BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF011A01

Length=475
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007205270.1|  hypothetical protein PRUPE_ppa006473mg             197   6e-58   Prunus persica
gb|KDO45354.1|  hypothetical protein CISIN_1g015298mg                   195   7e-58   Citrus sinensis [apfelsine]
gb|KDO45355.1|  hypothetical protein CISIN_1g015298mg                   196   1e-57   Citrus sinensis [apfelsine]
ref|XP_008246288.1|  PREDICTED: shaggy-related protein kinase alpha     196   1e-57   Prunus mume [ume]
emb|CDP15204.1|  unnamed protein product                                195   4e-57   Coffea canephora [robusta coffee]
gb|KDO45353.1|  hypothetical protein CISIN_1g015298mg                   195   4e-57   Citrus sinensis [apfelsine]
ref|XP_006480288.1|  PREDICTED: shaggy-related protein kinase alp...    195   4e-57   Citrus sinensis [apfelsine]
ref|XP_002280673.1|  PREDICTED: shaggy-related protein kinase alpha     195   4e-57   Vitis vinifera
emb|CAL07991.1|  shaggy/glycogen synthase kinase-3 like protein         185   9e-57   Platanus x hispanica [London plane tree]
ref|XP_004230343.1|  PREDICTED: shaggy-related protein kinase NtK-1     194   1e-56   Solanum lycopersicum
ref|XP_009629200.1|  PREDICTED: shaggy-related protein kinase NtK...    194   1e-56   Nicotiana tomentosiformis
ref|XP_006428242.1|  hypothetical protein CICLE_v10013624mg             194   2e-56   
ref|XP_010276519.1|  PREDICTED: shaggy-related protein kinase alpha     193   2e-56   Nelumbo nucifera [Indian lotus]
ref|XP_010097328.1|  Shaggy-related protein kinase alpha                196   2e-56   
ref|XP_002512564.1|  Glycogen synthase kinase-3 beta, putative          192   2e-56   
ref|XP_006382290.1|  hypothetical protein POPTR_0005s00710g             193   3e-56   Populus trichocarpa [western balsam poplar]
ref|NP_001274855.1|  Shaggy-like protein kinase NtK-1                   192   6e-56   Solanum tuberosum [potatoes]
ref|XP_008388444.1|  PREDICTED: shaggy-related protein kinase alpha     192   8e-56   
ref|XP_010524830.1|  PREDICTED: shaggy-related protein kinase alp...    191   9e-56   Tarenaya hassleriana [spider flower]
ref|XP_011039006.1|  PREDICTED: shaggy-related protein kinase alpha     191   9e-56   Populus euphratica
ref|XP_008363964.1|  PREDICTED: shaggy-related protein kinase alpha     191   1e-55   
ref|XP_009363099.1|  PREDICTED: glycogen synthase kinase-3 homolo...    191   1e-55   Pyrus x bretschneideri [bai li]
ref|XP_009775930.1|  PREDICTED: shaggy-related protein kinase NtK...    190   2e-55   Nicotiana sylvestris
ref|NP_001269276.1|  glycogen synthase kinase-3 homolog MsK-1-like      190   2e-55   Fragaria vesca [alpine strawberry]
ref|XP_004495628.1|  PREDICTED: glycogen synthase kinase-3 homolo...    190   3e-55   
gb|KJB45482.1|  hypothetical protein B456_007G308500                    186   3e-55   Gossypium raimondii
ref|XP_011092192.1|  PREDICTED: shaggy-related protein kinase alpha     190   3e-55   Sesamum indicum [beniseed]
ref|XP_002279596.1|  PREDICTED: shaggy-related protein kinase alp...    190   4e-55   Vitis vinifera
ref|XP_004495625.1|  PREDICTED: glycogen synthase kinase-3 homolo...    190   4e-55   
ref|XP_009366055.1|  PREDICTED: shaggy-related protein kinase alp...    189   5e-55   Pyrus x bretschneideri [bai li]
ref|XP_002874323.1|  hypothetical protein ARALYDRAFT_489503             189   7e-55   
sp|Q40518.1|MSK1_TOBAC  RecName: Full=Shaggy-related protein kina...    189   7e-55   Nicotiana tabacum [American tobacco]
gb|AEQ94156.1|  shaggy-related protein kinase                           183   8e-55   Elaeis guineensis
gb|KDP23349.1|  hypothetical protein JCGZ_23182                         189   8e-55   Jatropha curcas
ref|XP_007051226.1|  Shaggy-related kinase 11, 11 isoform 1             189   9e-55   
gb|KHN16033.1|  Glycogen synthase kinase-3 like MsK-1                   189   9e-55   Glycine soja [wild soybean]
gb|AFH00876.1|  glycogen synthase kinase-3                              189   1e-54   Glycine soja [wild soybean]
ref|XP_007145031.1|  hypothetical protein PHAVU_007G204000g             189   1e-54   Phaseolus vulgaris [French bean]
ref|XP_006588432.1|  PREDICTED: glycogen synthase kinase-3 isofor...    189   1e-54   Glycine max [soybeans]
gb|ACQ91102.1|  glycogen synthase kinase                                189   1e-54   Glycine max [soybeans]
ref|XP_002302794.1|  Glycogen synthase kinase-3 MsK-3 family protein    188   1e-54   Populus trichocarpa [western balsam poplar]
gb|KJB49765.1|  hypothetical protein B456_008G136600                    188   1e-54   Gossypium raimondii
gb|KHG00969.1|  Glycogen synthase kinase-3 MsK-3                        188   1e-54   Gossypium arboreum [tree cotton]
ref|XP_011087526.1|  PREDICTED: shaggy-related protein kinase NtK...    188   1e-54   Sesamum indicum [beniseed]
gb|AEQ94143.1|  putative Glycogen synthase kinase 3                     183   2e-54   Elaeis guineensis
ref|XP_006289925.1|  hypothetical protein CARUB_v10003541mg             188   2e-54   Capsella rubella
gb|KJB45480.1|  hypothetical protein B456_007G308500                    186   2e-54   Gossypium raimondii
ref|XP_008343189.1|  PREDICTED: glycogen synthase kinase-3 homolo...    187   2e-54   
ref|XP_008381452.1|  PREDICTED: glycogen synthase kinase-3 homolo...    187   3e-54   
ref|XP_009335521.1|  PREDICTED: shaggy-related protein kinase alpha     187   4e-54   Pyrus x bretschneideri [bai li]
ref|XP_009757512.1|  PREDICTED: shaggy-related protein kinase NtK-1     187   4e-54   Nicotiana sylvestris
ref|XP_006841582.1|  hypothetical protein AMTR_s00003p00196730          187   5e-54   Amborella trichopoda
ref|XP_008353866.1|  PREDICTED: glycogen synthase kinase-3 homolo...    186   6e-54   Malus domestica [apple tree]
ref|XP_009617298.1|  PREDICTED: shaggy-related protein kinase NtK-1     186   7e-54   Nicotiana tomentosiformis
ref|XP_002319468.1|  Glycogen synthase kinase-3 MsK-1 family protein    186   9e-54   Populus trichocarpa [western balsam poplar]
gb|ABK93098.1|  unknown                                                 186   1e-53   Populus trichocarpa [western balsam poplar]
gb|ABB55385.1|  Ser/Thr protein kinase-like                             186   1e-53   Solanum tuberosum [potatoes]
ref|XP_007221484.1|  hypothetical protein PRUPE_ppa006462mg             186   1e-53   Prunus persica
ref|NP_001242661.1|  glycogen synthase kinase-3                         186   2e-53   
gb|KJB45479.1|  hypothetical protein B456_007G308500                    186   2e-53   Gossypium raimondii
ref|XP_006394905.1|  hypothetical protein EUTSA_v10004319mg             185   2e-53   Eutrema salsugineum [saltwater cress]
ref|XP_003555781.1|  PREDICTED: glycogen synthase kinase-3 homolo...    185   3e-53   Glycine max [soybeans]
gb|KCW84977.1|  hypothetical protein EUGRSUZ_B01797                     182   3e-53   Eucalyptus grandis [rose gum]
ref|XP_008227813.1|  PREDICTED: glycogen synthase kinase-3 homolo...    184   5e-53   Prunus mume [ume]
gb|ACJ83284.1|  unknown                                                 177   7e-53   Medicago truncatula
ref|XP_006840718.1|  hypothetical protein AMTR_s00096p00102520          182   7e-53   
ref|XP_011023844.1|  PREDICTED: shaggy-related protein kinase alpha     184   8e-53   Populus euphratica
ref|XP_010270906.1|  PREDICTED: shaggy-related protein kinase alp...    184   9e-53   Nelumbo nucifera [Indian lotus]
gb|KHG02936.1|  Shaggy-related protein kinase alpha                     183   9e-53   Gossypium arboreum [tree cotton]
ref|XP_011003165.1|  PREDICTED: shaggy-related protein kinase alp...    183   1e-52   Populus euphratica
ref|XP_011040636.1|  PREDICTED: shaggy-related protein kinase alp...    183   1e-52   Populus euphratica
ref|XP_010270905.1|  PREDICTED: shaggy-related protein kinase alp...    184   2e-52   Nelumbo nucifera [Indian lotus]
gb|KDO86865.1|  hypothetical protein CISIN_1g015632mg                   180   2e-52   Citrus sinensis [apfelsine]
ref|XP_010910596.1|  PREDICTED: shaggy-related protein kinase alp...    182   2e-52   Elaeis guineensis
ref|XP_010070089.1|  PREDICTED: shaggy-related protein kinase alp...    182   2e-52   
ref|XP_010070081.1|  PREDICTED: shaggy-related protein kinase alp...    182   2e-52   Eucalyptus grandis [rose gum]
ref|XP_010921357.1|  PREDICTED: shaggy-related protein kinase alpha     182   2e-52   
gb|ABY60447.1|  serine/threonine protein kinase                         182   2e-52   Adonis aestivalis var. palaestina
ref|NP_001242406.1|  uncharacterized protein LOC100788612               182   2e-52   
ref|XP_006576226.1|  PREDICTED: uncharacterized protein LOC100788...    182   3e-52   
ref|XP_003554602.1|  PREDICTED: shaggy-related protein kinase alp...    182   3e-52   Glycine max [soybeans]
ref|XP_010674528.1|  PREDICTED: shaggy-related protein kinase alpha     182   3e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002515218.1|  Glycogen synthase kinase-3 beta, putative          182   3e-52   Ricinus communis
ref|XP_007031229.1|  Shaggy-related kinase 11, 11 isoform 1             182   4e-52   
ref|XP_010091400.1|  Glycogen synthase kinase-3-MsK-3-like protein      182   4e-52   Morus notabilis
ref|XP_011079505.1|  PREDICTED: shaggy-related protein kinase alp...    182   5e-52   Sesamum indicum [beniseed]
ref|XP_010042192.1|  PREDICTED: shaggy-related protein kinase alpha     181   7e-52   Eucalyptus grandis [rose gum]
ref|XP_008781189.1|  PREDICTED: shaggy-related protein kinase alp...    181   9e-52   Phoenix dactylifera
gb|KDO86864.1|  hypothetical protein CISIN_1g015632mg                   179   9e-52   Citrus sinensis [apfelsine]
ref|XP_006444574.1|  hypothetical protein CICLE_v10020852mg             179   1e-51   
ref|XP_004148581.1|  PREDICTED: glycogen synthase kinase-3 homolo...    181   1e-51   Cucumis sativus [cucumbers]
ref|XP_010493927.1|  PREDICTED: shaggy-related protein kinase alp...    180   2e-51   Camelina sativa [gold-of-pleasure]
ref|NP_568486.1|  Shaggy-related protein kinase alpha                   180   2e-51   Arabidopsis thaliana [mouse-ear cress]
emb|CAA04265.1|  shaggy-like kinase alpha                               180   2e-51   Arabidopsis thaliana [mouse-ear cress]
emb|CAA53181.1|  shaggy related kinase                                  180   2e-51   Arabidopsis thaliana [mouse-ear cress]
emb|CAN64359.1|  hypothetical protein VITISV_041427                     180   3e-51   Vitis vinifera
ref|XP_010038314.1|  PREDICTED: shaggy-related protein kinase alp...    179   4e-51   Eucalyptus grandis [rose gum]
ref|XP_006444573.1|  hypothetical protein CICLE_v10020852mg             179   4e-51   
ref|XP_010421531.1|  PREDICTED: shaggy-related protein kinase alp...    179   5e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010941497.1|  PREDICTED: shaggy-related protein kinase alpha     179   5e-51   
ref|XP_004135570.1|  PREDICTED: shaggy-related protein kinase alp...    179   5e-51   Cucumis sativus [cucumbers]
ref|XP_004163362.1|  PREDICTED: shaggy-related protein kinase alp...    179   6e-51   
ref|XP_008450520.1|  PREDICTED: shaggy-related protein kinase NtK-1     179   6e-51   Cucumis melo [Oriental melon]
gb|KDP28311.1|  hypothetical protein JCGZ_14082                         179   7e-51   Jatropha curcas
dbj|BAD95892.1|  Ser/Thr protein kinase                                 178   8e-51   Lotus japonicus
gb|AES82237.2|  glycogen synthase kinase                                177   1e-50   Medicago truncatula
sp|P51139.2|MSK3_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...    178   1e-50   Medicago sativa [alfalfa]
emb|CAA48472.1|  protein kinase                                         178   1e-50   Medicago sativa [alfalfa]
gb|AAM62970.1|  shaggy related protein kinase ASK-GAMMA                 177   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008793304.1|  PREDICTED: shaggy-related protein kinase alp...    177   2e-50   
ref|XP_010455024.1|  PREDICTED: shaggy-related protein kinase alp...    177   2e-50   Camelina sativa [gold-of-pleasure]
gb|ACJ85178.1|  unknown                                                 177   2e-50   Medicago truncatula
ref|XP_007031230.1|  Shaggy-related kinase 11, 11 isoform 2             177   2e-50   
emb|CDY19757.1|  BnaA09g04100D                                          177   3e-50   Brassica napus [oilseed rape]
gb|KHN00229.1|  Glycogen synthase kinase-3 like MsK-3                   180   3e-50   Glycine soja [wild soybean]
ref|XP_003626019.1|  Protein kinase, putative                           177   3e-50   
ref|XP_009383704.1|  PREDICTED: shaggy-related protein kinase alpha     177   3e-50   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX87033.1|  BnaC09g03480D                                          177   3e-50   
gb|AFK38277.1|  unknown                                                 177   3e-50   Medicago truncatula
ref|XP_010251221.1|  PREDICTED: shaggy-related protein kinase eps...    175   4e-50   Nelumbo nucifera [Indian lotus]
ref|XP_011466950.1|  PREDICTED: glycogen synthase kinase-3 homolo...    177   4e-50   Fragaria vesca subsp. vesca
ref|XP_003591238.1|  Glycogen synthase kinase                           177   4e-50   Medicago truncatula
ref|XP_008778092.1|  PREDICTED: shaggy-related protein kinase alp...    176   4e-50   Phoenix dactylifera
ref|XP_003626020.1|  Protein kinase, putative                           177   5e-50   
sp|P51137.1|MSK1_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...    176   7e-50   Medicago sativa [alfalfa]
ref|XP_006408022.1|  hypothetical protein EUTSA_v10020835mg             176   8e-50   Eutrema salsugineum [saltwater cress]
ref|XP_010251218.1|  PREDICTED: shaggy-related protein kinase eps...    176   8e-50   Nelumbo nucifera [Indian lotus]
dbj|BAJ34573.1|  unnamed protein product                                176   8e-50   Eutrema halophilum
ref|XP_006408021.1|  hypothetical protein EUTSA_v10020835mg             176   8e-50   Eutrema salsugineum [saltwater cress]
ref|XP_010546768.1|  PREDICTED: shaggy-related protein kinase alpha     176   9e-50   Tarenaya hassleriana [spider flower]
ref|NP_187235.1|  Shaggy-related protein kinase gamma                   176   1e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882438.1|  hypothetical protein ARALYDRAFT_477878             175   1e-49   
ref|XP_010251217.1|  PREDICTED: shaggy-related protein kinase eps...    175   1e-49   Nelumbo nucifera [Indian lotus]
ref|XP_009111716.1|  PREDICTED: shaggy-related protein kinase alp...    175   2e-49   Brassica rapa
ref|XP_010660896.1|  PREDICTED: shaggy-related protein kinase eps...    175   2e-49   Vitis vinifera
ref|XP_010938176.1|  PREDICTED: shaggy-related protein kinase alp...    174   2e-49   Elaeis guineensis
ref|XP_006588497.1|  PREDICTED: uncharacterized protein LOC100817...    174   3e-49   Glycine max [soybeans]
ref|XP_008812956.1|  PREDICTED: shaggy-related protein kinase alp...    174   4e-49   Phoenix dactylifera
ref|XP_003518657.1|  PREDICTED: glycogen synthase kinase-3 homolo...    174   4e-49   Glycine max [soybeans]
emb|CDX80585.1|  BnaC07g28590D                                          173   6e-49   
ref|XP_009384996.1|  PREDICTED: shaggy-related protein kinase alp...    173   6e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009134851.1|  PREDICTED: shaggy-related protein kinase gamma     173   9e-49   Brassica rapa
ref|XP_010679446.1|  PREDICTED: shaggy-related protein kinase NtK-1     173   1e-48   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU38392.1|  hypothetical protein MIMGU_mgv1a007572mg                172   1e-48   Erythranthe guttata [common monkey flower]
ref|XP_006299606.1|  hypothetical protein CARUB_v10015785mg             172   2e-48   Capsella rubella
emb|CDY49981.1|  BnaC03g34380D                                          172   3e-48   Brassica napus [oilseed rape]
ref|XP_004494455.1|  PREDICTED: glycogen synthase kinase-3 homolo...    171   3e-48   
ref|XP_010432712.1|  PREDICTED: shaggy-related protein kinase gam...    171   4e-48   Camelina sativa [gold-of-pleasure]
gb|EYU46859.1|  hypothetical protein MIMGU_mgv1a007395mg                171   4e-48   Erythranthe guttata [common monkey flower]
ref|XP_009384446.1|  PREDICTED: shaggy-related protein kinase alp...    171   6e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010486058.1|  PREDICTED: shaggy-related protein kinase gam...    171   7e-48   Camelina sativa [gold-of-pleasure]
gb|ABG74911.1|  AtSK12-like protein                                     171   9e-48   Brassica napus [oilseed rape]
ref|XP_009401663.1|  PREDICTED: shaggy-related protein kinase gamma     170   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS63877.1|  hypothetical protein M569_10905                         170   1e-47   Genlisea aurea
ref|XP_010464137.1|  PREDICTED: shaggy-related protein kinase gamma     170   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_009403747.1|  PREDICTED: shaggy-related protein kinase alp...    170   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009151155.1|  PREDICTED: shaggy-related protein kinase alpha     169   2e-47   Brassica rapa
emb|CDY27737.1|  BnaA05g31460D                                          171   2e-47   Brassica napus [oilseed rape]
ref|XP_010492276.1|  PREDICTED: shaggy-related protein kinase eps...    169   5e-47   Camelina sativa [gold-of-pleasure]
ref|XP_009382471.1|  PREDICTED: shaggy-related protein kinase alp...    168   5e-47   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY05202.1|  BnaC05g46010D                                          168   8e-47   
ref|XP_010248490.1|  PREDICTED: shaggy-related protein kinase eps...    168   8e-47   Nelumbo nucifera [Indian lotus]
gb|AAB61055.1|  Similar to shaggy related protein kinase. Belongs...    169   8e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009386339.1|  PREDICTED: shaggy-related protein kinase alp...    168   9e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010420109.1|  PREDICTED: shaggy-related protein kinase eps...    168   1e-46   Camelina sativa [gold-of-pleasure]
gb|KGN65982.1|  hypothetical protein Csa_1G560660                       167   1e-46   Cucumis sativus [cucumbers]
ref|XP_006650852.1|  PREDICTED: shaggy-related protein kinase alp...    167   1e-46   Oryza brachyantha
ref|XP_006287860.1|  hypothetical protein CARUB_v10001087mg             167   1e-46   
ref|XP_009147201.1|  PREDICTED: shaggy-related protein kinase gamma     167   2e-46   Brassica rapa
ref|XP_006643997.1|  PREDICTED: shaggy-related protein kinase alp...    166   5e-46   Oryza brachyantha
emb|CAB87631.1|  protein kinase MSK-3-like                              166   5e-46   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196968.2|  Shaggy-related protein kinase 13                      166   5e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010453592.1|  PREDICTED: shaggy-related protein kinase eps...    166   6e-46   Camelina sativa [gold-of-pleasure]
ref|XP_006399977.1|  hypothetical protein EUTSA_v10013689mg             166   6e-46   Eutrema salsugineum [saltwater cress]
emb|CDX70574.1|  BnaC03g06580D                                          164   2e-45   
emb|CDM82575.1|  unnamed protein product                                164   3e-45   Triticum aestivum [Canadian hard winter wheat]
dbj|BAF36565.1|  Shaggy-like kinase                                     164   3e-45   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002873682.1|  kinase family protein                              164   3e-45   
gb|EMT32435.1|  Glycogen synthase kinase-3-MsK-3-like protein           164   4e-45   
ref|XP_003566380.1|  PREDICTED: shaggy-related protein kinase alpha     163   5e-45   Brachypodium distachyon [annual false brome]
ref|XP_009334099.1|  PREDICTED: shaggy-related protein kinase eps...    163   7e-45   Pyrus x bretschneideri [bai li]
emb|CDX78587.1|  BnaA03g04990D                                          163   8e-45   
gb|EPS73818.1|  hypothetical protein M569_00937                         162   1e-44   Genlisea aurea
ref|XP_009382470.1|  PREDICTED: shaggy-related protein kinase alp...    162   1e-44   
ref|XP_008666944.1|  PREDICTED: glycogen synthase kinase-3 homolo...    154   1e-44   
ref|XP_004495878.1|  PREDICTED: glycogen synthase kinase-3 homolo...    162   1e-44   Cicer arietinum [garbanzo]
ref|XP_009131419.1|  PREDICTED: shaggy-related protein kinase eps...    160   9e-44   Brassica rapa
ref|NP_001042602.1|  Os01g0252100                                       159   1e-43   
tpg|DAA52173.1|  TPA: putative glycogen synthase kinase family pr...    154   2e-43   
gb|AES61591.2|  glycogen synthase kinase                                159   2e-43   Medicago truncatula
ref|XP_003591340.1|  Glycogen synthase kinase-3-like protein            159   2e-43   
ref|XP_010550142.1|  PREDICTED: shaggy-related protein kinase eps...    159   3e-43   Tarenaya hassleriana [spider flower]
ref|XP_011087528.1|  PREDICTED: shaggy-related protein kinase alp...    158   3e-43   Sesamum indicum [beniseed]
sp|P51138.1|MSK2_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...    158   4e-43   Medicago sativa [alfalfa]
tpg|DAA53953.1|  TPA: putative glycogen synthase kinase family pr...    155   6e-43   
ref|XP_002455378.1|  hypothetical protein SORBIDRAFT_03g009580          157   6e-43   Sorghum bicolor [broomcorn]
ref|XP_009759533.1|  PREDICTED: shaggy-related protein kinase eps...    157   6e-43   Nicotiana sylvestris
ref|XP_009598967.1|  PREDICTED: shaggy-related protein kinase eps...    157   6e-43   Nicotiana tomentosiformis
tpg|DAA52172.1|  TPA: putative glycogen synthase kinase family pr...    154   8e-43   
ref|XP_004967857.1|  PREDICTED: shaggy-related protein kinase alp...    157   9e-43   Setaria italica
gb|AFW79696.1|  putative glycogen synthase kinase family protein        156   2e-42   
tpg|DAA53950.1|  TPA: putative glycogen synthase kinase family pr...    155   2e-42   
ref|NP_001148880.1|  glycogen synthase kinase-3 MsK-3                   156   2e-42   
ref|XP_007215466.1|  hypothetical protein PRUPE_ppa006497mg             156   3e-42   
ref|XP_008230580.1|  PREDICTED: shaggy-related protein kinase eps...    156   3e-42   Prunus mume [ume]
ref|XP_007031506.1|  Shaggy-like kinase 13 isoform 3                    155   3e-42   
ref|XP_007031504.1|  Shaggy-like kinase 13 isoform 1                    155   4e-42   
tpg|DAA53951.1|  TPA: putative glycogen synthase kinase family pr...    155   4e-42   
ref|NP_001150105.1|  LOC100283734                                       155   4e-42   Zea mays [maize]
emb|CAA58594.1|  Petunia Shaggy kinase 4                                155   5e-42   Petunia x hybrida [garden petunia]
tpg|DAA53952.1|  TPA: putative glycogen synthase kinase family pr...    156   5e-42   
ref|XP_006364003.1|  PREDICTED: shaggy-related protein kinase eps...    155   5e-42   Solanum tuberosum [potatoes]
ref|XP_008672929.1|  PREDICTED: LOC100283734 isoform X1                 155   6e-42   Zea mays [maize]
ref|XP_004252661.1|  PREDICTED: shaggy-related protein kinase eps...    155   7e-42   Solanum lycopersicum
ref|XP_010108792.1|  Shaggy-related protein kinase epsilon              160   8e-42   
ref|XP_002987888.1|  GSK3/shaggy-like protein kinase                    154   1e-41   Selaginella moellendorffii
gb|EPS68300.1|  hypothetical protein M569_06467                         154   1e-41   Genlisea aurea
emb|CBI39647.3|  unnamed protein product                                153   2e-41   Vitis vinifera
ref|XP_008357735.1|  PREDICTED: shaggy-related protein kinase eps...    154   2e-41   
ref|XP_004252662.1|  PREDICTED: shaggy-related protein kinase eps...    153   3e-41   Solanum lycopersicum
gb|EMT09676.1|  Shaggy-related protein kinase alpha                     153   4e-41   
dbj|BAJ99594.1|  predicted protein                                      153   4e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AEN14336.1|  hypothetical protein rf1-C1-g7                          153   4e-41   Zea mays [maize]
ref|XP_010660897.1|  PREDICTED: shaggy-related protein kinase eps...    152   4e-41   
gb|EMS62368.1|  Shaggy-related protein kinase alpha                     153   6e-41   Triticum urartu
gb|KDO66111.1|  hypothetical protein CISIN_1g0141741mg                  146   2e-40   Citrus sinensis [apfelsine]
ref|XP_004304635.1|  PREDICTED: shaggy-related protein kinase eps...    151   2e-40   Fragaria vesca subsp. vesca
emb|CDP02094.1|  unnamed protein product                                151   2e-40   Coffea canephora [robusta coffee]
ref|XP_011097427.1|  PREDICTED: shaggy-related protein kinase eps...    150   3e-40   Sesamum indicum [beniseed]
emb|CBI37005.3|  unnamed protein product                                150   3e-40   Vitis vinifera
gb|KDO66112.1|  hypothetical protein CISIN_1g0141741mg                  147   3e-40   Citrus sinensis [apfelsine]
gb|KDO66115.1|  hypothetical protein CISIN_1g0141741mg                  146   3e-40   Citrus sinensis [apfelsine]
gb|EYU34726.1|  hypothetical protein MIMGU_mgv1a007335mg                150   6e-40   Erythranthe guttata [common monkey flower]
emb|CDX78658.1|  BnaA03g05700D                                          151   7e-40   
ref|XP_006446534.1|  hypothetical protein CICLE_v10015323mg             149   1e-39   Citrus clementina [clementine]
ref|XP_004232308.1|  PREDICTED: shaggy-related protein kinase eps...    149   1e-39   Solanum lycopersicum
ref|XP_006470301.1|  PREDICTED: shaggy-related protein kinase eps...    149   1e-39   Citrus sinensis [apfelsine]
gb|EYU34725.1|  hypothetical protein MIMGU_mgv1a007335mg                149   2e-39   Erythranthe guttata [common monkey flower]
ref|XP_006338577.1|  PREDICTED: shaggy-related protein kinase eps...    148   2e-39   Solanum tuberosum [potatoes]
ref|XP_006338576.1|  PREDICTED: shaggy-related protein kinase eps...    148   3e-39   Solanum tuberosum [potatoes]
ref|XP_006654010.1|  PREDICTED: shaggy-related protein kinase alp...    148   3e-39   
gb|KDO86034.1|  hypothetical protein CISIN_1g011138mg                   144   4e-39   Citrus sinensis [apfelsine]
gb|KDO86031.1|  hypothetical protein CISIN_1g011138mg                   148   8e-39   Citrus sinensis [apfelsine]
gb|EMS49677.1|  Glycogen synthase kinase-3-like protein MsK-3           147   1e-38   Triticum urartu
ref|XP_002991115.1|  hypothetical protein SELMODRAFT_451471             147   1e-38   Selaginella moellendorffii
ref|XP_003569078.1|  PREDICTED: shaggy-related protein kinase alp...    146   1e-38   Brachypodium distachyon [annual false brome]
ref|XP_004960405.1|  PREDICTED: shaggy-related protein kinase alp...    146   1e-38   Setaria italica
gb|AAQ23107.1|  shaggy-related protein kinase 2                         146   2e-38   Physcomitrella patens
ref|XP_001763265.1|  predicted protein                                  145   2e-38   
gb|KDO86033.1|  hypothetical protein CISIN_1g011138mg                   144   3e-38   Citrus sinensis [apfelsine]
ref|XP_008443540.1|  PREDICTED: shaggy-related protein kinase eps...    145   4e-38   Cucumis melo [Oriental melon]
gb|AFW57486.1|  putative glycogen synthase kinase family protein        143   5e-38   
ref|XP_007140965.1|  hypothetical protein PHAVU_008G156000g             144   6e-38   Phaseolus vulgaris [French bean]
ref|XP_009124961.1|  PREDICTED: shaggy-related protein kinase gam...    144   7e-38   Brassica rapa
ref|XP_002440537.1|  hypothetical protein SORBIDRAFT_09g002710          144   8e-38   Sorghum bicolor [broomcorn]
ref|XP_004164819.1|  PREDICTED: shaggy-related protein kinase eps...    144   1e-37   
gb|KGN59685.1|  hypothetical protein Csa_3G838640                       143   1e-37   Cucumis sativus [cucumbers]
ref|XP_004141099.1|  PREDICTED: shaggy-related protein kinase eps...    143   1e-37   
ref|XP_008662920.1|  PREDICTED: shaggy-related protein kinase alp...    143   1e-37   
gb|AAQ23108.1|  shaggy-related protein kinase 3                         144   1e-37   Physcomitrella patens
ref|XP_001781582.1|  predicted protein                                  144   1e-37   
ref|NP_001288361.1|  uncharacterized protein LOC103641344               143   2e-37   Zea mays [maize]
ref|XP_003567575.1|  PREDICTED: shaggy-related protein kinase alp...    143   2e-37   Brachypodium distachyon [annual false brome]
gb|ABG29426.1|  GSK-like kinase 1                                       143   2e-37   Aegilops speltoides
ref|XP_006445137.1|  hypothetical protein CICLE_v10020026mg             144   2e-37   
emb|CDP17018.1|  unnamed protein product                                142   2e-37   Coffea canephora [robusta coffee]
gb|ABC94949.1|  GSK-like kinase                                         142   3e-37   Aegilops tauschii
ref|XP_001781586.1|  predicted protein                                  142   3e-37   
gb|ABG29424.1|  GSK-like kinase 1D                                      142   4e-37   Triticum aestivum [Canadian hard winter wheat]
gb|AAT85177.1|  putative glycogen synthase kinase                       141   4e-37   Oryza sativa Japonica Group [Japonica rice]
gb|AAQ23111.1|  shaggy-related protein kinase 1                         142   5e-37   Physcomitrella patens
ref|XP_001763270.1|  predicted protein                                  142   5e-37   
gb|EAY96448.1|  hypothetical protein OsI_18343                          142   6e-37   Oryza sativa Indica Group [Indian rice]
gb|ABR16348.1|  unknown                                                 142   7e-37   Picea sitchensis
emb|CDY18828.1|  BnaAnng02930D                                          141   7e-37   Brassica napus [oilseed rape]
ref|XP_010278583.1|  PREDICTED: shaggy-related protein kinase eps...    142   9e-37   Nelumbo nucifera [Indian lotus]
ref|NP_001054564.1|  Os05g0134000                                       140   1e-36   
ref|XP_009340624.1|  PREDICTED: shaggy-related protein kinase the...    141   1e-36   Pyrus x bretschneideri [bai li]
ref|XP_001765207.1|  predicted protein                                  141   1e-36   
gb|AAY98510.1|  glycogen synthase kinase                                140   1e-36   
gb|ACJ85100.1|  unknown                                                 137   2e-36   
ref|XP_008383272.1|  PREDICTED: shaggy-related protein kinase theta     141   2e-36   
ref|XP_008344049.1|  PREDICTED: shaggy-related protein kinase eps...    140   2e-36   
ref|XP_007218957.1|  hypothetical protein PRUPE_ppa003552mg             141   2e-36   
gb|AAQ23109.1|  shaggy-related protein kinase 4                         140   3e-36   
ref|XP_001762052.1|  predicted protein                                  140   3e-36   
gb|ABC94947.1|  GSK-like kinase                                         139   3e-36   
ref|XP_010090625.1|  Shaggy-related protein kinase theta                140   4e-36   
ref|XP_006375323.1|  hypothetical protein POPTR_0014s07120g             139   4e-36   
ref|XP_004967591.1|  PREDICTED: shaggy-related protein kinase alp...    139   4e-36   
ref|XP_010255499.1|  PREDICTED: shaggy-related protein kinase eps...    140   5e-36   
ref|XP_008385705.1|  PREDICTED: shaggy-related protein kinase the...    140   5e-36   
ref|XP_006375322.1|  shaggy-related protein kinase theta                139   5e-36   
ref|XP_010255498.1|  PREDICTED: shaggy-related protein kinase eps...    140   6e-36   
gb|ABG29422.1|  GSK-like kinase 1A                                      139   6e-36   
ref|XP_011035087.1|  PREDICTED: shaggy-related protein kinase theta     139   7e-36   
ref|XP_002320754.2|  hypothetical protein POPTR_0014s07120g             139   7e-36   
ref|XP_003591341.1|  Glycogen synthase kinase-3-like protein            138   1e-35   
gb|ABG29423.1|  GSK-like kinase 1B                                      138   1e-35   
ref|XP_008232743.1|  PREDICTED: shaggy-related protein kinase the...    139   2e-35   
gb|AFK37839.1|  unknown                                                 137   2e-35   
gb|ACJ84453.1|  unknown                                                 137   2e-35   
ref|XP_002511803.1|  Glycogen synthase kinase-3 beta, putative          138   2e-35   
gb|ACU17807.1|  unknown                                                 132   2e-35   
ref|XP_007051908.1|  Shaggy-like protein kinase 32 isoform 1            138   3e-35   
gb|KJB22348.1|  hypothetical protein B456_004G042400                    137   4e-35   
ref|XP_002272112.1|  PREDICTED: shaggy-related protein kinase theta     137   4e-35   
ref|XP_007134960.1|  hypothetical protein PHAVU_010G090200g             137   4e-35   
emb|CAA11862.1|  shaggy kinase 7                                        137   4e-35   
gb|AFK41443.1|  unknown                                                 132   5e-35   
gb|KJB22347.1|  hypothetical protein B456_004G042400                    137   5e-35   
ref|XP_009131508.1|  PREDICTED: shaggy-related protein kinase eps...    135   6e-35   
emb|CDP08875.1|  unnamed protein product                                137   6e-35   
ref|XP_011093165.1|  PREDICTED: shaggy-related protein kinase alpha     136   9e-35   
ref|XP_002301334.1|  hypothetical protein POPTR_0002s15640g             135   1e-34   
ref|XP_003528879.1|  PREDICTED: shaggy-related protein kinase the...    136   1e-34   
ref|XP_008460173.1|  PREDICTED: shaggy-related protein kinase theta     136   1e-34   
gb|EMT29598.1|  Shaggy-related protein kinase theta                     136   1e-34   
gb|KDP28680.1|  hypothetical protein JCGZ_14451                         135   1e-34   
gb|AFN42826.1|  GSK3-like protein                                       134   2e-34   
tpg|DAA50519.1|  TPA: putative glycogen synthase kinase family pr...    132   3e-34   
ref|XP_007051909.1|  Shaggy-like protein kinase 32 isoform 2            134   4e-34   
ref|XP_003521276.1|  PREDICTED: shaggy-related protein kinase theta     134   4e-34   
gb|KHN27286.1|  Shaggy-related protein kinase theta                     134   5e-34   
ref|XP_007051910.1|  Shaggy-like protein kinase 32 isoform 3            134   5e-34   
ref|XP_004168158.1|  PREDICTED: shaggy-related protein kinase the...    134   5e-34   
ref|XP_004144981.1|  PREDICTED: shaggy-related protein kinase the...    134   5e-34   
ref|XP_004306833.1|  PREDICTED: shaggy-related protein kinase the...    134   5e-34   
ref|XP_011091732.1|  PREDICTED: shaggy-related protein kinase alp...    134   8e-34   
ref|XP_003574217.1|  PREDICTED: shaggy-related protein kinase alp...    134   9e-34   
ref|XP_009773710.1|  PREDICTED: shaggy-related protein kinase eps...    133   1e-33   
emb|CAA05329.1|  shaggy-like kinase 59                                  133   1e-33   
ref|XP_004229833.1|  PREDICTED: shaggy-related protein kinase eps...    133   2e-33   
ref|XP_002465046.1|  hypothetical protein SORBIDRAFT_01g031220          133   2e-33   
ref|XP_004510856.1|  PREDICTED: shaggy-related protein kinase the...    133   2e-33   
gb|KDO86866.1|  hypothetical protein CISIN_1g015632mg                   131   2e-33   
ref|XP_006382289.1|  hypothetical protein POPTR_0005s00710g             132   3e-33   
ref|XP_010493929.1|  PREDICTED: shaggy-related protein kinase alp...    131   3e-33   
ref|XP_010251219.1|  PREDICTED: shaggy-related protein kinase eps...    131   4e-33   
dbj|BAD95891.1|  Ser/Thr protein kinase                                 132   4e-33   
gb|KHN26183.1|  Glycogen synthase kinase-3 like MsK-1                   130   4e-33   
ref|XP_010919260.1|  PREDICTED: shaggy-related protein kinase NtK...    131   5e-33   
ref|XP_003534597.1|  PREDICTED: shaggy-related protein kinase theta     131   5e-33   
gb|EEC67328.1|  hypothetical protein OsI_34360                          132   5e-33   
ref|XP_006644095.1|  PREDICTED: glycogen synthase kinase-3 homolo...    131   5e-33   
ref|XP_010671733.1|  PREDICTED: shaggy-related protein kinase eps...    131   5e-33   
ref|XP_010652295.1|  PREDICTED: shaggy-related protein kinase alp...    130   7e-33   
emb|CAC08564.1|  wound-induced GSK-3-like protein                       131   7e-33   
ref|XP_011023409.1|  PREDICTED: shaggy-related protein kinase the...    130   8e-33   
ref|XP_010919259.1|  PREDICTED: shaggy-related protein kinase eps...    131   8e-33   
gb|EYU32069.1|  hypothetical protein MIMGU_mgv1a006024mg                131   8e-33   
ref|XP_011023410.1|  PREDICTED: shaggy-related protein kinase the...    130   1e-32   
ref|XP_011023408.1|  PREDICTED: shaggy-related protein kinase NtK...    130   1e-32   
ref|XP_003623822.1|  Shaggy-related protein kinase                      130   1e-32   
ref|XP_007139956.1|  hypothetical protein PHAVU_008G072800g             130   1e-32   
emb|CAA05328.1|  shaggy-like kinase 111                                 130   1e-32   
ref|XP_006588498.1|  PREDICTED: uncharacterized protein LOC100817...    129   1e-32   
ref|XP_006339456.1|  PREDICTED: shaggy-related protein kinase the...    130   1e-32   
ref|XP_009610982.1|  PREDICTED: shaggy-related protein kinase eps...    130   1e-32   
gb|AAT81407.1|  shaggy-related protein kinase 6                         130   1e-32   
emb|CAA58595.1|  Petunia Shaggy kinase 6                                130   1e-32   
gb|KEH18946.1|  shaggy-like kinase                                      130   2e-32   
ref|XP_003552357.1|  PREDICTED: shaggy-related protein kinase the...    130   2e-32   
dbj|BAO02525.1|  predicted Shaggy-like kinase ortholog                  129   2e-32   
gb|KHN00323.1|  Glycogen synthase kinase-3 like MsK-2                   129   2e-32   
emb|CAA11861.1|  shaggy kinase 6                                        129   2e-32   
ref|XP_009790920.1|  PREDICTED: shaggy-related protein kinase eps...    129   3e-32   
ref|XP_009602858.1|  PREDICTED: shaggy-related protein kinase eps...    129   3e-32   
emb|CAA11860.1|  shaggy-like kinase 91                                  129   3e-32   
gb|ABR68632.1|  RIM11-like protein                                      129   3e-32   
ref|XP_010456251.1|  PREDICTED: shaggy-related protein kinase theta     129   3e-32   
gb|KHN29413.1|  Shaggy-related protein kinase theta                     129   4e-32   
dbj|BAJ93751.1|  predicted protein                                      129   4e-32   
ref|XP_008799540.1|  PREDICTED: shaggy-related protein kinase alp...    129   4e-32   
gb|ABR17117.1|  unknown                                                 128   5e-32   
ref|XP_008799541.1|  PREDICTED: shaggy-related protein kinase alp...    129   5e-32   
gb|ABK24428.1|  unknown                                                 129   5e-32   
gb|KJB41235.1|  hypothetical protein B456_007G096100                    128   5e-32   
ref|NP_001065093.1|  Os10g0521700                                       128   6e-32   
gb|KCW84976.1|  hypothetical protein EUGRSUZ_B01797                     127   6e-32   
ref|XP_010427333.1|  PREDICTED: shaggy-related protein kinase the...    128   7e-32   
gb|KJB41237.1|  hypothetical protein B456_007G096100                    128   7e-32   
gb|KJB41234.1|  hypothetical protein B456_007G096100                    128   8e-32   
gb|ABC94948.1|  GSK-like kinase                                         127   1e-31   
ref|NP_001141576.1|  uncharacterized protein LOC100273692               126   1e-31   
gb|AAM77397.1|  GSK-like kinase                                         127   1e-31   
ref|NP_001242506.1|  uncharacterized protein LOC100817819               126   2e-31   
ref|XP_006661970.1|  PREDICTED: shaggy-related protein kinase the...    127   2e-31   
emb|CDY07202.1|  BnaCnng02170D                                          127   2e-31   
gb|ABK24355.1|  unknown                                                 126   2e-31   
ref|XP_006289072.1|  hypothetical protein CARUB_v10002475mg             127   2e-31   
ref|XP_004983886.1|  PREDICTED: LOW QUALITY PROTEIN: shaggy-relat...    127   2e-31   
emb|CDX91895.1|  BnaC03g31970D                                          127   2e-31   
sp|O04160.2|KSGT_BRANA  RecName: Full=Shaggy-related protein kina...    127   3e-31   
gb|KCW78018.1|  hypothetical protein EUGRSUZ_D02249                     126   3e-31   
gb|ABD97992.1|  glycogen synthase kinase                                125   3e-31   
ref|XP_003591339.1|  Glycogen synthase kinase-3-like protein            125   3e-31   
ref|XP_002872933.1|  hypothetical protein ARALYDRAFT_490498             126   4e-31   
ref|XP_010419626.1|  PREDICTED: shaggy-related protein kinase the...    124   4e-31   
gb|ABK24513.1|  unknown                                                 126   4e-31   
ref|XP_010940878.1|  PREDICTED: shaggy-related protein kinase eps...    126   4e-31   
ref|XP_004492676.1|  PREDICTED: shaggy-related protein kinase the...    126   4e-31   
ref|XP_010053665.1|  PREDICTED: shaggy-related protein kinase eps...    126   5e-31   
ref|NP_001042804.1|  Os01g0296100                                       125   5e-31   
emb|CDX74346.1|  BnaA03g27010D                                          125   6e-31   
ref|XP_009134534.1|  PREDICTED: shaggy-related protein kinase theta     125   6e-31   
ref|NP_191981.1|  Shaggy-related protein kinase theta                   125   6e-31   
ref|XP_010933863.1|  PREDICTED: shaggy-related protein kinase eps...    125   7e-31   
ref|XP_008660602.1|  PREDICTED: shaggy-related protein kinase alp...    125   1e-30   
ref|XP_006858581.1|  hypothetical protein AMTR_s00071p00186380          125   1e-30   
ref|XP_002526438.1|  conserved hypothetical protein                     119   2e-30   
ref|XP_006396267.1|  hypothetical protein EUTSA_v10028631mg             124   3e-30   
gb|KHG02100.1|  Shaggy-related protein kinase theta                     123   3e-30   
ref|XP_009393923.1|  PREDICTED: shaggy-related protein kinase eps...    123   4e-30   
ref|XP_009393922.1|  PREDICTED: shaggy-related protein kinase eps...    123   4e-30   
gb|KHG02099.1|  Shaggy-related protein kinase theta                     123   4e-30   
gb|KJB24673.1|  hypothetical protein B456_004G156700                    123   5e-30   
gb|KJB24670.1|  hypothetical protein B456_004G156700                    122   5e-30   
gb|KJB24671.1|  hypothetical protein B456_004G156700                    123   6e-30   
gb|KJB24672.1|  hypothetical protein B456_004G156700                    122   6e-30   
ref|XP_010523040.1|  PREDICTED: shaggy-related protein kinase theta     122   7e-30   
ref|XP_007025343.1|  Kinase superfamily protein isoform 2               122   7e-30   
ref|XP_001784146.1|  predicted protein                                  122   9e-30   
ref|XP_008795404.1|  PREDICTED: shaggy-related protein kinase the...    122   1e-29   
ref|XP_009111468.1|  PREDICTED: shaggy-related protein kinase theta     122   1e-29   
ref|XP_010556679.1|  PREDICTED: shaggy-related protein kinase alp...    121   2e-29   
ref|XP_008803035.1|  PREDICTED: shaggy-related protein kinase eps...    121   2e-29   
ref|XP_008803034.1|  PREDICTED: shaggy-related protein kinase eps...    121   2e-29   
gb|KFK30649.1|  hypothetical protein AALP_AA6G009500                    121   2e-29   
ref|NP_180655.1|  Shaggy-related protein kinase zeta                    120   2e-29   
gb|AAM65084.1|  putative shaggy-like protein kinase dzeta               120   2e-29   
emb|CAA64408.1|  shaggy-like kinase dzeta                               120   3e-29   
gb|KHG20282.1|  Shaggy-related protein kinase theta                     120   3e-29   
ref|XP_010245513.1|  PREDICTED: shaggy-related protein kinase kap...    120   3e-29   
ref|NP_001190762.1|  Shaggy-related protein kinase eta                  119   3e-29   
ref|XP_010245511.1|  PREDICTED: shaggy-related protein kinase kap...    120   3e-29   
ref|XP_010100748.1|  Shaggy-related protein kinase eta                  119   3e-29   
emb|CBI22011.3|  unnamed protein product                                120   3e-29   
gb|KDP21116.1|  hypothetical protein JCGZ_21587                         120   4e-29   
ref|XP_010255500.1|  PREDICTED: shaggy-related protein kinase the...    120   4e-29   
gb|KHN34245.1|  Shaggy-related protein kinase zeta                      120   4e-29   
gb|EPS67477.1|  shaggy kinase 7                                         120   4e-29   
gb|KDO77888.1|  hypothetical protein CISIN_1g016950mg                   119   4e-29   
ref|XP_010657061.1|  PREDICTED: shaggy-related protein kinase eta...    120   5e-29   
dbj|BAJ33611.1|  unnamed protein product                                119   5e-29   
ref|XP_006449527.1|  hypothetical protein CICLE_v10015608mg             119   5e-29   
emb|CAA64409.1|  shaggy-like kinase etha                                119   5e-29   
emb|CDY51144.1|  BnaA09g51790D                                          120   5e-29   
ref|XP_006467630.1|  PREDICTED: shaggy-related protein kinase eta...    119   5e-29   
ref|XP_009412822.1|  PREDICTED: shaggy-related protein kinase alp...    120   6e-29   
gb|AAL77705.1|  AT4g18710/F28A21_120                                    119   6e-29   
gb|ACJ84778.1|  unknown                                                 113   6e-29   
gb|ACJ85155.1|  unknown                                                 115   6e-29   
ref|XP_002870026.1|  hypothetical protein ARALYDRAFT_914806             119   6e-29   
ref|NP_193606.1|  Shaggy-related protein kinase eta                     119   7e-29   
ref|XP_008657609.1|  PREDICTED: shaggy-related protein kinase alp...    120   7e-29   
emb|CDP15948.1|  unnamed protein product                                119   1e-28   
ref|XP_003633016.1|  PREDICTED: shaggy-related protein kinase eta...    119   1e-28   
ref|XP_009141120.1|  PREDICTED: shaggy-related protein kinase zeta      119   1e-28   
ref|XP_009412821.1|  PREDICTED: shaggy-related protein kinase alp...    119   1e-28   
ref|XP_010686226.1|  PREDICTED: shaggy-related protein kinase eta       119   1e-28   
ref|XP_009801781.1|  PREDICTED: shaggy-related protein kinase eta...    119   1e-28   
gb|ABG74917.1|  BIN2-like protein                                       119   1e-28   
ref|XP_009132133.1|  PREDICTED: shaggy-related protein kinase eta       118   1e-28   
ref|XP_007041206.1|  Shaggy-like protein kinase 41 isoform 3            117   1e-28   
ref|XP_010671741.1|  PREDICTED: shaggy-related protein kinase the...    118   2e-28   
ref|XP_006294432.1|  hypothetical protein CARUB_v10023447mg             118   2e-28   
gb|KHN33940.1|  Shaggy-related protein kinase zeta                      118   2e-28   
ref|XP_007132829.1|  hypothetical protein PHAVU_011G128000g             118   2e-28   
ref|XP_009136953.1|  PREDICTED: shaggy-related protein kinase eta...    118   2e-28   
ref|XP_004149276.1|  PREDICTED: shaggy-related protein kinase zet...    118   2e-28   
ref|XP_008448253.1|  PREDICTED: shaggy-related protein kinase eta...    118   2e-28   
gb|KFK31745.1|  hypothetical protein AALP_AA6G153600                    118   2e-28   
ref|XP_002522231.1|  Glycogen synthase kinase-3 beta, putative          118   2e-28   
ref|XP_006468992.1|  PREDICTED: shaggy-related protein kinase zet...    118   2e-28   
gb|ADE76936.1|  unknown                                                 118   2e-28   
ref|XP_002881146.1|  hypothetical protein ARALYDRAFT_902112             118   2e-28   
gb|KDP42457.1|  hypothetical protein JCGZ_00254                         118   3e-28   
ref|XP_007048726.1|  GSK3/SHAGGY-like protein kinase 1 isoform 2        117   3e-28   
gb|KDO63405.1|  hypothetical protein CISIN_1g014750mg                   117   3e-28   
gb|KJB34904.1|  hypothetical protein B456_006G089400                    117   3e-28   
ref|XP_009593779.1|  PREDICTED: shaggy-related protein kinase eta...    118   3e-28   
ref|XP_010529205.1|  PREDICTED: shaggy-related protein kinase eta...    117   3e-28   
gb|KDO63403.1|  hypothetical protein CISIN_1g014750mg                   117   3e-28   
ref|XP_006348884.1|  PREDICTED: shaggy-related protein kinase zet...    118   3e-28   
gb|KJB34905.1|  hypothetical protein B456_006G089400                    117   3e-28   
ref|XP_007041204.1|  Shaggy-like protein kinase 41 isoform 1            117   3e-28   
gb|KHG20434.1|  Shaggy-related protein kinase eta                       117   3e-28   
ref|XP_004243275.1|  PREDICTED: shaggy-related protein kinase eta...    117   4e-28   
ref|XP_010540275.1|  PREDICTED: shaggy-related protein kinase the...    118   4e-28   
ref|XP_011047893.1|  PREDICTED: shaggy-related protein kinase kappa     114   4e-28   
gb|KJB34903.1|  hypothetical protein B456_006G089400                    116   4e-28   
gb|ABR17316.1|  unknown                                                 117   4e-28   
ref|XP_007048725.1|  SHAGGY-related protein kinase dZeta isoform 1      117   4e-28   
ref|XP_004240041.1|  PREDICTED: shaggy-related protein kinase eps...    117   4e-28   
gb|KJB34902.1|  hypothetical protein B456_006G089400                    117   4e-28   
ref|XP_010469777.1|  PREDICTED: shaggy-related protein kinase zet...    117   4e-28   
ref|XP_010689734.1|  PREDICTED: shaggy-related protein kinase eta       117   5e-28   
ref|XP_006446814.1|  hypothetical protein CICLE_v10015375mg             117   5e-28   
ref|XP_006389512.1|  hypothetical protein POPTR_0022s00480g             114   5e-28   



>ref|XP_007205270.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 ref|XP_007205271.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 ref|XP_007205272.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 gb|EMJ06469.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 gb|EMJ06470.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 gb|EMJ06471.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
Length=410

 Score =   197 bits (501),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/106 (89%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVGV P SG+RE SGH VGVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGVAPTSGLREPSGHAVGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>gb|KDO45354.1| hypothetical protein CISIN_1g015298mg [Citrus sinensis]
Length=353

 Score =   195 bits (496),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVGV P S +RESSGHTVGVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGVAPTSCVRESSGHTVGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AERIVG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQ  106



>gb|KDO45355.1| hypothetical protein CISIN_1g015298mg [Citrus sinensis]
Length=371

 Score =   196 bits (497),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVGV P S +RESSGHTVGVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGVAPTSCVRESSGHTVGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AERIVG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_008246288.1| PREDICTED: shaggy-related protein kinase alpha [Prunus mume]
 ref|XP_008246289.1| PREDICTED: shaggy-related protein kinase alpha [Prunus mume]
 ref|XP_008246290.1| PREDICTED: shaggy-related protein kinase alpha [Prunus mume]
Length=410

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVGV P SG+RE SGH VGVD LPEE+NDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGVAPTSGLREPSGHAVGVDKLPEELNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>emb|CDP15204.1| unnamed protein product [Coffea canephora]
Length=409

 Score =   195 bits (496),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVGV P SG+RESS H VGVD LPEEMNDMKIRDDK++EA +VDGNGTE GHIIVTTI
Sbjct  1    MASVGVAPTSGLRESSAHVVGVDRLPEEMNDMKIRDDKEVEATIVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>gb|KDO45353.1| hypothetical protein CISIN_1g015298mg [Citrus sinensis]
Length=409

 Score =   195 bits (495),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVGV P S +RESSGHTVGVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGVAPTSCVRESSGHTVGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AERIVG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_006480288.1| PREDICTED: shaggy-related protein kinase alpha-like [Citrus sinensis]
Length=409

 Score =   195 bits (495),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVGV P S +RESSGHTVGVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGVAPTSCVRESSGHTVGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AERIVG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_002280673.1| PREDICTED: shaggy-related protein kinase alpha [Vitis vinifera]
Length=409

 Score =   195 bits (495),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P SG+RE SGH  GVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGIAPTSGLREPSGHNAGVDRLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>emb|CAL07991.1| shaggy/glycogen synthase kinase-3 like protein [Platanus x acerifolia]
Length=109

 Score =   185 bits (469),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV V P SG+RE SG+ V VD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVSVVPTSGLREPSGNGVAVDRLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQ ISY+AER+VGHGSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQAISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQ  106



>ref|XP_004230343.1| PREDICTED: shaggy-related protein kinase NtK-1 [Solanum lycopersicum]
Length=409

 Score =   194 bits (492),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P SG+RESSGH  GVD LPEEMNDM+IRDDK+MEAA+VDGNGTE GHIIVTTI
Sbjct  1    MASVGLAPTSGLRESSGHNAGVDRLPEEMNDMRIRDDKEMEAAIVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_009629200.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
tomentosiformis]
 ref|XP_009629201.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
tomentosiformis]
Length=409

 Score =   194 bits (492),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P SG+RESSGH  GVD LPEEMNDM+IRDDK+MEAA+VDGNGTE GHIIVTTI
Sbjct  1    MASVGLAPTSGLRESSGHNAGVDRLPEEMNDMRIRDDKEMEAAIVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_006428242.1| hypothetical protein CICLE_v10013624mg [Citrus clementina]
 gb|ESR41482.1| hypothetical protein CICLE_v10013624mg [Citrus clementina]
Length=453

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVGV P S +RESSGHTVGVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGVAPTSCVRESSGHTVGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AERIVG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_010276519.1| PREDICTED: shaggy-related protein kinase alpha [Nelumbo nucifera]
 ref|XP_010276520.1| PREDICTED: shaggy-related protein kinase alpha [Nelumbo nucifera]
Length=409

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVGV P SG+RE+SG  VGVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGVVPTSGLRETSGSNVGVDRLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_010097328.1| Shaggy-related protein kinase alpha [Morus notabilis]
 gb|EXB67560.1| Shaggy-related protein kinase alpha [Morus notabilis]
Length=522

 Score =   196 bits (498),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 93/106 (88%), Positives = 97/106 (92%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVGV PA G RE SGH  GVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGVAPA-GAREPSGHAAGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  59

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  60   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  105



>ref|XP_002512564.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
 gb|EEF50016.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
Length=383

 Score =   192 bits (488),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 100/106 (94%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVGV P +G+RE+SGH VGVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGVAP-TGLREASGHNVGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  59

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  60   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  105



>ref|XP_006382290.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 ref|XP_006382291.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 ref|XP_006382292.1| Glycogen synthase kinase-3 MsK-1 family protein [Populus trichocarpa]
 gb|ERP60087.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 gb|ERP60088.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 gb|ERP60089.1| Glycogen synthase kinase-3 MsK-1 family protein [Populus trichocarpa]
Length=409

 Score =   193 bits (490),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            M SVGV P+SG+RE+S H  GVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MGSVGVAPSSGLREASAHNAGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|NP_001274855.1| Shaggy-like protein kinase NtK-1 [Solanum tuberosum]
 ref|XP_006344811.1| PREDICTED: shaggy-related protein kinase NtK-1 [Solanum tuberosum]
 gb|ABB87119.1| NtK-1-like [Solanum tuberosum]
Length=409

 Score =   192 bits (487),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P SG+RESSGH  GVD LPEEMNDM+IRDDK+MEA +VDGNGTE GHIIVTTI
Sbjct  1    MASVGLAPTSGLRESSGHNAGVDRLPEEMNDMRIRDDKEMEATIVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_008388444.1| PREDICTED: shaggy-related protein kinase alpha [Malus domestica]
 ref|XP_008388445.1| PREDICTED: shaggy-related protein kinase alpha [Malus domestica]
 ref|XP_008388446.1| PREDICTED: shaggy-related protein kinase alpha [Malus domestica]
Length=412

 Score =   192 bits (487),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 100/108 (93%), Gaps = 2/108 (2%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEA--AVVDGNGTEAGHIIVT  330
            MASVGV P SG+RE SGH VGVD LPEEMNDMKIRDDK+ME+  AVVDGNGTE GHIIVT
Sbjct  1    MASVGVAPTSGVREPSGHAVGVDKLPEEMNDMKIRDDKEMESTVAVVDGNGTEXGHIIVT  60

Query  331  TIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TIGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   TIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  108



>ref|XP_010524830.1| PREDICTED: shaggy-related protein kinase alpha-like [Tarenaya 
hassleriana]
Length=409

 Score =   191 bits (486),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P SG R+S+GH  GVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGLAPTSGARDSTGHASGVDRLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_011039006.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039008.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039009.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039010.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039011.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
Length=409

 Score =   191 bits (486),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            M SVGV P+SG+RE+S H  GVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MGSVGVAPSSGLREASVHNAGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_008363964.1| PREDICTED: shaggy-related protein kinase alpha [Malus domestica]
Length=406

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 99/108 (92%), Gaps = 2/108 (2%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEA--AVVDGNGTEAGHIIVT  330
            MASVGV P SG RE SGH VGVD LPEEMNDMKIRDDK+ME+  AVVDGNGTE GHIIVT
Sbjct  1    MASVGVAPTSGRREPSGHAVGVDKLPEEMNDMKIRDDKEMESTVAVVDGNGTETGHIIVT  60

Query  331  TIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TIGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   TIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  108



>ref|XP_009363099.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 [Pyrus x 
bretschneideri]
Length=409

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV V PASG+RE SG+ VGVD+LP EMNDMKIRDDK+MEA VV+GNGTEAGHIIVTTI
Sbjct  1    MASVSVVPASGLREPSGNAVGVDNLPNEMNDMKIRDDKEMEATVVNGNGTEAGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGLVFQAKCLETGETVAIKKVLQ  106



>ref|XP_009775930.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
sylvestris]
 ref|XP_009775931.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
sylvestris]
Length=409

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P SG+RESSGH  GVD LPEEMNDM+IRDDK+MEAA+VDGNGTE GHIIVTTI
Sbjct  1    MASVGLAPTSGLRESSGHNAGVDRLPEEMNDMRIRDDKEMEAAIVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQ KQTISY+AER+VG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQAKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|NP_001269276.1| glycogen synthase kinase-3 homolog MsK-1-like [Fragaria vesca]
 ref|XP_011465886.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X1 [Fragaria vesca subsp. vesca]
 ref|XP_011465887.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X1 [Fragaria vesca subsp. vesca]
 gb|AEH02865.1| protein kinase [Fragaria vesca]
Length=412

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 99/108 (92%), Gaps = 2/108 (2%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAV--VDGNGTEAGHIIVT  330
            MASVGV P +G+RE SGH VGVD LPEEMNDMKIRDDK+MEA V  VDGNGTE GHIIVT
Sbjct  1    MASVGVVPTAGLREPSGHAVGVDKLPEEMNDMKIRDDKEMEATVTVVDGNGTETGHIIVT  60

Query  331  TIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TIGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   TIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  108



>ref|XP_004495628.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X4 [Cicer arietinum]
Length=410

 Score =   190 bits (483),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 99/107 (93%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTV-GVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            MASVGV P SG+RE+SGH   GVD LPEEMNDMKIRDD++MEA VVDGNGTE GHIIVTT
Sbjct  1    MASVGVAPTSGLRETSGHAAAGVDRLPEEMNDMKIRDDREMEATVVDGNGTETGHIIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  107



>gb|KJB45482.1| hypothetical protein B456_007G308500 [Gossypium raimondii]
Length=275

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 98/106 (92%), Gaps = 2/106 (2%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P SG+RESS  T GV+ LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGMVPTSGLRESS--TAGVEKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  58

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  59   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  104



>ref|XP_011092192.1| PREDICTED: shaggy-related protein kinase alpha [Sesamum indicum]
Length=409

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P SG+RE+  H VGVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGIAPNSGLREAGSHAVGVDRLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AERIVG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_002279596.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Vitis 
vinifera]
 emb|CAN75652.1| hypothetical protein VITISV_017659 [Vitis vinifera]
Length=409

 Score =   190 bits (482),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV + PASG+RE +G+TVGVD LP+EMNDMKIRDDK+ME  VVDGNGTE GHIIVTTI
Sbjct  1    MASVSIAPASGLREPNGNTVGVDRLPDEMNDMKIRDDKEMEDTVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_004495625.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004495626.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X2 [Cicer arietinum]
 ref|XP_004495627.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X3 [Cicer arietinum]
Length=434

 Score =   190 bits (483),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 99/107 (93%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTV-GVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            MASVGV P SG+RE+SGH   GVD LPEEMNDMKIRDD++MEA VVDGNGTE GHIIVTT
Sbjct  1    MASVGVAPTSGLRETSGHAAAGVDRLPEEMNDMKIRDDREMEATVVDGNGTETGHIIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  107



>ref|XP_009366055.1| PREDICTED: shaggy-related protein kinase alpha-like [Pyrus x 
bretschneideri]
 ref|XP_009366056.1| PREDICTED: shaggy-related protein kinase alpha-like [Pyrus x 
bretschneideri]
Length=412

 Score =   189 bits (481),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 98/108 (91%), Gaps = 2/108 (2%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEA--AVVDGNGTEAGHIIVT  330
            MASVGV P S  RE SGH VGVD LPEEMNDMKIRDDK+ME+  AVVDGNGTE GHIIVT
Sbjct  1    MASVGVAPTSSRREPSGHVVGVDKLPEEMNDMKIRDDKEMESTVAVVDGNGTETGHIIVT  60

Query  331  TIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TIGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   TIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  108



>ref|XP_002874323.1| hypothetical protein ARALYDRAFT_489503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50582.1| hypothetical protein ARALYDRAFT_489503 [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   189 bits (480),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P  G R+S+ H +GVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGIAPNPGARDSTTHAIGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>sp|Q40518.1|MSK1_TOBAC RecName: Full=Shaggy-related protein kinase NtK-1 [Nicotiana 
tabacum]
 emb|CAA54803.1| shaggy like protein kinase [Nicotiana tabacum]
 prf||2106142A Ser/Thr protein kinase
Length=409

 Score =   189 bits (480),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            M SVG+ P SG+RESS H+VGVD LPEEMNDM+IRDDK++EAA+VDGNGTE GHIIVTTI
Sbjct  1    MTSVGLAPVSGLRESSSHSVGVDRLPEEMNDMRIRDDKEIEAAIVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG++GQPKQTISY+AERIVG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRHGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQ  106



>gb|AEQ94156.1| shaggy-related protein kinase [Elaeis guineensis]
Length=216

 Score =   183 bits (465),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV V P+SGM+ +SG  VGVD LP+EMN+MKIRDDK++EA V+DGNGTE GHIIVTTI
Sbjct  1    MASVSVVPSSGMKNTSGTHVGVDRLPDEMNEMKIRDDKEVEATVIDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>gb|KDP23349.1| hypothetical protein JCGZ_23182 [Jatropha curcas]
Length=408

 Score =   189 bits (479),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 99/106 (93%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVGV P +G+RE+SGH  GVD LPEEMN+MKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGVAP-TGLREASGHNAGVDKLPEEMNEMKIRDDKEMEATVVDGNGTETGHIIVTTI  59

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  60   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  105



>ref|XP_007051226.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
 ref|XP_007051227.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
 gb|EOX95383.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
 gb|EOX95384.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
Length=409

 Score =   189 bits (479),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV + P SG+RE SG+TVGVD LP+EMNDMKIRDDK++EA +VDGNGTE GHIIVTTI
Sbjct  1    MASVSIVPTSGLREPSGNTVGVDRLPDEMNDMKIRDDKEVEATIVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>gb|KHN16033.1| Glycogen synthase kinase-3 like MsK-1 [Glycine soja]
Length=411

 Score =   189 bits (479),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 98/107 (92%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGH-TVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            M SVGV P SG+RE+SGH   GVD LPEEMNDMKIRDD++MEA VVDGNGTE GHIIVTT
Sbjct  1    MTSVGVAPTSGLREASGHGAAGVDRLPEEMNDMKIRDDREMEATVVDGNGTETGHIIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  107



>gb|AFH00876.1| glycogen synthase kinase-3 [Glycine soja]
Length=410

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 98/107 (92%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGH-TVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            M SVGV P SG+RE+SGH   GVD LPEEMNDMKIRDD++MEA VVDGNGTE GHIIVTT
Sbjct  1    MTSVGVAPTSGLREASGHGAAGVDRLPEEMNDMKIRDDREMEATVVDGNGTETGHIIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  107



>ref|XP_007145031.1| hypothetical protein PHAVU_007G204000g [Phaseolus vulgaris]
 ref|XP_007145032.1| hypothetical protein PHAVU_007G204000g [Phaseolus vulgaris]
 gb|ESW17025.1| hypothetical protein PHAVU_007G204000g [Phaseolus vulgaris]
 gb|ESW17026.1| hypothetical protein PHAVU_007G204000g [Phaseolus vulgaris]
Length=410

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 98/107 (92%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGH-TVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            M SVGV P SG+RE+SGH   GVD LPEEMNDMKIRDD++MEA VVDGNGTE GHIIVTT
Sbjct  1    MTSVGVAPTSGLREASGHGAAGVDRLPEEMNDMKIRDDREMEATVVDGNGTETGHIIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  107



>ref|XP_006588432.1| PREDICTED: glycogen synthase kinase-3 isoform X1 [Glycine max]
Length=410

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 98/107 (92%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGH-TVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            M SVGV P SG+RE+SGH   GVD LPEEMNDMKIRDD++MEA VVDGNGTE GHIIVTT
Sbjct  1    MTSVGVAPTSGLREASGHGAAGVDRLPEEMNDMKIRDDREMEATVVDGNGTETGHIIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  107



>gb|ACQ91102.1| glycogen synthase kinase [Glycine max]
Length=410

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 98/107 (92%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGH-TVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            M SVGV P SG+RE+SGH   GVD LPEEMNDMKIRDD++MEA VVDGNGTE GHIIVTT
Sbjct  1    MTSVGVAPTSGLREASGHGAAGVDRLPEEMNDMKIRDDREMEATVVDGNGTETGHIIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  107



>ref|XP_002302794.1| Glycogen synthase kinase-3 MsK-3 family protein [Populus trichocarpa]
 gb|EEE82067.1| Glycogen synthase kinase-3 MsK-3 family protein [Populus trichocarpa]
Length=409

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV V PASG+R++ G+T GVD LPEEMNDMKI DDK+MEAAVVDGNGTE GHIIVTTI
Sbjct  1    MASVSVVPASGLRDTLGNTTGVDKLPEEMNDMKISDDKEMEAAVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGLVFQAKCLETGETVAIKKVLQ  106



>gb|KJB49765.1| hypothetical protein B456_008G136600 [Gossypium raimondii]
Length=409

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS+G+ P SG+RE SG+ VGVD LP+EMNDMKIRDDK++EA +VDGNGTE GHIIVTTI
Sbjct  1    MASIGMAPTSGLREPSGNAVGVDRLPDEMNDMKIRDDKEVEATIVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>gb|KHG00969.1| Glycogen synthase kinase-3 MsK-3 [Gossypium arboreum]
Length=409

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS+G+ P SG+RE SG+ VGVD LP+EMNDMKIRDDK++EA +VDGNGTE GHIIVTTI
Sbjct  1    MASIGMAPTSGLREPSGNAVGVDRLPDEMNDMKIRDDKEVEATIVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_011087526.1| PREDICTED: shaggy-related protein kinase NtK-1 isoform X1 [Sesamum 
indicum]
 ref|XP_011087527.1| PREDICTED: shaggy-related protein kinase NtK-1 isoform X1 [Sesamum 
indicum]
Length=409

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG  P+SG+RESS H VG+DSLP+EMNDMKIRD+KD+EA +VDGNGTE GH+IVT+I
Sbjct  1    MASVGTAPSSGLRESSSHAVGMDSLPDEMNDMKIRDEKDIEATLVDGNGTETGHVIVTSI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLE GETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLENGETVAIKKVLQ  106



>gb|AEQ94143.1| putative Glycogen synthase kinase 3 [Elaeis guineensis]
Length=231

 Score =   183 bits (464),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV V P+SGM+ +SG  VGVD LP+EMN+MKIRDDK++EA V+DGNGTE GHIIVTTI
Sbjct  1    MASVSVVPSSGMKNTSGTHVGVDRLPDEMNEMKIRDDKEVEATVIDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_006289925.1| hypothetical protein CARUB_v10003541mg [Capsella rubella]
 gb|EOA22823.1| hypothetical protein CARUB_v10003541mg [Capsella rubella]
Length=409

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P  G R+S+ H  GVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGIAPIPGARDSTAHASGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>gb|KJB45480.1| hypothetical protein B456_007G308500 [Gossypium raimondii]
Length=332

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 98/106 (92%), Gaps = 2/106 (2%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P SG+RESS  T GV+ LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGMVPTSGLRESS--TAGVEKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  58

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  59   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  104



>ref|XP_008343189.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Malus 
domestica]
Length=372

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV V PASG+RE  G+ VGVD+LP EMNDMKIRDDK+M A VVDGNGTEAGHIIVTTI
Sbjct  1    MASVSVVPASGLREPGGNAVGVDNLPNEMNDMKIRDDKEMGATVVDGNGTEAGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGLVFQAKCLETGETVAIKKVLQ  106



>ref|XP_008381452.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 [Malus domestica]
Length=409

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV V PASG+RE  G+  GVD+LP EMNDMKIRDDK+MEA VV+GNGTEAGHIIVTTI
Sbjct  1    MASVSVVPASGLREPXGNAAGVDNLPNEMNDMKIRDDKEMEATVVNGNGTEAGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGLVFQAKCLETGETVAIKKVLQ  106



>ref|XP_009335521.1| PREDICTED: shaggy-related protein kinase alpha [Pyrus x bretschneideri]
 ref|XP_009335522.1| PREDICTED: shaggy-related protein kinase alpha [Pyrus x bretschneideri]
 ref|XP_009335523.1| PREDICTED: shaggy-related protein kinase alpha [Pyrus x bretschneideri]
Length=414

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 101/110 (92%), Gaps = 4/110 (4%)
 Frame = +1

Query  157  MASVGVPPASGMRE--SSGHTVGVDSLPEEMNDMKIRDDKDMEA--AVVDGNGTEAGHII  324
            MASVGV P SG+RE  +SGH VGVD LPEEMNDMKIRDDK+ME+  AVVDGNGTE GHII
Sbjct  1    MASVGVAPTSGVREPCASGHAVGVDKLPEEMNDMKIRDDKEMESTVAVVDGNGTETGHII  60

Query  325  VTTIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            VTTIGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   VTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  110



>ref|XP_009757512.1| PREDICTED: shaggy-related protein kinase NtK-1 [Nicotiana sylvestris]
 ref|XP_009757513.1| PREDICTED: shaggy-related protein kinase NtK-1 [Nicotiana sylvestris]
Length=409

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            M SVG+ P SG+RESS H+VGVD LPEEMNDM+IRDDK++EAA+VDGNGTE GHIIVTT 
Sbjct  1    MTSVGLAPVSGLRESSSHSVGVDRLPEEMNDMRIRDDKEIEAAIVDGNGTETGHIIVTTT  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG++GQPKQTISY+AERIVG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRHGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_006841582.1| hypothetical protein AMTR_s00003p00196730 [Amborella trichopoda]
 gb|ERN03257.1| hypothetical protein AMTR_s00003p00196730 [Amborella trichopoda]
Length=409

 Score =   187 bits (474),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV V PA+G RE SG T+GVD LPEEMNDMKIRDDK++EA VVDGNGTE GHIIVTTI
Sbjct  1    MASVSVVPATGFRELSGSTMGVDKLPEEMNDMKIRDDKEVEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFG+VFQAKCLE+GETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLESGETVAIKKVLQ  106



>ref|XP_008353866.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 [Malus domestica]
 ref|XP_009367184.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Pyrus 
x bretschneideri]
 ref|XP_009367186.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Pyrus 
x bretschneideri]
Length=409

 Score =   186 bits (473),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV V PASG+RE  G+ VGVD+LP EMNDMKIRDDK+M A VVDGNGTEAGHIIVTTI
Sbjct  1    MASVSVVPASGLREPGGNAVGVDNLPNEMNDMKIRDDKEMGATVVDGNGTEAGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGLVFQAKCLETGETVAIKKVLQ  106



>ref|XP_009617298.1| PREDICTED: shaggy-related protein kinase NtK-1 [Nicotiana tomentosiformis]
 ref|XP_009617299.1| PREDICTED: shaggy-related protein kinase NtK-1 [Nicotiana tomentosiformis]
 ref|XP_009617301.1| PREDICTED: shaggy-related protein kinase NtK-1 [Nicotiana tomentosiformis]
Length=409

 Score =   186 bits (473),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            M SVG+ P SG+RESS H VGVD LPEEMNDM+IRDDK++EAA+VDGNGTE GHIIVTT 
Sbjct  1    MTSVGLAPVSGLRESSSHNVGVDRLPEEMNDMRIRDDKEIEAAIVDGNGTETGHIIVTTT  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG++GQPKQTISY+AERIVG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRHGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_002319468.1| Glycogen synthase kinase-3 MsK-1 family protein [Populus trichocarpa]
 gb|EEE95391.1| Glycogen synthase kinase-3 MsK-1 family protein [Populus trichocarpa]
Length=409

 Score =   186 bits (472),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS GV P SG+RE+  H  GVD LPEEMNDMKIRDDKDMEA VVDGNGTE GHIIVTTI
Sbjct  1    MASAGVAPTSGLREAGVHNAGVDKLPEEMNDMKIRDDKDMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VG+GSFGVVFQAKCLET ETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGNGSFGVVFQAKCLETSETVAIKKVLQ  106



>gb|ABK93098.1| unknown [Populus trichocarpa]
Length=409

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS GV P SG+RE+  H  GVD LPEEMNDMKIRDDKDMEA VVDGNGTE GHIIVTTI
Sbjct  1    MASAGVAPTSGLREAGVHNAGVDKLPEEMNDMKIRDDKDMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VG+GSFGVVFQAKCLET ETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGNGSFGVVFQAKCLETSETVAIKKVLQ  106



>gb|ABB55385.1| Ser/Thr protein kinase-like [Solanum tuberosum]
Length=409

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P SG+RESSGH  GVD LPEEMNDM+IRDDK+MEAA+V G GTE GHIIVTTI
Sbjct  1    MASVGLAPTSGLRESSGHNAGVDRLPEEMNDMRIRDDKEMEAAMVAGIGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_007221484.1| hypothetical protein PRUPE_ppa006462mg [Prunus persica]
 gb|EMJ22683.1| hypothetical protein PRUPE_ppa006462mg [Prunus persica]
Length=410

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV V PASG+R+ SG+ VGVDSLP  MNDMKIRD+K+MEA +VDGNGTEAGHIIVTTI
Sbjct  1    MASVSVVPASGIRDPSGNVVGVDSLPSGMNDMKIRDEKEMEATIVDGNGTEAGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGLVFQAKCLETGETVAIKKVLQ  106



>ref|NP_001242661.1| glycogen synthase kinase-3 [Glycine max]
 gb|ACU18223.1| unknown [Glycine max]
Length=410

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 97/107 (91%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGH-TVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            M SVGV P SG+RE+SGH   GVD LPEEMNDMKIRDD++MEA VVDGNGTE GHIIVTT
Sbjct  1    MTSVGVAPTSGLREASGHGAAGVDRLPEEMNDMKIRDDREMEATVVDGNGTETGHIIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER+VGHGSFGVVFQAKC ETGETVAIKKVLQ
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCSETGETVAIKKVLQ  107



>gb|KJB45479.1| hypothetical protein B456_007G308500 [Gossypium raimondii]
 gb|KJB45481.1| hypothetical protein B456_007G308500 [Gossypium raimondii]
Length=407

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 98/106 (92%), Gaps = 2/106 (2%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P SG+RESS  T GV+ LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGMVPTSGLRESS--TAGVEKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  58

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  59   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  104



>ref|XP_006394905.1| hypothetical protein EUTSA_v10004319mg [Eutrema salsugineum]
 gb|ESQ32191.1| hypothetical protein EUTSA_v10004319mg [Eutrema salsugineum]
Length=409

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P  G R+S+    GVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGIAPIPGARDSTAQATGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_003555781.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X1 [Glycine max]
 ref|XP_006605787.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X2 [Glycine max]
 ref|XP_006605788.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X3 [Glycine max]
 ref|XP_006605789.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X4 [Glycine max]
Length=426

 Score =   185 bits (470),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 96/107 (90%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGH-TVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            M SVGV P SG+RE+SGH     D LPEEMNDMKIRDD++MEA VVDGNGTE GHIIVTT
Sbjct  17   MTSVGVAPTSGLREASGHGAAAADRLPEEMNDMKIRDDREMEATVVDGNGTETGHIIVTT  76

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  77   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  123



>gb|KCW84977.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
Length=293

 Score =   182 bits (461),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 97/106 (92%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P S +RE SG +VGVD LPEEMN+MKIRDDK+ME  VVDGNGTEAGHIIVTTI
Sbjct  6    MASVGIAPNS-VREPSGQSVGVDRLPEEMNEMKIRDDKEMETTVVDGNGTEAGHIIVTTI  64

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  65   GGRNGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQ  110



>ref|XP_008227813.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 [Prunus mume]
Length=410

 Score =   184 bits (467),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV V PASG+R+ SG+  GVDSLP  MNDMKIRD+K+MEA +VDGNGTEAGHIIVTTI
Sbjct  1    MASVSVVPASGIRDPSGNVAGVDSLPSGMNDMKIRDEKEMEATIVDGNGTEAGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGLVFQAKCLETGETVAIKKVLQ  106



>gb|ACJ83284.1| unknown [Medicago truncatula]
Length=172

 Score =   177 bits (448),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 97/108 (90%), Gaps = 2/108 (2%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGH-TVGVDS-LPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVT  330
            MASVGV P SG +ES G   +GVD  LPEEM+DMKIRDD++MEA VVDGNGTE GHIIVT
Sbjct  1    MASVGVAPTSGFKESLGDGEIGVDDILPEEMSDMKIRDDREMEATVVDGNGTETGHIIVT  60

Query  331  TIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TIGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   TIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  108



>ref|XP_006840718.1| hypothetical protein AMTR_s00096p00102520 [Amborella trichopoda]
 gb|ERN02393.1| hypothetical protein AMTR_s00096p00102520 [Amborella trichopoda]
Length=356

 Score =   182 bits (463),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+PPAS +R+S+G  +GVD LPEE+N+MKI+DDK+MEA VVDGNGTE G IIVTTI
Sbjct  1    MASVGLPPASAVRKSNGSAIGVDKLPEEINEMKIKDDKEMEANVVDGNGTETGQIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQ ISY+AER+VGHGSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQNISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQ  106



>ref|XP_011023844.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011023845.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
Length=409

 Score =   184 bits (466),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS GV P SG+RE+  H  GVD LPEEMNDMKIRD+KDMEA VVDGNGTE GHIIVTTI
Sbjct  1    MASAGVAPTSGLREAGVHDAGVDKLPEEMNDMKIRDEKDMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VG+GSFGVVFQAKCLET ETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGNGSFGVVFQAKCLETSETVAIKKVLQ  106



>ref|XP_010270906.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Nelumbo nucifera]
 ref|XP_010270907.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Nelumbo nucifera]
Length=409

 Score =   184 bits (466),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV + PASG++E SG+ VGVD LPEEMN MKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVSIVPASGVKEPSGNCVGVDKLPEEMNGMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VG+GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGNGSFGIVFQAKCLETGETVAIKKVLQ  106



>gb|KHG02936.1| Shaggy-related protein kinase alpha [Gossypium arboreum]
 gb|KHG22311.1| Shaggy-related protein kinase alpha [Gossypium arboreum]
Length=407

 Score =   183 bits (465),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 97/106 (92%), Gaps = 2/106 (2%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P SG+RESS  T  V+ LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGMVPTSGLRESS--TASVEKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  58

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  59   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  104



>ref|XP_011003165.1| PREDICTED: shaggy-related protein kinase alpha-like [Populus 
euphratica]
 ref|XP_011003166.1| PREDICTED: shaggy-related protein kinase alpha-like [Populus 
euphratica]
Length=409

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV V PASG+R++ G+T G+D LP+EMN MKI DDK+MEAAVVDGNGTE GHIIVTTI
Sbjct  1    MASVSVVPASGLRDTRGNTTGIDKLPDEMNGMKISDDKEMEAAVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGLVFQAKCLETGETVAIKKVLQ  106



>ref|XP_011040636.1| PREDICTED: shaggy-related protein kinase alpha-like [Populus 
euphratica]
Length=409

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV V PA G+R+ + ++ GVD LP+EMNDM+IRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVSVVPAPGLRDRNRNSTGVDKLPDEMNDMRIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_010270905.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Nelumbo nucifera]
Length=434

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV + PASG++E SG+ VGVD LPEEMN MKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  26   MASVSIVPASGVKEPSGNCVGVDKLPEEMNGMKIRDDKEMEATVVDGNGTETGHIIVTTI  85

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VG+GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  86   GGRNGQPKQTISYMAERVVGNGSFGIVFQAKCLETGETVAIKKVLQ  131



>gb|KDO86865.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
Length=296

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 95/106 (90%), Gaps = 6/106 (6%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV V PASG      +TVGVD LPEEMNDMKIRDDK+MEA VVDGNGTEAGHIIVTTI
Sbjct  1    MASVSVVPASG------NTVGVDRLPEEMNDMKIRDDKEMEATVVDGNGTEAGHIIVTTI  54

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGE VAIKKVLQ
Sbjct  55   GGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGEAVAIKKVLQ  100



>ref|XP_010910596.1| PREDICTED: shaggy-related protein kinase alpha-like [Elaeis guineensis]
Length=409

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV V P+SGM+ +SG  VGVD LP+EMN+MKIRDDK++EA V+DGNGTE GHIIVTTI
Sbjct  1    MASVSVVPSSGMKNTSGTHVGVDRLPDEMNEMKIRDDKEVEATVIDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_010070089.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Eucalyptus grandis]
 gb|KCW58654.1| hypothetical protein EUGRSUZ_H01313 [Eucalyptus grandis]
 gb|KCW58655.1| hypothetical protein EUGRSUZ_H01313 [Eucalyptus grandis]
 gb|KCW58656.1| hypothetical protein EUGRSUZ_H01313 [Eucalyptus grandis]
 gb|KCW58657.1| hypothetical protein EUGRSUZ_H01313 [Eucalyptus grandis]
 gb|KCW58658.1| hypothetical protein EUGRSUZ_H01313 [Eucalyptus grandis]
Length=409

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVGVP ASG+R++SG+ +G   LPEEMNDMKIRD+++MEA V+DGNGTE GHIIVTTI
Sbjct  1    MASVGVPRASGLRDTSGYALGAHRLPEEMNDMKIRDEREMEATVIDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER VG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERAVGQGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_010070081.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070082.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070083.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070084.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070085.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070086.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070087.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070088.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
Length=412

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVGVP ASG+R++SG+ +G   LPEEMNDMKIRD+++MEA V+DGNGTE GHIIVTTI
Sbjct  1    MASVGVPRASGLRDTSGYALGAHRLPEEMNDMKIRDEREMEATVIDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER VG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERAVGQGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_010921357.1| PREDICTED: shaggy-related protein kinase alpha [Elaeis guineensis]
Length=409

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV V P+SGM+ +SG  VGVD LP+EMN+MKIRDDK++EA V+DGNGTE GHIIVTTI
Sbjct  1    MASVSVVPSSGMKNTSGTHVGVDRLPDEMNEMKIRDDKEVEATVIDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>gb|ABY60447.1| serine/threonine protein kinase [Adonis aestivalis var. palaestina]
Length=409

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV + P SG+R+ +G+  G D LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVSMAPPSGLRDPTGNAGGADRLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQ  106



>ref|NP_001242406.1| uncharacterized protein LOC100788612 [Glycine max]
 gb|ACU21024.1| unknown [Glycine max]
Length=406

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 98/107 (92%), Gaps = 5/107 (5%)
 Frame = +1

Query  157  MASVGVPP-ASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            MASVGV P +SG+RESSG    VD LPEEMNDM+IRDDK+MEA VVDGNGTE GHIIVTT
Sbjct  1    MASVGVAPTSSGLRESSG----VDRLPEEMNDMRIRDDKEMEATVVDGNGTETGHIIVTT  56

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AERIVGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  57   IGGRNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  103



>ref|XP_006576226.1| PREDICTED: uncharacterized protein LOC100788612 isoform X1 [Glycine 
max]
 gb|KHN14222.1| Shaggy-related protein kinase alpha [Glycine soja]
Length=406

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 98/107 (92%), Gaps = 5/107 (5%)
 Frame = +1

Query  157  MASVGVPP-ASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            MASVGV P +SG+RESSG    VD LPEEMNDM+IRDDK+MEA VVDGNGTE GHIIVTT
Sbjct  1    MASVGVAPTSSGLRESSG----VDRLPEEMNDMRIRDDKEMEATVVDGNGTETGHIIVTT  56

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AERIVGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  57   IGGRNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  103



>ref|XP_003554602.1| PREDICTED: shaggy-related protein kinase alpha-like isoform 1 
[Glycine max]
Length=406

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 98/107 (92%), Gaps = 5/107 (5%)
 Frame = +1

Query  157  MASVGVPP-ASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            MASVGV P +SG+RESSG    VD LPEEMNDM+IRDDK+MEA VVDGNGTE GHIIVTT
Sbjct  1    MASVGVAPTSSGLRESSG----VDRLPEEMNDMRIRDDKEMEATVVDGNGTETGHIIVTT  56

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AERIVGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  57   IGGRNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  103



>ref|XP_010674528.1| PREDICTED: shaggy-related protein kinase alpha [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010674529.1| PREDICTED: shaggy-related protein kinase alpha [Beta vulgaris 
subsp. vulgaris]
Length=407

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 96/106 (91%), Gaps = 2/106 (2%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVGV P SG+R+ SG  +GVD LPEEMNDMKIRDDKDME  VVDGNGTE GHIIVTTI
Sbjct  1    MASVGVVPTSGIRDPSG--LGVDRLPEEMNDMKIRDDKDMEPTVVDGNGTETGHIIVTTI  58

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  59   GGKNGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQ  104



>ref|XP_002515218.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
 gb|EEF47202.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
Length=409

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV V P SG+R+  G+  GVD LP+EMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVSVAPTSGIRDPGGNAAGVDRLPDEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGE VAIKKVLQ
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGEAVAIKKVLQ  106



>ref|XP_007031229.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
 gb|EOY11731.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
Length=407

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 96/106 (91%), Gaps = 2/106 (2%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P S +RES+    GVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGMAPTSVLRESNA--AGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  58

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  59   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  104



>ref|XP_010091400.1| Glycogen synthase kinase-3-MsK-3-like protein [Morus notabilis]
 gb|EXB44437.1| Glycogen synthase kinase-3-MsK-3-like protein [Morus notabilis]
Length=412

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGM-RESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            MASV V PASG+ RESSG+  GVD LP+EMNDMKIRD+K++EA +VDGNGTE GHIIVTT
Sbjct  1    MASVSVVPASGVVRESSGNAAGVDRLPDEMNDMKIRDEKEVEATIVDGNGTETGHIIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  107



>ref|XP_011079505.1| PREDICTED: shaggy-related protein kinase alpha-like [Sesamum 
indicum]
Length=413

 Score =   182 bits (461),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            M S+GVPPASG+R+ S    G+D LP+EMN+MK+RDDKDME AV+DGNGTE GHIIVTTI
Sbjct  1    MTSLGVPPASGVRDPSRKAGGLDKLPDEMNEMKLRDDKDMEPAVIDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AERIVG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_010042192.1| PREDICTED: shaggy-related protein kinase alpha [Eucalyptus grandis]
 ref|XP_010042197.1| PREDICTED: shaggy-related protein kinase alpha [Eucalyptus grandis]
 ref|XP_010042204.1| PREDICTED: shaggy-related protein kinase alpha [Eucalyptus grandis]
 gb|KCW84972.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
 gb|KCW84973.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
 gb|KCW84974.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
 gb|KCW84975.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
Length=413

 Score =   181 bits (460),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 97/106 (92%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P S +RE SG +VGVD LPEEMN+MKIRDDK+ME  VVDGNGTEAGHIIVTTI
Sbjct  6    MASVGIAPNS-VREPSGQSVGVDRLPEEMNEMKIRDDKEMETTVVDGNGTEAGHIIVTTI  64

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  65   GGRNGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQ  110



>ref|XP_008781189.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
 ref|XP_008781190.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
Length=409

 Score =   181 bits (459),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV V P+S M+ +SG +VGVD LP+EMN+MKIRDDK++EA V+DGNGTE GHIIVTTI
Sbjct  1    MASVSVVPSSRMKNTSGTSVGVDRLPDEMNEMKIRDDKEVEATVIDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQ  106



>gb|KDO86864.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
Length=354

 Score =   179 bits (455),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 95/106 (90%), Gaps = 6/106 (6%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV V PASG      +TVGVD LPEEMNDMKIRDDK+MEA VVDGNGTEAGHIIVTTI
Sbjct  1    MASVSVVPASG------NTVGVDRLPEEMNDMKIRDDKEMEATVVDGNGTEAGHIIVTTI  54

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGE VAIKKVLQ
Sbjct  55   GGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGEAVAIKKVLQ  100



>ref|XP_006444574.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 gb|ESR57814.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
Length=354

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 95/106 (90%), Gaps = 6/106 (6%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV V PASG      +TVGVD LPEEMNDMKIRDDK+MEA VVDGNGTEAGHIIVTTI
Sbjct  1    MASVSVVPASG------NTVGVDRLPEEMNDMKIRDDKEMEATVVDGNGTEAGHIIVTTI  54

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGE VAIKKVLQ
Sbjct  55   GGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGEAVAIKKVLQ  100



>ref|XP_004148581.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Cucumis 
sativus]
 ref|XP_004163975.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Cucumis 
sativus]
Length=409

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            M SV V PAS +R+  G T+GVD LP+EMNDMKIRDDK++EA VVDGNGTE GHIIVTTI
Sbjct  1    MTSVSVAPASMIRDHGGSTIGVDRLPDEMNDMKIRDDKEIEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGKNGQPKQTISYMAERAVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_010493927.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Camelina 
sativa]
 ref|XP_010493928.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Camelina 
sativa]
Length=412

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 96/109 (88%), Gaps = 3/109 (3%)
 Frame = +1

Query  157  MASVGVPPASGMRES--SGHT-VGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIV  327
            MASVG+ P  G R+S  S H   GVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIV
Sbjct  1    MASVGIAPIPGARDSTTSAHAATGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIV  60

Query  328  TTIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TTIGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   TTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  109



>ref|NP_568486.1| Shaggy-related protein kinase alpha [Arabidopsis thaliana]
 sp|P43288.3|KSG1_ARATH RecName: Full=Shaggy-related protein kinase alpha; AltName: Full=ASK-alpha 
[Arabidopsis thaliana]
 gb|AAL16257.1|AF428327_1 AT5g26750/F2P16_10 [Arabidopsis thaliana]
 gb|AAK76698.1| putative shaggy kinase alpha [Arabidopsis thaliana]
 gb|AAN13164.1| putative shaggy kinase alpha [Arabidopsis thaliana]
 gb|AED93596.1| Shaggy-related protein kinase alpha [Arabidopsis thaliana]
Length=405

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 95/106 (90%), Gaps = 4/106 (4%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P  G R+S+G    VD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGIAPNPGARDSTG----VDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  56

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  57   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  102



>emb|CAA04265.1| shaggy-like kinase alpha [Arabidopsis thaliana]
Length=405

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 95/106 (90%), Gaps = 4/106 (4%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P  G R+S+G    VD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGIAPNPGARDSTG----VDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  56

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  57   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  102



>emb|CAA53181.1| shaggy related kinase [Arabidopsis thaliana]
 emb|CAA48538.1| serine /threonine protein kinase [Arabidopsis thaliana]
Length=405

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 95/106 (90%), Gaps = 4/106 (4%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P  G R+S+G    VD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGIAPNPGARDSTG----VDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  56

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  57   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  102



>emb|CAN64359.1| hypothetical protein VITISV_041427 [Vitis vinifera]
Length=442

 Score =   180 bits (457),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS G+PPAS + + SG+T+ VD LPEE+N+MKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASAGIPPASAVGKPSGNTMFVDKLPEEINEMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQ  106



>ref|XP_010038314.1| PREDICTED: shaggy-related protein kinase alpha-like [Eucalyptus 
grandis]
 ref|XP_010038315.1| PREDICTED: shaggy-related protein kinase alpha-like [Eucalyptus 
grandis]
 gb|KCW50138.1| hypothetical protein EUGRSUZ_K03568 [Eucalyptus grandis]
Length=409

 Score =   179 bits (455),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV + P SG+R+ +G+TV  D LP+EMNDMKIRD+KDMEAAVV+GNG EAGHIIVTTI
Sbjct  1    MASVSMVPVSGLRDPTGNTVAFDRLPDEMNDMKIRDEKDMEAAVVNGNGAEAGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GGKNGQPKQTISYMAERAVGQGSFGIVFQAKCLETGETVAIKKVLQ  106



>ref|XP_006444573.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 ref|XP_006444575.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 ref|XP_006492384.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like isoform 
X1 [Citrus sinensis]
 gb|ESR57813.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 gb|ESR57815.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 gb|KDO86860.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
 gb|KDO86861.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
 gb|KDO86862.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
 gb|KDO86863.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
Length=403

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 95/106 (90%), Gaps = 6/106 (6%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV V PASG      +TVGVD LPEEMNDMKIRDDK+MEA VVDGNGTEAGHIIVTTI
Sbjct  1    MASVSVVPASG------NTVGVDRLPEEMNDMKIRDDKEMEATVVDGNGTEAGHIIVTTI  54

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGE VAIKKVLQ
Sbjct  55   GGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGEAVAIKKVLQ  100



>ref|XP_010421531.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
 ref|XP_010421533.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
Length=412

 Score =   179 bits (454),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 96/109 (88%), Gaps = 3/109 (3%)
 Frame = +1

Query  157  MASVGVPPASGMRESS--GHT-VGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIV  327
            MASVG+ P  G R+S+   H   GVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIV
Sbjct  1    MASVGIAPIPGARDSTTTAHAATGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIV  60

Query  328  TTIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TTIGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   TTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  109



>ref|XP_010941497.1| PREDICTED: shaggy-related protein kinase alpha [Elaeis guineensis]
Length=409

 Score =   179 bits (454),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            M+S+ + P+S ++ +SG+ + VD LP+EMNDMKIRDDK++EAAV+DGNGTE GHIIVTTI
Sbjct  1    MSSLSMAPSSRLKNTSGNGIAVDRLPDEMNDMKIRDDKEVEAAVIDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AERIVGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_004135570.1| PREDICTED: shaggy-related protein kinase alpha-like [Cucumis 
sativus]
Length=409

 Score =   179 bits (453),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS+GV   S +RE +GH VGVD LPEEMNDMKIRDDK++EA VVDGNGTE GHIIVTTI
Sbjct  1    MASMGVVSTSNLREPAGHNVGVDRLPEEMNDMKIRDDKEVEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NG  KQTISY+AER VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGYSKQTISYMAERAVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_004163362.1| PREDICTED: shaggy-related protein kinase alpha-like [Cucumis 
sativus]
Length=409

 Score =   179 bits (453),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS+GV   S +RE +GH VGVD LPEEMNDMKIRDDK++EA VVDGNGTE GHIIVTTI
Sbjct  1    MASMGVVSTSNLREPAGHNVGVDRLPEEMNDMKIRDDKEVEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NG  KQTISY+AER VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGYSKQTISYMAERAVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_008450520.1| PREDICTED: shaggy-related protein kinase NtK-1 [Cucumis melo]
Length=409

 Score =   179 bits (453),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS+GV   S +RE +GH VGVD LPEEMNDMKIRDDK++EA VVDGNGTE GHIIVTTI
Sbjct  1    MASMGVVSTSNLREPAGHNVGVDRLPEEMNDMKIRDDKEVEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NG  KQTISY+AER VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGYSKQTISYMAERAVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>gb|KDP28311.1| hypothetical protein JCGZ_14082 [Jatropha curcas]
Length=409

 Score =   179 bits (453),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV V P SG+RE SG+T G D LP+EMNDMKIRD+K+MEA VVD NGTE GHIIVTTI
Sbjct  1    MASVSVVPTSGLREPSGNTAGADKLPDEMNDMKIRDEKEMEATVVDDNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NG  KQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGKNGNAKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>dbj|BAD95892.1| Ser/Thr protein kinase [Lotus japonicus]
Length=412

 Score =   178 bits (452),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 97/109 (89%), Gaps = 3/109 (3%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGH--TVGVDSLPEEMNDMKIRDDKDMEAAVVDGNG-TEAGHIIV  327
            MASVGV P SG+RE+SG     GVD LPEEMNDMKIRDD++MEA VVDGN  TE GHIIV
Sbjct  1    MASVGVAPTSGVREASGCHGAAGVDRLPEEMNDMKIRDDREMEATVVDGNDVTETGHIIV  60

Query  328  TTIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TTIGG+NGQPKQTISY+AERIVGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   TTIGGRNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  109



>gb|AES82237.2| glycogen synthase kinase [Medicago truncatula]
Length=373

 Score =   177 bits (449),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 96/107 (90%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAA-VVDGNGTEAGHIIVTT  333
            MAS GV PASG  + +  +V V+ LPEEMNDMKIRDDK+MEAA +VDGNGTE GHIIVTT
Sbjct  2    MASGGVAPASGFIDKNASSVAVEKLPEEMNDMKIRDDKEMEAATIVDGNGTETGHIIVTT  61

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  62   IGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  108



>sp|P51139.2|MSK3_MEDSA RecName: Full=Glycogen synthase kinase-3 homolog MsK-3 [Medicago 
sativa]
Length=411

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 97/107 (91%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAA-VVDGNGTEAGHIIVTT  333
            MAS GV PASG  + +  +VGV+ LPEEMNDMKIRDDK+MEAA +VDGNGTE GHIIVTT
Sbjct  1    MASGGVAPASGFIDKNASSVGVEKLPEEMNDMKIRDDKEMEAATIVDGNGTETGHIIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  107



>emb|CAA48472.1| protein kinase [Medicago sativa]
Length=412

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 97/107 (91%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAA-VVDGNGTEAGHIIVTT  333
            MAS GV PASG  + +  +VGV+ LPEEMNDMKIRDDK+MEAA +VDGNGTE GHIIVTT
Sbjct  2    MASGGVAPASGFIDKNASSVGVEKLPEEMNDMKIRDDKEMEAATIVDGNGTETGHIIVTT  61

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  62   IGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  108



>gb|AAM62970.1| shaggy related protein kinase ASK-GAMMA [Arabidopsis thaliana]
Length=409

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P++ +RES+G+   VD LPEEM DMKI+DDK+MEA VV+GN TE GHIIVTTI
Sbjct  1    MASVGIEPSAAVRESTGNVTDVDRLPEEMKDMKIQDDKEMEATVVNGNVTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_008793304.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
Length=409

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            M+S  V  +SGM+ +SG +VG+D LP+EMNDMKIRDDK++EA VVDGNGTE GHIIVTTI
Sbjct  1    MSSASVVTSSGMKNASGTSVGMDRLPDEMNDMKIRDDKEVEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQ  106



>ref|XP_010455024.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
 ref|XP_010455025.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
Length=412

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 96/109 (88%), Gaps = 3/109 (3%)
 Frame = +1

Query  157  MASVGVPPASGMRESS--GHT-VGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIV  327
            MASVG+ P  G R+S+   H   GV+ LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIV
Sbjct  1    MASVGIAPIPGARDSTTTAHAATGVEKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIV  60

Query  328  TTIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TTIGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   TTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  109



>gb|ACJ85178.1| unknown [Medicago truncatula]
Length=384

 Score =   177 bits (448),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 96/107 (90%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAA-VVDGNGTEAGHIIVTT  333
            MAS GV PASG  + +  +V V+ LPEEMNDMKIRDDK+MEAA +VDGNGTE GHIIVTT
Sbjct  2    MASGGVAPASGFIDKNASSVAVEKLPEEMNDMKIRDDKEMEAATIVDGNGTETGHIIVTT  61

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  62   IGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  108



>ref|XP_007031230.1| Shaggy-related kinase 11, 11 isoform 2 [Theobroma cacao]
 gb|EOY11732.1| Shaggy-related kinase 11, 11 isoform 2 [Theobroma cacao]
Length=409

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 96/107 (90%), Gaps = 3/107 (3%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P S +RES+    GVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGMAPTSVLRESNA--AGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  58

Query  337  GGQNGQPK-QTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPK QTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  59   GGRNGQPKQQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  105



>emb|CDY19757.1| BnaA09g04100D [Brassica napus]
Length=406

 Score =   177 bits (448),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 93/106 (88%), Gaps = 3/106 (3%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV +PP  G R+S   T G+D LPEEMNDMK+RDDK+ME  VVDGNGTE GHIIVTTI
Sbjct  1    MASVAIPPVHGARDS---TTGLDKLPEEMNDMKLRDDKEMEPVVVDGNGTETGHIIVTTI  57

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  58   GGRNGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQ  103



>gb|KHN00229.1| Glycogen synthase kinase-3 like MsK-3 [Glycine soja]
Length=585

 Score =   180 bits (457),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 83/106 (78%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS GV PASG+R+ +  +V V+ LP+EMN MKIRD+++MEA VVDGNGTE GHIIVTTI
Sbjct  177  MASAGVAPASGVRDVNASSVAVERLPDEMNGMKIRDEREMEATVVDGNGTETGHIIVTTI  236

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VG+GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  237  GGKNGQPKQTISYMAERVVGNGSFGVVFQAKCLETGETVAIKKVLQ  282



>ref|XP_003626019.1| Protein kinase, putative [Medicago truncatula]
Length=411

 Score =   177 bits (448),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 96/107 (90%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAA-VVDGNGTEAGHIIVTT  333
            MAS GV PASG  + +  +V V+ LPEEMNDMKIRDDK+MEAA +VDGNGTE GHIIVTT
Sbjct  1    MASGGVAPASGFIDKNASSVAVEKLPEEMNDMKIRDDKEMEAATIVDGNGTETGHIIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  107



>ref|XP_009383704.1| PREDICTED: shaggy-related protein kinase alpha [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   177 bits (448),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV + P+S ++ + G ++ VDSLP+E+NDMKIRDDK++EA V+DGNGTE GHIIVTTI
Sbjct  1    MASVSMAPSSELKNNDGTSICVDSLPDELNDMKIRDDKEVEATVIDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>emb|CDX87033.1| BnaC09g03480D [Brassica napus]
Length=406

 Score =   177 bits (448),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 93/106 (88%), Gaps = 3/106 (3%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV +PP  G R+S   T G+D LPEEMNDMK+RDDK+ME  VVDGNGTE GHIIVTTI
Sbjct  1    MASVAIPPVPGARDS---TTGLDKLPEEMNDMKLRDDKEMEPIVVDGNGTETGHIIVTTI  57

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  58   GGRNGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQ  103



>gb|AFK38277.1| unknown [Medicago truncatula]
 gb|AES82238.2| glycogen synthase kinase [Medicago truncatula]
Length=412

 Score =   177 bits (448),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 96/107 (90%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAA-VVDGNGTEAGHIIVTT  333
            MAS GV PASG  + +  +V V+ LPEEMNDMKIRDDK+MEAA +VDGNGTE GHIIVTT
Sbjct  2    MASGGVAPASGFIDKNASSVAVEKLPEEMNDMKIRDDKEMEAATIVDGNGTETGHIIVTT  61

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  62   IGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  108



>ref|XP_010251221.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X4 [Nelumbo nucifera]
Length=350

 Score =   175 bits (444),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS G+ P S + +S+ +++ VD LPEE+N+MKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASAGIAPPSAVGKSTDNSMSVDKLPEEINEMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQ  106



>ref|XP_011466950.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011466953.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 isoform X2 
[Fragaria vesca subsp. vesca]
Length=409

 Score =   177 bits (448),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV V PASG+R+ SG+TV +DSLP EMNDMKIRDDK+ME  VV+GN TE GHIIVTTI
Sbjct  1    MASVSVAPASGLRDRSGNTVALDSLPNEMNDMKIRDDKEMEGTVVNGNSTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NG  KQTISY+AER VGHGSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGLLKQTISYMAERAVGHGSFGLVFQAKCLETGETVAIKKVLQ  106



>ref|XP_003591238.1| Glycogen synthase kinase [Medicago truncatula]
 gb|AES61489.1| glycogen synthase kinase [Medicago truncatula]
 gb|AFK45213.1| unknown [Medicago truncatula]
Length=411

 Score =   177 bits (448),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 97/108 (90%), Gaps = 2/108 (2%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGH-TVGVDS-LPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVT  330
            MASVGV P SG +ES G   +GVD  LPEEM+DMKIRDD++MEA VVDGNGTE GHIIVT
Sbjct  1    MASVGVAPTSGFKESLGDGEIGVDDILPEEMSDMKIRDDREMEATVVDGNGTETGHIIVT  60

Query  331  TIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TIGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   TIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  108



>ref|XP_008778092.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
 ref|XP_008778093.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
Length=409

 Score =   176 bits (447),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS+ +  +SG++ +SG+ + VD LP+EMNDMKIRDDK++EA V+DGNGTE GHIIVTTI
Sbjct  1    MASLRITLSSGLKNASGNNIAVDRLPDEMNDMKIRDDKEVEATVIDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPK+TISY+AERIVGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKRTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_003626020.1| Protein kinase, putative [Medicago truncatula]
Length=451

 Score =   177 bits (449),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 96/107 (90%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAA-VVDGNGTEAGHIIVTT  333
            MAS GV PASG  + +  +V V+ LPEEMNDMKIRDDK+MEAA +VDGNGTE GHIIVTT
Sbjct  1    MASGGVAPASGFIDKNASSVAVEKLPEEMNDMKIRDDKEMEAATIVDGNGTETGHIIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  107



>sp|P51137.1|MSK1_MEDSA RecName: Full=Glycogen synthase kinase-3 homolog MsK-1 [Medicago 
sativa]
 emb|CAA48474.1| protein kinase [Medicago sativa]
Length=411

 Score =   176 bits (446),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 96/108 (89%), Gaps = 2/108 (2%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGH-TVGVDS-LPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVT  330
            MASVGV P SG RE  G   +GVD  LPEEM+DMKIRDD++MEA VVDGNGTE GHIIVT
Sbjct  1    MASVGVAPTSGFREVLGDGEIGVDDILPEEMSDMKIRDDREMEATVVDGNGTETGHIIVT  60

Query  331  TIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TIGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   TIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  108



>ref|XP_006408022.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
 gb|ESQ49475.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
Length=410

 Score =   176 bits (446),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P++ +R+++G+   VD LPEEMNDMKI+DDK+MEA +V+GN TE GHIIVTTI
Sbjct  1    MASVGIEPSAPVRDTAGNATDVDRLPEEMNDMKIQDDKEMEATIVNGNVTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_010251218.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X2 [Nelumbo nucifera]
Length=392

 Score =   176 bits (445),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS G+ P S + +S+ +++ VD LPEE+N+MKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASAGIAPPSAVGKSTDNSMSVDKLPEEINEMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQ  106



>dbj|BAJ34573.1| unnamed protein product [Thellungiella halophila]
Length=409

 Score =   176 bits (446),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P++ +R+++G+   VD LPEEMNDMKI+DDK+MEA +V+GN TE GHIIVTTI
Sbjct  1    MASVGIEPSAPVRDTAGNATDVDRLPEEMNDMKIQDDKEMEATIVNGNVTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_006408021.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
 ref|XP_006408023.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
 gb|ESQ49474.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
 gb|ESQ49476.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
Length=409

 Score =   176 bits (446),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P++ +R+++G+   VD LPEEMNDMKI+DDK+MEA +V+GN TE GHIIVTTI
Sbjct  1    MASVGIEPSAPVRDTAGNATDVDRLPEEMNDMKIQDDKEMEATIVNGNVTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_010546768.1| PREDICTED: shaggy-related protein kinase alpha [Tarenaya hassleriana]
Length=399

 Score =   176 bits (445),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 92/106 (87%), Gaps = 10/106 (9%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVGV PASG          VD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGVAPASG----------VDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  50

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  51   GGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  96



>ref|NP_187235.1| Shaggy-related protein kinase gamma [Arabidopsis thaliana]
 ref|NP_850520.1| Shaggy-related protein kinase gamma [Arabidopsis thaliana]
 sp|P43289.1|KSG3_ARATH RecName: Full=Shaggy-related protein kinase gamma; AltName: Full=ASK-gamma 
[Arabidopsis thaliana]
 gb|AAF26086.1|AC012393_12 shaggy related protein kinase, ASK-GAMMA [Arabidopsis thaliana]
 emb|CAA53180.1| ASK-gamma (Arabidopsis shaggy-related kinase) [Arabidopsis thaliana]
 emb|CAA73247.1| shaggy-like kinase gamma [Arabidopsis thaliana]
 gb|AAL32791.1| shaggy related protein kinase, ASK-GAMMA [Arabidopsis thaliana]
 gb|AAM13346.1| shaggy related protein kinase, ASK-GAMMA [Arabidopsis thaliana]
 dbj|BAE99095.1| shaggy related protein kinase [Arabidopsis thaliana]
 dbj|BAH19402.1| AT3G05840 [Arabidopsis thaliana]
 gb|AEE74303.1| Shaggy-related protein kinase gamma [Arabidopsis thaliana]
 gb|AEE74304.1| Shaggy-related protein kinase gamma [Arabidopsis thaliana]
Length=409

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P++ +RES+G+    D LPEEM DMKI+DDK+MEA +V+GN TE GHIIVTTI
Sbjct  1    MASVGIEPSAAVRESTGNVTDADRLPEEMKDMKIQDDKEMEATIVNGNVTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_002882438.1| hypothetical protein ARALYDRAFT_477878 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58697.1| hypothetical protein ARALYDRAFT_477878 [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P++ +R+S+G+   VD LPEEM DMKI+DDK+MEA +V+GN TE GHIIVTTI
Sbjct  1    MASVGIEPSAAVRDSTGNVTDVDRLPEEMKDMKIQDDKEMEATIVNGNVTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_010251217.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X1 [Nelumbo nucifera]
Length=409

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS G+ P S + +S+ +++ VD LPEE+N+MKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASAGIAPPSAVGKSTDNSMSVDKLPEEINEMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQ  106



>ref|XP_009111716.1| PREDICTED: shaggy-related protein kinase alpha-like [Brassica 
rapa]
Length=406

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 92/106 (87%), Gaps = 3/106 (3%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV +PP  G R+S   T  +D LPEEMNDMK+RDDK+ME  VVDGNGTE GHIIVTTI
Sbjct  1    MASVAIPPVHGARDS---TTSLDKLPEEMNDMKLRDDKEMEPIVVDGNGTETGHIIVTTI  57

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  58   GGRNGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQ  103



>ref|XP_010660896.1| PREDICTED: shaggy-related protein kinase epsilon isoform X1 [Vitis 
vinifera]
 emb|CBI34900.3| unnamed protein product [Vitis vinifera]
Length=412

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 97/109 (89%), Gaps = 3/109 (3%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIV  327
            MAS G+PPAS + + SG+T+ VD LPEE+N+MKIRDDK   +MEA VVDGNGTE GHIIV
Sbjct  1    MASAGIPPASAVGKPSGNTMFVDKLPEEINEMKIRDDKVEKEMEATVVDGNGTETGHIIV  60

Query  328  TTIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TTIGG+NGQPKQTISY+AER+VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   TTIGGRNGQPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQ  109



>ref|XP_010938176.1| PREDICTED: shaggy-related protein kinase alpha-like [Elaeis guineensis]
Length=409

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS  V  ASGM+ + G +VGVD LP+EMNDMKIRDDK++EA V+DGNGTE GHIIVTTI
Sbjct  1    MASASVVTASGMKNAGGTSVGVDRLPDEMNDMKIRDDKEVEATVIDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTI Y+AER+VGHGSFG+VFQAKCLET ETVAIKKVLQ
Sbjct  61   GGRNGQPKQTIRYMAERVVGHGSFGIVFQAKCLETSETVAIKKVLQ  106



>ref|XP_006588497.1| PREDICTED: uncharacterized protein LOC100817819 isoform X1 [Glycine 
max]
Length=409

 Score =   174 bits (442),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS GV PASG+R+ + ++V V+ LP+EMN MKIRD+++MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASAGVAPASGVRDVNANSVAVERLPDEMNGMKIRDEREMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VG+GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGKNGQPKQTISYMAERVVGNGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_008812956.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Phoenix 
dactylifera]
Length=409

 Score =   174 bits (441),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS+ +  +SG++ ++ ++V VD LP+EMNDMKIRDDK++EA VVDGNGTE GHIIVTTI
Sbjct  1    MASLSMARSSGLKNTNVNSVAVDRLPDEMNDMKIRDDKEVEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQ  106



>ref|XP_003518657.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Glycine 
max]
Length=409

 Score =   174 bits (441),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS GV PASG+R+ +  +V V+ LP+EMN MKIRD+++MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASAGVAPASGVRDVNASSVAVERLPDEMNGMKIRDEREMEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VG+GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGKNGQPKQTISYMAERVVGNGSFGVVFQAKCLETGETVAIKKVLQ  106



>emb|CDX80585.1| BnaC07g28590D [Brassica napus]
Length=402

 Score =   173 bits (439),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 93/106 (88%), Gaps = 7/106 (7%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV +PP    R+S+G    VD LPEEMNDMKIRDDK+MEA VVDGN TE GHIIVTTI
Sbjct  1    MASVSIPPP---RDSTG----VDKLPEEMNDMKIRDDKEMEATVVDGNSTETGHIIVTTI  53

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  54   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  99



>ref|XP_009384996.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   173 bits (439),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS+ +PP+S +++++G +V VD+LP  MN MKI+DDK++EA VVDGNGTE GHIIVTTI
Sbjct  1    MASISLPPSSRLKDTTGSSVSVDTLPHAMNVMKIKDDKEVEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLET ETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETVETVAIKKVLQ  106



>ref|XP_009134851.1| PREDICTED: shaggy-related protein kinase gamma [Brassica rapa]
Length=410

 Score =   173 bits (438),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 97/107 (91%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGH-TVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            MA+VGV P++ +RES+G+ T  VD LPEEMN MKI+DDK+MEA +V+GN TE GHIIVTT
Sbjct  1    MATVGVEPSAAVRESNGNVTADVDRLPEEMNHMKIQDDKEMEATIVNGNVTETGHIIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  107



>ref|XP_010679446.1| PREDICTED: shaggy-related protein kinase NtK-1 [Beta vulgaris 
subsp. vulgaris]
Length=409

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P SG+++  G+   +D LP+EMNDMKIR+DK+MEAAVVDGNGTE GHIIVTTI
Sbjct  1    MASVGIAPTSGLKDPGGNVGAIDKLPDEMNDMKIREDKEMEAAVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQ KQT+SY+AERIVG GSFGVVFQA+CLETGETVAIKKVLQ
Sbjct  61   GGKNGQAKQTVSYMAERIVGQGSFGVVFQARCLETGETVAIKKVLQ  106



>gb|EYU38392.1| hypothetical protein MIMGU_mgv1a007572mg [Erythranthe guttata]
Length=403

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 92/106 (87%), Gaps = 6/106 (6%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P SG        VGVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGIAPISG------EAVGVDRLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  54

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG++GQPKQTISY+AERIVG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  55   GGRSGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQ  100



>ref|XP_006299606.1| hypothetical protein CARUB_v10015785mg [Capsella rubella]
 gb|EOA32504.1| hypothetical protein CARUB_v10015785mg [Capsella rubella]
Length=409

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P++ +R+S+G+    D LPEE+ DMKI+DDK+MEA +V+GN TE GHIIVTTI
Sbjct  1    MASVGIEPSAAVRDSTGNATDADRLPEELKDMKIQDDKEMEATIVNGNVTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQ  106



>emb|CDY49981.1| BnaC03g34380D [Brassica napus]
 emb|CDX74129.1| BnaA03g29180D [Brassica napus]
Length=411

 Score =   172 bits (435),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 97/107 (91%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGH-TVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            MA+VGV P++ +R+S+G+ T  VD LPEEMN MKI+DDK+MEA +V+GN TE GHIIVTT
Sbjct  1    MATVGVEPSAAVRDSNGNVTADVDRLPEEMNHMKIQDDKEMEATIVNGNVTETGHIIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  107



>ref|XP_004494455.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Cicer 
arietinum]
Length=385

 Score =   171 bits (433),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 95/107 (89%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAA-VVDGNGTEAGHIIVTT  333
            MAS  V PA+G  + +  + GV+ LPEEMNDMKIRDDK+MEAA VVDGNGTE GHIIVTT
Sbjct  1    MASGVVVPATGFTDKNASSGGVEKLPEEMNDMKIRDDKEMEAATVVDGNGTETGHIIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  107



>ref|XP_010432712.1| PREDICTED: shaggy-related protein kinase gamma-like [Camelina 
sativa]
Length=407

 Score =   171 bits (434),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 95/106 (90%), Gaps = 2/106 (2%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P++ +R+SS  T  VD LPEEM DMKI+DDK+MEA +V+GN TE GHIIVTTI
Sbjct  1    MASVGIEPSAAVRDSS--TTDVDRLPEEMKDMKIQDDKEMEATIVNGNVTETGHIIVTTI  58

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  59   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  104



>gb|EYU46859.1| hypothetical protein MIMGU_mgv1a007395mg [Erythranthe guttata]
 gb|EYU46860.1| hypothetical protein MIMGU_mgv1a007395mg [Erythranthe guttata]
Length=409

 Score =   171 bits (434),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV V P+ G+R+    T  +D LP+EMN+MK+RD+KDME AVVDGNGTE GHIIVTTI
Sbjct  1    MASVSVAPSLGVRDPGRKTGSLDRLPDEMNEMKLRDEKDMEPAVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AERIVG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_009384446.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384447.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384448.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   171 bits (433),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV + P+SG++ +SG ++G+D LP+EM+DMKIRDDK++EA V++G GTEAGHIIVTTI
Sbjct  1    MASVNMVPSSGLKNTSGTSLGMDKLPQEMSDMKIRDDKEVEATVINGKGTEAGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
             G+NGQPKQT+SY+AER VGHGSFGVVFQAKCLETGE+VAIKKVLQ
Sbjct  61   NGKNGQPKQTVSYMAERAVGHGSFGVVFQAKCLETGESVAIKKVLQ  106



>ref|XP_010486058.1| PREDICTED: shaggy-related protein kinase gamma-like [Camelina 
sativa]
Length=408

 Score =   171 bits (432),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 95/106 (90%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS+G+ P++ +R+SS  T  VD LPEEM DMKI+DDK+MEA +V+GN TE GHIIVTTI
Sbjct  1    MASLGIEPSAAVRDSST-TTDVDRLPEEMKDMKIQDDKEMEATIVNGNVTETGHIIVTTI  59

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  60   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  105



>gb|ABG74911.1| AtSK12-like protein [Brassica napus]
Length=410

 Score =   171 bits (432),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 96/107 (90%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGH-TVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            MA+VGV P++ +RES+G+ T  VD LPEE N MKI+DDK+MEA +V+GN TE GHIIVTT
Sbjct  1    MATVGVEPSAAVRESNGNVTADVDRLPEETNHMKIQDDKEMEATIVNGNVTETGHIIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  107



>ref|XP_009401663.1| PREDICTED: shaggy-related protein kinase gamma [Musa acuminata 
subsp. malaccensis]
Length=405

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV V P+SG++ +SG +V VD LPEEM+DM+IR+DK++EA V++GNGTE GHIIVTTI
Sbjct  1    MASVSVVPSSGLKNTSGTSVRVDKLPEEMSDMRIREDKEVEATVINGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
             G+ GQPKQT+SY+AER+VGHGSFG+VFQAKCLETGETVAIKKV+Q
Sbjct  61   NGKKGQPKQTVSYMAERVVGHGSFGIVFQAKCLETGETVAIKKVIQ  106



>gb|EPS63877.1| hypothetical protein M569_10905 [Genlisea aurea]
Length=409

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MA+V V  ++G+R+ S    G+D LP+EMN+MK+RDDKD+E AVVDGNGTE GHIIVTTI
Sbjct  1    MAAVSVSSSTGVRDPSNKPGGLDRLPDEMNEMKLRDDKDIEPAVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AERIVG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_010464137.1| PREDICTED: shaggy-related protein kinase gamma [Camelina sativa]
Length=410

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 96/107 (90%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESS-GHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            MASVG+ P++ +R+SS G+   VD LP+EM DMKI+DDK+MEA +V+GN TE GHIIVTT
Sbjct  1    MASVGIDPSAAVRDSSTGNATDVDRLPDEMKDMKIQDDKEMEATIVNGNVTETGHIIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  107



>ref|XP_009403747.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403755.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
Length=412

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            M S+ V P+ G+R +SG    VD LP+EM DMKIRDDK+ E  VVDGNGTE GHIIVTTI
Sbjct  1    MTSISVVPSMGLRNTSGTIGAVDRLPDEMKDMKIRDDKEAEETVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQ  106



>ref|XP_009151155.1| PREDICTED: shaggy-related protein kinase alpha [Brassica rapa]
 emb|CDX88238.1| BnaA06g28290D [Brassica napus]
Length=403

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 92/106 (87%), Gaps = 6/106 (6%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV +PP     +S+G   GVD LPEEMNDMKIRDDK+MEA VVDGN TE GHIIVTTI
Sbjct  1    MASVSIPPPI---DSTG---GVDKLPEEMNDMKIRDDKEMEATVVDGNSTETGHIIVTTI  54

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  55   GGRNGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQ  100



>emb|CDY27737.1| BnaA05g31460D [Brassica napus]
Length=514

 Score =   171 bits (434),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHT-VGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            MA++GV P++ +R+S+ +    VD LPEEMN MKI+DDK+MEA +V+GN TE GHIIVTT
Sbjct  104  MATMGVEPSAAVRDSTANAATDVDRLPEEMNHMKIQDDKEMEATIVNGNVTETGHIIVTT  163

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  164  IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  210



>ref|XP_010492276.1| PREDICTED: shaggy-related protein kinase epsilon [Camelina sativa]
 ref|XP_010492277.1| PREDICTED: shaggy-related protein kinase epsilon [Camelina sativa]
Length=411

 Score =   169 bits (427),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 93/108 (86%), Gaps = 2/108 (2%)
 Frame = +1

Query  157  MASVGVPPASGM--RESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVT  330
            MASVG  PAS M  ++S+      D LPE +N+MKI+DDK+MEAAVVDGNGTE GHIIVT
Sbjct  1    MASVGTLPASSMATKQSNASICAADKLPEGINEMKIKDDKEMEAAVVDGNGTETGHIIVT  60

Query  331  TIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TIGG+NGQPKQTISY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   TIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  108



>ref|XP_009382471.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Musa acuminata subsp. malaccensis]
 ref|XP_009382472.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=409

 Score =   168 bits (426),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASV + P S ++ +S  +VG+D LP+EM+DMKIRDDK++EA V+DGNGTE GHIIVTT+
Sbjct  1    MASVSLVPPSRLKITSSTSVGMDRLPDEMSDMKIRDDKEVEATVIDGNGTETGHIIVTTV  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
             G NGQPKQT+SY+AER+VGHGSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   NGINGQPKQTVSYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQ  106



>emb|CDY05202.1| BnaC05g46010D [Brassica napus]
Length=410

 Score =   168 bits (425),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 95/107 (89%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHT-VGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            MA+VGV P++ +R+S+ +    VD LPEEMN MKI+DDK+MEA +V+GN TE GHIIVTT
Sbjct  1    MATVGVEPSAAVRDSTANAATDVDRLPEEMNHMKIQDDKEMEATIVNGNVTETGHIIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  107



>ref|XP_010248490.1| PREDICTED: shaggy-related protein kinase epsilon [Nelumbo nucifera]
 ref|XP_010248491.1| PREDICTED: shaggy-related protein kinase epsilon [Nelumbo nucifera]
 ref|XP_010248492.1| PREDICTED: shaggy-related protein kinase epsilon [Nelumbo nucifera]
Length=408

 Score =   168 bits (425),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 94/106 (89%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS G+ P S + +  G+++ VD LPEE+N+MKIRDDK+MEA VVD NGTE GHIIVTTI
Sbjct  1    MASAGIAP-SAVGKPDGNSMSVDKLPEEINEMKIRDDKEMEATVVDENGTETGHIIVTTI  59

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AER+VGHGSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  60   GGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQ  105



>gb|AAB61055.1| Similar to shaggy related protein kinase. Belongs to the CDC2/CDKX 
subfamily [Arabidopsis thaliana]
Length=447

 Score =   169 bits (427),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 95/125 (76%), Gaps = 23/125 (18%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P  G R+S+G    VD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGIAPNPGARDSTG----VDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  56

Query  337  GGQNGQPK-------------------QTISYVAERIVGHGSFGVVFQAKCLETGETVAI  459
            GG+NGQPK                   QTISY+AER+VGHGSFGVVFQAKCLETGETVAI
Sbjct  57   GGRNGQPKQLVDWLVFRVFINFSTMSMQTISYMAERVVGHGSFGVVFQAKCLETGETVAI  116

Query  460  KKVLQ  474
            KKVLQ
Sbjct  117  KKVLQ  121



>ref|XP_009386339.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   168 bits (425),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS+ + P+SG +  SG  V VD LP EM+DM+IRDDK++EA V+DGNGTE GHIIVTTI
Sbjct  1    MASMSMVPSSGSKNPSGTNVDVDRLPGEMSDMRIRDDKEVEATVIDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
             G+NGQPKQTISY+AER+VGHGSFG VFQAKCLETGETVAIKKVLQ
Sbjct  61   NGRNGQPKQTISYMAERVVGHGSFGTVFQAKCLETGETVAIKKVLQ  106



>ref|XP_010420109.1| PREDICTED: shaggy-related protein kinase epsilon-like [Camelina 
sativa]
Length=411

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 93/108 (86%), Gaps = 2/108 (2%)
 Frame = +1

Query  157  MASVGVPPASGM--RESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVT  330
            MASVG  PAS M  ++++      D LPE +N+MKI+DDK+MEAAVVDGNGTE GHIIVT
Sbjct  1    MASVGTLPASSMATKQTNASVCAADKLPEGINEMKIKDDKEMEAAVVDGNGTETGHIIVT  60

Query  331  TIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TIGG+NGQPKQTISY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   TIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  108



>gb|KGN65982.1| hypothetical protein Csa_1G560660 [Cucumis sativus]
Length=387

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 91/106 (86%), Gaps = 3/106 (3%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS+GV   S +RE +GH VGVD LPEEMNDMKIRDDK++EA VVDGNGTE GHIIVTTI
Sbjct  1    MASMGVVSTSNLREPAGHNVGVDRLPEEMNDMKIRDDKEVEATVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NG  KQTISY+AER VGHGSFGV   AKCLETGETVAIKKVLQ
Sbjct  61   GGRNGYSKQTISYMAERAVGHGSFGV---AKCLETGETVAIKKVLQ  103



>ref|XP_006650852.1| PREDICTED: shaggy-related protein kinase alpha-like [Oryza brachyantha]
Length=409

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ PASG+R++ G ++GVDSL +EMND+KIRD+K++EA +++GNGTE GHIIVTTI
Sbjct  1    MASVGMAPASGLRDAGGTSLGVDSLHDEMNDLKIRDEKEVEATIINGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+ GQ KQTISY+AER++G GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRGGQRKQTISYMAERVIGQGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_006287860.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 ref|XP_006287861.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 ref|XP_006287862.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 gb|EOA20758.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 gb|EOA20759.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 gb|EOA20760.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
Length=410

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 93/107 (87%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGM-RESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            MASVG  PAS M  + S  ++  D LPE +N+MKI+DDK+MEAAVVDGNGTE GHIIVTT
Sbjct  1    MASVGTLPASSMATKQSNASICADKLPEGINEMKIKDDKEMEAAVVDGNGTETGHIIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  107



>ref|XP_009147201.1| PREDICTED: shaggy-related protein kinase gamma [Brassica rapa]
Length=410

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHT-VGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            MA++GV P++ +R+S+ +    VD LPEEMN MKI+DDK+MEA +V+GN TE GHIIVTT
Sbjct  1    MATMGVEPSAAVRDSTANAATDVDRLPEEMNHMKIQDDKEMEATIVNGNVTETGHIIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER+VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQ  107



>ref|XP_006643997.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Oryza brachyantha]
 ref|XP_006643998.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Oryza brachyantha]
Length=408

 Score =   166 bits (420),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 95/106 (90%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVGV P SG++ SSG ++G + LP++MND+KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASVGVAP-SGLKNSSGTSMGAEKLPDQMNDLKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQT+SY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  60   GGRNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  105



>emb|CAB87631.1| protein kinase MSK-3-like [Arabidopsis thaliana]
Length=408

 Score =   166 bits (420),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 93/107 (87%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGM-RESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            MASVG  PAS M  + S  ++  + LPE +N+MKI+DDK+MEAAVVDGNGTE GHIIVTT
Sbjct  1    MASVGTLPASSMATKQSNASICAEKLPEGINEMKIKDDKEMEAAVVDGNGTETGHIIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  107



>ref|NP_196968.2| Shaggy-related protein kinase 13 [Arabidopsis thaliana]
 sp|Q8VZD5.1|KSG5_ARATH RecName: Full=Shaggy-related protein kinase epsilon; AltName: 
Full=ASK-epsilon [Arabidopsis thaliana]
 gb|AAL57679.1| AT5g14640/T15N1_130 [Arabidopsis thaliana]
 gb|AAQ65089.1| At5g14640/T15N1_130 [Arabidopsis thaliana]
 gb|AED92057.1| Shaggy-related protein kinase 13 [Arabidopsis thaliana]
Length=410

 Score =   166 bits (420),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 93/107 (87%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGM-RESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            MASVG  PAS M  + S  ++  + LPE +N+MKI+DDK+MEAAVVDGNGTE GHIIVTT
Sbjct  1    MASVGTLPASSMATKQSNASICAEKLPEGINEMKIKDDKEMEAAVVDGNGTETGHIIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  107



>ref|XP_010453592.1| PREDICTED: shaggy-related protein kinase epsilon-like [Camelina 
sativa]
Length=411

 Score =   166 bits (419),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 93/108 (86%), Gaps = 2/108 (2%)
 Frame = +1

Query  157  MASVGVPPASGM--RESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVT  330
            MASVG  PAS M  ++S+      D LPE +++MKI+DDK+MEAAVVDGNGTE GHIIVT
Sbjct  1    MASVGTLPASSMATKQSNASICPADKLPEGIDEMKIKDDKEMEAAVVDGNGTETGHIIVT  60

Query  331  TIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TIGG+NGQPKQTISY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   TIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  108



>ref|XP_006399977.1| hypothetical protein EUTSA_v10013689mg [Eutrema salsugineum]
 gb|ESQ41430.1| hypothetical protein EUTSA_v10013689mg [Eutrema salsugineum]
Length=409

 Score =   166 bits (419),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG  P+S   + +  ++  D LPE +N+MKI+DDK+MEAAVVDGNGTE GHIIVTTI
Sbjct  1    MASVGTLPSSMTTKQNNASICADKLPEGINEMKIKDDKEMEAAVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  106



>emb|CDX70574.1| BnaC03g06580D [Brassica napus]
Length=409

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG  P+S        +V VD LPE +N+MKI+DDK+MEAAVVDGNGTE GHIIVTTI
Sbjct  1    MASVGTLPSSTATRKMNDSVCVDKLPEGINEMKIKDDKEMEAAVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG++GQPKQTISY+AER+VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GGKDGQPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQ  106



>emb|CDM82575.1| unnamed protein product [Triticum aestivum]
Length=406

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 94/106 (89%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVGV P SG + SSG ++G + LP++MND+KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASVGVAP-SGHKNSSGTSMGAEKLPDQMNDLKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQT+SY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  60   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  105



>dbj|BAF36565.1| Shaggy-like kinase [Triticum aestivum]
Length=406

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 94/106 (89%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVGV P SG + SSG ++G + LP++MND+KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASVGVAP-SGHKNSSGTSMGAEKLPDQMNDLKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQT+SY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  60   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  105



>ref|XP_002873682.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49941.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 93/107 (87%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGM-RESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            MASVG  PAS +  + S  ++  + LPE +N+MKI+DDK+MEAAVVDGNGTE GHIIVTT
Sbjct  1    MASVGTLPASSVATKQSNASICAEKLPEGINEMKIKDDKEMEAAVVDGNGTETGHIIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  107



>gb|EMT32435.1| Glycogen synthase kinase-3-MsK-3-like protein [Aegilops tauschii]
Length=435

 Score =   164 bits (415),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 94/106 (89%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVGV P SG + SSG ++G + LP++MND+KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  17   MASVGVAP-SGHKNSSGTSMGAEKLPDQMNDLKIRDDKEVEATIINGKGTETGHIIVTTT  75

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQT+SY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  76   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  121



>ref|XP_003566380.1| PREDICTED: shaggy-related protein kinase alpha [Brachypodium 
distachyon]
Length=408

 Score =   163 bits (412),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 94/106 (89%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MASVG+ P SG + SS  ++GV+ LP++MND+KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASVGIVP-SGQKNSSSTSMGVEKLPDQMNDLKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQT+SY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  60   GGRNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  105



>ref|XP_009334099.1| PREDICTED: shaggy-related protein kinase epsilon [Pyrus x bretschneideri]
 ref|XP_009334100.1| PREDICTED: shaggy-related protein kinase epsilon [Pyrus x bretschneideri]
 ref|XP_009334101.1| PREDICTED: shaggy-related protein kinase epsilon [Pyrus x bretschneideri]
Length=410

 Score =   163 bits (412),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPA-SGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            MAS G  PA S ++   G  +  D LPEE+NDMKI+D+K++EAAVV+GNGTE GHIIVTT
Sbjct  1    MASAGTAPAASAVKNRGGSAMFADKLPEEINDMKIKDEKEIEAAVVNGNGTETGHIIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER+VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGRNGQPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQ  107



>emb|CDX78587.1| BnaA03g04990D [Brassica napus]
Length=410

 Score =   163 bits (412),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 94/107 (88%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGM-RESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            MASVG  P+S M  + +  ++ VD LPE +N+MKI+DDK+MEAAVVDGNGTE GHIIVTT
Sbjct  1    MASVGTLPSSTMATKQNNASLCVDKLPEGINEMKIKDDKEMEAAVVDGNGTETGHIIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG++GQPKQTISY+AER+VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGKDGQPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQ  107



>gb|EPS73818.1| hypothetical protein M569_00937, partial [Genlisea aurea]
Length=408

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MA+  V  +SG+R+ +    G+D LP+EMN+MK+RDDKD+E AVVDGN TE GHIIVTTI
Sbjct  1    MAATSVDSSSGVRDPTKKPGGMDRLPDEMNEMKLRDDKDIEPAVVDGNVTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTI Y+AERIVG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   GGRNGQPKQTIGYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQ  106



>ref|XP_009382470.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=421

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = +1

Query  166  VGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTIGGQ  345
            V + P S ++ +S  +VG+D LP+EM+DMKIRDDK++EA V+DGNGTE GHIIVTT+ G 
Sbjct  16   VSLVPPSRLKITSSTSVGMDRLPDEMSDMKIRDDKEVEATVIDGNGTETGHIIVTTVNGI  75

Query  346  NGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            NGQPKQT+SY+AER+VGHGSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  76   NGQPKQTVSYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQ  118



>ref|XP_008666944.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Zea 
mays]
Length=116

 Score =   154 bits (389),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS GV P S  + SS  ++G + L ++MN++KIRDDK++E  +++G GTE GHIIVTT 
Sbjct  1    MASAGVAP-SRYKNSSSTSIGAEKLQDQMNELKIRDDKEVEVTIINGKGTETGHIIVTTT  59

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQT+SY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  60   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  105



>ref|XP_004495878.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-2-like [Cicer 
arietinum]
Length=410

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRE-SSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            MAS GV PASG+ + ++   V  D LP+E++ MKI+DDK+MEA VVDGN TEAGH+IVT 
Sbjct  1    MASAGVAPASGLIDVNTSSVVAADRLPDEIHGMKIKDDKEMEANVVDGNSTEAGHVIVTI  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER VGHGSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGKNGQPKQTISYMAERAVGHGSFGVVFQAKCLETGETVAIKKVLQ  107



>ref|XP_009131419.1| PREDICTED: shaggy-related protein kinase epsilon [Brassica rapa]
Length=410

 Score =   160 bits (404),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVG-VPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            MASVG +P ++        +V VD LPE +N+MKI+DDK+MEAAVVDGNGTE GHIIVTT
Sbjct  1    MASVGTLPSSTTATRKMNDSVCVDKLPEGINEMKIKDDKEMEAAVVDGNGTETGHIIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG++GQPKQTISY+AER+VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGKDGQPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQ  107



>ref|NP_001042602.1| Os01g0252100 [Oryza sativa Japonica Group]
 dbj|BAA92214.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAB40983.1| shaggy-related protein kinase gamma [Oryza sativa (japonica cultivar-group)]
 dbj|BAF04516.1| Os01g0252100 [Oryza sativa Japonica Group]
 dbj|BAG94276.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70327.1| hypothetical protein OsI_01196 [Oryza sativa Indica Group]
 gb|EEE54244.1| hypothetical protein OsJ_01119 [Oryza sativa Japonica Group]
Length=408

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 93/106 (88%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            M SVGV P SG++ SS  ++G + LP++M+D+KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MGSVGVAP-SGLKNSSSTSMGAEKLPDQMHDLKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQT+SY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  60   GGRNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  105



>tpg|DAA52173.1| TPA: putative glycogen synthase kinase family protein [Zea mays]
Length=217

 Score =   154 bits (389),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS GV P S  + SS  ++G + L ++MN++KIRDDK++E  +++G GTE GHIIVTT 
Sbjct  1    MASAGVAP-SRYKNSSSTSIGAEKLQDQMNELKIRDDKEVEVTIINGKGTETGHIIVTTT  59

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQT+SY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  60   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  105



>gb|AES61591.2| glycogen synthase kinase [Medicago truncatula]
Length=412

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRE-SSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            MA+ GV PASG+ + ++   + VD LP+E+  M+I+DDK+MEA VVDGN TEAGH+IVTT
Sbjct  2    MATAGVAPASGLVDVNASSAIAVDKLPDEILGMRIKDDKEMEAHVVDGNSTEAGHVIVTT  61

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER VG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  62   IGGKNGQPKQTISYMAERAVGQGSFGVVFQAKCLETGETVAIKKVLQ  108



>ref|XP_003591340.1| Glycogen synthase kinase-3-like protein [Medicago truncatula]
Length=411

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRE-SSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            MA+ GV PASG+ + ++   + VD LP+E+  M+I+DDK+MEA VVDGN TEAGH+IVTT
Sbjct  1    MATAGVAPASGLVDVNASSAIAVDKLPDEILGMRIKDDKEMEAHVVDGNSTEAGHVIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER VG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGKNGQPKQTISYMAERAVGQGSFGVVFQAKCLETGETVAIKKVLQ  107



>ref|XP_010550142.1| PREDICTED: shaggy-related protein kinase epsilon [Tarenaya hassleriana]
Length=409

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS G  P S   + +  ++  D LPE +NDMKI+DDK+MEAAVVDGNGTE GHIIVTTI
Sbjct  1    MASGGTLPTSVSGKQNNASLIADKLPEGINDMKIKDDKEMEAAVVDGNGTETGHIIVTTI  60

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQTISY+AERIVG GSFG+VFQAKCLETGE VAIKKVLQ
Sbjct  61   GGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLETGEAVAIKKVLQ  106



>ref|XP_011087528.1| PREDICTED: shaggy-related protein kinase alpha isoform X2 [Sesamum 
indicum]
Length=388

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +1

Query  220  VDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYVAERIVGH  399
            +DSLP+EMNDMKIRD+KD+EA +VDGNGTE GH+IVT+IGG+NGQPKQTISY+AER+VGH
Sbjct  1    MDSLPDEMNDMKIRDEKDIEATLVDGNGTETGHVIVTSIGGRNGQPKQTISYMAERVVGH  60

Query  400  GSFGVVFQAKCLETGETVAIKKVLQ  474
            GSFGVVFQAKCLE GETVAIKKVLQ
Sbjct  61   GSFGVVFQAKCLENGETVAIKKVLQ  85



>sp|P51138.1|MSK2_MEDSA RecName: Full=Glycogen synthase kinase-3 homolog MsK-2 [Medicago 
sativa]
 emb|CAA48473.1| protein kinase [Medicago sativa]
Length=411

 Score =   158 bits (400),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRE-SSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            MA+ GV PASG+ + ++   + VD LP+E+  M+I+DDK+MEA VVDGN TEAGH+IVTT
Sbjct  1    MATAGVAPASGIVDVNASSAIAVDKLPDEILGMRIKDDKEMEAHVVDGNSTEAGHVIVTT  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            IGG+NGQPKQTISY+AER VG GSFGVVFQAKCLETGETVAIKKVLQ
Sbjct  61   IGGKNGQPKQTISYMAERAVGQGSFGVVFQAKCLETGETVAIKKVLQ  107



>tpg|DAA53953.1| TPA: putative glycogen synthase kinase family protein [Zea mays]
Length=320

 Score =   155 bits (393),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS GV P SG + SS  ++G + L + MN++KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASAGVAP-SGYKNSSSTSIGAEKLQDHMNELKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQT+SY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  60   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  105



>ref|XP_002455378.1| hypothetical protein SORBIDRAFT_03g009580 [Sorghum bicolor]
 gb|EES00498.1| hypothetical protein SORBIDRAFT_03g009580 [Sorghum bicolor]
Length=408

 Score =   157 bits (398),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS GV P SG + SS  ++GV+ L ++MN++KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASAGVAP-SGFKNSSSASIGVEKLQDQMNEIKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQT+SY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  60   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  105



>ref|XP_009759533.1| PREDICTED: shaggy-related protein kinase epsilon [Nicotiana sylvestris]
Length=410

 Score =   157 bits (398),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 94/109 (86%), Gaps = 4/109 (4%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIV  327
            MAS G+ P++G +  +   + VD LPEE+N+MKIRDDK   +MEAAVVDGNGTE GHIIV
Sbjct  1    MASGGIIPSAGGKPQTDAML-VDKLPEEINEMKIRDDKVEKEMEAAVVDGNGTEKGHIIV  59

Query  328  TTIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TTIGG+NG+PKQTISY+AER+VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  60   TTIGGKNGEPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQ  108



>ref|XP_009598967.1| PREDICTED: shaggy-related protein kinase epsilon [Nicotiana tomentosiformis]
Length=410

 Score =   157 bits (398),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 94/109 (86%), Gaps = 4/109 (4%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIV  327
            MAS G+ P++G +  +   + VD LPEE+N+MKIRDDK   +MEAAVVDGNGTE GHIIV
Sbjct  1    MASGGIIPSAGGKPQTDAML-VDKLPEEINEMKIRDDKVEKEMEAAVVDGNGTEKGHIIV  59

Query  328  TTIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TTIGG+NG+PKQTISY+AER+VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  60   TTIGGKNGEPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQ  108



>tpg|DAA52172.1| TPA: putative glycogen synthase kinase family protein [Zea mays]
Length=263

 Score =   154 bits (389),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS GV P S  + SS  ++G + L ++MN++KIRDDK++E  +++G GTE GHIIVTT 
Sbjct  47   MASAGVAP-SRYKNSSSTSIGAEKLQDQMNELKIRDDKEVEVTIINGKGTETGHIIVTTT  105

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQT+SY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  106  GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  151



>ref|XP_004967857.1| PREDICTED: shaggy-related protein kinase alpha-like [Setaria 
italica]
Length=408

 Score =   157 bits (397),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS GV P SG + SS   VG D L + MN++KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASAGVAP-SGYKHSSSTNVGADKLQDHMNELKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQT+SY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  60   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  105



>gb|AFW79696.1| putative glycogen synthase kinase family protein [Zea mays]
Length=402

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS GV P SG + SS  ++G + L ++MN++KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASAGVAP-SGYKNSSSTSIGAEKLQDQMNELKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQT+SY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  60   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  105



>tpg|DAA53950.1| TPA: putative glycogen synthase kinase family protein [Zea mays]
Length=373

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS GV P SG + SS  ++G + L + MN++KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASAGVAP-SGYKNSSSTSIGAEKLQDHMNELKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQT+SY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  60   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  105



>ref|NP_001148880.1| glycogen synthase kinase-3 MsK-3 [Zea mays]
 ref|XP_008654975.1| PREDICTED: glycogen synthase kinase-3 MsK-3 isoform X1 [Zea mays]
 gb|ACG33274.1| glycogen synthase kinase-3 MsK-3 [Zea mays]
 gb|AFW79697.1| putative glycogen synthase kinase family protein [Zea mays]
Length=408

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS GV P SG + SS  ++G + L ++MN++KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASAGVAP-SGYKNSSSTSIGAEKLQDQMNELKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQT+SY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  60   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  105



>ref|XP_007215466.1| hypothetical protein PRUPE_ppa006497mg [Prunus persica]
 gb|EMJ16665.1| hypothetical protein PRUPE_ppa006497mg [Prunus persica]
Length=409

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  202  SGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYVA  381
            SG+T   D LPEE+N+MKI+D+K+ME AVV+GNGTE GHIIVTTIGG+NGQPKQTISY+A
Sbjct  16   SGNTKFADKLPEEINEMKIKDEKEMETAVVNGNGTETGHIIVTTIGGRNGQPKQTISYMA  75

Query  382  ERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            ER+VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  76   ERVVGQGSFGIVFQAKCLETGETVAIKKVLQ  106



>ref|XP_008230580.1| PREDICTED: shaggy-related protein kinase epsilon [Prunus mume]
Length=409

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  202  SGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYVA  381
            SG+T   D LPEE+N+MKI+D+K+ME AVV+GNGTE GHIIVTTIGG+NGQPKQTISY+A
Sbjct  16   SGNTKFADKLPEEINEMKIKDEKEMETAVVNGNGTETGHIIVTTIGGRNGQPKQTISYMA  75

Query  382  ERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            ER+VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  76   ERVVGQGSFGIVFQAKCLETGETVAIKKVLQ  106



>ref|XP_007031506.1| Shaggy-like kinase 13 isoform 3 [Theobroma cacao]
 gb|EOY02432.1| Shaggy-like kinase 13 isoform 3 [Theobroma cacao]
Length=413

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 93/109 (85%), Gaps = 3/109 (3%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIV  327
            MAS G+   S + + +G+T  VD LPEE+N+MKI+D+K   +MEA VVDGNGTE GHIIV
Sbjct  1    MASTGMAATSVVGKPTGNTTFVDKLPEEINEMKIKDEKVEKEMEATVVDGNGTETGHIIV  60

Query  328  TTIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TTIGG+NG+PKQTISY+AER+VG GSFG+VFQAKCLE+GETVAIKKVLQ
Sbjct  61   TTIGGRNGEPKQTISYMAERVVGQGSFGIVFQAKCLESGETVAIKKVLQ  109



>ref|XP_007031504.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
 ref|XP_007031505.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
 gb|EOY02430.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
 gb|EOY02431.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
Length=412

 Score =   155 bits (393),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 93/109 (85%), Gaps = 3/109 (3%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIV  327
            MAS G+   S + + +G+T  VD LPEE+N+MKI+D+K   +MEA VVDGNGTE GHIIV
Sbjct  1    MASTGMAATSVVGKPTGNTTFVDKLPEEINEMKIKDEKVEKEMEATVVDGNGTETGHIIV  60

Query  328  TTIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TTIGG+NG+PKQTISY+AER+VG GSFG+VFQAKCLE+GETVAIKKVLQ
Sbjct  61   TTIGGRNGEPKQTISYMAERVVGQGSFGIVFQAKCLESGETVAIKKVLQ  109



>tpg|DAA53951.1| TPA: putative glycogen synthase kinase family protein [Zea mays]
Length=408

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS GV P SG + SS  ++G + L + MN++KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASAGVAP-SGYKNSSSTSIGAEKLQDHMNELKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQT+SY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  60   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  105



>ref|NP_001150105.1| LOC100283734 [Zea mays]
 gb|ACG37853.1| glycogen synthase kinase-3 MsK-3 [Zea mays]
Length=408

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS GV P SG + SS  ++G + L + MN++KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASAGVAP-SGYKNSSSTSIGAEKLQDHMNELKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQT+SY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  60   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  105



>emb|CAA58594.1| Petunia Shaggy kinase 4 [Petunia x hybrida]
Length=409

 Score =   155 bits (392),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 94/109 (86%), Gaps = 5/109 (5%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIV  327
            MAS G+ P++G +  +   + VD LPEE+N+MKIRDDK   +MEAAVVDGNGTE GHIIV
Sbjct  1    MAS-GIMPSAGGKHRTDAML-VDKLPEEINEMKIRDDKAEKEMEAAVVDGNGTEKGHIIV  58

Query  328  TTIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TTIGG+NG+PKQTISY+AER+VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  59   TTIGGKNGEPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQ  107



>tpg|DAA53952.1| TPA: putative glycogen synthase kinase family protein [Zea mays]
Length=450

 Score =   156 bits (394),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS GV P SG + SS  ++G + L + MN++KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASAGVAP-SGYKNSSSTSIGAEKLQDHMNELKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQT+SY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  60   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  105



>ref|XP_006364003.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006364004.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X2 [Solanum tuberosum]
Length=410

 Score =   155 bits (392),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 93/109 (85%), Gaps = 4/109 (4%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIV  327
            MAS  + P++G +  +   + VD LPEE+N+MKIRDDK   +MEAAVVDGNGTE GHIIV
Sbjct  1    MASGCIMPSAGGKPQTDAML-VDKLPEEINEMKIRDDKAEKEMEAAVVDGNGTEKGHIIV  59

Query  328  TTIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TTIGG+NG+PKQTISY+AER+VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  60   TTIGGKNGEPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQ  108



>ref|XP_008672929.1| PREDICTED: LOC100283734 isoform X1 [Zea mays]
Length=438

 Score =   155 bits (393),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS GV P SG + SS  ++G + L + MN++KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASAGVAP-SGYKNSSSTSIGAEKLQDHMNELKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQT+SY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  60   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  105



>ref|XP_004252661.1| PREDICTED: shaggy-related protein kinase epsilon isoform X1 [Solanum 
lycopersicum]
Length=410

 Score =   155 bits (391),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 93/109 (85%), Gaps = 4/109 (4%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIV  327
            MAS  + P++G +  +   + VD LPEE+N+MKIRDDK   +MEAAVVDGNGTE GHIIV
Sbjct  1    MASGCIMPSAGGKPHTDAML-VDKLPEEINEMKIRDDKAEKEMEAAVVDGNGTEKGHIIV  59

Query  328  TTIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TTIGG+NG+PKQTISY+AER+VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  60   TTIGGKNGEPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQ  108



>ref|XP_010108792.1| Shaggy-related protein kinase epsilon [Morus notabilis]
 gb|EXC20307.1| Shaggy-related protein kinase epsilon [Morus notabilis]
Length=1931

 Score =   160 bits (406),  Expect = 8e-42, Method: Composition-based stats.
 Identities = 79/109 (72%), Positives = 93/109 (85%), Gaps = 3/109 (3%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIV  327
            MAS G  PAS + +  G+T   D LP+E+N+MKI+D+K   ++EAAVVDGNGTE GHIIV
Sbjct  1    MASAGAAPASTVGKPGGNTGFADKLPDEINEMKIKDEKAEKEVEAAVVDGNGTETGHIIV  60

Query  328  TTIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TTIGG+NGQPKQTISY+AER+VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   TTIGGRNGQPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQ  109



>ref|XP_002987888.1| GSK3/shaggy-like protein kinase [Selaginella moellendorffii]
 ref|XP_002994033.1| hypothetical protein SELMODRAFT_163279 [Selaginella moellendorffii]
 gb|EFJ04915.1| hypothetical protein SELMODRAFT_163279 [Selaginella moellendorffii]
 gb|EFJ10962.1| GSK3/shaggy-like protein kinase [Selaginella moellendorffii]
Length=423

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 91/120 (76%), Gaps = 14/120 (12%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTV-------GVDSLPEEMNDMKIRDDK-------DMEAAVVD  294
            MAS  V P   +R S+   V       GVD LPEEM++MKIRDDK       ++EA VVD
Sbjct  1    MASASVGPVGAIRGSTSAIVVSKVGGSGVDQLPEEMHEMKIRDDKTDHSDDKELEATVVD  60

Query  295  GNGTEAGHIIVTTIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GNGTE GHII TTIGG+NGQPKQTISYVAER+VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GNGTETGHIIATTIGGRNGQPKQTISYVAERVVGTGSFGIVFQAKCLETGETVAIKKVLQ  120



>gb|EPS68300.1| hypothetical protein M569_06467 [Genlisea aurea]
Length=411

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +1

Query  184  SGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQ  363
            +G+R  +     +D LP+EMN+MKIRDDKD+E AVVDGNGTE GHIIVTTIGG+NGQPKQ
Sbjct  11   AGVRGPAKKPGCLDRLPDEMNEMKIRDDKDIEPAVVDGNGTETGHIIVTTIGGRNGQPKQ  70

Query  364  TISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
             ISY+AERIVG GSFGVVFQAKCLETGE VAIKKVLQ
Sbjct  71   KISYMAERIVGQGSFGVVFQAKCLETGEAVAIKKVLQ  107



>emb|CBI39647.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/78 (92%), Positives = 76/78 (97%), Gaps = 0/78 (0%)
 Frame = +1

Query  241  MNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYVAERIVGHGSFGVVF  420
            MNDMKIRDDK+MEA VVDGNGTE GHIIVTTIGG+NGQPKQTISY+AER+VGHGSFGVVF
Sbjct  1    MNDMKIRDDKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVF  60

Query  421  QAKCLETGETVAIKKVLQ  474
            QAKCLETGETVAIKKVLQ
Sbjct  61   QAKCLETGETVAIKKVLQ  78



>ref|XP_008357735.1| PREDICTED: shaggy-related protein kinase epsilon [Malus domestica]
Length=410

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +1

Query  205  GHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYVAE  384
            G     D LPEE+NDMKI+D+K++EAAVV+GNGTE GHIIVTTIGG+NGQPKQTISY+AE
Sbjct  18   GSAXFADKLPEEINDMKIKDEKEIEAAVVNGNGTETGHIIVTTIGGRNGQPKQTISYMAE  77

Query  385  RIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            R+VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  78   RVVGQGSFGIVFQAKCLETGETVAIKKVLQ  107



>ref|XP_004252662.1| PREDICTED: shaggy-related protein kinase epsilon isoform X2 [Solanum 
lycopersicum]
 ref|XP_010314527.1| PREDICTED: shaggy-related protein kinase epsilon isoform X2 [Solanum 
lycopersicum]
Length=392

 Score =   153 bits (386),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 82/88 (93%), Gaps = 3/88 (3%)
 Frame = +1

Query  220  VDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYVAERI  390
            VD LPEE+N+MKIRDDK   +MEAAVVDGNGTE GHIIVTTIGG+NG+PKQTISY+AER+
Sbjct  3    VDKLPEEINEMKIRDDKAEKEMEAAVVDGNGTEKGHIIVTTIGGKNGEPKQTISYMAERV  62

Query  391  VGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  63   VGQGSFGIVFQAKCLETGETVAIKKVLQ  90



>gb|EMT09676.1| Shaggy-related protein kinase alpha [Aegilops tauschii]
Length=418

 Score =   153 bits (387),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 93/106 (88%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            M S GV PASG+R++ G +  VD LP+E+++M+I D+K++EA +++GNGTEAGHIIVTTI
Sbjct  1    MTSFGVAPASGLRDAGGSS-EVDKLPDEISNMRISDEKEVEATIINGNGTEAGHIIVTTI  59

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG++GQ KQTISY+AER++G GSFGVVFQAKCLET ETVAIKKVLQ
Sbjct  60   GGRDGQRKQTISYMAERVIGQGSFGVVFQAKCLETSETVAIKKVLQ  105



>dbj|BAJ99594.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=408

 Score =   153 bits (386),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 93/106 (88%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            M S GV PASG+R++ G +  VD LP+E+++M+I D+K++EA +++GNGTEAGHIIVTTI
Sbjct  1    MTSFGVAPASGLRDAGGSS-EVDRLPDEISNMRISDEKEVEATIINGNGTEAGHIIVTTI  59

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG++GQ KQTISY+AER++G GSFGVVFQAKCLET ETVAIKKVLQ
Sbjct  60   GGRDGQRKQTISYMAERVIGQGSFGVVFQAKCLETSETVAIKKVLQ  105



>gb|AEN14336.1| hypothetical protein rf1-C1-g7 [Zea mays]
Length=408

 Score =   153 bits (386),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            MAS GV P SG + SS  ++G + L + MN++KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASAGVAP-SGYKNSSSTSIGAEKLQDHMNELKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG+NGQPKQ +SY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  60   GGKNGQPKQAMSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  105



>ref|XP_010660897.1| PREDICTED: shaggy-related protein kinase epsilon isoform X2 [Vitis 
vinifera]
Length=393

 Score =   152 bits (385),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 81/88 (92%), Gaps = 3/88 (3%)
 Frame = +1

Query  220  VDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYVAERI  390
            VD LPEE+N+MKIRDDK   +MEA VVDGNGTE GHIIVTTIGG+NGQPKQTISY+AER+
Sbjct  3    VDKLPEEINEMKIRDDKVEKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERV  62

Query  391  VGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  63   VGQGSFGIVFQAKCLETGETVAIKKVLQ  90



>gb|EMS62368.1| Shaggy-related protein kinase alpha [Triticum urartu]
Length=455

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 93/106 (88%), Gaps = 1/106 (1%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  336
            M S GV PASG+R++ G +  VD LP+E+++M+I D+K++EA +++GNGTEAGHIIVTTI
Sbjct  1    MTSFGVAPASGLRDAGGSS-EVDKLPDEISNMRISDEKEVEATIINGNGTEAGHIIVTTI  59

Query  337  GGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            GG++GQ KQTISY+AER++G GSFGVVFQAKCLET ETVAIKKVLQ
Sbjct  60   GGRDGQRKQTISYMAERVIGQGSFGVVFQAKCLETSETVAIKKVLQ  105



>gb|KDO66111.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
Length=210

 Score =   146 bits (369),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 80/88 (91%), Gaps = 3/88 (3%)
 Frame = +1

Query  220  VDSLPEEMNDMKI---RDDKDMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYVAERI  390
            VD LPEE+N+MKI   R +K+MEA VVDGNGTE GHIIVTTIGG+NGQPKQTISY+AER+
Sbjct  39   VDKLPEEINEMKIKGERVEKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERV  98

Query  391  VGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  99   VGQGSFGIVFQAKCLETGETVAIKKVLQ  126



>ref|XP_004304635.1| PREDICTED: shaggy-related protein kinase epsilon [Fragaria vesca 
subsp. vesca]
Length=412

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +1

Query  223  DSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYVAERIVGHG  402
            D LPEE+N+MKI+D+K++EAAVV+GNGTE GHIIVTTIGG+NGQPKQT+SY+AER+VG G
Sbjct  26   DKLPEEINEMKIKDEKEIEAAVVNGNGTETGHIIVTTIGGRNGQPKQTVSYMAERVVGQG  85

Query  403  SFGVVFQAKCLETGETVAIKKVLQ  474
            SFG+VFQAKCLETGETVAIKKVLQ
Sbjct  86   SFGIVFQAKCLETGETVAIKKVLQ  109



>emb|CDP02094.1| unnamed protein product [Coffea canephora]
Length=410

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 92/109 (84%), Gaps = 4/109 (4%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIV  327
            MAS GV P S + +     + VD LPEE+N+MKI+D+K   +M+AAVVDGNGTE GHIIV
Sbjct  1    MASGGVMP-SAVGKPKIDAMLVDKLPEEINEMKIKDEKVEKEMDAAVVDGNGTETGHIIV  59

Query  328  TTIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TTIGG+NGQPKQ+ISY+AERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  60   TTIGGKNGQPKQSISYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  108



>ref|XP_011097427.1| PREDICTED: shaggy-related protein kinase epsilon-like [Sesamum 
indicum]
Length=407

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 82/88 (93%), Gaps = 3/88 (3%)
 Frame = +1

Query  220  VDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYVAERI  390
            VD LPEE+N+MKI+D+K   +MEAAVVDGNGTE GHIIVTTIGG+NGQPKQTISY+AERI
Sbjct  18   VDKLPEEINEMKIKDEKVEKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERI  77

Query  391  VGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            VG GSFG+VFQAKCLE+GETVAIKKVLQ
Sbjct  78   VGQGSFGIVFQAKCLESGETVAIKKVLQ  105



>emb|CBI37005.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/78 (91%), Positives = 75/78 (96%), Gaps = 0/78 (0%)
 Frame = +1

Query  241  MNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYVAERIVGHGSFGVVF  420
            MNDMKIRDDK+ME  VVDGNGTE GHIIVTTIGG+NGQPKQTISY+AER+VGHGSFGVVF
Sbjct  1    MNDMKIRDDKEMEDTVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGVVF  60

Query  421  QAKCLETGETVAIKKVLQ  474
            QAKCLETGETVAIKKVLQ
Sbjct  61   QAKCLETGETVAIKKVLQ  78



>gb|KDO66112.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
 gb|KDO66113.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
 gb|KDO66114.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
Length=244

 Score =   147 bits (370),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 80/88 (91%), Gaps = 3/88 (3%)
 Frame = +1

Query  220  VDSLPEEMNDMKI---RDDKDMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYVAERI  390
            VD LPEE+N+MKI   R +K+MEA VVDGNGTE GHIIVTTIGG+NGQPKQTISY+AER+
Sbjct  39   VDKLPEEINEMKIKGERVEKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERV  98

Query  391  VGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  99   VGQGSFGIVFQAKCLETGETVAIKKVLQ  126



>gb|KDO66115.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
Length=243

 Score =   146 bits (369),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 80/88 (91%), Gaps = 3/88 (3%)
 Frame = +1

Query  220  VDSLPEEMNDMKI---RDDKDMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYVAERI  390
            VD LPEE+N+MKI   R +K+MEA VVDGNGTE GHIIVTTIGG+NGQPKQTISY+AER+
Sbjct  39   VDKLPEEINEMKIKGERVEKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERV  98

Query  391  VGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  99   VGQGSFGIVFQAKCLETGETVAIKKVLQ  126



>gb|EYU34726.1| hypothetical protein MIMGU_mgv1a007335mg [Erythranthe guttata]
Length=407

 Score =   150 bits (378),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 81/88 (92%), Gaps = 3/88 (3%)
 Frame = +1

Query  220  VDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYVAERI  390
            V  LPEE+N+MKI+D+K   +MEAAVVDGNGTE GHIIVTTIGG+NGQPKQTISY+AERI
Sbjct  18   VSKLPEEINEMKIKDEKVEKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERI  77

Query  391  VGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  78   VGQGSFGIVFQAKCLETGETVAIKKVLQ  105



>emb|CDX78658.1| BnaA03g05700D [Brassica napus]
Length=568

 Score =   151 bits (382),  Expect = 7e-40, Method: Composition-based stats.
 Identities = 74/101 (73%), Positives = 87/101 (86%), Gaps = 1/101 (1%)
 Frame = +1

Query  172  VPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTIGGQNG  351
            +P  S    ++G +V VD LPE +N+MKI+DDK+MEAAVVDGNGTE GHIIVTTIG ++G
Sbjct  83   LPSTSPTTHNNG-SVCVDKLPEGINEMKIKDDKEMEAAVVDGNGTETGHIIVTTIGCKDG  141

Query  352  QPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            QPKQTISY+AER+V  GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  142  QPKQTISYMAERVVEQGSFGIVFQAKCLETGETVAIKKVLQ  182



>ref|XP_006446534.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 ref|XP_006446536.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 gb|ESR59774.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 gb|ESR59776.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
Length=429

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 82/90 (91%), Gaps = 3/90 (3%)
 Frame = +1

Query  214  VGVDSLPEEMNDMKIRDD---KDMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYVAE  384
            + VD LPEE+N+MKI+D+   K+MEA VVDGNGTE GHIIVTTIGG+NGQPKQTISY+AE
Sbjct  37   MPVDKLPEEINEMKIKDERVEKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAE  96

Query  385  RIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            R+VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  97   RVVGQGSFGIVFQAKCLETGETVAIKKVLQ  126



>ref|XP_004232308.1| PREDICTED: shaggy-related protein kinase epsilon [Solanum lycopersicum]
 ref|XP_010316289.1| PREDICTED: shaggy-related protein kinase epsilon [Solanum lycopersicum]
Length=410

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 82/90 (91%), Gaps = 3/90 (3%)
 Frame = +1

Query  214  VGVDSLPEEMNDMKIRDDKD---MEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYVAE  384
            V +D+LP+E+N MKI DDK+   MEAAVVDGNGTE GHIIVTTIGG+NGQPKQTISY+AE
Sbjct  19   VLIDNLPKEINAMKINDDKEGKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAE  78

Query  385  RIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            R+VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  79   RVVGQGSFGIVFQAKCLETGETVAIKKVLQ  108



>ref|XP_006470301.1| PREDICTED: shaggy-related protein kinase epsilon-like [Citrus 
sinensis]
Length=429

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 91/126 (72%), Gaps = 20/126 (16%)
 Frame = +1

Query  157  MASVGVPPASGMRESSGHTV-----------------GVDSLPEEMNDMKI---RDDKDM  276
            M S G+ PAS + +  G  V                  VD LPEE+N+MKI   R +K+M
Sbjct  1    MYSTGMAPASAVAKPDGDDVMIVDKLPAKPDDDDDAMPVDKLPEEINEMKIKGERVEKEM  60

Query  277  EAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVA  456
            EA VVDGNGTE GHIIVTTIGG+NGQPKQTISY+AER+VG GSFG+VFQAKCLETGETVA
Sbjct  61   EATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGQGSFGIVFQAKCLETGETVA  120

Query  457  IKKVLQ  474
            IKKVLQ
Sbjct  121  IKKVLQ  126



>gb|EYU34725.1| hypothetical protein MIMGU_mgv1a007335mg [Erythranthe guttata]
Length=410

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 81/91 (89%), Gaps = 6/91 (7%)
 Frame = +1

Query  220  VDSLPEEMNDMKIRDDK------DMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYVA  381
            V  LPEE+N+MKI+D+K      +MEAAVVDGNGTE GHIIVTTIGG+NGQPKQTISY+A
Sbjct  18   VSKLPEEINEMKIKDEKVEKVEIEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMA  77

Query  382  ERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            ERIVG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  78   ERIVGQGSFGIVFQAKCLETGETVAIKKVLQ  108



>ref|XP_006338577.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X2 [Solanum tuberosum]
Length=404

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 81/88 (92%), Gaps = 3/88 (3%)
 Frame = +1

Query  220  VDSLPEEMNDMKIRDDKD---MEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYVAERI  390
            +D+LP+E+N+MKI DDK+   MEA VVDGNGTE GHIIVTTIGG+NGQPKQTISY+AER+
Sbjct  15   IDNLPKEINEMKINDDKEGKEMEATVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERV  74

Query  391  VGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  75   VGQGSFGIVFQAKCLETGETVAIKKVLQ  102



>ref|XP_006338576.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X1 [Solanum tuberosum]
Length=410

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 81/88 (92%), Gaps = 3/88 (3%)
 Frame = +1

Query  220  VDSLPEEMNDMKIRDDKD---MEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYVAERI  390
            +D+LP+E+N+MKI DDK+   MEA VVDGNGTE GHIIVTTIGG+NGQPKQTISY+AER+
Sbjct  21   IDNLPKEINEMKINDDKEGKEMEATVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERV  80

Query  391  VGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  81   VGQGSFGIVFQAKCLETGETVAIKKVLQ  108



>ref|XP_006654010.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Oryza brachyantha]
 ref|XP_006654011.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Oryza brachyantha]
Length=410

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 87/107 (81%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPAS-GMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            MASVGV  +S G +  +  +  VD LP EM+ M IRDDKD+E  VV+GNGTE GHIIVT+
Sbjct  1    MASVGVVRSSLGFQNETSTSGDVDRLPNEMSTMSIRDDKDIEDIVVNGNGTEPGHIIVTS  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            I G+NGQ KQTISY+AER+VGHGSFG VFQAKCLETGETVAIKKVLQ
Sbjct  61   IDGRNGQAKQTISYMAERVVGHGSFGTVFQAKCLETGETVAIKKVLQ  107



>gb|KDO86034.1| hypothetical protein CISIN_1g011138mg [Citrus sinensis]
Length=272

 Score =   144 bits (364),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 89/117 (76%), Gaps = 11/117 (9%)
 Frame = +1

Query  157  MASVGVPPASGMRESSG----HTVGVDSLPEEMNDMKIRD-------DKDMEAAVVDGNG  303
            MAS  + P +   E++        G D LP+EMN+M+IRD       DKD+E ++V+GNG
Sbjct  56   MASTSLEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDDKDLEPSIVNGNG  115

Query  304  TEAGHIIVTTIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TEAG +I TT+GG+NGQPKQTISY+AER+VG GSFGVVFQAKCLETG++VAIKKVLQ
Sbjct  116  TEAGQVIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVLQ  172



>gb|KDO86031.1| hypothetical protein CISIN_1g011138mg [Citrus sinensis]
Length=492

 Score =   148 bits (373),  Expect = 8e-39, Method: Composition-based stats.
 Identities = 71/117 (61%), Positives = 89/117 (76%), Gaps = 11/117 (9%)
 Frame = +1

Query  157  MASVGVPPASGMRESSG----HTVGVDSLPEEMNDMKIRD-------DKDMEAAVVDGNG  303
            MAS  + P +   E++        G D LP+EMN+M+IRD       DKD+E ++V+GNG
Sbjct  56   MASTSLEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDDKDLEPSIVNGNG  115

Query  304  TEAGHIIVTTIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TEAG +I TT+GG+NGQPKQTISY+AER+VG GSFGVVFQAKCLETG++VAIKKVLQ
Sbjct  116  TEAGQVIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVLQ  172



>gb|EMS49677.1| Glycogen synthase kinase-3-like protein MsK-3 [Triticum urartu]
Length=473

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  214  VGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYVAERIV  393
            +G + LP++MND+KIRDDK++EA +++G GTE GHIIVTT GG+NGQPKQT+SY+AERIV
Sbjct  1    MGAEKLPDQMNDLKIRDDKEVEATIINGKGTETGHIIVTTTGGKNGQPKQTVSYMAERIV  60

Query  394  GHGSFGVVFQAKCLETGETVAIKKVLQ  474
            G GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GQGSFGIVFQAKCLETGETVAIKKVLQ  87



>ref|XP_002991115.1| hypothetical protein SELMODRAFT_451471 [Selaginella moellendorffii]
 ref|XP_002991645.1| hypothetical protein SELMODRAFT_186226 [Selaginella moellendorffii]
 gb|EFJ07216.1| hypothetical protein SELMODRAFT_186226 [Selaginella moellendorffii]
 gb|EFJ07923.1| hypothetical protein SELMODRAFT_451471 [Selaginella moellendorffii]
Length=456

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 81/93 (87%), Gaps = 8/93 (9%)
 Frame = +1

Query  220  VDSLPEEMNDMKIRDDK--------DMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISY  375
            VD LP+EM++MKIRDDK        ++EAAV+DGNGTE GHII TTIGG+NGQPKQTISY
Sbjct  61   VDQLPDEMHEMKIRDDKAATHIDEKEVEAAVIDGNGTETGHIIATTIGGRNGQPKQTISY  120

Query  376  VAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            VAER+VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  121  VAERVVGTGSFGIVFQAKCLETGETVAIKKVLQ  153



>ref|XP_003569078.1| PREDICTED: shaggy-related protein kinase alpha-like [Brachypodium 
distachyon]
Length=411

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 85/108 (79%), Gaps = 2/108 (2%)
 Frame = +1

Query  157  MASVGV--PPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVT  330
            MASVG   P + G +  +  +   D LP EM +M IRDDKD+E  VV+GNGTE GHIIVT
Sbjct  1    MASVGAVRPSSMGFQNDTSTSGDADRLPNEMGNMSIRDDKDIEDIVVNGNGTEPGHIIVT  60

Query  331  TIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            +I G+NGQ KQTISY+AER+VGHGSFG VFQAKCLETGETVAIKKVLQ
Sbjct  61   SIEGRNGQAKQTISYMAERVVGHGSFGTVFQAKCLETGETVAIKKVLQ  108



>ref|XP_004960405.1| PREDICTED: shaggy-related protein kinase alpha-like [Setaria 
italica]
Length=410

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +1

Query  157  MASVGVPPAS-GMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  333
            MAS GV  +S G +  +  +   D LP E+ +M IRDDKD+E  VV+GNGTE GHIIVT+
Sbjct  1    MASAGVARSSLGFQNDTSSSSDADRLPNELGNMSIRDDKDIEDIVVNGNGTEPGHIIVTS  60

Query  334  IGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            I G+NGQ KQTISY+AER+VGHGSFG VFQAKCLETGETVAIKKVLQ
Sbjct  61   IDGRNGQAKQTISYMAERVVGHGSFGTVFQAKCLETGETVAIKKVLQ  107



>gb|AAQ23107.1| shaggy-related protein kinase 2 [Physcomitrella patens]
 gb|AAQ23112.1| shaggy-related protein kinase 2 [Physcomitrella patens]
Length=423

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 82/93 (88%), Gaps = 7/93 (8%)
 Frame = +1

Query  217  GVDSLPEEMNDMKIRDDK-------DMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISY  375
            GV+SLP+EM+DMK+RDDK       ++EA+VVDGNGTE GHII TTIGG+NGQPKQTISY
Sbjct  28   GVESLPKEMHDMKLRDDKVDHSDDKEIEASVVDGNGTETGHIIATTIGGKNGQPKQTISY  87

Query  376  VAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
             AER+VG GSFG+VFQAKC+ETGETVAIKKVLQ
Sbjct  88   SAERVVGTGSFGIVFQAKCIETGETVAIKKVLQ  120



>ref|XP_001763265.1| predicted protein [Physcomitrella patens]
 gb|EDQ71795.1| predicted protein [Physcomitrella patens]
Length=423

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 82/93 (88%), Gaps = 7/93 (8%)
 Frame = +1

Query  217  GVDSLPEEMNDMKIRDDK-------DMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISY  375
            GV+SLP+EM+DMK+RDDK       ++EA+VVDGNGTE GHII TTIGG+NGQPKQTISY
Sbjct  28   GVESLPKEMHDMKLRDDKVDHSDDKEIEASVVDGNGTETGHIIATTIGGKNGQPKQTISY  87

Query  376  VAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
             AER+VG GSFG+VFQAKC+ETGETVAIKKVLQ
Sbjct  88   SAERVVGTGSFGIVFQAKCIETGETVAIKKVLQ  120



>gb|KDO86033.1| hypothetical protein CISIN_1g011138mg [Citrus sinensis]
Length=349

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 89/117 (76%), Gaps = 11/117 (9%)
 Frame = +1

Query  157  MASVGVPPASGMRESSG----HTVGVDSLPEEMNDMKIRD-------DKDMEAAVVDGNG  303
            MAS  + P +   E++        G D LP+EMN+M+IRD       DKD+E ++V+GNG
Sbjct  56   MASTSLEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDDKDLEPSIVNGNG  115

Query  304  TEAGHIIVTTIGGQNGQPKQTISYVAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  474
            TEAG +I TT+GG+NGQPKQTISY+AER+VG GSFGVVFQAKCLETG++VAIKKVLQ
Sbjct  116  TEAGQVIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVLQ  172



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552245584395