UDP-f...  99.4    6e-21   
gb|AFB18634.1|  CESA5                                                 99.0    6e-21   
gb|AEK86669.1|  cellulose synthase 5                                  99.0    6e-21   
gb|EPS66740.1|  hypothetical protein M569_08032                       99.0    6e-21   
gb|KEH43649.1|  cellulose synthase-like protein                       99.0    6e-21   
gb|KHG19971.1|  Cellulose synthase A catalytic subunit 9 [UDP-for...  95.5    6e-21   
gb|KHG22630.1|  Cellulose synthase A catalytic subunit 9 [UDP-for...  95.1    6e-21   
dbj|BAM05574.1|  cellulose synthase 3                                 97.1    6e-21   
gb|KHG02518.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...  99.0    6e-21   
gb|ACL36367.1|  cellulose synthase CesA9                              95.1    6e-21   
ref|XP_010546378.1|  PREDICTED: cellulose synthase A catalytic su...  99.0    6e-21   
ref|XP_011466718.1|  PREDICTED: cellulose synthase A catalytic su...  99.0    6e-21   
gb|AES62337.2|  cellulose synthase-like protein                       99.0    7e-21   
gb|KHG03006.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...  99.0    7e-21   
ref|XP_003531396.1|  PREDICTED: cellulose synthase A catalytic su...  99.0    7e-21   
gb|KHG02517.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...  99.0    7e-21   
ref|XP_003630174.1|  Cellulose synthase A catalytic subunit           99.0    7e-21   
gb|ACL36368.1|  cellulose synthase CesA10                             95.1    7e-21   
ref|XP_007018605.1|  Cellulose synthase 6                             99.0    8e-21   
ref|XP_006296592.1|  hypothetical protein CARUB_v10012872mg           98.6    8e-21   
ref|XP_007143558.1|  hypothetical protein PHAVU_007G081700g           98.6    8e-21   
ref|XP_003548102.1|  PREDICTED: cellulose synthase A catalytic su...  98.6    8e-21   
gb|KJB14950.1|  hypothetical protein B456_002G150300                  98.6    8e-21   
ref|XP_007199689.1|  hypothetical protein PRUPE_ppa000559mg           98.6    9e-21   
ref|XP_010545449.1|  PREDICTED: cellulose synthase A catalytic su...  98.6    1e-20   
ref|XP_004502891.1|  PREDICTED: cellulose synthase A catalytic su...  98.6    1e-20   
gb|KDP35302.1|  hypothetical protein JCGZ_09461                       98.6    1e-20   
ref|XP_003518592.1|  PREDICTED: cellulose synthase A catalytic su...  98.2    1e-20   
gb|KHN00756.1|  Cellulose synthase A catalytic subunit 6 [UDP-for...  98.2    1e-20   
gb|KHN26453.1|  Putative cellulose synthase A catalytic subunit 3...  98.2    1e-20   
ref|XP_010452989.1|  PREDICTED: cellulose synthase A catalytic su...  98.2    1e-20   
emb|CDY41973.1|  BnaA01g05450D                                        98.2    1e-20   
emb|CDY42621.1|  BnaC01g00330D                                        98.2    1e-20   
ref|XP_009115076.1|  PREDICTED: cellulose synthase A catalytic su...  98.2    1e-20   
gb|ACS68191.1|  cellulose synthase 2.1 catalytic subunit              98.2    1e-20   
ref|XP_006286951.1|  hypothetical protein CARUB_v10000099mg           98.2    1e-20   
ref|XP_006399471.1|  hypothetical protein EUTSA_v10012521mg           98.2    1e-20   
ref|XP_010491044.1|  PREDICTED: cellulose synthase A catalytic su...  98.2    1e-20   
ref|NP_001289648.1|  probable cellulose synthase A catalytic subu...  98.2    1e-20   
ref|NP_001105532.1|  cellulose synthase catalytic subunit 12          97.8    1e-20   
ref|XP_010645442.1|  PREDICTED: probable cellulose synthase A cat...  97.8    2e-20   
gb|EPS58530.1|  hypothetical protein M569_16283                       94.7    2e-20   
gb|KHG11460.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...  97.8    2e-20   
ref|XP_010452418.1|  PREDICTED: cellulose synthase A catalytic su...  97.8    2e-20   
ref|XP_004300066.1|  PREDICTED: probable cellulose synthase A cat...  97.8    2e-20   
ref|XP_003519160.1|  PREDICTED: cellulose synthase A catalytic su...  97.8    2e-20   
ref|XP_006582808.1|  PREDICTED: LOW QUALITY PROTEIN: probable cel...  97.8    2e-20   
gb|KHN14136.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...  97.8    2e-20   
ref|XP_002871389.1|  hypothetical protein ARALYDRAFT_908936           97.8    2e-20   
ref|XP_008381836.1|  PREDICTED: cellulose synthase A catalytic su...  97.8    2e-20   
ref|XP_009339472.1|  PREDICTED: cellulose synthase A catalytic su...  97.8    2e-20   
gb|EYU17477.1|  hypothetical protein MIMGU_mgv1a016004mg              91.7    2e-20   
ref|XP_008358296.1|  PREDICTED: cellulose synthase A catalytic su...  97.8    2e-20   
ref|XP_002983910.1|  family 2 glycosyltransferase                     97.8    2e-20   
emb|CBI37703.3|  unnamed protein product                              97.4    2e-20   
emb|CCW28829.1|  putative cellulose synthase family protein           97.8    2e-20   
ref|XP_008369157.1|  PREDICTED: cellulose synthase A catalytic su...  97.8    2e-20   
gb|AIA61439.1|  cellulose synthase                                    97.8    2e-20   
ref|XP_010266321.1|  PREDICTED: probable cellulose synthase A cat...  97.8    2e-20   
ref|XP_008461291.1|  PREDICTED: cellulose synthase A catalytic su...  97.8    2e-20   
ref|XP_006398979.1|  hypothetical protein EUTSA_v10012528mg           97.4    2e-20   
gb|AFR38984.1|  cellulose synthase                                    90.5    2e-20   
ref|XP_009782822.1|  PREDICTED: cellulose synthase A catalytic su...  97.4    2e-20   
gb|AFY06685.1|  cellulose synthase                                    97.4    2e-20   
emb|CDX81249.1|  BnaC09g06600D                                        97.4    2e-20   
emb|CDY18696.1|  BnaA09g06990D                                        97.4    2e-20   
ref|XP_009112155.1|  PREDICTED: cellulose synthase A catalytic su...  97.4    2e-20   
gb|AEI87569.1|  cellulose synthase catalytic subunit protein          97.4    2e-20   
gb|ACS68196.1|  cellulose synthase 6.1 catalytic subunit              97.4    2e-20   
gb|KCW78812.1|  hypothetical protein EUGRSUZ_C00246                   97.4    2e-20   
ref|XP_008463088.1|  PREDICTED: cellulose synthase A catalytic su...  97.4    2e-20   
ref|XP_008463087.1|  PREDICTED: cellulose synthase A catalytic su...  97.4    2e-20   
emb|CCW28832.1|  putative cellulose synthase                          94.0    2e-20   
ref|XP_004138382.1|  PREDICTED: cellulose synthase A catalytic su...  97.4    2e-20   
ref|XP_010266322.1|  PREDICTED: probable cellulose synthase A cat...  97.1    2e-20   
ref|XP_011101270.1|  PREDICTED: cellulose synthase A catalytic su...  97.4    2e-20   
gb|KDO83763.1|  hypothetical protein CISIN_1g001373mg                 97.1    2e-20   
gb|KCW78813.1|  hypothetical protein EUGRSUZ_C00246                   97.4    2e-20   
ref|NP_001289644.1|  cellulose synthase A catalytic subunit 7         97.4    2e-20   
ref|XP_006279743.1|  hypothetical protein CARUB_v10027598mg           97.4    3e-20   
ref|XP_008794369.1|  PREDICTED: cellulose synthase A catalytic su...  97.4    3e-20   
gb|AGE09566.1|  cellulose synthase-like protein                       97.1    3e-20   
gb|KEH19084.1|  cellulose synthase-like protein                       97.4    3e-20   
gb|AEK31217.1|  cellulose synthase A                                  97.1    3e-20   
ref|XP_010526630.1|  PREDICTED: cellulose synthase A catalytic su...  97.4    3e-20   
gb|AGJ71354.1|  cellulose synthase 3                                  97.1    3e-20   
gb|KCW78815.1|  hypothetical protein EUGRSUZ_C00246                   97.1    3e-20   
ref|XP_006434481.1|  hypothetical protein CICLE_v10000103mg           97.1    3e-20   
gb|AFS95066.1|  cellulose synthase                                    97.1    3e-20   
ref|XP_010260984.1|  PREDICTED: cellulose synthase A catalytic su...  97.1    3e-20   
gb|KCW78814.1|  hypothetical protein EUGRSUZ_C00246                   97.1    3e-20   
gb|AFR58756.2|  cellulose synthase 3                                  97.1    3e-20   



>ref|XP_006361724.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Solanum tuberosum]
Length=1086

 Score =   207 bits (526),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA GD+F+ACNECAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSPRVDGDD+EEDVD
Sbjct  48   LTATGDVFIACNECAFPVCRACYEYERKDGNQSCPQCKTRYKRFKGSPRVDGDDDEEDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +GN KAR++WQG+D  LSSSSRHES QPIPLLTNGQP+SG+ P SAT DTQ
Sbjct  108  DIDNEFNYAQGNSKARQQWQGDDAGLSSSSRHESQQPIPLLTNGQPVSGDFP-SATTDTQ  166

Query  362  SIRSMSGPLGPG  397
            S+RSMSGPLGPG
Sbjct  167  SVRSMSGPLGPG  178



>ref|XP_004245031.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Solanum lycopersicum]
Length=1086

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 120/131 (92%), Gaps = 1/131 (1%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvdd  184
            TA+GD+F+ACNECAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSPRVDGDD+EEDVDD
Sbjct  49   TASGDVFIACNECAFPVCRACYEYERKDGNQSCPQCKTRYKRFKGSPRVDGDDDEEDVDD  108

Query  185  lvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQS  364
            + NEFNY +GN KAR++WQG+D  LSSSSRHES QPIPLLT+GQP+SG+ P SAT DTQS
Sbjct  109  IDNEFNYAQGNSKARQQWQGDDAGLSSSSRHESQQPIPLLTDGQPVSGDFP-SATTDTQS  167

Query  365  IRSMSGPLGPG  397
            +RSMSGPLGPG
Sbjct  168  VRSMSGPLGPG  178



>emb|CBI21020.3| unnamed protein product [Vitis vinifera]
Length=921

 Score =   203 bits (516),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA GD+FVACNECAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSPRV+GDDEE+DVD
Sbjct  48   LTAAGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPRVEGDDEEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +GN KARR+WQGED DLSSSSRHES QPIPLLTNGQP+SGEIP S TPD Q
Sbjct  108  DIENEFNYAQGNSKARRQWQGEDADLSSSSRHESQQPIPLLTNGQPLSGEIP-SGTPDNQ  166

Query  362  SIRSMSGPLGPG  397
            S+R+ SGPLGPG
Sbjct  167  SVRTTSGPLGPG  178



>gb|AGC97433.2| cellulose synthase [Boehmeria nivea]
Length=1082

 Score =   204 bits (518),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 118/132 (89%), Gaps = 1/132 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA GD+FVACNECAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSPRVDGDD+E+D D
Sbjct  48   LTAAGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPRVDGDDDEDDDD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +GN  ARR+W+GED DLSSSSRHES QPIPLLTNGQP+SGEIP  ATPD Q
Sbjct  108  DLENEFNYADGNNNARRQWRGEDADLSSSSRHESQQPIPLLTNGQPVSGEIP-CATPDNQ  166

Query  362  SIRSMSGPLGPG  397
            S+R+ SGPLGPG
Sbjct  167  SVRTTSGPLGPG  178



>ref|XP_009785781.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Nicotiana sylvestris]
Length=1085

 Score =   204 bits (518),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            + A GD+FVACNECAFPVCR+CYEYERKDGNQ+CPQCKTRYKR KG PRVDGDD+E+DVD
Sbjct  48   LNAIGDVFVACNECAFPVCRSCYEYERKDGNQSCPQCKTRYKRHKGCPRVDGDDDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +GN KARR+WQGEDV LSSSSRH+   PIPLLTNGQ +SGEIP SATPDTQ
Sbjct  108  DIDNEFNYAQGNSKARRQWQGEDVSLSSSSRHDPQHPIPLLTNGQSVSGEIP-SATPDTQ  166

Query  362  SIRSMSGPLGPG  397
            S+RSMSGPLGPG
Sbjct  167  SVRSMSGPLGPG  178



>ref|XP_010648652.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Vitis vinifera]
Length=1084

 Score =   204 bits (518),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA GD+FVACNECAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSPRV+GDDEE+DVD
Sbjct  48   LTAAGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPRVEGDDEEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +GN KARR+WQGED DLSSSSRHES QPIPLLTNGQP+SGEIP S TPD Q
Sbjct  108  DIENEFNYAQGNSKARRQWQGEDADLSSSSRHESQQPIPLLTNGQPLSGEIP-SGTPDNQ  166

Query  362  SIRSMSGPLGPG  397
            S+R+ SGPLGPG
Sbjct  167  SVRTTSGPLGPG  178



>emb|CAN60659.1| hypothetical protein VITISV_018069 [Vitis vinifera]
Length=1097

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA GD+FVACNECAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSPRV+GDDEE+DVD
Sbjct  45   LTAXGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPRVEGDDEEDDVD  104

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +GN KARR+WQGED DLSSSSRHES QPIPLLTNGQP+SGEIP S TPD Q
Sbjct  105  DIENEFNYAQGNSKARRQWQGEDADLSSSSRHESQQPIPLLTNGQPLSGEIP-SGTPDNQ  163

Query  362  SIRSMSGPLGPG  397
            S+R+ SGPLGPG
Sbjct  164  SVRTTSGPLGPG  175



>ref|XP_010110357.1| Protein radially swollen 1 [Morus notabilis]
 gb|EXC26044.1| Protein radially swollen 1 [Morus notabilis]
Length=1080

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TANGD+FVACNECAFPVC  CYEYERKDGNQ+CPQCKTRYKR KGSPRVDGDD+E+DVD
Sbjct  48   LTANGDVFVACNECAFPVCHPCYEYERKDGNQSCPQCKTRYKRHKGSPRVDGDDDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +GN  +RR+W+GED DLSSSSRHES QPIPLLTNGQP+SGEIP  ATPD Q
Sbjct  108  DLENEFNYAQGNNNSRRQWRGEDADLSSSSRHESQQPIPLLTNGQPVSGEIP-CATPDNQ  166

Query  362  SIRSMSGPLGPG  397
            S+R+ SGPLGPG
Sbjct  167  SVRTTSGPLGPG  178



>ref|XP_009768318.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Nicotiana sylvestris]
Length=1085

 Score =   202 bits (514),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA+GD+FVACNECAFPVCR CYEYERKDGNQACPQCKTRYKR  GSPRVDGDD+EEDVD
Sbjct  48   LTASGDLFVACNECAFPVCRACYEYERKDGNQACPQCKTRYKRHMGSPRVDGDDDEEDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +GN KAR++WQG+D  LSSSSRHES QPIPLLTNGQ +SGEIP S T DTQ
Sbjct  108  DIDNEFNYAQGNSKARQQWQGDDAGLSSSSRHESQQPIPLLTNGQQVSGEIPRSMT-DTQ  166

Query  362  SIRSMSGPLGPG  397
            S+RSMSGPLGPG
Sbjct  167  SVRSMSGPLGPG  178



>ref|XP_009623502.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Nicotiana tomentosiformis]
Length=1085

 Score =   202 bits (514),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA+GD+FVACNECAFPVCR CYEYERKDGNQ+CPQCKTRYKR  GSPRVDGDD+EEDVD
Sbjct  48   LTASGDLFVACNECAFPVCRACYEYERKDGNQSCPQCKTRYKRHMGSPRVDGDDDEEDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +GN KAR++WQGED  LSSSSRHES QPIPLLTNGQ +SGEIP S T DTQ
Sbjct  108  DIDNEFNYAQGNSKARQQWQGEDAGLSSSSRHESQQPIPLLTNGQQVSGEIPRSMT-DTQ  166

Query  362  SIRSMSGPLGPG  397
            S+RSMSGPLGPG
Sbjct  167  SVRSMSGPLGPG  178



>gb|AGV22109.1| cellulose synthase 7 [Betula luminifera]
Length=1085

 Score =   202 bits (513),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 118/131 (90%), Gaps = 1/131 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA+GD+FVACNECAFPVCR CYEYERKDGNQACPQCKTRYKR KGSPRVDGDD+E+DVD
Sbjct  48   LTASGDVFVACNECAFPVCRPCYEYERKDGNQACPQCKTRYKRHKGSPRVDGDDDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +GN KARR+WQGED DLSSSSRHE+ QPIPLL NGQP+SGEIP SA  D Q
Sbjct  108  DLENEFNYTQGNSKARRQWQGEDADLSSSSRHEAQQPIPLLMNGQPMSGEIP-SAISDNQ  166

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  167  SVRTTSGPLGP  177



>ref|XP_007221583.1| hypothetical protein PRUPE_ppa000611mg [Prunus persica]
 gb|EMJ22782.1| hypothetical protein PRUPE_ppa000611mg [Prunus persica]
Length=1072

 Score =   202 bits (513),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 117/131 (89%), Gaps = 1/131 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA GD+FVACNECAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSPRVDGDD+E+D+D
Sbjct  48   LTATGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPRVDGDDDEDDID  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +GN  ARR+WQGED DLSSSSRHES QPIPLLTNGQP+SGEIP  ATPD Q
Sbjct  108  DLENEFNYAQGNSNARRQWQGEDADLSSSSRHESQQPIPLLTNGQPMSGEIP-CATPDNQ  166

Query  362  SIRSMSGPLGP  394
            S+R+ SGPL P
Sbjct  167  SVRTTSGPLDP  177



>ref|XP_008219478.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Prunus mume]
Length=1072

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 116/131 (89%), Gaps = 1/131 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA GD+FVACNECAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSPRVDGDD+E+D+D
Sbjct  48   LTATGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPRVDGDDDEDDID  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +GN   RR+WQGED DLSSSSRHES QPIPLLTNGQP+SGEIP  ATPD Q
Sbjct  108  DLENEFNYAQGNSNGRRQWQGEDADLSSSSRHESQQPIPLLTNGQPMSGEIP-CATPDNQ  166

Query  362  SIRSMSGPLGP  394
            S+R+ SGPL P
Sbjct  167  SVRTTSGPLDP  177



>ref|XP_008394069.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Malus domestica]
Length=1072

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 115/131 (88%), Gaps = 1/131 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            VTA GD+FVACNECAFPVCR CYEYERKDGNQACPQCKTRYKR KGSPRVDGDD+E+D+D
Sbjct  48   VTATGDVFVACNECAFPVCRPCYEYERKDGNQACPQCKTRYKRHKGSPRVDGDDDEDDID  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +G   ARR+WQGED DLSSSSRHES QPIPLLTNGQ +SGEIP  ATPD Q
Sbjct  108  DLENEFNYAQGTSNARRQWQGEDADLSSSSRHESQQPIPLLTNGQSVSGEIP-CATPDNQ  166

Query  362  SIRSMSGPLGP  394
            S+R+ SGPL P
Sbjct  167  SVRTTSGPLDP  177



>ref|XP_008387657.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Malus domestica]
Length=765

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 115/131 (88%), Gaps = 1/131 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA GD+FVACNECAFPVCR CYEYERKDGNQACPQCKTRYKR KGSPRVDGDD+E+D+D
Sbjct  48   LTATGDVFVACNECAFPVCRPCYEYERKDGNQACPQCKTRYKRHKGSPRVDGDDDEDDID  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +G   ARR+WQGED DLSSSSRHES QPIPLLTNGQ +SGEIP  ATPD Q
Sbjct  108  DLENEFNYTQGTSNARRQWQGEDADLSSSSRHESQQPIPLLTNGQSVSGEIP-CATPDNQ  166

Query  362  SIRSMSGPLGP  394
            S+R+ SGPL P
Sbjct  167  SVRTTSGPLDP  177



>ref|XP_009597841.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Nicotiana tomentosiformis]
Length=1085

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 117/132 (89%), Gaps = 1/132 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            + A GD+FVACNECAFPVCR+CYEYERKDGNQ+CPQCKTRYKR KG PRVDGDD+E+DVD
Sbjct  48   LNAIGDVFVACNECAFPVCRSCYEYERKDGNQSCPQCKTRYKRHKGCPRVDGDDDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +GN KARR+WQGED  LSSSSR +   PIPLLTNGQ +SGEIP SATPDTQ
Sbjct  108  DIDNEFNYAQGNSKARRQWQGEDASLSSSSRQDPQHPIPLLTNGQSVSGEIP-SATPDTQ  166

Query  362  SIRSMSGPLGPG  397
            S+RSMSGPLGPG
Sbjct  167  SVRSMSGPLGPG  178



>ref|XP_009355721.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Pyrus x bretschneideri]
 ref|XP_009348606.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Pyrus x bretschneideri]
Length=1072

 Score =   198 bits (504),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 115/131 (88%), Gaps = 1/131 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA GD+FVACNECAFPVCR CYEYERKDGNQACPQCKTRYKR KGSPRVDGDD+E+D+D
Sbjct  48   LTATGDVFVACNECAFPVCRPCYEYERKDGNQACPQCKTRYKRHKGSPRVDGDDDEDDID  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +G   ARR+WQGED DLSSSSRHES QPIPLLTNGQ +SGEIP  ATPD Q
Sbjct  108  DLENEFNYAQGTSNARRQWQGEDADLSSSSRHESQQPIPLLTNGQSVSGEIP-CATPDNQ  166

Query  362  SIRSMSGPLGP  394
            S+R+ SGPL P
Sbjct  167  SVRTTSGPLDP  177



>ref|XP_008366693.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Malus domestica]
Length=1072

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 115/131 (88%), Gaps = 1/131 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA GD+FVACNECAFPVCR CYEYERKDGNQACPQCKTRYKR KGSPRVDGDD+E+D+D
Sbjct  48   LTATGDVFVACNECAFPVCRPCYEYERKDGNQACPQCKTRYKRHKGSPRVDGDDDEDDID  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +G   ARR+WQGED DLSSSSRHES QPIPLLTNGQ +SGEIP  ATPD Q
Sbjct  108  DLENEFNYTQGTSNARRQWQGEDADLSSSSRHESQQPIPLLTNGQSVSGEIP-CATPDNQ  166

Query  362  SIRSMSGPLGP  394
            S+R+ SGPL P
Sbjct  167  SVRTTSGPLDP  177



>gb|AAT66940.1| CesA1 [Acacia mangium]
Length=1082

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 118/131 (90%), Gaps = 3/131 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA GD+FVACNECAFPVCR CYEYERKDGN+ACPQCKTRYKR KGSPRV+GDD+E+DVD
Sbjct  48   LTATGDVFVACNECAFPVCRPCYEYERKDGNKACPQCKTRYKRHKGSPRVEGDDDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +G  KARRKW+GED D+SSS+R++S QPIPLLT+GQP+SGEIP   TPDTQ
Sbjct  108  DIENEFNYDQGKTKARRKWEGEDADISSSARYDSQQPIPLLTSGQPMSGEIP---TPDTQ  164

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  165  SVRTTSGPLGP  175



>ref|XP_006450469.1| hypothetical protein CICLE_v10007296mg [Citrus clementina]
 ref|XP_006483338.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
isoform X2 [Citrus sinensis]
 gb|ESR63709.1| hypothetical protein CICLE_v10007296mg [Citrus clementina]
 gb|KDO61692.1| hypothetical protein CISIN_1g001399mg [Citrus sinensis]
Length=1085

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 119/131 (91%), Gaps = 1/131 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA GDIFVACNECAFPVCR CYEYERKDG Q+CPQCKTRYKR KGSPRV+GDDEE+D+D
Sbjct  48   LTAMGDIFVACNECAFPVCRPCYEYERKDGTQSCPQCKTRYKRHKGSPRVEGDDEEDDID  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +GN KARR+WQGED++LS+SSRHES QPIPLLTNGQ +SGEIP  ATPDTQ
Sbjct  108  DLENEFNYAQGNSKARRQWQGEDLELSASSRHESQQPIPLLTNGQSVSGEIP-CATPDTQ  166

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  167  SVRTTSGPLGP  177



>ref|XP_002308657.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE92180.1| cellulose synthase family protein [Populus trichocarpa]
Length=1075

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 118/132 (89%), Gaps = 2/132 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            VT NGDIFVACNECAFPVCR CYEYERKDG Q+CPQCKTRY+R KGSPRVDGD++E+DVD
Sbjct  48   VTENGDIFVACNECAFPVCRPCYEYERKDGTQSCPQCKTRYRRHKGSPRVDGDEDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +G  KARR+WQGED++LSSSSRHES QPIPLLTNGQP+SGEIP  ATPD Q
Sbjct  108  DLENEFNYAQGIGKARRQWQGEDIELSSSSRHES-QPIPLLTNGQPVSGEIP-CATPDNQ  165

Query  362  SIRSMSGPLGPG  397
            S+R+ SGPLGP 
Sbjct  166  SVRTTSGPLGPA  177



>gb|KDO61693.1| hypothetical protein CISIN_1g001399mg [Citrus sinensis]
Length=1059

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 119/131 (91%), Gaps = 1/131 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA GDIFVACNECAFPVCR CYEYERKDG Q+CPQCKTRYKR KGSPRV+GDDEE+D+D
Sbjct  22   LTAMGDIFVACNECAFPVCRPCYEYERKDGTQSCPQCKTRYKRHKGSPRVEGDDEEDDID  81

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +GN KARR+WQGED++LS+SSRHES QPIPLLTNGQ +SGEIP  ATPDTQ
Sbjct  82   DLENEFNYAQGNSKARRQWQGEDLELSASSRHESQQPIPLLTNGQSVSGEIP-CATPDTQ  140

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  141  SVRTTSGPLGP  151



>emb|CDP13491.1| unnamed protein product [Coffea canephora]
Length=1082

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 121/132 (92%), Gaps = 3/132 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA+GD+FVACNECAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSPRVDGDD+E+DVD
Sbjct  49   LTADGDMFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPRVDGDDDEDDVD  108

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +G  KARR+WQGED +LSSSSRH+  +PIPLLTNGQP+SGEIP+ ATP+T+
Sbjct  109  DLDNEFNYAQGTSKARRQWQGEDAELSSSSRHD--RPIPLLTNGQPVSGEIPI-ATPETR  165

Query  362  SIRSMSGPLGPG  397
            S+RS SGPLGPG
Sbjct  166  SVRSTSGPLGPG  177



>ref|XP_006483337.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
isoform X1 [Citrus sinensis]
Length=1102

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 119/131 (91%), Gaps = 1/131 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA GDIFVACNECAFPVCR CYEYERKDG Q+CPQCKTRYKR KGSPRV+GDDEE+D+D
Sbjct  65   LTAMGDIFVACNECAFPVCRPCYEYERKDGTQSCPQCKTRYKRHKGSPRVEGDDEEDDID  124

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +GN KARR+WQGED++LS+SSRHES QPIPLLTNGQ +SGEIP  ATPDTQ
Sbjct  125  DLENEFNYAQGNSKARRQWQGEDLELSASSRHESQQPIPLLTNGQSVSGEIP-CATPDTQ  183

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  184  SVRTTSGPLGP  194



>gb|AAO25536.1| cellulose synthase [Populus tremuloides]
Length=1083

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 118/132 (89%), Gaps = 2/132 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            VT NGDIFVACNECAFPVCR CYEYERKDG Q+CPQCKTRY+R KGSPRVDGD++E+DVD
Sbjct  48   VTENGDIFVACNECAFPVCRPCYEYERKDGTQSCPQCKTRYRRHKGSPRVDGDEDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +G  KARR+WQGED++LSSSSRHES QPIPLLTNGQP+SGEIP  ATPD Q
Sbjct  108  DLENEFNYAQGIGKARRQWQGEDIELSSSSRHES-QPIPLLTNGQPVSGEIP-CATPDNQ  165

Query  362  SIRSMSGPLGPG  397
            S+R+ SGPLGP 
Sbjct  166  SVRTTSGPLGPA  177



>ref|XP_007013842.1| Cellulose synthase 1 [Theobroma cacao]
 gb|EOY31461.1| Cellulose synthase 1 [Theobroma cacao]
Length=1085

 Score =   195 bits (496),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 116/131 (89%), Gaps = 1/131 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA GD+FVACNECAFPVCR CYEYERKDG Q CPQCKTRYKR KGSPRV+GDD+E+DVD
Sbjct  48   LTAAGDVFVACNECAFPVCRPCYEYERKDGTQCCPQCKTRYKRHKGSPRVEGDDDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEF+Y +G+ KARR+WQGEDVDLSSSSRHES QPIPLLTNG  +SGEIP  ATPD +
Sbjct  108  DLENEFDYAQGHSKARRQWQGEDVDLSSSSRHESQQPIPLLTNGHSVSGEIP-CATPDNE  166

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  167  SVRTTSGPLGP  177



>gb|KDP33612.1| hypothetical protein JCGZ_07183 [Jatropha curcas]
Length=1084

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 117/132 (89%), Gaps = 1/132 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            VTA+GD FVACNECAFPVCR CYEYERKDG Q+CPQCKTRY+R KGSPRV+GD++E+DVD
Sbjct  48   VTASGDTFVACNECAFPVCRPCYEYERKDGTQSCPQCKTRYRRHKGSPRVEGDEDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +GN K RR+WQGEDVDLSSSSRHES QPIPLLTNGQ +SGEIP  AT DTQ
Sbjct  108  DLENEFNYAQGNSKTRRQWQGEDVDLSSSSRHESQQPIPLLTNGQSVSGEIP-CATLDTQ  166

Query  362  SIRSMSGPLGPG  397
            S+R+ SGPLGP 
Sbjct  167  SVRTTSGPLGPA  178



>gb|AFZ78556.1| cellulose synthase [Populus tomentosa]
Length=1075

 Score =   193 bits (490),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 117/132 (89%), Gaps = 2/132 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            VT NGDIFVACNECAFPVCR CYEYERKDG Q+CPQCKTRY+R KGSPRVDGD++E+DVD
Sbjct  48   VTENGDIFVACNECAFPVCRPCYEYERKDGTQSCPQCKTRYRRHKGSPRVDGDEDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +G  KARR+WQGED++LSSSSRHES QPIPLLTNGQ +SGEIP  ATPD Q
Sbjct  108  DLENEFNYAQGIGKARRQWQGEDIELSSSSRHES-QPIPLLTNGQQVSGEIP-CATPDNQ  165

Query  362  SIRSMSGPLGPG  397
            S+R+ SGPLGP 
Sbjct  166  SVRTTSGPLGPA  177



>ref|XP_011039709.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Populus euphratica]
Length=1097

 Score =   192 bits (489),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 116/132 (88%), Gaps = 2/132 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            VT NGD FVACNECAFPVCR CYEYERKDG Q+CPQCKTRY+R KGSPRVDGD++E+DVD
Sbjct  48   VTENGDFFVACNECAFPVCRPCYEYERKDGTQSCPQCKTRYRRHKGSPRVDGDEDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +G  KAR +WQGED++LSSSSRHES QPIPLLTNGQP+SGEIP  ATPD Q
Sbjct  108  DLENEFNYAQGIGKARHQWQGEDIELSSSSRHES-QPIPLLTNGQPVSGEIP-CATPDNQ  165

Query  362  SIRSMSGPLGPG  397
            S+R+ SGPLGP 
Sbjct  166  SVRTTSGPLGPA  177



>gb|AFZ78558.1| cellulose synthase [Populus tomentosa]
Length=1084

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 117/132 (89%), Gaps = 2/132 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            VT NGDIFVACNECAFPVCR CYEYERKDG Q+CPQCKTRY+R KGSPRVDGD++E+DVD
Sbjct  48   VTENGDIFVACNECAFPVCRPCYEYERKDGTQSCPQCKTRYRRHKGSPRVDGDEDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +GN  A+ +WQG+D++LSSSSRHES QPIPLLTNGQP+SGEIP  ATPD Q
Sbjct  108  DLENEFNYPQGNGNAKHQWQGDDIELSSSSRHES-QPIPLLTNGQPVSGEIP-CATPDNQ  165

Query  362  SIRSMSGPLGPG  397
            S+R+ SGPLGP 
Sbjct  166  SVRTTSGPLGPA  177



>ref|XP_002324291.1| TGACG-motif binding family protein [Populus trichocarpa]
 gb|EEF02856.1| TGACG-motif binding family protein [Populus trichocarpa]
Length=1084

 Score =   190 bits (482),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 115/132 (87%), Gaps = 2/132 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            VT NGDIFVACNECAFPVCR CYEYERKDG Q+CPQCKTRY+R KGSPRVDGD++E+ VD
Sbjct  48   VTENGDIFVACNECAFPVCRPCYEYERKDGTQSCPQCKTRYRRHKGSPRVDGDEDEDGVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +G   A+ +WQG+D++LSSSSRHES QPIPLLTNGQP+SGEIP  ATPD Q
Sbjct  108  DLENEFNYAQGIGNAKHQWQGDDIELSSSSRHES-QPIPLLTNGQPVSGEIP-CATPDNQ  165

Query  362  SIRSMSGPLGPG  397
            S+R+ SGPLGP 
Sbjct  166  SVRTTSGPLGPA  177



>ref|XP_011026459.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Populus euphratica]
Length=1084

 Score =   189 bits (481),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 116/132 (88%), Gaps = 2/132 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            VT NGDIFVACNECAFPVCR CYEYERKDG Q+CPQCKTRY+R KGSPRVDGD++E+DVD
Sbjct  48   VTENGDIFVACNECAFPVCRPCYEYERKDGTQSCPQCKTRYRRHKGSPRVDGDEDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +G   A+ +WQG+D++LSSSSRHES QPIPLLTNGQP+SGEIP  ATPD Q
Sbjct  108  DLENEFNYAQGIGNAKHQWQGDDIELSSSSRHES-QPIPLLTNGQPVSGEIP-CATPDNQ  165

Query  362  SIRSMSGPLGPG  397
            S+R+ SGPLGP 
Sbjct  166  SVRTTSGPLGPA  177



>ref|XP_002515536.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
 gb|EEF46985.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
Length=1083

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 116/130 (89%), Gaps = 1/130 (1%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvdd  184
            TA+GD FVACNECAFPVCR CYEYERKDG Q+CPQCKTRY+R KGSPRV+GD++E+DVDD
Sbjct  49   TASGDTFVACNECAFPVCRPCYEYERKDGTQSCPQCKTRYRRHKGSPRVEGDEDEDDVDD  108

Query  185  lvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQS  364
            L NEF+Y +GN K R +WQG+DVDLS+SSRHES QPIPLLTNGQP+SGEIP  ATPD QS
Sbjct  109  LENEFSYAQGNGKTRSQWQGDDVDLSASSRHESQQPIPLLTNGQPVSGEIP-CATPDNQS  167

Query  365  IRSMSGPLGP  394
            +R+ SGPLGP
Sbjct  168  VRTTSGPLGP  177



>ref|XP_011081578.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Sesamum indicum]
Length=1084

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            + ANGD+FVACNECAFPVCR CYEYERKDGNQACPQCKTRYKR KGSPRVDGDD+E+D+D
Sbjct  48   LAANGDVFVACNECAFPVCRACYEYERKDGNQACPQCKTRYKRHKGSPRVDGDDDEDDID  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEF+Y +G VKAR +W G+D +LS+SSR ES QPIPLLTNGQ +SGEIP S   DT 
Sbjct  108  DLENEFSYSQGKVKARSQWPGDDAELSASSRRESQQPIPLLTNGQSVSGEIPPSLQ-DTH  166

Query  362  SIRSMSGPLGPG  397
            S+RS SGPLGPG
Sbjct  167  SVRSTSGPLGPG  178



>gb|EYU32338.1| hypothetical protein MIMGU_mgv1a000544mg [Erythranthe guttata]
Length=1084

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 115/132 (87%), Gaps = 1/132 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            VTANGD+FVACNECAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSPRVDGDD+E+DVD
Sbjct  48   VTANGDVFVACNECAFPVCRACYEYERKDGNQSCPQCKTRYKRQKGSPRVDGDDDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEF+Y +G  KAR +W G++++LS+SSR ES QPIPLLTNGQ +SGEIP S   DT 
Sbjct  108  DLENEFSYSQGKNKARSQWHGDEIELSASSRRESQQPIPLLTNGQQVSGEIPPSIQ-DTN  166

Query  362  SIRSMSGPLGPG  397
            SIRS SGPLGPG
Sbjct  167  SIRSTSGPLGPG  178



>ref|XP_010689561.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Beta vulgaris subsp. vulgaris]
Length=1086

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 116/131 (89%), Gaps = 2/131 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T +GD+FVACNECAFPVCR CY+YERKDGNQ CPQCKTRYKR KGSPRV+GDDEE+D+D
Sbjct  49   LTPSGDVFVACNECAFPVCRPCYDYERKDGNQCCPQCKTRYKRHKGSPRVEGDDEEDDID  108

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY  G  KAR +WQGEDVDLSSSSRHES QPIPLLTNGQ +SGEIP SATPD Q
Sbjct  109  DLENEFNYTRGTSKARHQWQGEDVDLSSSSRHES-QPIPLLTNGQVVSGEIP-SATPDNQ  166

Query  362  SIRSMSGPLGP  394
            S+RS SGP+GP
Sbjct  167  SVRSTSGPIGP  177



>gb|KGN60109.1| hypothetical protein Csa_3G878780 [Cucumis sativus]
Length=1062

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 117/131 (89%), Gaps = 2/131 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA+GD+FVACNECAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSPRVDGDD+E+DVD
Sbjct  48   LTASGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPRVDGDDDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +G+ K +R+W GED +LS+S+RHES QPIPLLTNGQ +SGEIP  ATPD Q
Sbjct  108  DIENEFNYVQGSSKTKRQWHGEDAELSTSARHES-QPIPLLTNGQSVSGEIP-CATPDNQ  165

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  166  SVRTTSGPLGP  176



>ref|XP_010670651.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Beta vulgaris subsp. vulgaris]
Length=1086

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 116/131 (89%), Gaps = 2/131 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T +GD+FVACNECAFPVCR CY+YERKDGNQ CPQCKTRYKR KGSPRV+GDDEE+D+D
Sbjct  49   LTPSGDVFVACNECAFPVCRPCYDYERKDGNQCCPQCKTRYKRHKGSPRVEGDDEEDDID  108

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY  G  KAR +WQGEDVDLSSSSRHES QPIPLLTNGQ +SGEIP SATPD Q
Sbjct  109  DLENEFNYTSGTSKARHQWQGEDVDLSSSSRHES-QPIPLLTNGQVVSGEIP-SATPDNQ  166

Query  362  SIRSMSGPLGP  394
            S+RS SGP+GP
Sbjct  167  SVRSTSGPIGP  177



>ref|XP_010250039.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Nelumbo nucifera]
Length=1085

 Score =   187 bits (476),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 118/133 (89%), Gaps = 2/133 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            VTA GD+FVACNECAFPVCR CYEYER+DGNQ+CPQCKTRYKR KGSPRV+GDDEE+DVD
Sbjct  48   VTATGDVFVACNECAFPVCRPCYEYERRDGNQSCPQCKTRYKRHKGSPRVEGDDEEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY  GN K  R+WQG+DVDLSSS+RHES +PIPLLTNGQP+SGE+P +ATPD Q
Sbjct  108  DLDNEFNYSHGNGKGMRQWQGDDVDLSSSNRHESQRPIPLLTNGQPVSGEMP-NATPDDQ  166

Query  362  SIR-SMSGPLGPG  397
            S+R + SGPLG G
Sbjct  167  SVRTTTSGPLGSG  179



>ref|XP_008466397.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Cucumis melo]
Length=1081

 Score =   187 bits (476),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 117/131 (89%), Gaps = 2/131 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA+GD+FVACNECAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSPRVDGDD+E+DVD
Sbjct  48   LTASGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPRVDGDDDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +G+ K +R+W GED +LS+S+RHES QPIPLLTNGQ +SGEIP  ATPD Q
Sbjct  108  DIENEFNYVQGSSKTKRQWHGEDAELSTSARHES-QPIPLLTNGQSVSGEIP-CATPDNQ  165

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  166  SVRTTSGPLGP  176



>ref|XP_004136343.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Cucumis sativus]
 ref|XP_004169170.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Cucumis sativus]
Length=1081

 Score =   187 bits (476),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 117/131 (89%), Gaps = 2/131 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA+GD+FVACNECAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSPRVDGDD+E+DVD
Sbjct  48   LTASGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPRVDGDDDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +G+ K +R+W GED +LS+S+RHES QPIPLLTNGQ +SGEIP  ATPD Q
Sbjct  108  DIENEFNYVQGSSKTKRQWHGEDAELSTSARHES-QPIPLLTNGQSVSGEIP-CATPDNQ  165

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  166  SVRTTSGPLGP  176



>gb|KJB53894.1| hypothetical protein B456_009G010200 [Gossypium raimondii]
Length=892

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 113/131 (86%), Gaps = 3/131 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            V A GD+FVACNECAFPVCR CYEYERKDG Q CPQCKTRYKR KGSPRV+GDD+EEDVD
Sbjct  48   VGAAGDVFVACNECAFPVCRPCYEYERKDGTQCCPQCKTRYKRQKGSPRVEGDDDEEDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEF+Y +G  KARR+WQGEDVDLSSSSRHES QPIPLLTNG  +SGEI   ATPD +
Sbjct  108  DLENEFDYAQGLSKARRQWQGEDVDLSSSSRHESQQPIPLLTNGHTVSGEI---ATPDNR  164

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  165  SVRTTSGPLGP  175



>ref|XP_010048223.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Eucalyptus grandis]
 gb|KCW80412.1| hypothetical protein EUGRSUZ_C01769 [Eucalyptus grandis]
Length=1082

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            ++A+GD+FVACNECAFPVCR CYEYERKDGNQ CPQCKTRYKR KGSPRV+GDD+E+ VD
Sbjct  48   LSASGDVFVACNECAFPVCRPCYEYERKDGNQCCPQCKTRYKRQKGSPRVEGDDDEDGVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEF+Y  GN + RR+WQGED DLSSSSR ES  P+PLLTNG PISGEIP  ATPD Q
Sbjct  108  DLENEFSYTRGNAR-RRQWQGEDPDLSSSSRRESQHPVPLLTNGLPISGEIP-CATPDNQ  165

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  166  SVRTTSGPLGP  176



>gb|KJB53892.1| hypothetical protein B456_009G010200 [Gossypium raimondii]
Length=1083

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 113/131 (86%), Gaps = 3/131 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            V A GD+FVACNECAFPVCR CYEYERKDG Q CPQCKTRYKR KGSPRV+GDD+EEDVD
Sbjct  48   VGAAGDVFVACNECAFPVCRPCYEYERKDGTQCCPQCKTRYKRQKGSPRVEGDDDEEDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEF+Y +G  KARR+WQGEDVDLSSSSRHES QPIPLLTNG  +SGEI   ATPD +
Sbjct  108  DLENEFDYAQGLSKARRQWQGEDVDLSSSSRHESQQPIPLLTNGHTVSGEI---ATPDNR  164

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  165  SVRTTSGPLGP  175



>gb|AFB18635.1| CESA6 [Gossypium hirsutum]
 gb|KJB53882.1| hypothetical protein B456_009G009500 [Gossypium raimondii]
Length=1083

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 113/131 (86%), Gaps = 3/131 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            V A GD+FVACNECAFPVCR CYEYERKDG Q CPQCKTRYKR KGSPRV+GDD+EEDVD
Sbjct  48   VGAAGDVFVACNECAFPVCRPCYEYERKDGTQCCPQCKTRYKRHKGSPRVEGDDDEEDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEF+Y +G  KARR+WQGEDVDLSSSSRHES QPIPLLTNG  +SGEI   ATPD +
Sbjct  108  DLENEFDYAQGLSKARRQWQGEDVDLSSSSRHESQQPIPLLTNGHTVSGEI---ATPDNR  164

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  165  SVRTTSGPLGP  175



>gb|KHG11461.1| Cellulose synthase A catalytic subunit 1 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1083

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 113/131 (86%), Gaps = 3/131 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            V A GD+FVACNECAFPVCR CYEYERKDG Q CPQCKTRYKR KGSPRV+GDD+EEDVD
Sbjct  48   VGAAGDVFVACNECAFPVCRPCYEYERKDGTQCCPQCKTRYKRHKGSPRVEGDDDEEDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEF+Y +G  KARR+WQGEDVDLSSSSRHES QPIPLLTNG  +SGEI   ATPD +
Sbjct  108  DLENEFDYAQGLSKARREWQGEDVDLSSSSRHESQQPIPLLTNGHTVSGEI---ATPDNR  164

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  165  SVRTTSGPLGP  175



>ref|XP_004291468.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
isoform X2 [Fragaria vesca subsp. vesca]
Length=1069

 Score =   184 bits (467),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 114/131 (87%), Gaps = 4/131 (3%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA GD+FVACNECAFPVCR CYEYERKDGNQACPQCKTRYKR KGSPRVDGD++E+D+D
Sbjct  48   LTATGDVFVACNECAFPVCRPCYEYERKDGNQACPQCKTRYKRHKGSPRVDGDEDEDDID  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +G    RR+WQG+D DLSSSSRHES QPIPLLTNGQ +SGEIP  ATPD Q
Sbjct  108  DLENEFNYAQGT---RRQWQGDDPDLSSSSRHESGQPIPLLTNGQSVSGEIP-CATPDNQ  163

Query  362  SIRSMSGPLGP  394
            S+R+ SGPL P
Sbjct  164  SVRTTSGPLDP  174



>ref|XP_011071168.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Sesamum indicum]
Length=1084

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 115/132 (87%), Gaps = 1/132 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            VTA+GD+FVACNECAFPVCR CYEYERKDGNQ+CPQCKTRYKR KG PRVDGDDEEED+D
Sbjct  48   VTASGDLFVACNECAFPVCRACYEYERKDGNQSCPQCKTRYKRQKGCPRVDGDDEEEDID  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL +EFNY +G  KAR +W G+DV+LS+SSR ES QPIPLLT+GQ +SGEIP S T DT 
Sbjct  108  DLEDEFNYSQGKSKARSQWLGDDVELSASSRRESQQPIPLLTHGQSVSGEIPPS-TQDTH  166

Query  362  SIRSMSGPLGPG  397
            S+RS SGPLGPG
Sbjct  167  SVRSTSGPLGPG  178



>gb|AHL45023.1| cellulose synthase 1A [Linum usitatissimum]
Length=1079

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 114/132 (86%), Gaps = 2/132 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TANGD+FVACNECAFPVCR CYEYERKDG QACPQCKTRYKR KG PRVDGD++E+D+D
Sbjct  48   LTANGDVFVACNECAFPVCRPCYEYERKDGTQACPQCKTRYKRHKGCPRVDGDEDEDDID  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL +EF+Y +   KA R WQG+DV+LSSSSRHES  PIPLLTNGQ ISGEIP  ATPDTQ
Sbjct  108  DLEDEFSY-QATGKAGRHWQGDDVELSSSSRHESQMPIPLLTNGQQISGEIP-CATPDTQ  165

Query  362  SIRSMSGPLGPG  397
            S+R+ SGPLGP 
Sbjct  166  SVRTTSGPLGPA  177



>gb|AHL45024.1| cellulose synthase 1B [Linum usitatissimum]
Length=1079

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 114/131 (87%), Gaps = 2/131 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TANGD+FVACNECAFPVCR CYEYERKDG QACPQCKTRYKR KG PRVDGD++E+DVD
Sbjct  48   LTANGDVFVACNECAFPVCRPCYEYERKDGTQACPQCKTRYKRHKGCPRVDGDEDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL +EF+Y +   KA R WQG+DV+LSSSSRHES  PIPLLTNGQ ISGEIP  ATPDTQ
Sbjct  108  DLEDEFSY-QATGKAGRHWQGDDVELSSSSRHESQMPIPLLTNGQQISGEIP-CATPDTQ  165

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  166  SVRTTSGPLGP  176



>ref|XP_010254360.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Nelumbo nucifera]
Length=1085

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 116/133 (87%), Gaps = 2/133 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            VTA GD+FVACNECAFPVCR CYEYER+DGNQ+CPQCKTRYKR KGSPRV+GDDEE+D+D
Sbjct  48   VTATGDVFVACNECAFPVCRPCYEYERRDGNQSCPQCKTRYKRHKGSPRVEGDDEEDDID  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY  GN K  R+WQG+DV+LSSSSRHES + IPLLTNGQP+SGE+P +ATPD Q
Sbjct  108  DLDNEFNYTHGNGKGMRQWQGDDVELSSSSRHESLRSIPLLTNGQPVSGEMP-NATPDNQ  166

Query  362  SIR-SMSGPLGPG  397
            S+R + SG LG G
Sbjct  167  SVRTTTSGHLGSG  179



>ref|XP_011459196.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
isoform X1 [Fragaria vesca subsp. vesca]
Length=1072

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 114/134 (85%), Gaps = 7/134 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA GD+FVACNECAFPVCR CYEYERKDGNQACPQCKTRYKR KGSPRVDGD++E+D+D
Sbjct  48   LTATGDVFVACNECAFPVCRPCYEYERKDGNQACPQCKTRYKRHKGSPRVDGDEDEDDID  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQP---ISGEIPLSATP  352
            DL NEFNY +G    RR+WQG+D DLSSSSRHES QPIPLLTNGQ    +SGEIP  ATP
Sbjct  108  DLENEFNYAQGT---RRQWQGDDPDLSSSSRHESGQPIPLLTNGQSSVQVSGEIP-CATP  163

Query  353  DTQSIRSMSGPLGP  394
            D QS+R+ SGPL P
Sbjct  164  DNQSVRTTSGPLDP  177



>gb|KCW81421.1| hypothetical protein EUGRSUZ_C02801 [Eucalyptus grandis]
Length=1085

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 117/131 (89%), Gaps = 1/131 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA+GD+FVACNECAFPVCR CYEYERKDGNQ+CPQCK+RYKR KGSPRVDGDD+E++VD
Sbjct  48   LTASGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKSRYKRHKGSPRVDGDDDEDEVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +G   AR++WQGED DLSSSSRHES  PIPLLTNGQP+SGEIP  A+ D+Q
Sbjct  108  DLENEFNYAQGTSAARQQWQGEDPDLSSSSRHESRHPIPLLTNGQPMSGEIP-CASIDSQ  166

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  167  SVRTTSGPLGP  177



>gb|KCW81422.1| hypothetical protein EUGRSUZ_C02801 [Eucalyptus grandis]
Length=991

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 117/131 (89%), Gaps = 1/131 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA+GD+FVACNECAFPVCR CYEYERKDGNQ+CPQCK+RYKR KGSPRVDGDD+E++VD
Sbjct  48   LTASGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKSRYKRHKGSPRVDGDDDEDEVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +G   AR++WQGED DLSSSSRHES  PIPLLTNGQP+SGEIP  A+ D+Q
Sbjct  108  DLENEFNYAQGTSAARQQWQGEDPDLSSSSRHESRHPIPLLTNGQPMSGEIP-CASIDSQ  166

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  167  SVRTTSGPLGP  177



>ref|NP_001289657.1| cellulose synthase A catalytic subunit 1 [Eucalyptus grandis]
 gb|AAY60847.1| cellulose synthase 5 [Eucalyptus grandis]
Length=1085

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 117/131 (89%), Gaps = 1/131 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA+GD+FVACNECAFPVCR CYEYERKDGNQ+CPQCK+RYKR KGSPRVDGDD+E++VD
Sbjct  48   LTASGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKSRYKRHKGSPRVDGDDDEDEVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +G   AR++WQGED DLSSSSRHES  PIPLLTNGQP+SGEIP  A+ D+Q
Sbjct  108  DLENEFNYAQGTSAARQQWQGEDPDLSSSSRHESRHPIPLLTNGQPMSGEIP-CASIDSQ  166

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  167  SVRTTSGPLGP  177



>gb|AEK31219.1| cellulose synthase A [Eucalyptus camaldulensis]
Length=1085

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 116/131 (89%), Gaps = 1/131 (1%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA GD+FVACNECAFPVCR CYEYERKDGNQ+CPQCK+RYKR KGSPRVDGDD+E++VD
Sbjct  48   LTAGGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKSRYKRHKGSPRVDGDDDEDEVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +G   AR++WQGED DLSSSSRHES  PIPLLTNGQP+SGEIP  A+ D+Q
Sbjct  108  DLENEFNYAQGTSAARQQWQGEDPDLSSSSRHESRHPIPLLTNGQPMSGEIP-CASIDSQ  166

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  167  SVRTTSGPLGP  177



>ref|XP_004501313.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Cicer arietinum]
Length=1082

 Score =   173 bits (438),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 112/131 (85%), Gaps = 4/131 (3%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA  D+FVACNEC FPVCR CYEYERKDGN++CPQCKTRYKR +GSPRV+GDDEE+DVD
Sbjct  49   LTATSDVFVACNECGFPVCRPCYEYERKDGNKSCPQCKTRYKRHRGSPRVEGDDEEDDVD  108

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +GN KARR+W+ E   LSSSSR +  QPIPLLTNGQ +SGEIP  ATPDTQ
Sbjct  109  DIENEFNYAQGNSKARRQWEDE---LSSSSRRDYQQPIPLLTNGQTMSGEIP-CATPDTQ  164

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  165  SVRTTSGPLGP  175



>ref|XP_007137035.1| hypothetical protein PHAVU_009G094200g [Phaseolus vulgaris]
 gb|ESW09029.1| hypothetical protein PHAVU_009G094200g [Phaseolus vulgaris]
Length=1084

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 114/131 (87%), Gaps = 2/131 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA GD+FVACNECAFPVCR CYEYERKDGNQ+CPQCKTRYKR +GSPRV+GD++EED D
Sbjct  49   LTATGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRHRGSPRVEGDEDEEDSD  108

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY  G  KARR+W+ ED DLSSSSR ES QPIPLLTNGQ ISGEIP  ATPDTQ
Sbjct  109  DIENEFNYAPGKAKARRQWE-EDADLSSSSRRESQQPIPLLTNGQTISGEIP-CATPDTQ  166

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  167  SVRTTSGPLGP  177



>ref|XP_010526207.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Tarenaya hassleriana]
Length=1084

 Score =   170 bits (431),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 111/131 (85%), Gaps = 4/131 (3%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T NGD+FVACNECAFPVCR CYEYERKDG Q CPQCKTRY+R KGSPRVDGD++E+DVD
Sbjct  48   LTENGDVFVACNECAFPVCRPCYEYERKDGTQCCPQCKTRYRRHKGSPRVDGDEDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEF+Y +GN KARR   GE  + SSSSRHES QPIPLLT+G  +SGEIP  ATPDTQ
Sbjct  108  DLENEFDYVQGNNKARRPRHGE--EFSSSSRHES-QPIPLLTHGHTVSGEIP-CATPDTQ  163

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  164  SVRTTSGPLGP  174



>gb|KHN07088.1| Cellulose synthase A catalytic subunit 1 [UDP-forming] [Glycine 
soja]
Length=1084

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 115/131 (88%), Gaps = 2/131 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA GD+FVACNECAFPVCR CYEYERKDGNQ+CPQCKTRYKR +GSPRV+GD++E+D D
Sbjct  49   LTATGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRHRGSPRVEGDEDEDDSD  108

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +G  KARR+W+ +D DLSSSSR ES QPIPLLTNGQ +SGEIP  ATPDTQ
Sbjct  109  DIENEFNYAQGKAKARRQWE-DDADLSSSSRRESQQPIPLLTNGQTMSGEIP-CATPDTQ  166

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  167  SVRTTSGPLGP  177



>ref|XP_003526416.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Glycine max]
Length=1084

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 115/131 (88%), Gaps = 2/131 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA GD+FVACNECAFPVCR CYEYERKDGNQ+CPQCKTRYKR +GSPRV+GD++E+D D
Sbjct  49   LTATGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRHRGSPRVEGDEDEDDSD  108

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +G  KARR+W+ +D DLSSSSR ES QPIPLLTNGQ +SGEIP  ATPDTQ
Sbjct  109  DIENEFNYAQGKAKARRQWE-DDADLSSSSRRESQQPIPLLTNGQTMSGEIP-CATPDTQ  166

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  167  SVRTTSGPLGP  177



>ref|XP_010525969.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010525970.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
isoform X2 [Tarenaya hassleriana]
Length=1085

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 111/131 (85%), Gaps = 4/131 (3%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T NGD+FVACNECAFPVCR CYEYERKDG Q CPQCKTRY+R KGSPRV+GD++E+DVD
Sbjct  48   LTENGDVFVACNECAFPVCRPCYEYERKDGTQCCPQCKTRYRRHKGSPRVEGDEDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +GN KAR    GE  + SSSSRHES QPIPLLT+G  +SGEIP  ATPDTQ
Sbjct  108  DLENEFNYSQGNNKARHLRHGE--EFSSSSRHES-QPIPLLTHGHTVSGEIP-CATPDTQ  163

Query  362  SIRSMSGPLGP  394
            S+R+MSGPLGP
Sbjct  164  SVRTMSGPLGP  174



>tpg|DAA53227.1| TPA: cellulose synthase3 [Zea mays]
Length=194

 Score =   157 bits (398),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 103/127 (81%), Gaps = 4/127 (3%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            ++A GDIFVACNECAFPVCR CYEYERK+GNQ CPQCKTRYKR KGSPRV GD+EE+ VD
Sbjct  47   LSATGDIFVACNECAFPVCRPCYEYERKEGNQCCPQCKTRYKRHKGSPRVRGDEEEDGVD  106

Query  182  dlvNEFNYGEGNVKA---RRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATP  352
            DL NEFNY +GNV+    + + QGEDVD+SSSSRHE H  IP LT GQ +SG+IP  A+P
Sbjct  107  DLDNEFNYTQGNVQGPQWQLRGQGEDVDISSSSRHEPHHRIPRLTTGQQMSGDIP-DASP  165

Query  353  DTQSIRS  373
            D  SIRS
Sbjct  166  DRHSIRS  172



>gb|KHN08123.1| Cellulose synthase A catalytic subunit 1 [UDP-forming] [Glycine 
soja]
Length=1084

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 115/131 (88%), Gaps = 2/131 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA GD+FVACNECAFPVCR CYEYERKDGNQ+CPQCKTRYKR +GSPRV+GD++E+D D
Sbjct  49   LTATGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRHRGSPRVEGDEDEDDSD  108

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +G  KARR+W+ +D DLSSSSR ES QPIPLLTNGQ +SGEIP  ATPDTQ
Sbjct  109  DIENEFNYAQGKAKARRQWE-DDPDLSSSSRRESQQPIPLLTNGQTMSGEIP-CATPDTQ  166

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  167  SVRTTSGPLGP  177



>ref|XP_003522623.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Glycine max]
Length=1084

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 115/131 (88%), Gaps = 2/131 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA GD+FVACNECAFPVCR CYEYERKDGNQ+CPQCKTRYKR +GSPRV+GD++E+D D
Sbjct  49   LTATGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRHRGSPRVEGDEDEDDSD  108

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +G  KARR+W+ +D DLSSSSR ES QPIPLLTNGQ +SGEIP  ATPDTQ
Sbjct  109  DIENEFNYAQGKAKARRQWE-DDPDLSSSSRRESQQPIPLLTNGQTMSGEIP-CATPDTQ  166

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  167  SVRTTSGPLGP  177



>ref|XP_010914890.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Elaeis guineensis]
Length=1077

 Score =   167 bits (422),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 103/128 (80%), Gaps = 5/128 (4%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T  GD+FVACNECAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSPRV+GDDEE+ VD
Sbjct  48   LTVTGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPRVEGDDEEDGVD  107

Query  182  dlvNEFNYGEGNVKARRKW----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSAT  349
            DL NEFNY +GN K   +W    QGEDVDLSSSSRHE    IP LTNGQ +SGEIP  AT
Sbjct  108  DLDNEFNYTQGNGKTAHQWQLQGQGEDVDLSSSSRHEPQHCIPRLTNGQQVSGEIP-DAT  166

Query  350  PDTQSIRS  373
            PD  SIRS
Sbjct  167  PDRHSIRS  174



>dbj|BAJ93596.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=429

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 103/124 (83%), Gaps = 2/124 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            V+A GD+FVACNECAFPVCR CYEYERKDG Q CPQCKTRYKRLKGSPRV GD+EEEDVD
Sbjct  50   VSATGDVFVACNECAFPVCRPCYEYERKDGVQCCPQCKTRYKRLKGSPRVPGDEEEEDVD  109

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +GN K   +WQGED+DLSSSSRHE H  IP LT GQ ISGEIP  A+PD  
Sbjct  110  DLDNEFNYKQGNGKG-PEWQGEDIDLSSSSRHEPHHRIPRLTTGQQISGEIP-DASPDRH  167

Query  362  SIRS  373
            SIRS
Sbjct  168  SIRS  171



>gb|EPS68064.1| hypothetical protein M569_06709, partial [Genlisea aurea]
Length=1088

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +2

Query  8    ANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvddl  187
            ANGD FVACNECAFPVCR CYEYERKDGNQ+CPQCKTRY+R KGS RV GDD+E+DVDDL
Sbjct  52   ANGDTFVACNECAFPVCRACYEYERKDGNQSCPQCKTRYRRQKGSQRVSGDDDEDDVDDL  111

Query  188  vNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQSI  367
             NEF+Y +   K +  W G+DV++S+SSR E  QPIPLLT+GQ +S EI   +  DT S+
Sbjct  112  ENEFSYPKAKNKDKSHWHGDDVEMSASSRREPQQPIPLLTSGQTVSSEIIPPSIQDTNSV  171

Query  368  RSMSGPLGPG  397
            RS SGPLGPG
Sbjct  172  RSTSGPLGPG  181



>ref|XP_008784981.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Phoenix dactylifera]
Length=1077

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 105/128 (82%), Gaps = 5/128 (4%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T  GD+FVACNECAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSPRV+GDDEE+DVD
Sbjct  48   LTVTGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPRVEGDDEEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQ----GEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSAT  349
            DL NEFN  +GN KA  +WQ    GEDVDLSSSSRHE  Q IP LTNGQ +SGEIP  AT
Sbjct  108  DLDNEFNGTQGNGKAVHQWQLQGHGEDVDLSSSSRHEPQQRIPRLTNGQQVSGEIP-DAT  166

Query  350  PDTQSIRS  373
            PD  SIRS
Sbjct  167  PDRHSIRS  174



>ref|XP_002455100.1| hypothetical protein SORBIDRAFT_03g004310 [Sorghum bicolor]
 gb|EES00220.1| hypothetical protein SORBIDRAFT_03g004310 [Sorghum bicolor]
Length=355

 Score =   155 bits (392),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 102/128 (80%), Gaps = 6/128 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            ++A GD+FVACNECAFPVCR CYEYERK+GNQ CPQCKTRYKR KGSPRV GD+EE+ VD
Sbjct  47   LSATGDVFVACNECAFPVCRPCYEYERKEGNQCCPQCKTRYKRHKGSPRVRGDEEEDGVD  106

Query  182  dlvNEFNYGEGNVKARRKWQ----GEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSAT  349
            DL NEFNY +GNV+   +WQ     EDVDLSSSSRHE H  IP LT GQ +SG+IP  A+
Sbjct  107  DLDNEFNYTQGNVQG-PQWQLQGHREDVDLSSSSRHEPHHRIPRLTTGQQMSGDIP-DAS  164

Query  350  PDTQSIRS  373
            PD  SIRS
Sbjct  165  PDRHSIRS  172



>ref|XP_008792060.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Phoenix dactylifera]
Length=1077

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 102/127 (80%), Gaps = 5/127 (4%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvdd  184
            T  GD+FVACNECAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSPRV+GDDEE+DVDD
Sbjct  49   TVTGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPRVEGDDEEDDVDD  108

Query  185  lvNEFNYGEGNVKARRKW----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATP  352
            L NEFNY +G  K   +W    QGEDVDLSSSSRHE    IP LTNGQ +SGEIP  ATP
Sbjct  109  LDNEFNYTQGTGKTMHQWQLQGQGEDVDLSSSSRHEPQHCIPRLTNGQQVSGEIP-DATP  167

Query  353  DTQSIRS  373
            D  SIRS
Sbjct  168  DRHSIRS  174



>gb|EMT03676.1| Putative cellulose synthase A catalytic subunit 1 (UDP-forming) 
[Aegilops tauschii]
Length=1075

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 104/124 (84%), Gaps = 2/124 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            V+A GD+FVACNECAFPVCR CYEYERKDG + CPQCKTRYKRLKGSPRV GD+EEEDVD
Sbjct  50   VSATGDVFVACNECAFPVCRPCYEYERKDGVKCCPQCKTRYKRLKGSPRVPGDEEEEDVD  109

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +GN K   +WQGED+DLSSSSRHE H  IP LT+GQ +SGEIP  A+PD  
Sbjct  110  DLDNEFNYKQGNGKG-PEWQGEDIDLSSSSRHEPHHRIPRLTSGQQMSGEIP-DASPDRH  167

Query  362  SIRS  373
            SIRS
Sbjct  168  SIRS  171



>gb|ACS68190.1| cellulose synthase 1.2 catalytic subunit [Brassica napus]
Length=1083

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 108/132 (82%), Gaps = 5/132 (4%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T  GD+FVACNECAFPVCR CYEYERKDG Q CPQCKTRY+RL+GSPRV+GD++E+DVD
Sbjct  48   LTETGDLFVACNECAFPVCRPCYEYERKDGTQCCPQCKTRYRRLRGSPRVEGDEDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +G  K RR+ Q    + SSSSRHES QPIPLLT+G  +SGEI    TPDTQ
Sbjct  108  DIENEFNYAQGANKGRRQ-QRHGEEFSSSSRHES-QPIPLLTHGHTVSGEI---RTPDTQ  162

Query  362  SIRSMSGPLGPG  397
            S+R+ SGPLGPG
Sbjct  163  SVRTTSGPLGPG  174



>ref|XP_010925238.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Elaeis guineensis]
Length=1077

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 104/128 (81%), Gaps = 5/128 (4%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T  GD+FVACNECAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSPRV+GDDEE+DVD
Sbjct  48   LTVTGDVFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPRVEGDDEEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQ----GEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSAT  349
            DL NEFNY  GN KA  +WQ    GED+DLSSSSRHE  Q IP LT+ Q +SGEIP  AT
Sbjct  108  DLDNEFNYTPGNSKAVHQWQLQGHGEDIDLSSSSRHEPPQRIPRLTSDQQVSGEIP-DAT  166

Query  350  PDTQSIRS  373
            PD  SIRS
Sbjct  167  PDRHSIRS  174



>gb|AGT16647.1| cellulose synthase [Saccharum hybrid cultivar R570]
Length=1073

 Score =   159 bits (401),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 103/127 (81%), Gaps = 4/127 (3%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            ++A GD+FVACNECAFPVCR CYEYERK+GNQ CPQCKTRYKR KGSPRV GD+EE+ VD
Sbjct  47   LSATGDVFVACNECAFPVCRPCYEYERKEGNQCCPQCKTRYKRHKGSPRVRGDEEEDGVD  106

Query  182  dlvNEFNYGEGNVKA---RRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATP  352
            DL NEFNY +GNV+    + + QGEDVDLSSSSRHE H  IP LT GQ +SG+IP  A+P
Sbjct  107  DLDNEFNYTQGNVQGPQWQLRGQGEDVDLSSSSRHEPHHRIPRLTTGQQMSGDIP-DASP  165

Query  353  DTQSIRS  373
            D  SIRS
Sbjct  166  DRHSIRS  172



>ref|XP_008673642.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Zea mays]
 tpg|DAA53226.1| TPA: cellulose synthase3 [Zea mays]
Length=1074

 Score =   159 bits (401),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 103/127 (81%), Gaps = 4/127 (3%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            ++A GDIFVACNECAFPVCR CYEYERK+GNQ CPQCKTRYKR KGSPRV GD+EE+ VD
Sbjct  47   LSATGDIFVACNECAFPVCRPCYEYERKEGNQCCPQCKTRYKRHKGSPRVRGDEEEDGVD  106

Query  182  dlvNEFNYGEGNVKA---RRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATP  352
            DL NEFNY +GNV+    + + QGEDVD+SSSSRHE H  IP LT GQ +SG+IP  A+P
Sbjct  107  DLDNEFNYTQGNVQGPQWQLRGQGEDVDISSSSRHEPHHRIPRLTTGQQMSGDIP-DASP  165

Query  353  DTQSIRS  373
            D  SIRS
Sbjct  166  DRHSIRS  172



>tpg|DAA53225.1| TPA: cellulose synthase3 [Zea mays]
Length=1073

 Score =   159 bits (401),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 103/127 (81%), Gaps = 4/127 (3%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            ++A GDIFVACNECAFPVCR CYEYERK+GNQ CPQCKTRYKR KGSPRV GD+EE+ VD
Sbjct  46   LSATGDIFVACNECAFPVCRPCYEYERKEGNQCCPQCKTRYKRHKGSPRVRGDEEEDGVD  105

Query  182  dlvNEFNYGEGNVKA---RRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATP  352
            DL NEFNY +GNV+    + + QGEDVD+SSSSRHE H  IP LT GQ +SG+IP  A+P
Sbjct  106  DLDNEFNYTQGNVQGPQWQLRGQGEDVDISSSSRHEPHHRIPRLTTGQQMSGDIP-DASP  164

Query  353  DTQSIRS  373
            D  SIRS
Sbjct  165  DRHSIRS  171



>emb|CDX72357.1| BnaC07g43790D [Brassica napus]
Length=1083

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 108/132 (82%), Gaps = 5/132 (4%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T  GD+FVACNECAFPVCR CYEYERKDG Q CPQCKTRY+RL+GSPRV+GD++E+DVD
Sbjct  48   LTETGDLFVACNECAFPVCRPCYEYERKDGTQCCPQCKTRYRRLRGSPRVEGDEDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +G  K RR+ Q    + SSSSRHES QPIPLLT+G  +SGEI    TPDTQ
Sbjct  108  DIENEFNYTQGANKGRRQ-QRHGEEFSSSSRHES-QPIPLLTHGHTVSGEI---RTPDTQ  162

Query  362  SIRSMSGPLGPG  397
            S+R+ SGPLGPG
Sbjct  163  SVRTTSGPLGPG  174



>ref|XP_009138081.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Brassica rapa]
Length=1083

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 108/132 (82%), Gaps = 5/132 (4%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T  GD+FVACNECAFPVCR CYEY+RKDG Q CPQCKTRY+RL+GSPRV+GD++E+DVD
Sbjct  48   LTETGDLFVACNECAFPVCRPCYEYDRKDGTQCCPQCKTRYRRLRGSPRVEGDEDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +G  K RR+ Q    + SSSSRHES QPIPLLT+G  +SGEI    TPDTQ
Sbjct  108  DIENEFNYAQGANKGRRQ-QRHGEEFSSSSRHES-QPIPLLTHGHTVSGEI---RTPDTQ  162

Query  362  SIRSMSGPLGPG  397
            S+R+ SGPLGPG
Sbjct  163  SVRTTSGPLGPG  174



>emb|CDY13484.1| BnaA03g52020D [Brassica napus]
Length=1083

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 107/132 (81%), Gaps = 5/132 (4%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T  GD+FVACNECAFPVCR CYEYERKDG Q CPQCKTRY+RL+G PRV+GD++E+DVD
Sbjct  48   LTETGDLFVACNECAFPVCRPCYEYERKDGTQCCPQCKTRYRRLRGHPRVEGDEDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +G  K RR+ Q    + SSSSRHES QPIPLLT+G  +SGEI    TPDTQ
Sbjct  108  DIENEFNYAQGANKGRRQ-QRHGEEFSSSSRHES-QPIPLLTHGHTVSGEI---RTPDTQ  162

Query  362  SIRSMSGPLGPG  397
            S+R+ SGPLGPG
Sbjct  163  SVRTTSGPLGPG  174



>ref|XP_006412477.1| hypothetical protein EUTSA_v10024278mg [Eutrema salsugineum]
 gb|ESQ53930.1| hypothetical protein EUTSA_v10024278mg [Eutrema salsugineum]
Length=1082

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 107/131 (82%), Gaps = 6/131 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +   GD+FVACNECAFPVCR CYEYERKDG Q CPQCKTRY+R +GSPRV+GD++E+DVD
Sbjct  48   LAETGDVFVACNECAFPVCRPCYEYERKDGTQCCPQCKTRYRRHRGSPRVEGDEDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +G  KARR+  GE  + SSSSRHES QPIPLLT+G  +SGEI    TPDTQ
Sbjct  108  DIENEFNYTQGANKARRQRHGE--EFSSSSRHES-QPIPLLTHGHTVSGEI---RTPDTQ  161

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  162  SVRTTSGPLGP  172



>gb|ACS68189.1| cellulose synthase 1.1 catalytic subunit [Brassica napus]
Length=1083

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 107/132 (81%), Gaps = 5/132 (4%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T  GD+FVACNECAFPVCR CYEYERKDG Q CPQCKTRY+RL+GSPRV+GD++E+DVD
Sbjct  48   LTETGDLFVACNECAFPVCRPCYEYERKDGTQCCPQCKTRYRRLRGSPRVEGDEDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +G  K RR+ Q    +  SSSRHES QPIPLLT+G  +SGEI    TPDTQ
Sbjct  108  DIENEFNYTQGANKGRRQ-QRHGEEFPSSSRHES-QPIPLLTHGHTVSGEI---RTPDTQ  162

Query  362  SIRSMSGPLGPG  397
            S+R+ SGPLGPG
Sbjct  163  SVRTTSGPLGPG  174



>gb|ACZ82297.1| cellulose synthase [Phyllostachys edulis]
Length=1076

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 104/128 (81%), Gaps = 6/128 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            ++A GD+FVACNECAFPVCR CYEYERKDGNQ CPQCKTRYKR KGSPRV GDDEEEDVD
Sbjct  47   LSATGDVFVACNECAFPVCRPCYEYERKDGNQCCPQCKTRYKRHKGSPRVPGDDEEEDVD  106

Query  182  dlvNEFNYGEGNVKARRKW----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSAT  349
            DL NEFNY +GN K   +W    QGEDVDLSSSSRHE H  IP LT+GQ ISG+IP  A+
Sbjct  107  DLDNEFNYKQGNSKG-LQWQLQAQGEDVDLSSSSRHEPHHRIPRLTSGQQISGDIP-DAS  164

Query  350  PDTQSIRS  373
            PD  SIRS
Sbjct  165  PDRHSIRS  172



>gb|AAY43218.1| cellulose synthase BoCesA2 [Bambusa oldhamii]
Length=1073

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 105/128 (82%), Gaps = 6/128 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            ++A GD+FVACNECAFPVCR CYEYERKDGNQ CPQCKTRYKR KGSPRV GDDEEEDVD
Sbjct  47   LSATGDVFVACNECAFPVCRPCYEYERKDGNQCCPQCKTRYKRHKGSPRVPGDDEEEDVD  106

Query  182  dlvNEFNYGEGNVKARRKW----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSAT  349
            DL NEFNY +GN K  ++W    QGEDVD+SSSSRHE H  IP LT+GQ ISG+IP  A+
Sbjct  107  DLDNEFNYKQGNSKG-QQWQLRAQGEDVDISSSSRHEPHHRIPRLTSGQQISGDIP-DAS  164

Query  350  PDTQSIRS  373
            PD  SIRS
Sbjct  165  PDRHSIRS  172



>gb|EMT20923.1| Putative cellulose synthase A catalytic subunit 1 (UDP-forming) 
[Aegilops tauschii]
Length=1074

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 105/127 (83%), Gaps = 4/127 (3%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            V+A+GD+FVACNECAFPVCR CYEYERKDG + CPQCKTRYKRLKGSPRV GD+EEEDVD
Sbjct  45   VSASGDVFVACNECAFPVCRPCYEYERKDGVKCCPQCKTRYKRLKGSPRVPGDEEEEDVD  104

Query  182  dlvNEFNYGEGNVKA---RRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATP  352
            DL NEFNY +GN K    + + QGED+DLSSSSRHE H  IP LT+GQ ISGEIP  A+P
Sbjct  105  DLDNEFNYKQGNGKGPEWQLRGQGEDIDLSSSSRHEPHHRIPRLTSGQQISGEIP-DASP  163

Query  353  DTQSIRS  373
            D  SIRS
Sbjct  164  DRHSIRS  170



>gb|AAY43217.1| cellulose synthase BoCesA1 [Bambusa oldhamii]
Length=1078

 Score =   155 bits (393),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 106/129 (82%), Gaps = 4/129 (3%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            V+A GD+FVACNECAFPVCR CYEYERK+GNQ CPQCKTRYKR KGSPRV GDDEEEDVD
Sbjct  50   VSATGDVFVACNECAFPVCRPCYEYERKEGNQCCPQCKTRYKRHKGSPRVQGDDEEEDVD  109

Query  182  dlvNEFNYGEGNVKA---RRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATP  352
            DL NEFNY +G+ K    +R+ QGEDVDLSSSSRHE H  IP LT+GQ ISGE+P  A+P
Sbjct  110  DLDNEFNYKQGSGKGPEWQRQGQGEDVDLSSSSRHEPHHRIPRLTSGQQISGEMP-DASP  168

Query  353  DTQSIRSMS  379
            D  SIRS +
Sbjct  169  DRHSIRSQT  177



>gb|ACZ82296.1| cellulose synthase [Phyllostachys edulis]
Length=1077

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 104/128 (81%), Gaps = 6/128 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            V+A GD+FVACNECAFPVCR CYEYERK+GNQ CPQCKTRYKR KGSPRV GD+EEEDVD
Sbjct  50   VSATGDVFVACNECAFPVCRPCYEYERKEGNQCCPQCKTRYKRHKGSPRVQGDEEEEDVD  109

Query  182  dlvNEFNYGEGNVKARRKW----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSAT  349
            DL NEFNY +GN K   +W    QGEDVDLSSSSRHE H  IP LT+GQ ISGEIP  A+
Sbjct  110  DLDNEFNYKQGNGKG-PEWQIQGQGEDVDLSSSSRHEPHHRIPRLTSGQQISGEIP-DAS  167

Query  350  PDTQSIRS  373
            PD  SIRS
Sbjct  168  PDRHSIRS  175



>dbj|BAJ88271.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1060

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 104/127 (82%), Gaps = 4/127 (3%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            V+A GD+FVACNECAFPVCR CYEYERKDG + CPQCKTRYKRLKGSPRV GD+EEEDVD
Sbjct  32   VSATGDVFVACNECAFPVCRPCYEYERKDGVKCCPQCKTRYKRLKGSPRVPGDEEEEDVD  91

Query  182  dlvNEFNYGEGNVKA---RRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATP  352
            DL NEFNY +GN K    + + QGED+DLSSSSRHE H  IP LT+GQ ISGEIP  A+P
Sbjct  92   DLDNEFNYKQGNGKGPEWQLQGQGEDIDLSSSSRHEPHHRIPRLTSGQQISGEIP-DASP  150

Query  353  DTQSIRS  373
            D  SIRS
Sbjct  151  DRHSIRS  157



>ref|XP_003568832.2| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Brachypodium distachyon]
Length=1078

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 105/128 (82%), Gaps = 6/128 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            V+A GD+FVACNECAFPVCR CYEYERK+GNQ CPQCKTRY+RLKGSPRV GD+EEEDVD
Sbjct  50   VSATGDVFVACNECAFPVCRPCYEYERKEGNQCCPQCKTRYRRLKGSPRVQGDEEEEDVD  109

Query  182  dlvNEFNYGEGNVKARRKW----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSAT  349
            DL NEFNY +GN K   +W    QGED+DLSSSSRHE H  IP LT+GQ +SG+IP  A+
Sbjct  110  DLDNEFNYKQGNGKG-PEWQLHGQGEDIDLSSSSRHEPHHRIPRLTSGQQLSGDIP-DAS  167

Query  350  PDTQSIRS  373
            PD  SIRS
Sbjct  168  PDRHSIRS  175



>gb|AAC39333.1| RSW1-like cellulose synthase catalytic subunit [Oryza sativa 
Japonica Group]
Length=583

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 104/128 (81%), Gaps = 7/128 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            V+A GD+FVACNECAFPVCR CYEYERK+GNQ CPQCKTRYKR KGSPRV GD+EEEDVD
Sbjct  50   VSATGDVFVACNECAFPVCRPCYEYERKEGNQCCPQCKTRYKRHKGSPRVQGDEEEEDVD  109

Query  182  dlvNEFNYGEGNVKARRKW----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSAT  349
            DL NEFNY  GN K   +W    QGEDVDLSSSSRHE H+ IP LT+GQ ISGEIP  A+
Sbjct  110  DLDNEFNYKHGNGKG-PEWQIQRQGEDVDLSSSSRHEQHR-IPRLTSGQQISGEIP-DAS  166

Query  350  PDTQSIRS  373
            PD  SIRS
Sbjct  167  PDRHSIRS  174



>gb|AAY43216.1| cellulose synthase BoCesA8 [Bambusa oldhamii]
Length=1078

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 104/128 (81%), Gaps = 6/128 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            V+A GD+FVACNECAFPVCR CYEYERK+GNQ CPQCKTRYKR KGSPRV GD+EEEDVD
Sbjct  50   VSATGDVFVACNECAFPVCRPCYEYERKEGNQCCPQCKTRYKRHKGSPRVQGDEEEEDVD  109

Query  182  dlvNEFNYGEGNVKARRKW----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSAT  349
            DL NEFNY +GN K   +W    QGEDVDLSSSSRH+ H  IP LT+GQ ISGEIP  A+
Sbjct  110  DLDNEFNYKQGNGKG-PEWQIEGQGEDVDLSSSSRHQPHHRIPRLTSGQQISGEIP-DAS  167

Query  350  PDTQSIRS  373
            PD  SIRS
Sbjct  168  PDRHSIRS  175



>ref|XP_009399755.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Musa acuminata subsp. malaccensis]
Length=1077

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 105/127 (83%), Gaps = 4/127 (3%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            ++A GD+FVACNECAFPVCR CYEYERK+GN++CPQCKTRYKR KGSPRV+GDDEE+DVD
Sbjct  48   LSATGDLFVACNECAFPVCRACYEYERKEGNKSCPQCKTRYKRHKGSPRVEGDDEEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQ---GEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATP  352
            DL NEF+Y +GN KA  KWQ    EDVDLSSSSRHE    IP LT+GQ +SGE+P  A+P
Sbjct  108  DLDNEFSYRQGNAKAGSKWQLQGQEDVDLSSSSRHEPQHRIPRLTSGQQVSGEVP-DASP  166

Query  353  DTQSIRS  373
            D  SIRS
Sbjct  167  DRHSIRS  173



>gb|ACT16001.1| cellulose synthase [Phyllostachys edulis]
Length=1070

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 105/127 (83%), Gaps = 4/127 (3%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            ++A GDIFVACNECAFPVCR CYEYERKDGNQ CPQCKTRYKR KGSPRV GDDEEEDVD
Sbjct  47   LSATGDIFVACNECAFPVCRPCYEYERKDGNQCCPQCKTRYKRHKGSPRVPGDDEEEDVD  106

Query  182  dlvNEFNYGEGNVKARR---KWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATP  352
            DL NEFNY +GN K+++   + QGE+VDLSSS RHE H  IP LT+GQ ISG+IP  A+P
Sbjct  107  DLDNEFNYKQGNSKSQQWQLRVQGEEVDLSSSCRHEPHHRIPRLTSGQQISGDIP-DASP  165

Query  353  DTQSIRS  373
            D  SIRS
Sbjct  166  DRHSIRS  172



>gb|AAY43219.2| cellulose synthase BoCesA3 [Bambusa oldhamii]
Length=1074

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 104/128 (81%), Gaps = 6/128 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            ++A GD+FVACNECAFPVCR CYEYERKDGNQ CPQCKTRYKR KGSPRV GD+EE+DVD
Sbjct  47   LSATGDVFVACNECAFPVCRPCYEYERKDGNQCCPQCKTRYKRHKGSPRVPGDEEEDDVD  106

Query  182  dlvNEFNYGEGNVKARRKW----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSAT  349
            DL NEFNY +GN K  ++W    QGEDVD+ SSSRHE H  IP LT+GQ ISG+IP  A+
Sbjct  107  DLDNEFNYKQGNSKG-QQWQLRAQGEDVDILSSSRHEPHHRIPCLTSGQQISGDIP-DAS  164

Query  350  PDTQSIRS  373
            PD  SIRS
Sbjct  165  PDRHSIRS  172



>gb|AFG25776.1| cellulose synthase 2 [Bambusa emeiensis]
Length=1074

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 104/128 (81%), Gaps = 6/128 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            ++A GD+FVACNECAFPVCR CYEYERKDGNQ CPQCKTRYKR KGSPRV GD+EEEDVD
Sbjct  47   LSATGDVFVACNECAFPVCRPCYEYERKDGNQCCPQCKTRYKRHKGSPRVPGDEEEEDVD  106

Query  182  dlvNEFNYGEGNVKARRKW----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSAT  349
            DL NEFNY +GN K  ++W    QGEDVD+ SSSRHE H  IP LT+GQ ISG+IP  A+
Sbjct  107  DLDNEFNYKQGNSKG-QQWQLQAQGEDVDILSSSRHEPHHRIPRLTSGQQISGDIP-DAS  164

Query  350  PDTQSIRS  373
            PD  SIRS
Sbjct  165  PDRHSIRS  172



>gb|AAR29967.1| putative cellulose synthase catalytic subunit [Hordeum vulgare]
Length=1074

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 101/124 (81%), Gaps = 2/124 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            V+A GD+FVACNECAFPVCR CYEYERKDG Q CPQCKTRYKRLKGSPRV GD+EEEDVD
Sbjct  50   VSATGDVFVACNECAFPVCRPCYEYERKDGVQCCPQCKTRYKRLKGSPRVPGDEEEEDVD  109

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFNY +GN K   +WQGED+DLSSSS H+ H  IP LT  Q ISGEIP  A+PD  
Sbjct  110  DLDNEFNYKQGNGKG-PEWQGEDIDLSSSSCHDPHHRIPRLTTRQQISGEIP-DASPDRH  167

Query  362  SIRS  373
            SIRS
Sbjct  168  SIRS  171



>gb|AAY43225.1| cellulose synthase BoCesA3 [Bambusa oldhamii]
Length=1074

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 104/128 (81%), Gaps = 6/128 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            ++A GD+FVACNECAFPVCR CYEYERKDGNQ CPQCKTRYKR KGSPRV GD+EEEDVD
Sbjct  47   LSATGDVFVACNECAFPVCRPCYEYERKDGNQCCPQCKTRYKRHKGSPRVPGDEEEEDVD  106

Query  182  dlvNEFNYGEGNVKARRKW----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSAT  349
            DL NEFNY +GN K  ++W    QGEDVD+ SSSRHE H  IP LT+GQ ISG+IP  A+
Sbjct  107  DLDNEFNYKQGNSKG-QQWQLRAQGEDVDILSSSRHEPHHRIPRLTSGQQISGDIP-DAS  164

Query  350  PDTQSIRS  373
            PD  SIRS
Sbjct  165  PDRHSIRS  172



>ref|NP_194967.1| cellulose synthase A catalytic subunit 1 [UDP-forming] [Arabidopsis 
thaliana]
 sp|O48946.1|CESA1_ARATH RecName: Full=Cellulose synthase A catalytic subunit 1 [UDP-forming]; 
Short=AtCesA1; AltName: Full=Protein RADIALLY SWOLLEN 
1; Short=AtRSW1 [Arabidopsis thaliana]
 gb|AAC39334.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
 emb|CAA22568.1| cellulose synthase catalytic subunit (RSW1) [Arabidopsis thaliana]
 emb|CAB79958.1| cellulose synthase catalytic subunit (RSW1) [Arabidopsis thaliana]
 gb|AAP40467.1| putative cellulose synthase catalytic subunit (RSW1) [Arabidopsis 
thaliana]
 dbj|BAE98406.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AEE86053.1| cellulose synthase A catalytic subunit 1 [UDP-forming] [Arabidopsis 
thaliana]
 gb|AHL38667.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1081

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 106/131 (81%), Gaps = 6/131 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +   GD+FVACNECAFPVCR CYEYERKDG Q CPQCKTR++R +GSPRV+GD++E+DVD
Sbjct  48   LAETGDVFVACNECAFPVCRPCYEYERKDGTQCCPQCKTRFRRHRGSPRVEGDEDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +G  KAR +  GE  + SSSSRHES QPIPLLT+G  +SGEI    TPDTQ
Sbjct  108  DIENEFNYAQGANKARHQRHGE--EFSSSSRHES-QPIPLLTHGHTVSGEI---RTPDTQ  161

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  162  SVRTTSGPLGP  172



>ref|XP_002867245.1| hypothetical protein ARALYDRAFT_491486 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43504.1| hypothetical protein ARALYDRAFT_491486 [Arabidopsis lyrata subsp. 
lyrata]
Length=1081

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 106/131 (81%), Gaps = 6/131 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +   GD+FVACNECAFPVCR CYEYERKDG Q CPQCKTR++R +GSPRV+GD++E+DVD
Sbjct  48   LAETGDVFVACNECAFPVCRPCYEYERKDGTQCCPQCKTRFRRHRGSPRVEGDEDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +G  KAR +  GE  + SSSSRHES QPIPLLT+G  +SGEI    TPDTQ
Sbjct  108  DIENEFNYAQGANKARHQRHGE--EFSSSSRHES-QPIPLLTHGHTVSGEI---RTPDTQ  161

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  162  SVRTTSGPLGP  172



>ref|XP_006654097.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming]-like [Oryza brachyantha]
Length=1076

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 105/128 (82%), Gaps = 7/128 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            V+ANGD+FVACNECAFPVCR CYEYERK+GNQ CPQCKTRYKR KGSPRV GD+EEEDVD
Sbjct  50   VSANGDVFVACNECAFPVCRPCYEYERKEGNQCCPQCKTRYKRHKGSPRVQGDEEEEDVD  109

Query  182  dlvNEFNYGEGNVKARRKW----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSAT  349
            DL NEFNY  GN K   +W    QGEDVDLSSSSRHE H+ IP LT+GQ ISGEIP  A+
Sbjct  110  DLDNEFNYKHGNGKG-PEWQIQRQGEDVDLSSSSRHEQHR-IPRLTSGQQISGEIP-DAS  166

Query  350  PDTQSIRS  373
            PD  S+RS
Sbjct  167  PDRHSVRS  174



>gb|AFW81388.1| cellulose synthase1 [Zea mays]
Length=1075

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 102/125 (82%), Gaps = 2/125 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            V+A GD+FVACNECAFPVCR CYEYERK+GNQ CPQCKTRYKR KGSPRV GD++EEDVD
Sbjct  50   VSATGDVFVACNECAFPVCRPCYEYERKEGNQCCPQCKTRYKRQKGSPRVHGDEDEEDVD  109

Query  182  dlvNEFNYGEGNVKA-RRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDT  358
            DL NEFNY +GN K    + QG+D DLSSS+RHE H  IP LT+GQ ISGEIP  A+PD 
Sbjct  110  DLDNEFNYKQGNGKGPEWQLQGDDADLSSSARHEPHHRIPRLTSGQQISGEIP-DASPDR  168

Query  359  QSIRS  373
             SIRS
Sbjct  169  HSIRS  173



>ref|XP_004968377.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming]-like [Setaria italica]
Length=1075

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 104/127 (82%), Gaps = 4/127 (3%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            ++A GD+FVACNECAFPVCR CYEYERK+GNQ CPQCKTRYKR KGSPRV GDDEE++VD
Sbjct  48   LSATGDVFVACNECAFPVCRPCYEYERKEGNQCCPQCKTRYKRHKGSPRVPGDDEEDEVD  107

Query  182  dlvNEFNYGEGNVKA---RRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATP  352
            DL NEFNY +GN K    + + QGEDVD+SSSSRHE H  IP LT+GQ ISG+IP  A+P
Sbjct  108  DLDNEFNYTQGNGKGPQWQLQGQGEDVDISSSSRHEPHHRIPCLTSGQQISGDIP-DASP  166

Query  353  DTQSIRS  373
            D  SIRS
Sbjct  167  DRHSIRS  173



>ref|NP_001054788.1| Os05g0176100 [Oryza sativa Japonica Group]
 sp|Q6AT26.1|CESA1_ORYSJ RecName: Full=Probable cellulose synthase A catalytic subunit 
1 [UDP-forming]; AltName: Full=OsCesA1 [Oryza sativa Japonica 
Group]
 sp|A2Y0X2.1|CESA1_ORYSI RecName: Full=Probable cellulose synthase A catalytic subunit 
1 [UDP-forming]; AltName: Full=OsCesA1 [Oryza sativa Indica 
Group]
 gb|AAT77342.1| putative cellulose synthase [Oryza sativa Japonica Group]
 gb|AAU44296.1| putative cellulose synthase [Oryza sativa Japonica Group]
 dbj|BAF16702.1| Os05g0176100 [Oryza sativa Japonica Group]
 gb|EAY96732.1| hypothetical protein OsI_18650 [Oryza sativa Indica Group]
 dbj|BAG90687.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93842.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94005.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95409.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62512.1| hypothetical protein OsJ_17310 [Oryza sativa Japonica Group]
Length=1076

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 104/128 (81%), Gaps = 7/128 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            V+A GD+FVACNECAFPVCR CYEYERK+GNQ CPQCKTRYKR KGSPRV GD+EEEDVD
Sbjct  50   VSATGDVFVACNECAFPVCRPCYEYERKEGNQCCPQCKTRYKRHKGSPRVQGDEEEEDVD  109

Query  182  dlvNEFNYGEGNVKARRKW----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSAT  349
            DL NEFNY  GN K   +W    QGEDVDLSSSSRHE H+ IP LT+GQ ISGEIP  A+
Sbjct  110  DLDNEFNYKHGNGKG-PEWQIQRQGEDVDLSSSSRHEQHR-IPRLTSGQQISGEIP-DAS  166

Query  350  PDTQSIRS  373
            PD  SIRS
Sbjct  167  PDRHSIRS  174



>ref|XP_010447394.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Camelina sativa]
Length=1081

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 105/131 (80%), Gaps = 6/131 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +   GD+FVACNECAFPVCR CYEYERKDG Q CPQCKTRY+R +GS RV+GD++E+DVD
Sbjct  48   LAETGDVFVACNECAFPVCRPCYEYERKDGTQYCPQCKTRYRRHRGSTRVEGDEDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +G  KAR +  GE  + SSSSRHES QPIPLLT+G  +SGEI    TPDTQ
Sbjct  108  DIENEFNYAQGANKARHQRHGE--EFSSSSRHES-QPIPLLTHGHAVSGEI---RTPDTQ  161

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  162  SVRTTSGPLGP  172



>ref|XP_010432725.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Camelina sativa]
Length=1081

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 105/131 (80%), Gaps = 6/131 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +   GD+FVACNECAFPVCR CYEYERKDG Q CPQCKTRY+R +GS RV+GD++E+DVD
Sbjct  48   LAETGDVFVACNECAFPVCRPCYEYERKDGTQCCPQCKTRYRRHRGSTRVEGDEDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +G  KAR +  GE  + SSSSRHES QPIPLLT+G  +SGEI    TPDTQ
Sbjct  108  DIENEFNYAQGANKARHQRHGE--EFSSSSRHES-QPIPLLTHGHAVSGEI---RTPDTQ  161

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  162  SVRTTSGPLGP  172



>ref|NP_001105574.1| cellulose synthase2 [Zea mays]
 gb|AAF89962.1|AF200526_1 cellulose synthase-2 [Zea mays]
 gb|AFW77326.1| cellulose synthase2 [Zea mays]
Length=1074

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 102/125 (82%), Gaps = 2/125 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            V+A GD+FVACNECAFPVCR CYEYERK+GNQ CPQCKTRYKR KGSPRV GDDEEEDVD
Sbjct  50   VSATGDVFVACNECAFPVCRPCYEYERKEGNQCCPQCKTRYKRQKGSPRVHGDDEEEDVD  109

Query  182  dlvNEFNYGEGNVKA-RRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDT  358
            DL NEFNY +GN K    + QG+D DLSSS+RH+ H  IP LT+GQ ISGEIP  A+PD 
Sbjct  110  DLDNEFNYKQGNGKGPEWQLQGDDADLSSSARHDPHHRIPRLTSGQQISGEIP-DASPDR  168

Query  359  QSIRS  373
             SIRS
Sbjct  169  HSIRS  173



>ref|XP_004965873.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming]-like [Setaria italica]
Length=1077

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 103/128 (80%), Gaps = 6/128 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            V+A GD+FVACNECAFPVCR CYEYERK+GNQ CPQCKTRYKR KGSPRV GD+EEEDVD
Sbjct  50   VSATGDVFVACNECAFPVCRPCYEYERKEGNQCCPQCKTRYKRQKGSPRVHGDEEEEDVD  109

Query  182  dlvNEFNYGEGNVKARRKW----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSAT  349
            DL NEFNY +GN K   +W    QG+D DLSSS+RHE H  IP LT+GQ ISGEIP  A+
Sbjct  110  DLDNEFNYKQGNGKG-PEWQLHGQGDDADLSSSARHEPHHRIPRLTSGQQISGEIP-DAS  167

Query  350  PDTQSIRS  373
            PD  SIRS
Sbjct  168  PDRHSIRS  175



>ref|XP_010445007.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Camelina sativa]
Length=1286

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 105/131 (80%), Gaps = 6/131 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +   GD+FVACNECAFPVCR CYEYERKDG Q CPQCKTRY+R +GS RV+GD++E+DVD
Sbjct  48   LAETGDVFVACNECAFPVCRPCYEYERKDGTQCCPQCKTRYRRHRGSTRVEGDEDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY +G  KAR +  GE  + SSSSRHES QPIPLLT+G  +SGEI    TPDTQ
Sbjct  108  DIENEFNYAQGANKARHQRHGE--EFSSSSRHES-QPIPLLTHGHAVSGEI---RTPDTQ  161

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  162  SVRTTSGPLGP  172



>ref|NP_001104954.1| cellulose synthase-1 [Zea mays]
 gb|AAF89961.1|AF200525_1 cellulose synthase-1 [Zea mays]
Length=1075

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 102/125 (82%), Gaps = 2/125 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            V+A GD+FVACNECAFPVCR CYEYERK+GNQ CPQCKTRYKR KGSPRV GD++EEDVD
Sbjct  50   VSATGDVFVACNECAFPVCRPCYEYERKEGNQCCPQCKTRYKRQKGSPRVHGDEDEEDVD  109

Query  182  dlvNEFNYGEGNVKA-RRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDT  358
            DL NEFNY +G+ K    + QG+D DLSSS+RHE H  IP LT+GQ ISGEIP  A+PD 
Sbjct  110  DLDNEFNYKQGSGKGPEWQLQGDDADLSSSARHEPHHRIPRLTSGQQISGEIP-DASPDR  168

Query  359  QSIRS  373
             SIRS
Sbjct  169  HSIRS  173



>ref|XP_006842872.1| hypothetical protein AMTR_s00081p00171100 [Amborella trichopoda]
 gb|ERN04547.1| hypothetical protein AMTR_s00081p00171100 [Amborella trichopoda]
Length=1083

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 111/137 (81%), Gaps = 7/137 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA+G+ FVACNECAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSPRV+GDD+EED+D
Sbjct  48   LTASGEPFVACNECAFPVCRPCYEYERKDGNQSCPQCKTRYKRQKGSPRVEGDDDEEDID  107

Query  182  dlvNEFNYGEGNVKARRKW----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSAT  349
            DL NEFNY  GN  ++R+W    QGED +LS+SS   S QPIPLLTNGQ +SGEIP  AT
Sbjct  108  DLENEFNY-RGNGNSKRQWQMYGQGEDANLSASSGPNSQQPIPLLTNGQQMSGEIP-DAT  165

Query  350  PDTQSIRSM-SGPLGPG  397
            P+ Q + ++ SGPL  G
Sbjct  166  PEHQPMATLNSGPLSSG  182



>gb|ACQ99194.1| cellulose synthase [Phyllostachys edulis]
Length=1078

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 103/128 (80%), Gaps = 6/128 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            V+A GD+FVACNECAFPVCR CYEYERK+GNQ CPQCKTRYKR KGSPRV GD+EEEDVD
Sbjct  50   VSATGDVFVACNECAFPVCRPCYEYERKEGNQCCPQCKTRYKRHKGSPRVQGDEEEEDVD  109

Query  182  dlvNEFNYGEGNVKARRKW----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSAT  349
            DL NEFNY +GN K   +W    QGEDVDLSSSSRHE H  IP LT+G+ ISG IP  A+
Sbjct  110  DLDNEFNYKQGNGKG-PEWQIQGQGEDVDLSSSSRHEPHHRIPRLTSGRQISGGIP-DAS  167

Query  350  PDTQSIRS  373
            PD  SIRS
Sbjct  168  PDRHSIRS  175



>ref|XP_004960821.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming]-like isoform X2 [Setaria italica]
Length=1077

 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 103/128 (80%), Gaps = 6/128 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            V+A GD+FVACNECAFPVCR CYEYERK+GNQ CPQCKTRY+R KGSPRV GD+EEEDVD
Sbjct  50   VSATGDVFVACNECAFPVCRPCYEYERKEGNQCCPQCKTRYRRQKGSPRVHGDEEEEDVD  109

Query  182  dlvNEFNYGEGNVKARRKW----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSAT  349
            DL NEFNY +GN K   +W    QG+D DLSSS+RHE H  IP LT+GQ ISGEIP  A+
Sbjct  110  DLDNEFNYKQGNGKG-PEWQLHGQGDDADLSSSARHEPHHRIPRLTSGQQISGEIP-DAS  167

Query  350  PDTQSIRS  373
            PD  SIRS
Sbjct  168  PDRHSIRS  175



>ref|XP_004960820.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming]-like isoform X1 [Setaria italica]
Length=1106

 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 103/128 (80%), Gaps = 6/128 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            V+A GD+FVACNECAFPVCR CYEYERK+GNQ CPQCKTRY+R KGSPRV GD+EEEDVD
Sbjct  50   VSATGDVFVACNECAFPVCRPCYEYERKEGNQCCPQCKTRYRRQKGSPRVHGDEEEEDVD  109

Query  182  dlvNEFNYGEGNVKARRKW----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSAT  349
            DL NEFNY +GN K   +W    QG+D DLSSS+RHE H  IP LT+GQ ISGEIP  A+
Sbjct  110  DLDNEFNYKQGNGKG-PEWQLHGQGDDADLSSSARHEPHHRIPRLTSGQQISGEIP-DAS  167

Query  350  PDTQSIRS  373
            PD  SIRS
Sbjct  168  PDRHSIRS  175



>ref|XP_006285557.1| hypothetical protein CARUB_v10006999mg [Capsella rubella]
 gb|EOA18455.1| hypothetical protein CARUB_v10006999mg [Capsella rubella]
Length=1081

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 105/131 (80%), Gaps = 6/131 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +   GD+FVACNECAFPVCR CYEYERKDG Q CPQCKTRY+R +GS RV+GD++E+DVD
Sbjct  48   LAETGDVFVACNECAFPVCRPCYEYERKDGTQCCPQCKTRYRRHRGSTRVEGDEDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEF+Y +G  KAR +  GE  + SSSSRHES QPIPLLT+G  +SGEI    TPDTQ
Sbjct  108  DIENEFSYAQGANKARHQRHGE--EFSSSSRHES-QPIPLLTHGHTVSGEI---RTPDTQ  161

Query  362  SIRSMSGPLGP  394
            S+R+ SGPLGP
Sbjct  162  SVRTTSGPLGP  172



>gb|KFK29850.1| hypothetical protein AALP_AA7G186800 [Arabis alpina]
Length=1081

 Score =   150 bits (378),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 104/126 (83%), Gaps = 6/126 (5%)
 Frame = +2

Query  17   DIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvddlvNE  196
            D+FVACNECAFPVCR CYEYERKDG Q CPQCKTRY+R +G PRV+GD++E+DVDD+ NE
Sbjct  52   DVFVACNECAFPVCRPCYEYERKDGTQCCPQCKTRYRRHRGCPRVEGDEDEDDVDDIENE  111

Query  197  FNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQSIRSM  376
            FNY +G  KAR + +GE  + SSSSRHES QPIPLLT+G  +SGEI    TPDTQS+R+ 
Sbjct  112  FNYAQGANKARLQRRGE--EFSSSSRHES-QPIPLLTHGHAVSGEI---RTPDTQSVRTT  165

Query  377  SGPLGP  394
            SGPLGP
Sbjct  166  SGPLGP  171



>ref|XP_009389939.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Musa acuminata subsp. malaccensis]
Length=1078

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 103/128 (80%), Gaps = 5/128 (4%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            ++ +GD+FVACNECAFPVCR CYEYERK+GN++CPQCKTRYKR KGSPRVDGDDEEEDVD
Sbjct  48   LSDSGDLFVACNECAFPVCRACYEYERKEGNKSCPQCKTRYKRHKGSPRVDGDDEEEDVD  107

Query  182  dlvNEFNYGEGNVKARRKW----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSAT  349
            DL NEFN  +GNV+A   W    Q EDVDLSSS RHE    IP LT+GQ +SGE+P  AT
Sbjct  108  DLDNEFNCRQGNVEAGHTWQLQGQAEDVDLSSSFRHEPQHRIPYLTSGQQVSGEVP-DAT  166

Query  350  PDTQSIRS  373
            PD  SIRS
Sbjct  167  PDRHSIRS  174



>ref|XP_009126053.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Brassica rapa]
Length=1080

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 105/132 (80%), Gaps = 8/132 (6%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T  GD+FVACNECAFPVCR CYEYERKDG Q CP CKTRY+RL+GSPRV+GD++E+DVD
Sbjct  48   LTETGDLFVACNECAFPVCRPCYEYERKDGTQCCPHCKTRYRRLRGSPRVEGDEDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEF+Y +G     R+ +    + SSSSRH+S QPIPLLT+G  +SGEI    TPDTQ
Sbjct  108  DIENEFSYAQGGANKPRRRE----EFSSSSRHDS-QPIPLLTHGHGVSGEI---RTPDTQ  159

Query  362  SIRSMSGPLGPG  397
            S+R+ SGPLGPG
Sbjct  160  SVRTTSGPLGPG  171



>ref|XP_002440694.1| hypothetical protein SORBIDRAFT_09g005280 [Sorghum bicolor]
 gb|EES19124.1| hypothetical protein SORBIDRAFT_09g005280 [Sorghum bicolor]
Length=1073

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 99/124 (80%), Gaps = 4/124 (3%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            V+A GD+FVACNECAFPVCR CYEYERK+GNQ CPQCKTRYKR KGSPRV GD+EEEDVD
Sbjct  50   VSATGDVFVACNECAFPVCRPCYEYERKEGNQCCPQCKTRYKRQKGSPRVHGDEEEEDVD  109

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NEFN G+G      + QG+D DLSSS+RHE H  IP LT GQ +SGEIP  A+PD  
Sbjct  110  DLDNEFNNGKG---PEWQLQGDDADLSSSARHEPHHRIPRLTTGQQMSGEIP-DASPDRH  165

Query  362  SIRS  373
            SIRS
Sbjct  166  SIRS  169



>emb|CDX68844.1| BnaC01g06090D [Brassica napus]
Length=1080

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 104/132 (79%), Gaps = 8/132 (6%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T  GD+FVACNECAFPVCR CYEYERKDG Q CP CKTRY+RL+G PRV+GD++E+DVD
Sbjct  48   LTETGDLFVACNECAFPVCRPCYEYERKDGTQCCPHCKTRYRRLRGHPRVEGDEDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEF+Y +G     R+ +    + SSSSRH+S QPIPLLT+G  +SGEI    TPDTQ
Sbjct  108  DIENEFSYAQGGANKPRRRE----EFSSSSRHDS-QPIPLLTHGHGVSGEI---RTPDTQ  159

Query  362  SIRSMSGPLGPG  397
            S+R+ SGPLGPG
Sbjct  160  SVRTTSGPLGPG  171



>emb|CDX75242.1| BnaA01g04600D [Brassica napus]
Length=1080

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 104/132 (79%), Gaps = 8/132 (6%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T  GD+FVACNECAFPVCR CY+YERKDG Q CP CKTRY+RL+G PRV+GD++E+DVD
Sbjct  48   LTETGDLFVACNECAFPVCRPCYDYERKDGTQCCPHCKTRYRRLRGHPRVEGDEDEDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEF+Y +G     R+ +    + SSSSRH+S QPIPLLT+G  +SGEI    TPDTQ
Sbjct  108  DIENEFSYAQGGANKPRRRE----EFSSSSRHDS-QPIPLLTHGHGVSGEI---RTPDTQ  159

Query  362  SIRSMSGPLGPG  397
            S+R+ SGPLGPG
Sbjct  160  SVRTTSGPLGPG  171



>ref|XP_003603419.1| Cellulose synthase [Medicago truncatula]
 gb|AES73670.1| cellulose synthase-like protein [Medicago truncatula]
Length=1087

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 107/133 (80%), Gaps = 8/133 (6%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvdd  184
            T  GD+FVACNEC +PVCR CYEYERK+GN++CPQCKTRYKRL+GSPRVDGDDEE+DVDD
Sbjct  50   TPTGDVFVACNECGYPVCRDCYEYERKEGNKSCPQCKTRYKRLRGSPRVDGDDEEDDVDD  109

Query  185  lvNEFNYGEG---NVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPD  355
            + NEFNY +G   N K+RR+W   D   +SSSR E  QP PLLTNGQ +SGEIP   TPD
Sbjct  110  IENEFNYRQGNNNNNKSRRQWDDSDRS-ASSSRREYQQP-PLLTNGQTMSGEIP---TPD  164

Query  356  TQSIRSMSGPLGP  394
             QS+R+ SGPLGP
Sbjct  165  NQSVRTTSGPLGP  177



>gb|AFW81389.1| cellulose synthase1 [Zea mays]
Length=1071

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 99/125 (79%), Gaps = 6/125 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            V+A GD+FVACNECAFPVCR CYEYERK+GNQ CPQCKTRYKR KGSPRV GD++EEDVD
Sbjct  50   VSATGDVFVACNECAFPVCRPCYEYERKEGNQCCPQCKTRYKRQKGSPRVHGDEDEEDVD  109

Query  182  dlvNEFNYGEGNVKA-RRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDT  358
            DL NEFNY +GN K    + QG+D DLSSS+RHE H  IP LT+GQ    +IP  A+PD 
Sbjct  110  DLDNEFNYKQGNGKGPEWQLQGDDADLSSSARHEPHHRIPRLTSGQ----QIP-DASPDR  164

Query  359  QSIRS  373
             SIRS
Sbjct  165  HSIRS  169



>ref|XP_006405185.1| hypothetical protein EUTSA_v10000022mg [Eutrema salsugineum]
 gb|ESQ46638.1| hypothetical protein EUTSA_v10000022mg [Eutrema salsugineum]
Length=1080

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 99/130 (76%), Gaps = 6/130 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T  G +FVACNEC FP+CR CYEYERKDG Q CPQCKTR+ R  GSPRV+GDDE++DVD
Sbjct  48   LTQTGIVFVACNECGFPLCRPCYEYERKDGTQCCPQCKTRFIRHNGSPRVEGDDEDDDVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEFNY + N KAR     E  + SSSSRHES QPI +LT+G P+SGEI    TPDTQ
Sbjct  108  DIENEFNYTQRNNKARLPHLAE--EFSSSSRHES-QPISVLTHGHPVSGEI---TTPDTQ  161

Query  362  SIRSMSGPLG  391
            S+++ SG LG
Sbjct  162  SVQTTSGQLG  171



>gb|KEH33342.1| BZIP transcription factor [Medicago truncatula]
Length=254

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 98/131 (75%), Gaps = 3/131 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA G++FVAC+EC+FP+C  CYEYE K+  Q+CPQCKTR+K  K  PRV G D+E+DVD
Sbjct  46   LTATGEVFVACHECSFPLCYPCYEYEWKNVIQSCPQCKTRFKSHKDDPRVKGGDDEDDVD  105

Query  182  dlvNEFNYGEGNVKARRKWQ-GEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDT  358
            DL NE  YG+GN  A+  WQ  ED DLSSSS H+S    P LTNGQ +SG+IP  AT DT
Sbjct  106  DLRNEVKYGQGN-NAKAGWQWDEDADLSSSSGHDSQLQNPHLTNGQLMSGDIPC-ATSDT  163

Query  359  QSIRSMSGPLG  391
            QS+++ SGPLG
Sbjct  164  QSVQTTSGPLG  174



>gb|KEH33341.1| BZIP transcription factor [Medicago truncatula]
Length=323

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 98/131 (75%), Gaps = 3/131 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA G++FVAC+EC+FP+C  CYEYE K+  Q+CPQCKTR+K  K  PRV G D+E+DVD
Sbjct  46   LTATGEVFVACHECSFPLCYPCYEYEWKNVIQSCPQCKTRFKSHKDDPRVKGGDDEDDVD  105

Query  182  dlvNEFNYGEGNVKARRKWQ-GEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDT  358
            DL NE  YG+GN  A+  WQ  ED DLSSSS H+S    P LTNGQ +SG+IP  AT DT
Sbjct  106  DLRNEVKYGQGN-NAKAGWQWDEDADLSSSSGHDSQLQNPHLTNGQLMSGDIPC-ATSDT  163

Query  359  QSIRSMSGPLG  391
            QS+++ SGPLG
Sbjct  164  QSVQTTSGPLG  174



>gb|ACP28170.1| LONG1 [Pisum sativum]
 gb|ACP28171.1| LONG1 [Pisum sativum]
Length=322

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 94/131 (72%), Gaps = 3/131 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            + A GD+FVAC+ECAFP+C  CYEYE K+ +Q CPQCKTRYK  K  PRV GDD+E+DVD
Sbjct  45   LAATGDVFVACDECAFPLCHPCYEYEIKNVSQLCPQCKTRYKTHKDGPRVKGDDDEDDVD  104

Query  182  dlvNEFNYGEGNVKARRKWQ-GEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDT  358
             L NE  YG GN  ++  WQ  ED DLSSSS H+S    P LTNGQ +SGEI   AT DT
Sbjct  105  GLRNEVKYGPGN-NSKTGWQWDEDADLSSSSGHDSQLQNPHLTNGQLMSGEIAC-ATSDT  162

Query  359  QSIRSMSGPLG  391
            QS ++ SGPLG
Sbjct  163  QSAQTTSGPLG  173



>ref|NP_180124.1| cellulose synthase 10 [Arabidopsis thaliana]
 sp|Q9SKJ5.1|CESAA_ARATH RecName: Full=Probable cellulose synthase A catalytic subunit 
10 [UDP-forming]; Short=AtCesA10; Short=AtCesA13 [Arabidopsis 
thaliana]
 gb|AAD20713.1| putative cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AEC07714.1| cellulose synthase 10 [Arabidopsis thaliana]
Length=1065

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 94/124 (76%), Gaps = 5/124 (4%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T  G++FVACNEC FP+C++CYEYERKDG+Q CPQCK R++R  GSPRV+ D++E+DV+
Sbjct  42   LTKTGNVFVACNECGFPLCQSCYEYERKDGSQCCPQCKARFRRHNGSPRVEVDEKEDDVN  101

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEF+Y +GN KAR   + E  + SSSSRHE   P+ LLT+G P+SGEIP   TPD  
Sbjct  102  DIENEFDYTQGNNKARLPHRAE--EFSSSSRHEESLPVSLLTHGHPVSGEIP---TPDRN  156

Query  362  SIRS  373
            +  S
Sbjct  157  ATLS  160



>gb|AHL38838.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1058

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 94/124 (76%), Gaps = 5/124 (4%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T  G++FVACNEC FP+C++CYEYERKDG+Q CPQCK R++R  GSPRV+ D++E+DV+
Sbjct  42   LTKTGNVFVACNECGFPLCQSCYEYERKDGSQCCPQCKARFRRHNGSPRVEVDEKEDDVN  101

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEF+Y +GN KAR   + E  + SSSSRHE   P+ LLT+G P+SGEIP   TPD  
Sbjct  102  DIENEFDYTQGNNKARLPHRAE--EFSSSSRHEESLPVSLLTHGHPVSGEIP---TPDRN  156

Query  362  SIRS  373
            +  S
Sbjct  157  ATLS  160



>emb|CAA66478.1| transcription factor [Vicia faba var. minor]
Length=322

 Score =   126 bits (316),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 94/131 (72%), Gaps = 3/131 (2%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA G +FVAC+ECAFP+C  CYEYE K+ +Q CPQCKTRYK  K  P+V GDD+E+DVD
Sbjct  45   LTAAGGVFVACHECAFPLCHPCYEYEIKNVSQLCPQCKTRYKTHKDGPQVKGDDDEDDVD  104

Query  182  dlvNEFNYGEGNVKARRKWQ-GEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDT  358
             L NE  YG GN  ++  WQ  ED DLSSSS H+S    P LTNGQ +SGEI   AT DT
Sbjct  105  GLRNEVKYGPGN-NSKTGWQWDEDADLSSSSGHDSQLQNPHLTNGQLMSGEIAC-ATSDT  162

Query  359  QSIRSMSGPLG  391
            QS ++ SGPLG
Sbjct  163  QSAQTTSGPLG  173



>gb|AFM37966.1| cellulose synthase catalytic subunit [Cunninghamia lanceolata]
Length=1091

 Score =   130 bits (327),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 94/123 (76%), Gaps = 12/123 (10%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            VTA+G++FVACNECAFPVCR CYEYERK+GN++CPQCKTRYKR KGSPRV+GD+EE+DVD
Sbjct  48   VTADGELFVACNECAFPVCRPCYEYERKEGNKSCPQCKTRYKRHKGSPRVEGDEEEDDVD  107

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            DL NEFNY +    A+++       WQ     GEDVD  +SSR E     PLLTNGQP+S
Sbjct  108  DLENEFNYSQVRKNAKQERAEAMMHWQMYGRGGEDVDSVTSSRQEPRSQAPLLTNGQPVS  167

Query  326  GEI  334
            GE 
Sbjct  168  GEF  170



>ref|XP_006601864.1| PREDICTED: bZIP transcription factor bZIP36 isoform X1 [Glycine 
max]
Length=316

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 95/132 (72%), Gaps = 4/132 (3%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRY-KRLKGSPRvdgddeeedv  178
            +TA GD+FVAC+EC FP+C +CYEYE K+ +Q+CPQCKT +  R +G+     DD+E+D 
Sbjct  38   LTATGDLFVACHECGFPLCHSCYEYELKNVSQSCPQCKTTFTSRQEGAEVEGDDDDEDDA  97

Query  179  ddlvNEFNYGEG-NVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPD  355
            DDL N  NYG+G N K+   W+ ED DLSSSS H+SH P P L NGQP+SGE P  AT D
Sbjct  98   DDLDNGINYGQGNNSKSGMLWE-EDADLSSSSGHDSHIPNPHLVNGQPMSGEFPC-ATSD  155

Query  356  TQSIRSMSGPLG  391
             QS+++ S P+G
Sbjct  156  AQSMQTTSDPMG  167



>ref|NP_001237272.1| bZIP transcription factor bZIP36 [Glycine max]
 gb|AAC05017.1| TGACG-motif binding factor [Glycine max]
 gb|ABI34641.1| bZIP transcription factor bZIP36 [Glycine max]
Length=326

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 95/132 (72%), Gaps = 4/132 (3%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRY-KRLKGSPRvdgddeeedv  178
            +TA GD+FVAC+EC FP+C +CYEYE K+ +Q+CPQCKT +  R +G+     DD+E+D 
Sbjct  48   LTATGDLFVACHECGFPLCHSCYEYELKNVSQSCPQCKTTFTSRQEGAEVEGDDDDEDDA  107

Query  179  ddlvNEFNYGEG-NVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPD  355
            DDL N  NYG+G N K+   W+ ED DLSSSS H+SH P P L NGQP+SGE P  AT D
Sbjct  108  DDLDNGINYGQGNNSKSGMLWE-EDADLSSSSGHDSHIPNPHLVNGQPMSGEFPC-ATSD  165

Query  356  TQSIRSMSGPLG  391
             QS+++ S P+G
Sbjct  166  AQSMQTTSDPMG  177



>gb|KHN28520.1| Cellulose synthase A catalytic subunit 1 [UDP-forming] [Glycine 
soja]
Length=326

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 95/132 (72%), Gaps = 4/132 (3%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRY-KRLKGSPRvdgddeeedv  178
            +TA GD+FVAC+EC FP+C +CYEYE K+ +Q+CPQCKT +  R +G+     DD+E+D 
Sbjct  48   LTATGDLFVACHECGFPLCHSCYEYELKNVSQSCPQCKTTFTSRQEGAEVEGDDDDEDDA  107

Query  179  ddlvNEFNYGEG-NVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPD  355
            DDL N  NYG+G N K+   W+ ED DLSSSS H+SH P P L NGQP+SGE P  AT D
Sbjct  108  DDLDNGINYGQGNNSKSGMLWE-EDADLSSSSGHDSHIPNPHLVNGQPMSGEFPC-ATSD  165

Query  356  TQSIRSMSGPLG  391
             QS+++ S P+G
Sbjct  166  AQSMQTTSDPMG  177



>ref|XP_007146304.1| hypothetical protein PHAVU_006G029200g [Phaseolus vulgaris]
 gb|ESW18298.1| hypothetical protein PHAVU_006G029200g [Phaseolus vulgaris]
Length=290

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 94/131 (72%), Gaps = 4/131 (3%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRY-KRLKGSPRvdgddeeedv  178
            +TA GD+FVAC+EC  P+C +CYEYE K+ +Q+CPQCKTR+    +G+     DD++ED 
Sbjct  23   LTATGDVFVACHECGLPLCHSCYEYELKNVSQSCPQCKTRFTSHQEGAGVEGDDDDDEDA  82

Query  179  ddlvNEFNYGEG-NVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPD  355
            DDL NE NYG+G N KA  +W+ ED D SSSS H+S  P P L NGQP+SG+IP  AT D
Sbjct  83   DDLDNEINYGQGNNSKAGMQWE-EDADFSSSSGHDSQIPNPHLANGQPMSGDIPC-ATSD  140

Query  356  TQSIRSMSGPL  388
             QS+++ SG +
Sbjct  141  AQSMQTTSGLM  151



>ref|XP_007146305.1| hypothetical protein PHAVU_006G029200g [Phaseolus vulgaris]
 gb|ESW18299.1| hypothetical protein PHAVU_006G029200g [Phaseolus vulgaris]
Length=315

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 94/131 (72%), Gaps = 4/131 (3%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRY-KRLKGSPRvdgddeeedv  178
            +TA GD+FVAC+EC  P+C +CYEYE K+ +Q+CPQCKTR+    +G+     DD++ED 
Sbjct  48   LTATGDVFVACHECGLPLCHSCYEYELKNVSQSCPQCKTRFTSHQEGAGVEGDDDDDEDA  107

Query  179  ddlvNEFNYGEG-NVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPD  355
            DDL NE NYG+G N KA  +W+ ED D SSSS H+S  P P L NGQP+SG+IP  AT D
Sbjct  108  DDLDNEINYGQGNNSKAGMQWE-EDADFSSSSGHDSQIPNPHLANGQPMSGDIPC-ATSD  165

Query  356  TQSIRSMSGPL  388
             QS+++ SG +
Sbjct  166  AQSMQTTSGLM  176



>ref|XP_006293591.1| hypothetical protein CARUB_v10022538mg [Capsella rubella]
 gb|EOA26489.1| hypothetical protein CARUB_v10022538mg [Capsella rubella]
Length=1091

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 92/124 (74%), Gaps = 6/124 (5%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            VT  G++FV+CNEC FP+CR+CYEYERKDG Q CPQCKTR+KR  GSP+V GD +E DVD
Sbjct  49   VTETGNVFVSCNECDFPLCRSCYEYERKDGTQCCPQCKTRFKRYNGSPQVKGDAKEVDVD  108

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            D+ NEF+Y +GN K R   + E  + SSSSR ES Q + LLT+G P SGEIP   TPD +
Sbjct  109  DIENEFDYTQGNNKTRLPDRAE--EFSSSSRLESQQ-VSLLTHGHPASGEIP---TPDRK  162

Query  362  SIRS  373
            ++ S
Sbjct  163  AVLS  166



>ref|XP_004513402.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Cicer arietinum]
Length=304

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 89/131 (68%), Gaps = 11/131 (8%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T  G++FVAC+ECAFP+C  CYEYERK+ +Q+CPQCKTRYK  K   R      ++D D
Sbjct  35   LTTTGNVFVACHECAFPLCNPCYEYERKNVSQSCPQCKTRYKSHKEGTR---VKGDDDED  91

Query  182  dlvNEFNYGEGNVKARRKWQ-GEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDT  358
            DL NE  YG     ++  WQ  ED DLSSSS H+S Q +  L NGQ IS EIP  AT DT
Sbjct  92   DLRNEVKYG-----SKTGWQWEEDADLSSSSGHDSQQNL-RLANGQLISSEIPC-ATSDT  144

Query  359  QSIRSMSGPLG  391
            QS+++ SGPLG
Sbjct  145  QSVQTTSGPLG  155



>gb|AAQ63936.1| cellulose synthase [Pinus radiata]
Length=1066

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 90/126 (71%), Gaps = 14/126 (11%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA+GD+FVACN CAFPVCR CY+YERKDGNQ+CPQCKTRYK  KGSPRV+GD+ E+  D
Sbjct  13   LTADGDLFVACNVCAFPVCRPCYDYERKDGNQSCPQCKTRYKMHKGSPRVEGDEGEDGAD  72

Query  182  dlvNEFNY---GEGNVK-----ARRKWQ-----GEDVDLSSSSRHE-SHQPIPLLTNGQP  319
            D+ NE++Y   G  N K     A  +WQ     GEDV   +S+R E S   IP LTNGQ 
Sbjct  73   DVGNEYHYPPPGSRNEKQKIAEAMLRWQMSYGRGEDVGAPTSTRQEVSESQIPRLTNGQS  132

Query  320  ISGEIP  337
            ISGE+P
Sbjct  133  ISGELP  138



>gb|KHM99690.1| Cellulose synthase A catalytic subunit 1 [UDP-forming] [Glycine 
soja]
Length=324

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 89/128 (70%), Gaps = 4/128 (3%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRY-KRLKGSPRvdgddeeedv  178
            + A GD+FVAC+EC FP+C +CYEYE K  +Q+CPQCKT +    +G+     DD+E+D 
Sbjct  48   LMATGDVFVACHECGFPLCHSCYEYELKHMSQSCPQCKTAFTSHQEGAEVEGDDDDEDDA  107

Query  179  ddlvNEFNYGEGN-VKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPD  355
            DDL NE NYG+GN  KA   W+ ED DLSSSS H+S  P P L NGQP+SGE P  AT D
Sbjct  108  DDLDNEINYGQGNSSKAGMLWE-EDADLSSSSGHDSQIPNPHLANGQPMSGEFPC-ATSD  165

Query  356  TQSIRSMS  379
             QS+++ S
Sbjct  166  AQSMQTTS  173



>ref|NP_001238218.1| TGACG-motif-binding factor [Glycine max]
 gb|AAC05018.1| TGACG-motif-binding factor [Glycine max]
Length=322

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 82/127 (65%), Gaps = 4/127 (3%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA GD+FVAC+EC FP+C +CYEYE K  +Q+CPQCKT +   +       + +     
Sbjct  48   LTATGDVFVACHECGFPLCHSCYEYELKHMSQSCPQCKTAFTSHQEGAE-VEEIDMMTDA  106

Query  182  dlvNEFNYGEGN-VKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDT  358
             L NE NYG+GN  KA   W+ ED DLSSSS H+S  P P L NGQP+SGE P  AT D 
Sbjct  107  YLDNEINYGQGNSSKAGMLWE-EDADLSSSSGHDSQIPNPHLANGQPMSGEFPC-ATSDA  164

Query  359  QSIRSMS  379
            QS+++ S
Sbjct  165  QSMQTTS  171



>ref|XP_006838305.1| hypothetical protein AMTR_s00103p00124340 [Amborella trichopoda]
 gb|ERN00874.1| hypothetical protein AMTR_s00103p00124340 [Amborella trichopoda]
Length=1088

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 96/138 (70%), Gaps = 15/138 (11%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRv-dgddeeedv  178
            VTA G++FVAC+ C+FPVCR CYEYERKDGNQ+CPQCKTRYKR KGSPR+   + +++DV
Sbjct  31   VTAEGELFVACDVCSFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPRIPGDEGDDDDV  90

Query  179  ddlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHES-HQPIPLLTNGQP  319
             D+ +++NY  GN   ++K       WQ     GEDV   +   +E+    IPLLTNGQ 
Sbjct  91   GDVASDYNYPSGNQNQKQKIAEAMLHWQMSYGRGEDVAPPAYDTNETPLNHIPLLTNGQL  150

Query  320  ISGEIPLSATPDTQSIRS  373
            +SGEIP +A+PD  ++ S
Sbjct  151  VSGEIP-AASPDHPTMAS  167



>ref|XP_007052528.1| Cellulose synthase family protein isoform 4, partial [Theobroma 
cacao]
 ref|XP_007052529.1| Cellulose synthase family protein isoform 4, partial [Theobroma 
cacao]
 gb|EOX96685.1| Cellulose synthase family protein isoform 4, partial [Theobroma 
cacao]
 gb|EOX96686.1| Cellulose synthase family protein isoform 4, partial [Theobroma 
cacao]
Length=898

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 88/135 (65%), Gaps = 14/135 (10%)
 Frame = +2

Query  8    ANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvdd  184
            A+GD F+ACN CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP +     E+ D DD
Sbjct  31   ADGDPFIACNVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPAILGDRQEDGDADD  90

Query  185  lvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPISG  328
             V++FNY   N   ++K       W      GEDV   +  +  SH  IPLLTNGQ +SG
Sbjct  91   GVSDFNYSSENQNQKQKIAERMLSWHATYGRGEDVGAPNYDKEVSHNHIPLLTNGQEVSG  150

Query  329  EIPLSATPDTQSIRS  373
            E+  +A+P+  S+ S
Sbjct  151  ELS-AASPERLSMAS  164



>gb|AIX94076.1| putative cellulose synthase, partial [Lactuca sativa]
Length=858

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 86/107 (80%), Gaps = 6/107 (6%)
 Frame = +2

Query  77   ERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvddlvNEFNYGEGNVKARRKWQGEDVD  256
            ERKDG Q CPQCKTRY+RL+GSPRV+GD +E+DVDD+ NEFNY +G  K RR+  GE  +
Sbjct  1    ERKDGTQCCPQCKTRYRRLRGSPRVEGDGDEDDVDDIENEFNYTQGANKGRRQRHGE--E  58

Query  257  LSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQSIRSMSGPLGPG  397
             SSSSRH+S QPIPLLT+G  +SGEI    TPDTQS+R+ SGPLGPG
Sbjct  59   FSSSSRHDS-QPIPLLTHGHGVSGEI---RTPDTQSVRTTSGPLGPG  101



>ref|XP_007052526.1| Cellulose synthase family protein isoform 2 [Theobroma cacao]
 ref|XP_007052530.1| Cellulose synthase family protein isoform 2 [Theobroma cacao]
 gb|EOX96683.1| Cellulose synthase family protein isoform 2 [Theobroma cacao]
 gb|EOX96687.1| Cellulose synthase family protein isoform 2 [Theobroma cacao]
Length=1068

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 88/135 (65%), Gaps = 14/135 (10%)
 Frame = +2

Query  8    ANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvdd  184
            A+GD F+ACN CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP +     E+ D DD
Sbjct  31   ADGDPFIACNVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPAILGDRQEDGDADD  90

Query  185  lvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPISG  328
             V++FNY   N   ++K       W      GEDV   +  +  SH  IPLLTNGQ +SG
Sbjct  91   GVSDFNYSSENQNQKQKIAERMLSWHATYGRGEDVGAPNYDKEVSHNHIPLLTNGQEVSG  150

Query  329  EIPLSATPDTQSIRS  373
            E+  +A+P+  S+ S
Sbjct  151  ELS-AASPERLSMAS  164



>gb|AIS85978.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85980.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85981.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85982.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85983.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85992.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85995.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85997.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85998.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85999.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86007.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86008.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 90/136 (66%), Gaps = 14/136 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            TA+G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKRLKGSP +    +E+ D D
Sbjct  30   TADGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRLKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       WQ     GED   S+  +  SH  IPLLTNG  +S
Sbjct  90   DGASDFNYSSENQNQKQKIAERMLSWQMTYGRGEDSGASNYDKEVSHNHIPLLTNGHEVS  149

Query  326  GEIPLSATPDTQSIRS  373
            GE+  +A+P+  S+ S
Sbjct  150  GELS-AASPEHISMAS  164



>gb|AIS85991.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 90/136 (66%), Gaps = 14/136 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            TA+G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKRLKGSP +    +E+ D D
Sbjct  30   TADGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRLKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       WQ     GED   S+  +  SH  IPLLTNG  +S
Sbjct  90   DGASDFNYSSENQNQKQKIAERMLSWQMTYGRGEDSGASNYDKEVSHNHIPLLTNGHEVS  149

Query  326  GEIPLSATPDTQSIRS  373
            GE+  +A+P+  S+ S
Sbjct  150  GELS-AASPEHISMAS  164



>gb|AIS85990.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86003.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86006.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86010.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 90/136 (66%), Gaps = 14/136 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            TA+G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKRLKGSP +    +E+ D D
Sbjct  30   TADGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRLKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       WQ     GED   S+  +  SH  IPLLTNG  +S
Sbjct  90   DGASDFNYSSENQNQKQKIAERMLSWQMTYGRGEDSGASNYDKEVSHNHIPLLTNGHEVS  149

Query  326  GEIPLSATPDTQSIRS  373
            GE+  +A+P+  S+ S
Sbjct  150  GELS-AASPEHISMAS  164



>gb|AIS85987.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 90/136 (66%), Gaps = 14/136 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            TA+G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKRLKGSP +    +E+ D D
Sbjct  30   TADGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRLKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       WQ     GED   S+  +  SH  IPLLTNG  +S
Sbjct  90   DGASDFNYSSENQNQKQKIAERMLSWQMTYGRGEDSGASNYDKEVSHNHIPLLTNGHEVS  149

Query  326  GEIPLSATPDTQSIRS  373
            GE+  +A+P+  S+ S
Sbjct  150  GELS-AASPEHISMAS  164



>gb|AIS85996.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86001.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 90/136 (66%), Gaps = 14/136 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            TA+G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKRLKGSP +    +E+ D D
Sbjct  30   TADGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRLKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       WQ     GED   S+  +  SH  IPLLTNG  +S
Sbjct  90   DGASDFNYSSENQNQKQKIAERMLSWQMTYGRGEDSGASNYDKEVSHNHIPLLTNGHEVS  149

Query  326  GEIPLSATPDTQSIRS  373
            GE+  +A+P+  S+ S
Sbjct  150  GELS-AASPEHISMAS  164



>gb|AIS86011.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 90/136 (66%), Gaps = 14/136 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            TA+G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKRLKGSP +    +E+ D D
Sbjct  30   TADGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRLKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       WQ     GED   S+  +  SH  IPLLTNG  +S
Sbjct  90   DGASDFNYSSENQNQKQKIAERMLSWQMTYGRGEDSGASNYDKEVSHNHIPLLTNGHEVS  149

Query  326  GEIPLSATPDTQSIRS  373
            GE+  +A+P+  S+ S
Sbjct  150  GELS-AASPEHISMAS  164



>ref|XP_007052525.1| Cellulose synthase family protein isoform 1 [Theobroma cacao]
 gb|EOX96682.1| Cellulose synthase family protein isoform 1 [Theobroma cacao]
Length=1237

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 88/135 (65%), Gaps = 14/135 (10%)
 Frame = +2

Query  8    ANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvdd  184
            A+GD F+ACN CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP +     E+ D DD
Sbjct  31   ADGDPFIACNVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPAILGDRQEDGDADD  90

Query  185  lvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPISG  328
             V++FNY   N   ++K       W      GEDV   +  +  SH  IPLLTNGQ +SG
Sbjct  91   GVSDFNYSSENQNQKQKIAERMLSWHATYGRGEDVGAPNYDKEVSHNHIPLLTNGQEVSG  150

Query  329  EIPLSATPDTQSIRS  373
            E+  +A+P+  S+ S
Sbjct  151  ELS-AASPERLSMAS  164



>gb|AIA10372.1| cellulose synthase [Boehmeria nivea]
Length=1079

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 91/135 (67%), Gaps = 13/135 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvdd  184
            T +G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP + GD EE+DVDD
Sbjct  30   TTDGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPAILGDKEEDDVDD  89

Query  185  lvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPISG  328
              ++FNY   N   ++K       WQ     GEDV   +  +   H  IPLLTNGQ +SG
Sbjct  90   GASDFNYPSENQNEKQKIAERMLSWQMTYGRGEDVVAPNYDKEVPHNHIPLLTNGQEVSG  149

Query  329  EIPLSATPDTQSIRS  373
            E+  +A+P+  S+ S
Sbjct  150  ELS-AASPERFSMAS  163



>ref|XP_007052527.1| Cellulose synthase family protein isoform 3 [Theobroma cacao]
 gb|EOX96684.1| Cellulose synthase family protein isoform 3 [Theobroma cacao]
Length=1108

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 88/135 (65%), Gaps = 14/135 (10%)
 Frame = +2

Query  8    ANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvdd  184
            A+GD F+ACN CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP +     E+ D DD
Sbjct  31   ADGDPFIACNVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPAILGDRQEDGDADD  90

Query  185  lvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPISG  328
             V++FNY   N   ++K       W      GEDV   +  +  SH  IPLLTNGQ +SG
Sbjct  91   GVSDFNYSSENQNQKQKIAERMLSWHATYGRGEDVGAPNYDKEVSHNHIPLLTNGQEVSG  150

Query  329  EIPLSATPDTQSIRS  373
            E+  +A+P+  S+ S
Sbjct  151  ELS-AASPERLSMAS  164



>gb|AAQ63935.1| cellulose synthase [Pinus radiata]
Length=1096

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 86/125 (69%), Gaps = 13/125 (10%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            + A+G+ FVACNECAFPVCR CYEYE KDGNQ+CPQCKTRYK  KGSP+VDGD E+E  D
Sbjct  48   LAADGEFFVACNECAFPVCRPCYEYEWKDGNQSCPQCKTRYKWHKGSPQVDGDKEDECAD  107

Query  182  dlvNEFNYGEGN-------VKARRKWQ-----GEDVDLSSSSRHESHQ-PIPLLTNGQPI  322
            DL ++FN  +GN        +A   WQ     GEDV  S S   E  Q  +PL+TNGQ I
Sbjct  108  DLDHDFNSTQGNRNEKQQIAEAMLHWQMAYGRGEDVGPSRSESQELPQLQVPLITNGQAI  167

Query  323  SGEIP  337
            SGE+P
Sbjct  168  SGELP  172



>gb|AIS86005.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 89/136 (65%), Gaps = 14/136 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            TA+G  FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKRLKGSP +    +E+ D D
Sbjct  30   TADGGPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRLKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       WQ     GED   S+  +  SH  IPLLTNG  +S
Sbjct  90   DGASDFNYSSENQNQKQKIAERMLSWQMTYGRGEDSGASNYDKEVSHNHIPLLTNGHEVS  149

Query  326  GEIPLSATPDTQSIRS  373
            GE+  +A+P+  S+ S
Sbjct  150  GELS-AASPEHISMAS  164



>ref|XP_010541595.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Tarenaya hassleriana]
Length=1072

 Score =   115 bits (289),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 89/131 (68%), Gaps = 17/131 (13%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA GD+FVACNECAFPVCR CYEYERKDG Q CP+CKTRYKR +GS RVDGDD+ +  D
Sbjct  49   LTAAGDLFVACNECAFPVCRPCYEYERKDGTQCCPKCKTRYKRHRGSVRVDGDDDGDGAD  108

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSATPDTQ  361
            DL NE                   + S SSRH +H+ I L + G+ +SGEIP SAT D Q
Sbjct  109  DLENE----------------FSSEFSMSSRHGAHRQIHLHSQGRTVSGEIP-SATIDIQ  151

Query  362  SIRSMSGPLGP  394
            S+R+ SGPL P
Sbjct  152  SVRTTSGPLVP  162



>gb|AAL23710.2| cellulose synthase [Populus tremuloides]
Length=1078

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 90/135 (67%), Gaps = 13/135 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            TA+G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKRLKGSP +    +E+ D D
Sbjct  30   TADGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRLKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARR------KWQ-----GEDVDLSSSSRHESHQPIPLLTNGQPISG  328
            D  ++FNY E   + ++       WQ     GED   S+  +  SH  IPLLTNG  +SG
Sbjct  90   DGASDFNYSENQNQKQKIAERMLSWQMTYGPGEDSGASNYDKEVSHNHIPLLTNGHEVSG  149

Query  329  EIPLSATPDTQSIRS  373
            ++  +A+P+  S+ S
Sbjct  150  DLS-AASPEHISMAS  163



>gb|AIS85977.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 89/136 (65%), Gaps = 14/136 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            TA+G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKRLKGSP +    +E+ D D
Sbjct  30   TADGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRLKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       WQ     GED    +  +  SH  IPLLTNG  +S
Sbjct  90   DGASDFNYSSENQNQKQKIAERMLSWQMTYGRGEDSGAPNYDKEVSHNHIPLLTNGHDVS  149

Query  326  GEIPLSATPDTQSIRS  373
            GE+  +A+P+  S+ S
Sbjct  150  GELS-AASPEHISMAS  164



>gb|AIS85989.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85993.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85994.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86000.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86002.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 89/136 (65%), Gaps = 14/136 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            TA+G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKRLKGSP +    +E+ D D
Sbjct  30   TADGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRLKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       WQ     GED    +  +  SH  IPLLTNG  +S
Sbjct  90   DGASDFNYSSENQNQKQKIAERMLSWQMTYGRGEDSGAPNYDKEVSHNHIPLLTNGHDVS  149

Query  326  GEIPLSATPDTQSIRS  373
            GE+  +A+P+  S+ S
Sbjct  150  GELS-AASPEHISMAS  164



>gb|AIS86009.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 89/136 (65%), Gaps = 14/136 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            TA+G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKRLKGSP +    +E+ D D
Sbjct  30   TADGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRLKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       WQ     GED    +  +  SH  IPLLTNG  +S
Sbjct  90   DGASDFNYSSENQNQKQKIAERMLSWQMTYGRGEDSGAPNYDKEVSHNHIPLLTNGHDVS  149

Query  326  GEIPLSATPDTQSIRS  373
            GE+  +A+P+  S+ S
Sbjct  150  GELS-AASPEHISMAS  164



>gb|AFZ78554.1| cellulose synthase [Populus tomentosa]
 gb|AIS85972.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85973.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85974.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85975.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85976.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85979.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85984.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85985.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85986.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85988.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86012.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 89/136 (65%), Gaps = 14/136 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            TA+G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKRLKGSP +    +E+ D D
Sbjct  30   TADGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRLKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       WQ     GED    +  +  SH  IPLLTNG  +S
Sbjct  90   DGASDFNYSSENQNQKQKIAERMLSWQMTYGRGEDSGAPNYDKEVSHNHIPLLTNGHDVS  149

Query  326  GEIPLSATPDTQSIRS  373
            GE+  +A+P+  S+ S
Sbjct  150  GELS-AASPEHISMAS  164



>gb|AIS86004.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 89/136 (65%), Gaps = 14/136 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            TA+G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKRLKGSP +    +E+ D D
Sbjct  30   TADGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRLKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       WQ     GED    +  +  SH  IPLLTNG  +S
Sbjct  90   DGASDFNYSSENQNQKQKIAERMLSWQMTYGRGEDSGAPNYDKEVSHNHIPLLTNGHDVS  149

Query  326  GEIPLSATPDTQSIRS  373
            GE+  +A+P+  S+ S
Sbjct  150  GELS-AASPEHISMAS  164



>ref|XP_007220288.1| hypothetical protein PRUPE_ppa000593mg [Prunus persica]
 gb|EMJ21487.1| hypothetical protein PRUPE_ppa000593mg [Prunus persica]
Length=1082

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 89/136 (65%), Gaps = 14/136 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            TA+G+ F+AC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP +    +E+ D D
Sbjct  30   TADGEPFIACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       W      GED+   +  +  SH  IPLLTNGQ +S
Sbjct  90   DGTSDFNYTSENQNEKQKIAERMLSWHMTYGRGEDIGAPNYDKEVSHNHIPLLTNGQEVS  149

Query  326  GEIPLSATPDTQSIRS  373
            GE+  +A+P+  S+ S
Sbjct  150  GELS-AASPERLSMAS  164



>ref|XP_008231249.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Prunus mume]
 ref|XP_008231250.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Prunus mume]
Length=1082

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 89/136 (65%), Gaps = 14/136 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            TA+G+ F+AC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP +    +E+ D D
Sbjct  30   TADGEPFIACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       W      GED+   +  +  SH  IPLLTNGQ +S
Sbjct  90   DGTSDFNYTSENQNEKQKIAERMLSWHMTYGRGEDIGAPNYDKEVSHNHIPLLTNGQEVS  149

Query  326  GEIPLSATPDTQSIRS  373
            GE+  +A+P+  S+ S
Sbjct  150  GELS-AASPERLSMAS  164



>dbj|BAC20318.1| bZIP with a Ring-finger motif [Lotus japonicus]
 dbj|BAC20319.1| bZIP with a Ring-finger motif [Lotus japonicus]
 dbj|BAC20320.1| bZIP with a Ring-finger motif [Lotus japonicus]
Length=321

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 92/135 (68%), Gaps = 15/135 (11%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd----gddee  169
            +TANGDIFVAC+ECAF +C  CYEYER + +  CPQCKTRY+  K S +++     DD+E
Sbjct  48   LTANGDIFVACHECAFQLCHPCYEYERNNVSPYCPQCKTRYESHKESSQMEGDDDDDDDE  107

Query  170  edvddlvNEFNYGEGN-VKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSA  346
            +DVDDL NE  YG+GN +KAR +W+ ED DLSSSS H+S    P LTNGQ +SGE   + 
Sbjct  108  DDVDDLENEVKYGQGNRMKARLQWE-EDADLSSSSGHDSQMQNPHLTNGQLMSGENLCAT  166

Query  347  TPDTQSIRSMSGPLG  391
            T         SGP+G
Sbjct  167  T---------SGPMG  172



>ref|XP_010088232.1| OsCesA3 protein [Morus notabilis]
 gb|EXB32784.1| OsCesA3 protein [Morus notabilis]
Length=1077

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 89/136 (65%), Gaps = 19/136 (14%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            T +G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP +    +E+ DVD
Sbjct  30   TVDGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPAILGDKEEDLDVD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  + FNY   N   ++K       WQ     GED+D     +  SH  IPLLTNGQ +S
Sbjct  90   DGASNFNYTSENQTEKQKIAERMLSWQMTYGRGEDID-----KEASHNHIPLLTNGQEVS  144

Query  326  GEIPLSATPDTQSIRS  373
            GE+  +A+P+  S+ S
Sbjct  145  GELS-AASPERLSMAS  159



>ref|XP_008375180.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Malus domestica]
Length=1082

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 92/145 (63%), Gaps = 18/145 (12%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            TA+G+ F+AC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP +    +E+   D
Sbjct  30   TADGEPFIACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPAILGDREEDAVAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       W      GEDV   +  +  SH  IPLL +GQ +S
Sbjct  90   DDTSDFNYTSENQNEKQKIAERMLSWHMTYGRGEDVSAPNYDKEVSHNHIPLLASGQEVS  149

Query  326  GEIPLSATPDTQSIRSMSGP-LGPG  397
            GE+  +A+P+     SM+ P +GPG
Sbjct  150  GELS-AASPERL---SMASPGVGPG  170



>ref|XP_009364979.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Pyrus x bretschneideri]
 ref|XP_009364980.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Pyrus x bretschneideri]
Length=1081

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 91/136 (67%), Gaps = 14/136 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedv-d  181
            TA+G+ F+AC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP + GD EE+ V D
Sbjct  30   TADGEPFIACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPAILGDREEDAVPD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       W      GEDV   +  +  SH  IPLLT+GQ +S
Sbjct  90   DGTSDFNYTSENQNEKQKIAERMLSWHMTYGRGEDVSAPNYDKEVSHNHIPLLTSGQEVS  149

Query  326  GEIPLSATPDTQSIRS  373
            GE+  +A+P+  S+ S
Sbjct  150  GELS-AASPERLSMAS  164



>ref|XP_009354747.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Pyrus x bretschneideri]
 ref|XP_009354748.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Pyrus x bretschneideri]
Length=1082

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 92/145 (63%), Gaps = 18/145 (12%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            TA+G+ F+AC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP +    +E+   D
Sbjct  30   TADGEPFIACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPAILGDREEDAVAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       W      GEDV   +  +  SH  IPLL +GQ +S
Sbjct  90   DGTSDFNYTSENQNEKQKIAERMLSWHMTYGRGEDVSAPNYDKEVSHNHIPLLASGQEVS  149

Query  326  GEIPLSATPDTQSIRSMSGP-LGPG  397
            GE+  +A+P+     SM+ P +GPG
Sbjct  150  GELS-AASPERL---SMASPGVGPG  170



>ref|XP_011047398.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
isoform X1 [Populus euphratica]
 ref|XP_011047399.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
isoform X2 [Populus euphratica]
 ref|XP_011047400.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
isoform X1 [Populus euphratica]
Length=1079

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 88/135 (65%), Gaps = 14/135 (10%)
 Frame = +2

Query  8    ANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvdd  184
            A+G+ FVAC+ CAFPVCR CYEYERK GNQ+CPQCKTRYKRLKGSP +    +E+ D DD
Sbjct  31   ADGEPFVACDVCAFPVCRPCYEYERKHGNQSCPQCKTRYKRLKGSPAILGDREEDGDADD  90

Query  185  lvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPISG  328
              ++FNY   N   ++K       WQ     GED    +  +  SH  IPLLT+GQ +SG
Sbjct  91   GASDFNYSSENQNQKQKIAERMLSWQMTYGRGEDAGAPNYDKEVSHNHIPLLTSGQEVSG  150

Query  329  EIPLSATPDTQSIRS  373
            E+  +A+PD  S+ S
Sbjct  151  ELS-AASPDHISMAS  164



>gb|KHG03009.1| Cellulose synthase A catalytic subunit 3 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1068

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 87/137 (64%), Gaps = 16/137 (12%)
 Frame = +2

Query  8    ANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvdd  184
            A+GD F+AC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP +    +E+ D DD
Sbjct  30   ADGDPFIACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPAILGDREEDGDADD  89

Query  185  lvNEFNYGEGNVKARRK---------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPI  322
              ++FNY   N    +K         W      GEDV   +  +  SH  IPLLTNGQ +
Sbjct  90   GASDFNYSSENKNQNQKQKISERMLSWHATYGRGEDVGAPNYDKEVSHNHIPLLTNGQEV  149

Query  323  SGEIPLSATPDTQSIRS  373
            SGE+  +A+P+  S+ S
Sbjct  150  SGELS-AASPERLSMAS  165



>gb|AFI71894.1| cellulose synthase 3 [Paeonia lactiflora]
Length=1081

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 86/134 (64%), Gaps = 13/134 (10%)
 Frame = +2

Query  8    ANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvddl  187
             +GD FVACN CAFPVCR CYEYERKDGNQ+CPQCKT YKR KGSP + GD EE + DD 
Sbjct  30   VDGDPFVACNVCAFPVCRPCYEYERKDGNQSCPQCKTIYKRHKGSPAIQGDKEEGEADDG  89

Query  188  vNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPISGE  331
             ++FNY   N   ++K       W      GED+   +  +  SH  IP LT+G+ +SGE
Sbjct  90   ASDFNYSSENQNQKQKIAERMLSWHMTYGRGEDIGTPNYDKEVSHNNIPFLTHGREVSGE  149

Query  332  IPLSATPDTQSIRS  373
            +  +A+P+  S+ S
Sbjct  150  LS-AASPEHFSMSS  162



>gb|KDP43475.1| hypothetical protein JCGZ_16762 [Jatropha curcas]
Length=1078

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 89/138 (64%), Gaps = 16/138 (12%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeee---d  175
            T  GD F+AC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP + GD EE+   D
Sbjct  28   TVAGDPFIACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRQKGSPAILGDREEDGDGD  87

Query  176  vddlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQP  319
             D++ ++FNY       ++K       WQ     GEDV   +  +  SH  IPLLTNG  
Sbjct  88   ADEVASDFNYSSETQNQKQKISERMLSWQMRYGRGEDVGAPNYDKEVSHNHIPLLTNGHE  147

Query  320  ISGEIPLSATPDTQSIRS  373
            +SGE+  +A+P+  S+ S
Sbjct  148  VSGELS-AASPEHISMAS  164



>ref|XP_002298432.1| hypothetical protein POPTR_0001s27320g [Populus trichocarpa]
 ref|XP_006369625.1| cellulose synthase family protein [Populus trichocarpa]
 ref|XP_006369626.1| hypothetical protein POPTR_0001s27320g [Populus trichocarpa]
 gb|EEE83237.1| hypothetical protein POPTR_0001s27320g [Populus trichocarpa]
 gb|ERP66194.1| cellulose synthase family protein [Populus trichocarpa]
 gb|ERP66195.1| hypothetical protein POPTR_0001s27320g [Populus trichocarpa]
Length=1081

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 88/136 (65%), Gaps = 14/136 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            TA+G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKRL GSP +    +E+ D D
Sbjct  30   TADGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRLNGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   +++       WQ     GED    +  +  SH  IPLLTNG  +S
Sbjct  90   DGASDFNYSSENQNQKQRIAERMLSWQMTYGRGEDSGAPNYDKEVSHNHIPLLTNGHEVS  149

Query  326  GEIPLSATPDTQSIRS  373
            GE+  +A+P+  S+ S
Sbjct  150  GELS-AASPEHVSMAS  164



>ref|XP_007133819.1| hypothetical protein PHAVU_011G211500g [Phaseolus vulgaris]
 gb|ESW05813.1| hypothetical protein PHAVU_011G211500g [Phaseolus vulgaris]
Length=1074

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 88/135 (65%), Gaps = 14/135 (10%)
 Frame = +2

Query  8    ANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeee-dvdd  184
             +G+ F+AC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP +  D EE+    D
Sbjct  31   VDGEPFIACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPAILRDTEEDGAATD  90

Query  185  lvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPISG  328
            + ++FNY   N   ++K       WQ     GE+V   +  +  SH  IPLLT+GQ +SG
Sbjct  91   IASDFNYDSDNQNQKQKISDRMLSWQLTYARGEEVGAPNYDKEVSHNHIPLLTSGQEVSG  150

Query  329  EIPLSATPDTQSIRS  373
            E+  +A+P+  S+ S
Sbjct  151  ELS-AASPERLSMAS  164



>gb|KJB25016.1| hypothetical protein B456_004G172400 [Gossypium raimondii]
 gb|KJB25018.1| hypothetical protein B456_004G172400 [Gossypium raimondii]
 gb|KJB25019.1| hypothetical protein B456_004G172400 [Gossypium raimondii]
 gb|KJB25020.1| hypothetical protein B456_004G172400 [Gossypium raimondii]
Length=1068

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 86/137 (63%), Gaps = 16/137 (12%)
 Frame = +2

Query  8    ANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvdd  184
            A+GD F+AC  CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP +    +E+ D DD
Sbjct  30   ADGDPFIACGVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPAILGDREEDGDADD  89

Query  185  lvNEFNYGEGNVKARRK---------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPI  322
              ++FNY   N    +K         W      GEDV   +  +  SH  IPLLTNGQ +
Sbjct  90   GASDFNYSSENKNQNQKQKISERMLSWHATYGRGEDVGAPNYDKEVSHNHIPLLTNGQEV  149

Query  323  SGEIPLSATPDTQSIRS  373
            SGE+  +A+P+  S+ S
Sbjct  150  SGELS-AASPERLSMAS  165



>gb|AEE60898.1| cellulose synthase [Populus tomentosa]
Length=1079

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 87/136 (64%), Gaps = 14/136 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            T +G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRY+R KGSP +    +E+ D D
Sbjct  30   TVDGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYRRHKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D   +FNY   N   ++K       WQ     GED+   S  +  SH  IPL+TNG  +S
Sbjct  90   DGAIDFNYSSENQNQKQKIAERMLSWQMMFGRGEDLGAPSYDKEVSHHHIPLITNGHEVS  149

Query  326  GEIPLSATPDTQSIRS  373
            GE+  +A+P+  S+ S
Sbjct  150  GELS-AASPEHISMAS  164



>ref|XP_006369624.1| hypothetical protein POPTR_0001s27320g [Populus trichocarpa]
 gb|ERP66193.1| hypothetical protein POPTR_0001s27320g [Populus trichocarpa]
Length=1031

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 88/136 (65%), Gaps = 14/136 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            TA+G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKRL GSP +    +E+ D D
Sbjct  30   TADGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRLNGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   +++       WQ     GED    +  +  SH  IPLLTNG  +S
Sbjct  90   DGASDFNYSSENQNQKQRIAERMLSWQMTYGRGEDSGAPNYDKEVSHNHIPLLTNGHEVS  149

Query  326  GEIPLSATPDTQSIRS  373
            GE+  +A+P+  S+ S
Sbjct  150  GELS-AASPEHVSMAS  164



>ref|XP_006826669.1| hypothetical protein AMTR_s00137p00043990 [Amborella trichopoda]
 gb|ERM93906.1| hypothetical protein AMTR_s00137p00043990 [Amborella trichopoda]
Length=1047

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 86/132 (65%), Gaps = 11/132 (8%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            VTA G++FVACNEC FPVCR CYEYER++G Q CPQCKTRYKRLKGSPRV+GD++EED+D
Sbjct  46   VTAEGELFVACNECGFPVCRPCYEYERREGTQLCPQCKTRYKRLKGSPRVEGDEDEEDID  105

Query  182  dlvNEF----------NYGEGNVKARRKW-QGEDVDLSSSSRHESHQPIPLLTNGQPISG  328
            D+ +EF          +  E  +  +  + +G D + S +S H    P P+    +P+SG
Sbjct  106  DIEHEFSLEDEQSKRQHLAEAMLHGKMSYGRGVDEEASQTSHHHPEIPHPITARSRPVSG  165

Query  329  EIPLSATPDTQS  364
            E PL    D  S
Sbjct  166  EFPLPHHADQGS  177



>gb|AEP33538.1| cellulose synthase catalytic subunit [Gossypium schwendimanii]
Length=1067

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 86/133 (65%), Gaps = 13/133 (10%)
 Frame = +2

Query  11   NGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvddl  187
            +GD F+ACN CAFPVCR CYEYERKDGNQ+CPQCKTRYK  KGSP +    +   D DD 
Sbjct  32   DGDPFIACNICAFPVCRPCYEYERKDGNQSCPQCKTRYKWQKGSPAILGDRETGGDADDG  91

Query  188  vNEFNYGEGNVKARRK------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEI  334
             ++FNY E   + ++       W     +GEDV  ++  +  SH  IPLLT+GQ +SGE+
Sbjct  92   ASDFNYSENQEQKQKLAERMQGWNAKYGRGEDVGAATYDKEISHNHIPLLTSGQEVSGEL  151

Query  335  PLSATPDTQSIRS  373
              +A+P+  S+ S
Sbjct  152  S-AASPERLSMAS  163



>ref|XP_004499886.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cicer arietinum]
Length=1078

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 84/136 (62%), Gaps = 14/136 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            T + D F AC  CAFPVCR CYEYERKDGNQ+CPQCKTRYK+LKGSP +    DE+   D
Sbjct  31   TVDSDPFTACGVCAFPVCRACYEYERKDGNQSCPQCKTRYKKLKGSPAILGDRDEDGGAD  90

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            +  N+F Y   N   ++K       WQ     GE+VD  +  +  SH  IP LT GQ +S
Sbjct  91   NGANDFKYNSENQSQKQKIAERMLSWQMAYGRGEEVDAPNYDKEVSHNHIPRLTGGQEVS  150

Query  326  GEIPLSATPDTQSIRS  373
            GE+  +A+P+  S+ S
Sbjct  151  GELS-AASPERLSMAS  165



>gb|AFK49023.1| unknown [Lotus japonicus]
Length=321

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 91/135 (67%), Gaps = 15/135 (11%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd----gddee  169
            +TANGDIFVAC+ECAF +C  CYEYER + +  CPQCKTRY+  K S +++     DD+E
Sbjct  48   LTANGDIFVACHECAFQLCHPCYEYERNNVSPYCPQCKTRYESHKESSQMEGDDDDDDDE  107

Query  170  edvddlvNEFNYGEGN-VKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSA  346
            +DVDDL NE  YG+GN +KAR +W+ ED DLSSSS H+S    P LTNGQ +SG    + 
Sbjct  108  DDVDDLENEVKYGQGNRMKARLQWE-EDADLSSSSGHDSQMQNPHLTNGQLMSGGNLCAT  166

Query  347  TPDTQSIRSMSGPLG  391
            T         SGP+G
Sbjct  167  T---------SGPMG  172



>ref|XP_002960719.1| hypothetical protein SELMODRAFT_73698 [Selaginella moellendorffii]
 gb|EFJ38258.1| hypothetical protein SELMODRAFT_73698 [Selaginella moellendorffii]
Length=1082

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 93/142 (65%), Gaps = 12/142 (8%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T +GD+FVACNECAFPVCR CY+YERKDGNQACPQCKTRYKR KGSPRV+GDD+EE+ D
Sbjct  45   LTVDGDLFVACNECAFPVCRPCYDYERKDGNQACPQCKTRYKRHKGSPRVEGDDDEEEFD  104

Query  182  dlvNEFNYGEGNVKARRKWQGEDV--DLSSSSRHESHQ--------PIPLLTNGQPISGE  331
            DL +EFN  +   K  R+   E +     S  R E H+        P+PLLTNGQ    +
Sbjct  105  DLDSEFNIHDEVDKMDRQQLAEAMLHGRMSYGRAEDHEIEMPGLQPPVPLLTNGQMDGSD  164

Query  332  IPLSATPDTQSIRSMSGPLGPG  397
            + +   PD  ++   S   GPG
Sbjct  165  VDV-IPPDHHALIVPSN-FGPG  184



>ref|XP_002983952.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ14964.1| family 2 glycosyltransferase [Selaginella moellendorffii]
Length=1090

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 93/142 (65%), Gaps = 12/142 (8%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T +GD+FVACNECAFPVCR CY+YERKDGNQACPQCKTRYKR KGSPRV+GDD+EE+ D
Sbjct  45   LTVDGDLFVACNECAFPVCRPCYDYERKDGNQACPQCKTRYKRHKGSPRVEGDDDEEEFD  104

Query  182  dlvNEFNYGEGNVKARRKWQGEDV--DLSSSSRHESHQ--------PIPLLTNGQPISGE  331
            DL +EFN  +   K  R+   E +     S  R E H+        P+PLLTNGQ    +
Sbjct  105  DLDSEFNIHDEVDKMDRQQLAEAMLHGRMSYGRAEDHEIEMPGLQPPVPLLTNGQMDGSD  164

Query  332  IPLSATPDTQSIRSMSGPLGPG  397
            + +   PD  ++   S   GPG
Sbjct  165  VDV-IPPDHHALIVPSN-FGPG  184



>gb|AEP33557.1| cellulose synthase catalytic subunit [Gossypium gossypioides]
Length=1067

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 85/133 (64%), Gaps = 13/133 (10%)
 Frame = +2

Query  11   NGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvddl  187
            +GD F+ACN CAFPVCR CYEYERKDGNQ+CPQCKTRYK  KGSP +    +   D DD 
Sbjct  32   DGDPFIACNICAFPVCRPCYEYERKDGNQSCPQCKTRYKWQKGSPAILGDRETGGDADDS  91

Query  188  vNEFNYGEGNVKARRK------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEI  334
             ++FNY E   + ++       W     +GEDV   +  +  SH  IPLLT+GQ +SGE+
Sbjct  92   ASDFNYSENQEQKQKLAERMLGWNAKYGRGEDVGAPTYDKEISHNHIPLLTSGQEVSGEL  151

Query  335  PLSATPDTQSIRS  373
              +A+P+  S+ S
Sbjct  152  S-AASPERLSMAS  163



>ref|XP_002532166.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
 gb|EEF30219.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
Length=1085

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 86/137 (63%), Gaps = 15/137 (11%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeee-dvd  181
            T +GD FVACN CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP + GD EE+ D D
Sbjct  30   TLDGDPFVACNVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRQKGSPAILGDREEDCDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQG------EDVDLSSSSRHESHQPIPLLTNGQPI  322
            D   +FNY       R+K       WQ       +DV      +  SH  IPLLTNG  +
Sbjct  90   DGAKDFNYPTETQNQRQKIAERMLSWQMNYGRGEDDVGAPKYDKEVSHNHIPLLTNGHEV  149

Query  323  SGEIPLSATPDTQSIRS  373
            SGE+  +A+P+  S+ S
Sbjct  150  SGELS-AASPEHVSMAS  165



>ref|XP_003533898.2| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X1 [Glycine max]
 ref|XP_006587173.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X2 [Glycine max]
Length=1074

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 86/137 (63%), Gaps = 13/137 (9%)
 Frame = +2

Query  8    ANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvdd  184
            ANGD F+AC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP +    +E+   DD
Sbjct  32   ANGDPFIACDVCAFPVCRACYEYERKDGNQSCPQCKTRYKRHKGSPAILGDREEDGGADD  91

Query  185  lvNEFNYGEGNVKARRK------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPISGE  331
              ++FNY   N   ++K      WQ      E+    +  +  SH  IPLL+ GQ +SGE
Sbjct  92   GASDFNYNSENQNEKQKIEHMLGWQMAYGRAEEAIAPNYDKEVSHNHIPLLSGGQEVSGE  151

Query  332  IPLSATPDTQSIRSMSG  382
            +  +A+P+  S+ S  G
Sbjct  152  LS-AASPERLSMASPGG  167



>gb|KHM98952.1| Cellulose synthase A catalytic subunit 3 [UDP-forming] [Glycine 
soja]
Length=1062

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 86/137 (63%), Gaps = 13/137 (9%)
 Frame = +2

Query  8    ANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvdd  184
            ANGD F+AC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP +    +E+   DD
Sbjct  20   ANGDPFIACDVCAFPVCRACYEYERKDGNQSCPQCKTRYKRHKGSPAILGDREEDGGADD  79

Query  185  lvNEFNYGEGNVKARRK------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPISGE  331
              ++FNY   N   ++K      WQ      E+    +  +  SH  IPLL+ GQ +SGE
Sbjct  80   GASDFNYNSENQNEKQKIEHMLGWQMAYGRAEEAIAPNYDKEVSHNHIPLLSGGQEVSGE  139

Query  332  IPLSATPDTQSIRSMSG  382
            +  +A+P+  S+ S  G
Sbjct  140  LS-AASPERLSMASPGG  155



>gb|AEP33540.1| cellulose synthase catalytic subunit [Gossypium mustelinum]
Length=1067

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 85/133 (64%), Gaps = 13/133 (10%)
 Frame = +2

Query  11   NGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvddl  187
            +GD F+ACN CAFPVCR CYEYERKDGNQ+CPQCKTRYK  KGSP +    +   D DD 
Sbjct  32   DGDPFIACNVCAFPVCRPCYEYERKDGNQSCPQCKTRYKWQKGSPAILGDRETGGDADDG  91

Query  188  vNEFNYGEGNVKARRK------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEI  334
             ++FNY E   + ++       W     +GEDV   +  +  SH  IPLLT+GQ +SGE+
Sbjct  92   ASDFNYSENQEQKQKLAERTLGWNAKYDRGEDVGAPTYDKEISHNHIPLLTSGQEVSGEL  151

Query  335  PLSATPDTQSIRS  373
              +A+P+  S+ S
Sbjct  152  S-AASPERLSMAS  163



>gb|KHG16921.1| Cellulose synthase A catalytic subunit 3 [UDP-forming] [Gossypium 
arboreum]
Length=1064

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 85/133 (64%), Gaps = 13/133 (10%)
 Frame = +2

Query  11   NGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvddl  187
            +GD F+ACN CAFPVCR CYEYERKDGNQ+CPQCKTRYK  KGSP +    +   D DD 
Sbjct  32   DGDPFIACNVCAFPVCRPCYEYERKDGNQSCPQCKTRYKWQKGSPAILGDRETGGDADDG  91

Query  188  vNEFNYGEGNVKARRK------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEI  334
             ++FNY E   + ++       W     +GEDV   +  +  SH  IPLLT+GQ +SGE+
Sbjct  92   ASDFNYSENQEQKQKLAERTLGWNAKYDRGEDVGAPTYDKEISHNHIPLLTSGQEVSGEL  151

Query  335  PLSATPDTQSIRS  373
              +A+P+  S+ S
Sbjct  152  S-AASPERLSMAS  163



>gb|AFZ78557.1| cellulose synthase [Populus tomentosa]
Length=1079

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 87/136 (64%), Gaps = 14/136 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            T +G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRY+R KGSP +    +E+ D D
Sbjct  30   TVDGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYRRHKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D   +FNY   N   ++K       WQ     GED+   +  +  SH  IPL+TNG  +S
Sbjct  90   DGAIDFNYSSENQNQKQKIAERMLSWQMMFGRGEDLGTPNYDKEVSHHHIPLITNGHEVS  149

Query  326  GEIPLSATPDTQSIRS  373
            GE+  +A+P+  S+ S
Sbjct  150  GELS-AASPEHISMAS  164



>gb|ADZ16120.1| cellulose synthase A3 [Gossypium herbaceum subsp. africanum]
Length=1067

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 85/133 (64%), Gaps = 13/133 (10%)
 Frame = +2

Query  11   NGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvddl  187
            +GD F+ACN CAFPVCR CYEYERKDGNQ+CPQCKTRYK  KGSP +    +   D DD 
Sbjct  32   DGDPFIACNVCAFPVCRPCYEYERKDGNQSCPQCKTRYKWQKGSPAILGDRETGGDADDG  91

Query  188  vNEFNYGEGNVKARRK------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEI  334
             ++FNY E   + ++       W     +GEDV   +  +  SH  IPLLT+GQ +SGE+
Sbjct  92   ASDFNYSENQEQKQKLAERTLGWNAKYDRGEDVGAPTYDKEISHNHIPLLTSGQEVSGEL  151

Query  335  PLSATPDTQSIRS  373
              +A+P+  S+ S
Sbjct  152  S-AASPERLSMAS  163



>gb|EPS73573.1| hypothetical protein M569_01183, partial [Genlisea aurea]
Length=1056

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 87/136 (64%), Gaps = 8/136 (6%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTC-YEYERKDGNQACPQCKTRYKRLKGSPRvdgddee---  169
            V+ +GD F ACNEC  P+C+ C YE ERK+GNQ CPQCK +Y+R KG+ RV  D  +   
Sbjct  21   VSESGDAFFACNECGIPLCQYCCYECERKNGNQFCPQCKAKYQRQKGNQRVGSDGYDDEG  80

Query  170  edvddlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQPIPLLTNGQPISGEIPLSAT  349
              VDD  NEF+Y       +  W G D++LS+SS HES  PI LLT+ Q +S +I   + 
Sbjct  81   VVVDDSENEFSYSP---MVKSHWFGGDIELSASSGHESFHPISLLTHEQLVSNDI-YPSI  136

Query  350  PDTQSIRSMSGPLGPG  397
             D+ S+RS SGPL PG
Sbjct  137  QDSDSVRSNSGPLSPG  152



>gb|AEP33539.1| cellulose synthase catalytic subunit [Gossypium turneri]
Length=1067

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 85/133 (64%), Gaps = 13/133 (10%)
 Frame = +2

Query  11   NGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvddl  187
            +GD F+ACN CAFPVCR CYEYERKDGNQ+CPQCKTRYK  KGSP +    +   D DD 
Sbjct  32   DGDPFIACNICAFPVCRRCYEYERKDGNQSCPQCKTRYKWQKGSPAILGDRETGGDADDG  91

Query  188  vNEFNYGEGNVKARRK------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEI  334
             ++FNY E   + ++       W     +GEDV   +  +  SH  IPLLT+GQ +SGE+
Sbjct  92   ASDFNYSENQEQKQKLAERMQGWNAKYGRGEDVGAPTYDKEISHNHIPLLTSGQEVSGEL  151

Query  335  PLSATPDTQSIRS  373
              +A+P+  S+ S
Sbjct  152  S-AASPERLSMAS  163



>gb|AEP33537.1| cellulose synthase catalytic subunit [Gossypium laxum]
Length=1067

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 85/133 (64%), Gaps = 13/133 (10%)
 Frame = +2

Query  11   NGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvddl  187
            +GD F+ACN CAFPVCR CYEYERKDGNQ+CPQCKTRYK  KGSP +    +   D DD 
Sbjct  32   DGDPFIACNICAFPVCRPCYEYERKDGNQSCPQCKTRYKWQKGSPAILGDRETGGDADDG  91

Query  188  vNEFNYGEGNVKARRK------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEI  334
             ++FNY E   + ++       W     +GEDV   +  +  SH  IPLLT+GQ +SGE+
Sbjct  92   ASDFNYSENQEQKQKLAERMQGWNAKYGRGEDVGAPTYDKEISHNHIPLLTSGQEVSGEL  151

Query  335  PLSATPDTQSIRS  373
              +A+P+  S+ S
Sbjct  152  S-AASPERLSMAS  163



>gb|AAT66941.1| CesA2 [Acacia mangium]
Length=1075

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 89/144 (62%), Gaps = 17/144 (12%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            T +G+ F+AC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP +    +E+   D
Sbjct  30   TVDGEPFIACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPAILGDGEEDGVAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++ NY   N   ++K       W       E++   +  +  SH  IPLLTNGQ +S
Sbjct  90   DGTSDLNYDSENQNQKQKISERMLSWHMTYGRTEEIGAPNYDKEVSHNQIPLLTNGQEVS  149

Query  326  GEIPLSATPDTQSIRSMSGPLGPG  397
            GE+  +A+P+     SM+ P GPG
Sbjct  150  GELS-AASPER---LSMASPGGPG  169



>gb|AEP33553.1| cellulose synthase catalytic subunit [Gossypium harknessii]
Length=1067

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 85/133 (64%), Gaps = 13/133 (10%)
 Frame = +2

Query  11   NGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvddl  187
            +GD F+ACN CAFPVCR CYEYERKDGNQ+CPQCKTRYK  KGSP +    +   D DD 
Sbjct  32   DGDPFIACNICAFPVCRPCYEYERKDGNQSCPQCKTRYKWQKGSPAILGDRETGGDADDG  91

Query  188  vNEFNYGEGNVKARRK------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEI  334
             ++FNY E   + ++       W     +GEDV   +  +  SH  IPLLT+GQ +SGE+
Sbjct  92   ASDFNYSENQEQKQKLAERMQGWNAKYGRGEDVGAPTYDKEISHNHIPLLTSGQEVSGEL  151

Query  335  PLSATPDTQSIRS  373
              +A+P+  S+ S
Sbjct  152  S-AASPERLSMAS  163



>gb|AEP33556.1| cellulose synthase catalytic subunit [Gossypium aridum]
 gb|AEP33558.1| cellulose synthase catalytic subunit [Gossypium lobatum]
Length=1067

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 85/133 (64%), Gaps = 13/133 (10%)
 Frame = +2

Query  11   NGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvddl  187
            +GD F+ACN CAFPVCR CYEYERKDGNQ+CPQCKTRYK  KGSP +    +   D DD 
Sbjct  32   DGDPFIACNICAFPVCRPCYEYERKDGNQSCPQCKTRYKWQKGSPAILGDRETGGDADDG  91

Query  188  vNEFNYGEGNVKARRK------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEI  334
             ++FNY E   + ++       W     +GEDV   +  +  SH  IPLLT+GQ +SGE+
Sbjct  92   ASDFNYSENQEQKQKLAERMQGWNAKYGRGEDVGAPTYDKEISHNHIPLLTSGQEVSGEL  151

Query  335  PLSATPDTQSIRS  373
              +A+P+  S+ S
Sbjct  152  S-AASPERLSMAS  163



>gb|ACS94418.1| cellulose synthase A [Leucaena leucocephala]
Length=410

 Score =   107 bits (266),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 85/136 (63%), Gaps = 14/136 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            T +G+ F+AC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP +    +E+   D
Sbjct  30   TVDGEPFIACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPAILGDGEEDGVAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++ NY   N   ++K       WQ      E +   +  +  SH  IPLLT+GQ +S
Sbjct  90   DGASDLNYDSENQDQKQKISERMLSWQMTYGRAEAISAPNYDKEVSHSHIPLLTSGQEVS  149

Query  326  GEIPLSATPDTQSIRS  373
            GE+  +A+P+  S+ S
Sbjct  150  GELS-AASPERLSMAS  164



>gb|AEP33536.1| cellulose synthase catalytic subunit [Gossypium thurberi]
Length=1067

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 85/133 (64%), Gaps = 13/133 (10%)
 Frame = +2

Query  11   NGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvddl  187
            +GD F+ACN CAFPVCR CYEYERKDGNQ+CPQCKTRYK  KGSP +    +   D DD 
Sbjct  32   DGDPFIACNICAFPVCRPCYEYERKDGNQSCPQCKTRYKWQKGSPAILGDRETGGDADDG  91

Query  188  vNEFNYGEGNVKARRK------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEI  334
             ++FNY E   + ++       W     +GEDV   +  +  SH  IPLLT+GQ +SGE+
Sbjct  92   ASDFNYSENQEQKQKLAERMQGWNAKYGRGEDVGAPTYDKEISHNHIPLLTSGQEVSGEL  151

Query  335  PLSATPDTQSIRS  373
              +A+P+  S+ S
Sbjct  152  S-AASPERLSMAS  163



>gb|AEP33552.1| cellulose synthase catalytic subunit [Gossypium armourianum]
Length=1067

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 85/133 (64%), Gaps = 13/133 (10%)
 Frame = +2

Query  11   NGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvddl  187
            +GD F+ACN CAFPVCR CYEYERKDGNQ+CPQCKTRYK  KGSP +    +   D DD 
Sbjct  32   DGDPFIACNICAFPVCRPCYEYERKDGNQSCPQCKTRYKWQKGSPAILGDRETGGDADDG  91

Query  188  vNEFNYGEGNVKARRK------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEI  334
             ++FNY E   + ++       W     +GEDV   +  +  SH  IPLLT+GQ +SGE+
Sbjct  92   ASDFNYSENQEQKQKLAERMQGWNAKYGRGEDVGAPTYDKEISHNHIPLLTSGQEVSGEL  151

Query  335  PLSATPDTQSIRS  373
              +A+P+  S+ S
Sbjct  152  S-AASPERVSMAS  163



>gb|AEP33554.1| cellulose synthase catalytic subunit [Gossypium davidsonii]
 gb|AEP33555.1| cellulose synthase catalytic subunit [Gossypium klotzschianum]
Length=1067

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 85/133 (64%), Gaps = 13/133 (10%)
 Frame = +2

Query  11   NGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvddl  187
            +GD F+ACN CAFPVCR CYEYERKDGNQ+CPQCKTRYK  KGSP +    +   D DD 
Sbjct  32   DGDPFIACNICAFPVCRPCYEYERKDGNQSCPQCKTRYKWQKGSPAILGDRETGGDADDG  91

Query  188  vNEFNYGEGNVKARRK------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEI  334
             ++FNY E   + ++       W     +GEDV   +  +  SH  IPLLT+GQ +SGE+
Sbjct  92   ASDFNYSENQEQKQKLAERMQGWNAKYGRGEDVGAPTYDKEISHNHIPLLTSGQEVSGEL  151

Query  335  PLSATPDTQSIRS  373
              +A+P+  S+ S
Sbjct  152  S-AASPERLSMAS  163



>ref|XP_002314037.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE87992.1| cellulose synthase family protein [Populus trichocarpa]
Length=1079

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 87/136 (64%), Gaps = 14/136 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            T +G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRY+R KGSP +    +E+ D D
Sbjct  30   TVDGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYRRHKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D   +FNY   N   ++K       WQ     GED+   +  +  SH  IPL+TNG  +S
Sbjct  90   DGAIDFNYSSENQNQKQKIAERMLSWQMTFGRGEDLGAPNYDKEVSHNHIPLITNGHEVS  149

Query  326  GEIPLSATPDTQSIRS  373
            GE+  +A+P+  S+ S
Sbjct  150  GELS-AASPEHISMAS  164



>ref|XP_004306536.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Fragaria vesca subsp. vesca]
Length=1083

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 88/142 (62%), Gaps = 14/142 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            TA G+ F+AC+ C+FPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP +    +E+ D D
Sbjct  30   TAAGEPFIACDVCSFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  +EFNY   N   ++K       W      GED+   +  +  SH  IPLLTNG  +S
Sbjct  90   DGASEFNYTSENQNEKQKIAERMLSWHMTYGRGEDIGGPNYDKEVSHNHIPLLTNGTEVS  149

Query  326  GEIPLSATPDTQSIRSMSGPLG  391
            GE+  +A+P   S+ S    +G
Sbjct  150  GELS-AASPGRLSMASPGASIG  170



>ref|NP_001275292.1| cellulose synthase [Solanum tuberosum]
 gb|AAP97495.1| cellulose synthase [Solanum tuberosum]
Length=1083

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 87/142 (61%), Gaps = 15/142 (11%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            T NG+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP +     E+ D D
Sbjct  30   TVNGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPAISGESVEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++ NY   N+  ++K       W      GE+       +  SH  IPLLTNG  +S
Sbjct  90   DGASDLNYSSENLNEKQKVADRVLSWHATYGRGEETGAPKYDKEVSHNHIPLLTNGTDVS  149

Query  326  GEIPLSATPDTQSIRSMSGPLG  391
            GE+  +A+P+  S+ S  GP G
Sbjct  150  GELS-AASPERYSMAS-PGPAG  169



>gb|EPS71230.1| hypothetical protein M569_03522 [Genlisea aurea]
Length=1086

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 85/115 (74%), Gaps = 12/115 (10%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +TA+ ++FVACNECAFPVCRTCYEYER++G+Q CPQC+TRYKR+KGSPRV+GD++E+  D
Sbjct  50   ITADRELFVACNECAFPVCRTCYEYERREGSQCCPQCRTRYKRIKGSPRVEGDEDEDGAD  109

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSS-------SSRHESHQ---PIPLLTNGQ  316
            DL +EF+YG+  ++A R  QG     S+        SRH+S      IPLLT G+
Sbjct  110  DLEHEFDYGD--IEALRYLQGAGATASAHGGRLVVDSRHDSASQTPEIPLLTYGE  162



>gb|ACC59195.1| cellulose synthase [Betula platyphylla]
Length=1084

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 91/137 (66%), Gaps = 15/137 (11%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            T +G+ F+AC++CAFPVCR CYEYER+DGNQ+CPQCKTRYKR KGSP +    +E+ D D
Sbjct  30   TVDGEPFIACDDCAFPVCRPCYEYERRDGNQSCPQCKTRYKRHKGSPAILGDREEDVDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHE-SHQPIPLLTNGQPI  322
            ++ ++FNY   +   ++K       W      GEDV ++ +   E SH  IPLLTNG  +
Sbjct  90   EVASDFNYTSEDQNQKQKIAERMLSWHMTYGRGEDVVVAPTYDKEVSHNHIPLLTNGTEV  149

Query  323  SGEIPLSATPDTQSIRS  373
            SGE+  +A+P+  S+ S
Sbjct  150  SGELS-AASPEHLSMAS  165



>gb|AGV22107.1| cellulose synthase 2 [Betula luminifera]
Length=1084

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 90/137 (66%), Gaps = 15/137 (11%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            T +G+ F+AC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP +    +E+ D D
Sbjct  30   TVDGEPFIACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPAILGDREEDVDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHE-SHQPIPLLTNGQPI  322
            ++ ++FNY   +   ++K       W      GEDV ++ +   E SH  IPLLTNG  +
Sbjct  90   EVASDFNYTSEDQNQKQKIAERMLSWHMTYGRGEDVVVAPTYDKEVSHNHIPLLTNGTEV  149

Query  323  SGEIPLSATPDTQSIRS  373
            SGE+  +A+P+  S+ S
Sbjct  150  SGELS-AASPEHLSMAS  165



>ref|XP_009408434.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Musa acuminata subsp. malaccensis]
Length=1091

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 87/123 (71%), Gaps = 13/123 (11%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T +GD+FVACNECAFP+CRTCYEYER++GNQ CPQCKTR+KRLKG PRV GDDEE+ VD
Sbjct  48   LTVDGDLFVACNECAFPICRTCYEYERREGNQVCPQCKTRFKRLKGCPRVAGDDEEDGVD  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDV-----------DLSSSSRHESHQPIPLLTNGQPISG  328
            DL NEFN+  G+ K   ++  + +           D+++ +   +   +PLLTNG+ +  
Sbjct  108  DLENEFNFVGGH-KQESQYMADAMLQGHMSYGRWGDINAPNMAHNAPQVPLLTNGEMVD-  165

Query  329  EIP  337
            +IP
Sbjct  166  DIP  168



>ref|XP_010257191.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Nelumbo nucifera]
Length=1076

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 85/135 (63%), Gaps = 17/135 (13%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvdd  184
            T +G++F+AC+ CAFPVCR CYEYERKDG Q+CPQCKTRYKR KGSP        + V+D
Sbjct  28   TVSGELFIACDVCAFPVCRPCYEYERKDGTQSCPQCKTRYKRHKGSP----PIRGDPVED  83

Query  185  lvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPISG  328
             +++ +Y  GN   ++K       W      GEDV   +  +  S   IPLLTNGQ +SG
Sbjct  84   DMDDVDYSSGNQDQKQKIAERMLSWHMSYGRGEDVRTPNYDKEVSLNHIPLLTNGQSVSG  143

Query  329  EIPLSATPDTQSIRS  373
            E+  +A+P+  S+ S
Sbjct  144  ELS-AASPERISMAS  157



>ref|XP_006382504.1| cellulose synthase 6 family protein [Populus trichocarpa]
 gb|ERP60301.1| cellulose synthase 6 family protein [Populus trichocarpa]
Length=1084

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 83/124 (67%), Gaps = 18/124 (15%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T +G++FVACNECAFP+CRTCYEYERK+GNQ CPQCKTR+KRLKG  RV GDDEE+  D
Sbjct  48   LTVDGELFVACNECAFPICRTCYEYERKEGNQVCPQCKTRFKRLKGCARVHGDDEEDGTD  107

Query  182  dlvNEFNYGEGNVKARRKWQGE---------DVDLSSSSRHESHQP---IPLLTNGQPIS  325
            DL NEFN+ +G    R   Q           D DL     H+ H P   +PLLTNGQ + 
Sbjct  108  DLENEFNF-DGRNSNRHDMQHHGGPESMLHYDPDLP----HDLHHPLPRVPLLTNGQMVD  162

Query  326  GEIP  337
             +IP
Sbjct  163  -DIP  165



>ref|XP_004229630.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Solanum lycopersicum]
Length=1083

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 86/142 (61%), Gaps = 15/142 (11%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            T NG+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP +     E+ D D
Sbjct  30   TVNGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPAISGESVEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++ NY   N+  ++K       W      GE+       +  SH  IPLLTNG  +S
Sbjct  90   DGASDLNYSSENLNEKQKVADRVLSWHATYGRGEETGAPKYDKEVSHNHIPLLTNGTDVS  149

Query  326  GEIPLSATPDTQSIRSMSGPLG  391
            GE+  +A+P   S+ S  GP G
Sbjct  150  GELS-AASPGRYSMAS-PGPAG  169



>ref|XP_009386450.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Musa acuminata subsp. malaccensis]
 ref|XP_009386451.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Musa acuminata subsp. malaccensis]
Length=1066

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 86/132 (65%), Gaps = 18/132 (14%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvdd  184
            T +GDIFVAC+ C FPVCR CYEYERKDGNQ+CPQCKT+YKR +GSP V G++ ++   D
Sbjct  29   TVDGDIFVACDVCGFPVCRPCYEYERKDGNQSCPQCKTKYKRHRGSPPVRGEEGDDGDAD  88

Query  185  lvNEFNYGEGNVKARRK-------W-----QGEDV---DLSSSSRHESHQPIPLLTNGQP  319
             V++FNY  GN   + K       W     QGED+      S     +H  IPLLT+ Q 
Sbjct  89   DVSDFNYPTGNQDQKPKITERMLGWHMSHEQGEDIGPPKYDSGGIPRNH--IPLLTHSQG  146

Query  320  ISGEIPLSATPD  355
            +SGE+P++ +PD
Sbjct  147  LSGELPMT-SPD  157



>gb|AEK31218.1| cellulose synthase A [Eucalyptus camaldulensis]
Length=1080

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 87/135 (64%), Gaps = 13/135 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            + +G+ FVACN CAFPVCR CYEYERKDGNQ+CPQCKTRYKR +GSP +    +E+ D D
Sbjct  30   SVDGEPFVACNVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHRGSPAILGDQEEDADAD  89

Query  182  dlvNEFNYGEGNVKARR------KW-----QGEDVDLSSSSRHESHQPIPLLTNGQPISG  328
            D V++FNY E     R+       W     Q EDV   +  +  SH  IP LT+GQ +SG
Sbjct  90   DSVSDFNYSENQSLNRKTEERILSWHMQYGQNEDVSAPNYDKEVSHNHIPRLTSGQEVSG  149

Query  329  EIPLSATPDTQSIRS  373
            E+  +A+P+  S+ S
Sbjct  150  ELS-AASPERLSVAS  163



>gb|KDO83418.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
Length=544

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 89/145 (61%), Gaps = 18/145 (12%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            T +G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYK+ KGSP +    +E+ D D
Sbjct  30   TVDGNPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKKHKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       W     QGED          SH  IP LT GQ +S
Sbjct  90   DGASDFNYSSENQNQKQKISERMLSWHMRYGQGEDASAPKYDNEVSHNHIPRLTGGQEVS  149

Query  326  GEIPLSATPDTQSIRSMSGP-LGPG  397
            GE+  +A+P+     SM+ P +GPG
Sbjct  150  GELS-AASPEH---LSMASPGVGPG  170



>ref|XP_011025442.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic 
subunit 3 [UDP-forming]-like [Populus euphratica]
Length=1079

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 87/136 (64%), Gaps = 14/136 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            T +G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRY+R KGSP +    +E+ D D
Sbjct  30   TVDGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYRRHKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       WQ     G D+   +  +  +H  IPL+TNG  +S
Sbjct  90   DGASDFNYSSENQNQKQKIAERMLSWQMTFGRGGDLGAPNYDKEVTHNHIPLITNGHEVS  149

Query  326  GEIPLSATPDTQSIRS  373
            GE+  +A+PD  S+ S
Sbjct  150  GELS-AASPDHISMAS  164



>gb|AEP33559.1| cellulose synthase catalytic subunit [Gossypium trilobum]
Length=1067

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 85/133 (64%), Gaps = 13/133 (10%)
 Frame = +2

Query  11   NGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvddl  187
            +G+ F+ACN CAFPVCR CYEYERKDGNQ+CPQCKTRYK  KGSP +    +   D DD 
Sbjct  32   DGNPFIACNICAFPVCRPCYEYERKDGNQSCPQCKTRYKWQKGSPAILGDRETGGDADDG  91

Query  188  vNEFNYGEGNVKARRK------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEI  334
             ++FNY E   + ++       W     +GEDV   +  +  SH  IPLLT+GQ +SGE+
Sbjct  92   ASDFNYSENQEQKQKLAERMQGWNAKYGRGEDVGAPTYDKEISHNHIPLLTSGQEVSGEL  151

Query  335  PLSATPDTQSIRS  373
              +A+P+  S+ S
Sbjct  152  S-AASPERLSMAS  163



>gb|ABY25277.1| cellulose synthase [Eucalyptus grandis]
Length=1080

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 87/135 (64%), Gaps = 13/135 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            + +G+ FVACN CAFPVCR CYEYERKDGNQ+CPQCKTRYKR +GSP +    +E+ D D
Sbjct  30   SVDGEPFVACNVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHRGSPAILGDQEEDADAD  89

Query  182  dlvNEFNYGEGNVKARR------KW-----QGEDVDLSSSSRHESHQPIPLLTNGQPISG  328
            D V++FNY E     R+       W     Q EDV   +  +  SH  IP LT+GQ +SG
Sbjct  90   DSVSDFNYSENQNLNRKTEERILSWHMQYGQNEDVSAPNYDKEVSHNHIPRLTSGQEVSG  149

Query  329  EIPLSATPDTQSIRS  373
            E+  +A+P+  S+ S
Sbjct  150  ELS-AASPERLSVAS  163



>ref|NP_001289668.1| cellulose synthase A catalytic subunit 3 [UDP-forming]-like [Eucalyptus 
grandis]
 gb|ABY25274.1| cellulose synthase [Eucalyptus grandis]
 gb|KCW66107.1| hypothetical protein EUGRSUZ_G03380 [Eucalyptus grandis]
 gb|KCW66108.1| hypothetical protein EUGRSUZ_G03380 [Eucalyptus grandis]
Length=1080

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 87/135 (64%), Gaps = 13/135 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            + +G+ FVACN CAFPVCR CYEYERKDGNQ+CPQCKTRYKR +GSP +    +E+ D D
Sbjct  30   SVDGEPFVACNVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHRGSPAILGDQEEDADAD  89

Query  182  dlvNEFNYGEGNVKARR------KW-----QGEDVDLSSSSRHESHQPIPLLTNGQPISG  328
            D V++FNY E     R+       W     Q EDV   +  +  SH  IP LT+GQ +SG
Sbjct  90   DSVSDFNYSENQNLNRKTEERILSWHMQYGQNEDVSAPNYDKEVSHNHIPRLTSGQEVSG  149

Query  329  EIPLSATPDTQSIRS  373
            E+  +A+P+  S+ S
Sbjct  150  ELS-AASPERLSVAS  163



>ref|XP_011036833.1| PREDICTED: probable cellulose synthase A catalytic subunit 3 
[UDP-forming] isoform X2 [Populus euphratica]
 ref|XP_011036834.1| PREDICTED: probable cellulose synthase A catalytic subunit 3 
[UDP-forming] isoform X3 [Populus euphratica]
Length=1084

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 83/124 (67%), Gaps = 18/124 (15%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T +G++FVACNECAFP+CRTCYEYERK+GNQ CPQCKTR+KRLKG  RV GD+EE+  D
Sbjct  48   LTVDGELFVACNECAFPICRTCYEYERKEGNQVCPQCKTRFKRLKGCARVHGDEEEDGTD  107

Query  182  dlvNEFNYGEGNVKARRKWQGE---------DVDLSSSSRHESHQP---IPLLTNGQPIS  325
            DL NEFN+ +G    R   Q           D DL     H+ H P   +PLLTNGQ + 
Sbjct  108  DLENEFNF-DGRNSNRHDMQHRGGPESMLHYDPDLP----HDLHHPLPQVPLLTNGQMVD  162

Query  326  GEIP  337
             +IP
Sbjct  163  -DIP  165



>gb|KHN39939.1| Cellulose synthase A catalytic subunit 3 [UDP-forming] [Glycine 
soja]
Length=1073

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 84/137 (61%), Gaps = 13/137 (9%)
 Frame = +2

Query  8    ANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvdd  184
             NGD F+ACN CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP +    +E+   D+
Sbjct  31   VNGDPFIACNVCAFPVCRACYEYERKDGNQSCPQCKTRYKRHKGSPAILGDQEEDGGADE  90

Query  185  lvNEFNYGEGNVKARRK------WQG-----EDVDLSSSSRHESHQPIPLLTNGQPISGE  331
              ++ NY   N   ++K      WQ      E+    +  +  SH  IPLL+ GQ +SGE
Sbjct  91   GASDLNYNSENQNEKQKIERMLGWQMAHGRVEEAVAPNYDKEVSHNHIPLLSGGQEVSGE  150

Query  332  IPLSATPDTQSIRSMSG  382
            +  +A+P+  S+ S  G
Sbjct  151  LS-AASPERLSMASPGG  166



>ref|XP_011036830.1| PREDICTED: probable cellulose synthase A catalytic subunit 6 
[UDP-forming] isoform X1 [Populus euphratica]
 ref|XP_011036831.1| PREDICTED: probable cellulose synthase A catalytic subunit 6 
[UDP-forming] isoform X1 [Populus euphratica]
 ref|XP_011036832.1| PREDICTED: probable cellulose synthase A catalytic subunit 6 
[UDP-forming] isoform X1 [Populus euphratica]
Length=1110

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 80/119 (67%), Gaps = 17/119 (14%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T +G++FVACNECAFP+CRTCYEYERK+GNQ CPQCKTR+KRLKG  RV GD+EE+  D
Sbjct  48   LTVDGELFVACNECAFPICRTCYEYERKEGNQVCPQCKTRFKRLKGCARVHGDEEEDGTD  107

Query  182  dlvNEFNYGEGNVKARRKWQGE---------DVDLSSSSRHESHQP---IPLLTNGQPI  322
            DL NEFN+ +G    R   Q           D DL     H+ H P   +PLLTNGQ +
Sbjct  108  DLENEFNF-DGRNSNRHDMQHRGGPESMLHYDPDLP----HDLHHPLPQVPLLTNGQMV  161



>ref|XP_011087713.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Sesamum indicum]
 ref|XP_011087722.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Sesamum indicum]
Length=1066

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 83/136 (61%), Gaps = 13/136 (10%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T +G+ FVACN CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP + GD EE+   
Sbjct  29   LTVDGEPFVACNVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPAIRGDGEEDGAA  88

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D     ++   N   ++K       W      GEDV      +  SH  IPLLTNG  +S
Sbjct  89   DDDASDHHFSENQNEKQKNSERMLSWHMTYGRGEDVGAPKYDKEVSHTHIPLLTNGTDVS  148

Query  326  GEIPLSATPDTQSIRS  373
            GE+  +A+P   S+ S
Sbjct  149  GELS-AASPGRLSMAS  163



>ref|XP_007148880.1| hypothetical protein PHAVU_005G022100g [Phaseolus vulgaris]
 gb|ESW20874.1| hypothetical protein PHAVU_005G022100g [Phaseolus vulgaris]
Length=1075

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 85/138 (62%), Gaps = 14/138 (10%)
 Frame = +2

Query  8    ANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvdd  184
             +G  F+AC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP +    +E+   DD
Sbjct  32   VDGSSFIACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPAILGDREEDGGADD  91

Query  185  lvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPISG  328
              ++FNY   N   ++K       WQ      EDV   +  +  SH  IP+L+ GQ +SG
Sbjct  92   GASDFNYNSENQNQKQKIAERMLGWQMAYGRAEDVGAPNYDKEVSHNHIPMLSGGQEVSG  151

Query  329  EIPLSATPDTQSIRSMSG  382
            E+  +A+P+  S+ S  G
Sbjct  152  ELS-AASPERLSMASPGG  168



>gb|AFZ78563.1| cellulose synthase [Populus tomentosa]
Length=1083

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 83/124 (67%), Gaps = 18/124 (15%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T +G++FVACNECAFP+CRTCYEYERK+GNQ CPQCKTR+KRLKG  RV GD+EE+  D
Sbjct  48   LTVDGELFVACNECAFPICRTCYEYERKEGNQVCPQCKTRFKRLKGCARVHGDEEEDGTD  107

Query  182  dlvNEFNYGEGNVKARRKWQ---------GEDVDLSSSSRHESHQPI---PLLTNGQPIS  325
            DL NEFN+ +G    R   Q           D DL     H+ H P+   PLLTNGQ + 
Sbjct  108  DLENEFNF-DGRNSNRHGMQHHGGPESMLHHDPDLP----HDLHHPLPQFPLLTNGQMVD  162

Query  326  GEIP  337
             +IP
Sbjct  163  -DIP  165



>gb|AAD39534.2| cellulose synthase catalytic subunit [Gossypium hirsutum]
Length=1067

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 84/133 (63%), Gaps = 13/133 (10%)
 Frame = +2

Query  11   NGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvddl  187
            +GD F+ACN CAFPVCR CYEYERKDGNQ+CPQCKTRYK  KGSP +    +   D DD 
Sbjct  32   DGDPFIACNICAFPVCRPCYEYERKDGNQSCPQCKTRYKWQKGSPAILGDRETGGDADDG  91

Query  188  vNEFNYGEGNVKARRK------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEI  334
             ++F Y E   + ++       W     +GEDV   +  +  SH  IPLLT+GQ +SGE+
Sbjct  92   ASDFIYSENQEQKQKLAERMQGWNAKYGRGEDVGAPTYDKEISHNHIPLLTSGQEVSGEL  151

Query  335  PLSATPDTQSIRS  373
              +A+P+  S+ S
Sbjct  152  S-AASPERLSMAS  163



>gb|AEP33541.1| cellulose synthase catalytic subunit [Gossypium mustelinum]
Length=1067

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 84/133 (63%), Gaps = 13/133 (10%)
 Frame = +2

Query  11   NGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvddl  187
            +GD F+ACN CAFPVCR CYEYERKDGNQ+CPQCKTRYK  KGSP +    +   D DD 
Sbjct  32   DGDPFIACNICAFPVCRPCYEYERKDGNQSCPQCKTRYKWQKGSPAILGDRETGGDADDG  91

Query  188  vNEFNYGEGNVKARRK------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEI  334
             ++F Y E   + ++       W     +GEDV   +  +  SH  IPLLT+GQ +SGE+
Sbjct  92   ASDFIYSENQEQKQKLAERMQGWNAKYGRGEDVGAPTYDKEISHNHIPLLTSGQEVSGEL  151

Query  335  PLSATPDTQSIRS  373
              +A+P+  S+ S
Sbjct  152  S-AASPERLSMAS  163



>ref|XP_003546888.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Glycine max]
Length=1073

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 84/137 (61%), Gaps = 13/137 (9%)
 Frame = +2

Query  8    ANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvdd  184
             NGD F+AC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP +    +E+   D+
Sbjct  31   VNGDPFIACDVCAFPVCRACYEYERKDGNQSCPQCKTRYKRHKGSPAILGDQEEDGGADE  90

Query  185  lvNEFNYGEGNVKARRK------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPISGE  331
              ++ NY   N   ++K      WQ      E+    +  +  SH  IPLL+ GQ +SGE
Sbjct  91   GASDLNYNSENQNEKQKIERMLGWQMAHGRAEEAVAPNYDKEVSHNHIPLLSGGQEVSGE  150

Query  332  IPLSATPDTQSIRSMSG  382
            +  +A+P+  S+ S  G
Sbjct  151  LS-AASPERLSMASPGG  166



>gb|AEP33551.1| cellulose synthase catalytic subunit [Gossypium hirsutum subsp. 
latifolium]
Length=1067

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 84/133 (63%), Gaps = 13/133 (10%)
 Frame = +2

Query  11   NGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvddl  187
            +GD F+ACN CAFPVCR CYEYERKDGNQ+CPQCKTRYK  KGSP +    +   D DD 
Sbjct  32   DGDPFIACNICAFPVCRPCYEYERKDGNQSCPQCKTRYKWQKGSPAILGDRETGGDADDG  91

Query  188  vNEFNYGEGNVKARRK------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEI  334
             ++F Y E   + ++       W     +GEDV   +  +  SH  IPLLT+GQ +SGE+
Sbjct  92   ASDFIYSENQEQKQKLAERMQGWNAKYGRGEDVGAPTYDKEISHNHIPLLTSGQEVSGEL  151

Query  335  PLSATPDTQSIRS  373
              +A+P+  S+ S
Sbjct  152  S-AASPERLSMAS  163



>gb|AEP33545.1| cellulose synthase catalytic subunit [Gossypium tomentosum]
Length=1067

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 84/133 (63%), Gaps = 13/133 (10%)
 Frame = +2

Query  11   NGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvddl  187
            +GD F+ACN CAFPVCR CYEYERKDGNQ+CPQCKTRYK  KGSP +    +   D DD 
Sbjct  32   DGDPFIACNICAFPVCRPCYEYERKDGNQSCPQCKTRYKWQKGSPAILGDRETGGDADDG  91

Query  188  vNEFNYGEGNVKARRK------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEI  334
             ++F Y E   + ++       W     +GEDV   +  +  SH  IPLLT+GQ +SGE+
Sbjct  92   ASDFIYSENQEQKQKLAERMQGWNAKYGRGEDVGAPTYDKEISHNHIPLLTSGQEVSGEL  151

Query  335  PLSATPDTQSIRS  373
              +A+P+  S+ S
Sbjct  152  S-AASPERLSMAS  163



>gb|AEP33547.1| cellulose synthase catalytic subunit [Gossypium barbadense var. 
brasiliense]
 gb|AEP33549.1| cellulose synthase catalytic subunit [Gossypium barbadense var. 
peruvianum]
Length=1066

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 84/133 (63%), Gaps = 13/133 (10%)
 Frame = +2

Query  11   NGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvddl  187
            +GD F+ACN CAFPVCR CYEYERKDGNQ+CPQCKTRYK  KGSP +    +   D DD 
Sbjct  32   DGDPFIACNICAFPVCRPCYEYERKDGNQSCPQCKTRYKWQKGSPAILGDRETGGDADDG  91

Query  188  vNEFNYGEGNVKARRK------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEI  334
             ++F Y E   + ++       W     +GEDV   +  +  SH  IPLLT+GQ +SGE+
Sbjct  92   ASDFIYSENQEQKQKLAERMQGWNAKYGRGEDVGAPTYDKEISHNHIPLLTSGQEVSGEL  151

Query  335  PLSATPDTQSIRS  373
              +A+P+  S+ S
Sbjct  152  S-AASPERLSMAS  163



>gb|KDO83417.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
Length=773

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 89/145 (61%), Gaps = 18/145 (12%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            T +G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYK+ KGSP +    +E+ D D
Sbjct  30   TVDGNPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKKHKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       W     QGED          SH  IP LT GQ +S
Sbjct  90   DGASDFNYSSENQNQKQKISERMLSWHMRYGQGEDASAPKYDNEVSHNHIPRLTGGQEVS  149

Query  326  GEIPLSATPDTQSIRSMSGP-LGPG  397
            GE+  +A+P+     SM+ P +GPG
Sbjct  150  GELS-AASPEH---LSMASPGVGPG  170



>gb|ADZ16119.1| cellulose synthase A3 [Gossypium barbadense]
Length=1067

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 84/133 (63%), Gaps = 13/133 (10%)
 Frame = +2

Query  11   NGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvddl  187
            +GD F+ACN CAFPVCR CYEYERKDGNQ+CPQCKTRYK  KGSP +    +   D DD 
Sbjct  32   DGDPFIACNICAFPVCRPCYEYERKDGNQSCPQCKTRYKWQKGSPAILGDRETGGDADDG  91

Query  188  vNEFNYGEGNVKARRK------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEI  334
             ++F Y E   + ++       W     +GEDV   +  +  SH  IPLLT+GQ +SGE+
Sbjct  92   ASDFIYSENQEQKQKLAERMQGWNAKYGRGEDVGAPTYDKEISHNHIPLLTSGQEVSGEL  151

Query  335  PLSATPDTQSIRS  373
              +A+P+  S+ S
Sbjct  152  S-AASPERLSMAS  163



>gb|ADZ16123.1| cellulose synthase A3 [Gossypium hirsutum]
Length=1067

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 84/133 (63%), Gaps = 13/133 (10%)
 Frame = +2

Query  11   NGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvddl  187
            +GD F+ACN CAFPVCR CYEYERKDGNQ+CPQCKTRYK  KGSP +    +   D DD 
Sbjct  32   DGDPFIACNICAFPVCRPCYEYERKDGNQSCPQCKTRYKWQKGSPAILGDRETGGDADDG  91

Query  188  vNEFNYGEGNVKARRK------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEI  334
             ++F Y E   + ++       W     +GEDV   +  +  SH  IPLLT+GQ +SGE+
Sbjct  92   ASDFIYSENQEQKQKLAERMQGWNAKYGRGEDVGAPTYDKEISHNHIPLLTSGQEVSGEL  151

Query  335  PLSATPDTQSIRS  373
              +A+P+  S+ S
Sbjct  152  S-AASPERLSMAS  163



>ref|XP_006439112.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
 gb|ESR52352.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
Length=773

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 89/145 (61%), Gaps = 18/145 (12%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            T +G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYK+ KGSP +    +E+ D D
Sbjct  30   TVDGNPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKKHKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       W     QGED          SH  IP LT GQ +S
Sbjct  90   DGASDFNYSSENQNQKQKISERMLGWHMRYGQGEDASAPKYDNEVSHNHIPRLTGGQEVS  149

Query  326  GEIPLSATPDTQSIRSMSGP-LGPG  397
            GE+  +A+P+     SM+ P +GPG
Sbjct  150  GELS-AASPEH---LSMASPGVGPG  170



>gb|KDO83415.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
Length=813

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 89/145 (61%), Gaps = 18/145 (12%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            T +G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYK+ KGSP +    +E+ D D
Sbjct  30   TVDGNPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKKHKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       W     QGED          SH  IP LT GQ +S
Sbjct  90   DGASDFNYSSENQNQKQKISERMLSWHMRYGQGEDASAPKYDNEVSHNHIPRLTGGQEVS  149

Query  326  GEIPLSATPDTQSIRSMSGP-LGPG  397
            GE+  +A+P+     SM+ P +GPG
Sbjct  150  GELS-AASPEH---LSMASPGVGPG  170



>gb|KDO83416.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
Length=811

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 89/145 (61%), Gaps = 18/145 (12%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            T +G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYK+ KGSP +    +E+ D D
Sbjct  30   TVDGNPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKKHKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       W     QGED          SH  IP LT GQ +S
Sbjct  90   DGASDFNYSSENQNQKQKISERMLSWHMRYGQGEDASAPKYDNEVSHNHIPRLTGGQEVS  149

Query  326  GEIPLSATPDTQSIRSMSGP-LGPG  397
            GE+  +A+P+     SM+ P +GPG
Sbjct  150  GELS-AASPEH---LSMASPGVGPG  170



>gb|AEP33543.1| cellulose synthase catalytic subunit [Gossypium darwinii]
Length=1067

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 83/133 (62%), Gaps = 13/133 (10%)
 Frame = +2

Query  11   NGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvddl  187
            +GD F+ACN CAFPVCR CYEYERKDGNQ+CPQCKTRYK  KGSP +        D DD 
Sbjct  32   DGDPFIACNICAFPVCRPCYEYERKDGNQSCPQCKTRYKWQKGSPAILGDRGTGGDADDG  91

Query  188  vNEFNYGEGNVKARRK------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPISGEI  334
             ++F Y E   + ++       W     +GEDV   +  +  SH  IPLLT+GQ +SGE+
Sbjct  92   ASDFIYSENQEQKQKLAERMQGWNAKYGRGEDVGAPTYDKEISHNHIPLLTSGQEVSGEL  151

Query  335  PLSATPDTQSIRS  373
              +A+P+  S+ S
Sbjct  152  S-AASPERLSMAS  163



>ref|XP_006439115.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
 gb|ESR52355.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
Length=811

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 89/145 (61%), Gaps = 18/145 (12%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            T +G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYK+ KGSP +    +E+ D D
Sbjct  30   TVDGNPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKKHKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       W     QGED          SH  IP LT GQ +S
Sbjct  90   DGASDFNYSSENQNQKQKISERMLGWHMRYGQGEDASAPKYDNEVSHNHIPRLTGGQEVS  149

Query  326  GEIPLSATPDTQSIRSMSGP-LGPG  397
            GE+  +A+P+     SM+ P +GPG
Sbjct  150  GELS-AASPEH---LSMASPGVGPG  170



>gb|KDO83414.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
Length=850

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 89/145 (61%), Gaps = 18/145 (12%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            T +G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYK+ KGSP +    +E+ D D
Sbjct  30   TVDGNPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKKHKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       W     QGED          SH  IP LT GQ +S
Sbjct  90   DGASDFNYSSENQNQKQKISERMLSWHMRYGQGEDASAPKYDNEVSHNHIPRLTGGQEVS  149

Query  326  GEIPLSATPDTQSIRSMSGP-LGPG  397
            GE+  +A+P+     SM+ P +GPG
Sbjct  150  GELS-AASPEH---LSMASPGVGPG  170



>gb|AGV22108.1| cellulose synthase 6 [Betula luminifera]
Length=1103

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 87/120 (73%), Gaps = 9/120 (8%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T +G++FVACNECAFPVCR CYEYER++GNQACPQCKTRYKR+KGSPRV+GD+EE+D+D
Sbjct  54   ITVDGELFVACNECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDID  113

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDL-----SSSSRHESHQPIPLLTNGQ--PISGEIPL  340
            DL NEF+Y  GN+      +G +  L     S    H +   IP L+  +  P+S EIPL
Sbjct  114  DLDNEFDY--GNLNGLGPQEGAEAMLYSHLNSGRGYHSNASGIPALSAHETSPLSSEIPL  171



>ref|XP_009629755.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana tomentosiformis]
Length=1094

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 87/118 (74%), Gaps = 13/118 (11%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T +G+ FVACNECAFP+CR CYEYER++GNQACPQCKTRYKR+KGSPRV+GD+EE+D+D
Sbjct  50   ITVDGEPFVACNECAFPICRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDID  109

Query  182  dlvNEFNYGEGNVKARRKWQGEDV----------DLSSSSRHESHQP---IPLLTNGQ  316
            D+ +EF+YG G++  +   +   V          + ++SSR +S  P   IPLLT G+
Sbjct  110  DIEHEFDYGVGSLGRQGSGRVPSVYGGSGHAGSYENATSSRQDSSTPGIEIPLLTYGE  167



>gb|ACU87559.2| cellulose synthase [Leucaena leucocephala]
Length=1075

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 85/136 (63%), Gaps = 14/136 (10%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            T +G+ F+AC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYKR KGSP +    +E+   D
Sbjct  30   TVDGEPFIACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKRHKGSPAILGDGEEDGVAD  89

Query  182  dlvNEFNYGEGNVKARRK-------WQ-----GEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++ NY   N   ++K       WQ      E +   +  +  SH  IPLLT+GQ +S
Sbjct  90   DGASDLNYDSENQNQKQKISERMLSWQMTYGRAEAISAPNYDKEVSHSHIPLLTSGQEVS  149

Query  326  GEIPLSATPDTQSIRS  373
            GE+  +A+P+  S+ S
Sbjct  150  GELS-AASPERLSMAS  164



>ref|XP_011023647.1| PREDICTED: probable cellulose synthase A catalytic subunit 3 
[UDP-forming] [Populus euphratica]
 ref|XP_011023648.1| PREDICTED: probable cellulose synthase A catalytic subunit 3 
[UDP-forming] [Populus euphratica]
 ref|XP_011023649.1| PREDICTED: probable cellulose synthase A catalytic subunit 3 
[UDP-forming] [Populus euphratica]
Length=1087

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 86/129 (67%), Gaps = 25/129 (19%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T +G++FVACNECAFP+CRTCYEYER++GNQ CPQCKTR+KRLKG  RV GD+EE+ +D
Sbjct  48   LTVDGELFVACNECAFPICRTCYEYERREGNQVCPQCKTRFKRLKGCARVHGDEEEDGID  107

Query  182  dlvNEFNY--------------GEGNVKARRKWQGEDVDLSSSSRHESHQP---IPLLTN  310
            DL NEFN+              G G  ++ R +   D DL     H+ H P   +PLLTN
Sbjct  108  DLENEFNFDGRNSNRHDMQHHGGLGGPESMRHY---DPDLP----HDLHHPLPQVPLLTN  160

Query  311  GQPISGEIP  337
            GQ +  +IP
Sbjct  161  GQMVD-DIP  168



>ref|XP_006482874.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X1 [Citrus sinensis]
 ref|XP_006482875.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X2 [Citrus sinensis]
 ref|XP_006482876.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X3 [Citrus sinensis]
 ref|XP_006482877.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X4 [Citrus sinensis]
Length=1079

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 89/145 (61%), Gaps = 18/145 (12%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            T +G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYK+ KGSP +    +E+ D D
Sbjct  30   TVDGNPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKKHKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       W     QGED          SH  IP LT GQ +S
Sbjct  90   DGASDFNYSSENQNQKQKISERMLGWHMRYGQGEDASAPKYDNEVSHNHIPRLTGGQEVS  149

Query  326  GEIPLSATPDTQSIRSMSGP-LGPG  397
            GE+  +A+P+     SM+ P +GPG
Sbjct  150  GELS-AASPEH---LSMASPGVGPG  170



>ref|XP_006439113.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
 ref|XP_006439114.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
 gb|ESR52353.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
 gb|ESR52354.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
Length=1079

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 89/145 (61%), Gaps = 18/145 (12%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            T +G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYK+ KGSP +    +E+ D D
Sbjct  30   TVDGNPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKKHKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       W     QGED          SH  IP LT GQ +S
Sbjct  90   DGASDFNYSSENQNQKQKISERMLGWHMRYGQGEDASAPKYDNEVSHNHIPRLTGGQEVS  149

Query  326  GEIPLSATPDTQSIRSMSGP-LGPG  397
            GE+  +A+P+     SM+ P +GPG
Sbjct  150  GELS-AASPEH---LSMASPGVGPG  170



>gb|AAP40636.1| cellulose synthase 6 [Populus tremuloides]
Length=1087

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 80/121 (66%), Gaps = 18/121 (15%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T +G++FVACNECAFP+CRTCYEYER++GNQ CPQCKTR+KRLKG  RV GD+EE+ +D
Sbjct  48   LTVDGEVFVACNECAFPICRTCYEYERREGNQVCPQCKTRFKRLKGCARVHGDEEEDGID  107

Query  182  dlvNEFNYG-----------EGNVKARRKWQGEDVDLSSSSRHESHQP---IPLLTNGQP  319
            DL NEFN+             G +      +  D DL     H+ H P   +PLLTNGQ 
Sbjct  108  DLENEFNFDGRNSNRHDMQHHGGLGGPESMRHYDPDLP----HDLHHPLPQVPLLTNGQM  163

Query  320  I  322
            +
Sbjct  164  V  164



>gb|KDO83412.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
Length=1082

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 89/145 (61%), Gaps = 18/145 (12%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            T +G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYK+ KGSP +    +E+ D D
Sbjct  33   TVDGNPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKKHKGSPAILGDREEDGDAD  92

Query  182  dlvNEFNYGEGNVKARRK-------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       W     QGED          SH  IP LT GQ +S
Sbjct  93   DGASDFNYSSENQNQKQKISERMLSWHMRYGQGEDASAPKYDNEVSHNHIPRLTGGQEVS  152

Query  326  GEIPLSATPDTQSIRSMSGP-LGPG  397
            GE+  +A+P+     SM+ P +GPG
Sbjct  153  GELS-AASPEH---LSMASPGVGPG  173



>gb|ACJ38667.1| cellulose synthase [Betula luminifera]
Length=1093

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 79/120 (66%), Gaps = 9/120 (8%)
 Frame = +2

Query  2    VTANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvdgddeeedvd  181
            +T +G++FVACNECAFP+CRTCYEYER++GNQ CPQCKTR+KRLKG  RV GD+EE+ +D
Sbjct  48   LTVDGELFVACNECAFPICRTCYEYERREGNQVCPQCKTRFKRLKGCARVQGDEEEDGID  107

Query  182  dlvNEFNYGEGNVKARRKWQGEDVDLSSSSRHESHQP--------IPLLTNGQPISGEIP  337
            DL NEFN+     +        D  L      +S  P        +PLLTNGQ +  +IP
Sbjct  108  DLENEFNFDARTKQDMHHALAADAMLHYGRASDSDLPHVIHSTPQVPLLTNGQMVD-DIP  166



>gb|KDO83405.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83406.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83407.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83408.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83409.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83410.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83411.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
Length=1079

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 89/145 (61%), Gaps = 18/145 (12%)
 Frame = +2

Query  5    TANGDIFVACNECAFPVCRTCYEYERKDGNQACPQCKTRYKRLKGSPRvd-gddeeedvd  181
            T +G+ FVAC+ CAFPVCR CYEYERKDGNQ+CPQCKTRYK+ KGSP +    +E+ D D
Sbjct  30   TVDGNPFVACDVCAFPVCRPCYEYERKDGNQSCPQCKTRYKKHKGSPAILGDREEDGDAD  89

Query  182  dlvNEFNYGEGNVKARRK-------W-----QGEDVDLSSSSRHESHQPIPLLTNGQPIS  325
            D  ++FNY   N   ++K       W     QGED          SH  IP LT GQ +S
Sbjct  90   DGASDFNYSSENQNQKQKISERMLSWHMRYGQGEDASAPKYDNEVSHNHIPRLTGGQEVS  149

Query  326  GEIPLSATPDTQSIRSMSGP-LGPG  397
            GE+  +A+P+     SM+ P +GPG
Sbjct  150  GELS-AASPEH---LSMASPGVGPG  170



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554820161530