BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF010O24

Length=526
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009619763.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    182   3e-50   Nicotiana tomentosiformis
ref|XP_009788969.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    181   4e-50   Nicotiana sylvestris
ref|XP_009788970.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    181   4e-50   Nicotiana sylvestris
ref|XP_009796493.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    180   2e-49   Nicotiana sylvestris
ref|XP_009614011.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    180   2e-49   Nicotiana tomentosiformis
ref|XP_011079189.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    178   4e-49   Sesamum indicum [beniseed]
ref|XP_009777352.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    177   2e-48   Nicotiana sylvestris
ref|XP_009777355.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    177   2e-48   Nicotiana sylvestris
emb|CDO97777.1|  unnamed protein product                                176   2e-48   Coffea canephora [robusta coffee]
ref|XP_011072711.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    176   3e-48   Sesamum indicum [beniseed]
ref|XP_009591325.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    176   5e-48   Nicotiana tomentosiformis
ref|XP_006357429.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    174   2e-47   
ref|XP_010654359.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    173   5e-47   Vitis vinifera
emb|CBI35784.3|  unnamed protein product                                172   8e-47   Vitis vinifera
ref|XP_004241858.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    169   8e-46   Solanum lycopersicum
gb|EYU21256.1|  hypothetical protein MIMGU_mgv1a002171mg                168   2e-45   Erythranthe guttata [common monkey flower]
gb|EYU21255.1|  hypothetical protein MIMGU_mgv1a002171mg                168   2e-45   Erythranthe guttata [common monkey flower]
ref|XP_004235517.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    162   5e-43   
ref|XP_006342885.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    161   8e-43   Solanum tuberosum [potatoes]
ref|XP_011048642.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    160   2e-42   Populus euphratica
gb|ABO31100.1|  ovule receptor-like kinase 28                           159   5e-42   Solanum chacoense
gb|EPS61932.1|  ovule receptor-like kinase 28                           158   7e-42   Genlisea aurea
ref|NP_974311.1|  STRUBBELIG-receptor family 7 protein                  158   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974312.1|  STRUBBELIG-receptor family 7 protein                  158   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188052.2|  STRUBBELIG-receptor family 7 protein                  158   1e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KFK38799.1|  hypothetical protein AALP_AA3G161700                    158   1e-41   Arabis alpina [alpine rockcress]
ref|XP_010655240.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    156   3e-41   
ref|XP_008781708.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    156   3e-41   Phoenix dactylifera
emb|CBI18374.3|  unnamed protein product                                156   4e-41   Vitis vinifera
ref|XP_010655239.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    156   4e-41   Vitis vinifera
emb|CDY36601.1|  BnaC06g06540D                                          156   4e-41   Brassica napus [oilseed rape]
ref|XP_009408730.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    156   4e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006392757.1|  hypothetical protein EUTSA_v10011271mg             156   6e-41   
ref|XP_006392758.1|  hypothetical protein EUTSA_v10011271mg             156   6e-41   Eutrema salsugineum [saltwater cress]
ref|XP_009147586.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    156   7e-41   Brassica rapa
ref|XP_010462281.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    156   7e-41   Camelina sativa [gold-of-pleasure]
emb|CDY24077.1|  BnaA06g00750D                                          155   7e-41   Brassica napus [oilseed rape]
ref|XP_010501035.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    155   7e-41   Camelina sativa [gold-of-pleasure]
ref|XP_006304699.1|  hypothetical protein CARUB_v10011957mg             155   8e-41   Capsella rubella
ref|XP_010479951.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    155   8e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010489831.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    152   8e-41   Camelina sativa [gold-of-pleasure]
ref|XP_004252624.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    155   9e-41   Solanum lycopersicum
gb|ABB20817.1|  putative leucine-rich repeat transmembrane protei...    155   1e-40   Isatis tinctoria [woad]
ref|XP_010501850.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    155   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010465325.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    155   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_009106960.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    154   3e-40   Brassica rapa
ref|XP_009398614.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    153   4e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK35699.1|  hypothetical protein AALP_AA4G025700                    153   5e-40   Arabis alpina [alpine rockcress]
ref|XP_006362102.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    153   5e-40   Solanum tuberosum [potatoes]
emb|CDY02495.1|  BnaA08g01020D                                          152   1e-39   
gb|KDP25030.1|  hypothetical protein JCGZ_22565                         152   2e-39   Jatropha curcas
ref|XP_002320001.2|  leucine-rich repeat transmembrane protein ki...    152   2e-39   
ref|XP_011011656.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    152   2e-39   Populus euphratica
ref|XP_006369070.1|  leucine-rich repeat transmembrane protein ki...    151   3e-39   
ref|XP_006300068.1|  hypothetical protein CARUB_v10016296mg             151   4e-39   Capsella rubella
ref|XP_002513297.1|  strubbelig receptor, putative                      150   4e-39   
ref|XP_010542346.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    150   5e-39   Tarenaya hassleriana [spider flower]
ref|XP_010928729.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    150   5e-39   
gb|AAG51973.1|AC024260_11  leucine-rich repeat transmembrane prot...    149   6e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010245765.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    150   7e-39   
ref|XP_011012291.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    150   9e-39   Populus euphratica
emb|CDY25686.1|  BnaC03g69890D                                          149   2e-38   Brassica napus [oilseed rape]
ref|XP_009406399.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    149   2e-38   
ref|NP_001077716.1|  STRUBBELIG-receptor family 6                       149   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175777.1|  STRUBBELIG-receptor family 6                          149   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010685195.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    148   3e-38   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW53999.1|  hypothetical protein EUGRSUZ_J03194                     148   4e-38   Eucalyptus grandis [rose gum]
ref|XP_010034888.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    148   5e-38   
ref|XP_002310348.1|  leucine-rich repeat transmembrane protein ki...    147   7e-38   
ref|XP_008372915.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    147   7e-38   Malus domestica [apple tree]
ref|NP_001174920.1|  Os06g0634500                                       139   7e-38   
ref|XP_010273793.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    147   7e-38   Nelumbo nucifera [Indian lotus]
gb|KGN45936.1|  hypothetical protein Csa_6G024930                       147   1e-37   Cucumis sativus [cucumbers]
ref|XP_008445635.1|  PREDICTED: LOW QUALITY PROTEIN: protein STRU...    147   1e-37   
gb|KDO67050.1|  hypothetical protein CISIN_1g040888mg                   145   1e-37   Citrus sinensis [apfelsine]
ref|XP_006425179.1|  hypothetical protein CICLE_v10030356mg             145   2e-37   
ref|XP_008228094.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    146   2e-37   Prunus mume [ume]
gb|KDP40614.1|  hypothetical protein JCGZ_24613                         146   2e-37   Jatropha curcas
ref|XP_011031253.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    146   2e-37   Populus euphratica
gb|EYU33875.1|  hypothetical protein MIMGU_mgv1a002066mg                146   3e-37   Erythranthe guttata [common monkey flower]
gb|KHG25534.1|  protein strubbelig-receptor family 6                    146   3e-37   Gossypium arboreum [tree cotton]
ref|XP_006488603.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    145   3e-37   Citrus sinensis [apfelsine]
ref|XP_004138532.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    145   4e-37   Cucumis sativus [cucumbers]
gb|EPS68087.1|  hypothetical protein M569_06686                         144   6e-37   Genlisea aurea
ref|XP_008668240.1|  PREDICTED: uncharacterized protein LOC100381...    144   1e-36   
ref|XP_008668239.1|  PREDICTED: uncharacterized protein LOC100381...    144   1e-36   Zea mays [maize]
ref|XP_011072790.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    144   1e-36   Sesamum indicum [beniseed]
ref|XP_010087069.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5               144   1e-36   Morus notabilis
ref|XP_004959657.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    144   2e-36   
ref|XP_006426818.1|  hypothetical protein CICLE_v10025011mg             144   2e-36   Citrus clementina [clementine]
ref|XP_008465036.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    143   2e-36   
emb|CDO97730.1|  unnamed protein product                                144   2e-36   Coffea canephora [robusta coffee]
gb|KJB67277.1|  hypothetical protein B456_010G183400                    142   3e-36   Gossypium raimondii
gb|KJB67280.1|  hypothetical protein B456_010G183400                    142   3e-36   Gossypium raimondii
ref|XP_008465035.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    143   3e-36   Cucumis melo [Oriental melon]
ref|XP_008380807.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    143   3e-36   
gb|EEC85048.1|  hypothetical protein OsI_32379                          142   3e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_008465033.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    143   3e-36   
gb|KJB67062.1|  hypothetical protein B456_010G172500                    142   3e-36   Gossypium raimondii
gb|KJB67061.1|  hypothetical protein B456_010G172500                    142   4e-36   Gossypium raimondii
ref|XP_006845114.1|  hypothetical protein AMTR_s00005p00184180          135   4e-36   
gb|KJB67278.1|  hypothetical protein B456_010G183400                    142   4e-36   Gossypium raimondii
gb|AFQ91933.1|  leucine-rich repeat receptor-like kinase                142   6e-36   Brassica rapa subsp. oleifera [biennial turnip rape]
gb|EEE70214.1|  hypothetical protein OsJ_30326                          142   6e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002891770.1|  hypothetical protein ARALYDRAFT_474507             142   7e-36   
gb|KJB67276.1|  hypothetical protein B456_010G183400                    142   7e-36   Gossypium raimondii
ref|XP_009146380.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    142   8e-36   Brassica rapa
gb|KDP20703.1|  hypothetical protein JCGZ_21174                         142   8e-36   Jatropha curcas
emb|CDX97567.1|  BnaA05g25120D                                          142   8e-36   
ref|XP_002885038.1|  hypothetical protein ARALYDRAFT_478852             142   9e-36   
ref|NP_001063921.1|  Os09g0559900                                       141   1e-35   
ref|XP_010099162.1|  Protein STRUBBELIG-RECEPTOR FAMILY 8               141   1e-35   
ref|XP_009391183.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    141   1e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006407090.1|  hypothetical protein EUTSA_v10020162mg             141   2e-35   Eutrema salsugineum [saltwater cress]
ref|XP_010033635.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    141   2e-35   Eucalyptus grandis [rose gum]
ref|XP_004144448.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    141   2e-35   Cucumis sativus [cucumbers]
ref|XP_004165988.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    141   2e-35   
ref|XP_007217016.1|  hypothetical protein PRUPE_ppa002092mg             140   2e-35   Prunus persica
ref|XP_011460016.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    141   2e-35   Fragaria vesca subsp. vesca
ref|XP_011031832.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    140   2e-35   Populus euphratica
ref|XP_002316561.2|  hypothetical protein POPTR_0011s01540g             140   2e-35   
ref|XP_011002570.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    140   3e-35   Populus euphratica
ref|XP_007026173.1|  STRUBBELIG-receptor family 8 isoform 1             140   3e-35   
ref|XP_004303773.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    140   3e-35   Fragaria vesca subsp. vesca
ref|XP_011002569.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    140   4e-35   Populus euphratica
ref|XP_009385265.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    140   4e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009385272.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    140   4e-35   
gb|KJB57112.1|  hypothetical protein B456_009G148500                    140   4e-35   Gossypium raimondii
gb|KHN38109.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5                    139   6e-35   Glycine soja [wild soybean]
gb|KHG12210.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    139   6e-35   Gossypium arboreum [tree cotton]
ref|XP_006586431.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    139   7e-35   
ref|XP_008355924.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    139   8e-35   
gb|KHG12209.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    139   8e-35   Gossypium arboreum [tree cotton]
gb|KCW77015.1|  hypothetical protein EUGRSUZ_D01360                     139   8e-35   Eucalyptus grandis [rose gum]
ref|XP_007213628.1|  hypothetical protein PRUPE_ppa002088mg             139   9e-35   
ref|XP_006383865.1|  hypothetical protein POPTR_0004s00710g             137   1e-34   
ref|XP_002304260.2|  hypothetical protein POPTR_0003s07130g             139   1e-34   
ref|XP_010913801.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    137   1e-34   Elaeis guineensis
ref|XP_010052884.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    139   1e-34   Eucalyptus grandis [rose gum]
ref|XP_010052883.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    139   1e-34   Eucalyptus grandis [rose gum]
gb|EEC81030.1|  hypothetical protein OsI_23812                          138   2e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_007023606.1|  Strubbelig-receptor family 5 isoform 2             139   2e-34   
ref|XP_007217699.1|  hypothetical protein PRUPE_ppa002458mg             138   2e-34   
ref|XP_007023605.1|  Strubbelig-receptor family 5 isoform 1             139   2e-34   
ref|XP_008649054.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    138   2e-34   Zea mays [maize]
ref|XP_008649053.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    138   2e-34   Zea mays [maize]
ref|XP_009357210.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    138   2e-34   Pyrus x bretschneideri [bai li]
ref|XP_007135873.1|  hypothetical protein PHAVU_010G165200g             138   2e-34   Phaseolus vulgaris [French bean]
ref|XP_008224758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    138   2e-34   Prunus mume [ume]
ref|XP_006383864.1|  hypothetical protein POPTR_0004s00710g             137   2e-34   
ref|XP_010913799.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    137   2e-34   Elaeis guineensis
ref|XP_008653346.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    137   3e-34   
ref|XP_008649051.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    138   3e-34   Zea mays [maize]
ref|XP_008653345.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    137   3e-34   Zea mays [maize]
ref|XP_008649052.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    138   3e-34   Zea mays [maize]
gb|AAV64203.1|  leucine-rich repeat transmembrane protein kinase ...    137   3e-34   Zea mays [maize]
ref|XP_006465790.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    137   3e-34   Citrus sinensis [apfelsine]
ref|XP_003604115.1|  Protein STRUBBELIG-RECEPTOR FAMILY                 137   5e-34   
ref|XP_011046989.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    137   6e-34   Populus euphratica
emb|CDY39110.1|  BnaA01g29460D                                          137   6e-34   Brassica napus [oilseed rape]
ref|XP_008228078.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    137   6e-34   
ref|XP_002461023.1|  hypothetical protein SORBIDRAFT_02g039370          137   7e-34   Sorghum bicolor [broomcorn]
ref|XP_009116969.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    137   7e-34   Brassica rapa
ref|XP_009388759.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    136   9e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    136   9e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010534991.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    136   9e-34   Tarenaya hassleriana [spider flower]
ref|XP_010928424.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    135   1e-33   
dbj|BAK07184.1|  predicted protein                                      136   1e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006449792.1|  hypothetical protein CICLE_v10014418mg             135   1e-33   
emb|CDX98445.1|  BnaC05g39300D                                          136   1e-33   
gb|KDO78353.1|  hypothetical protein CISIN_1g005001mg                   134   1e-33   Citrus sinensis [apfelsine]
gb|KDO78351.1|  hypothetical protein CISIN_1g005001mg                   134   1e-33   Citrus sinensis [apfelsine]
gb|KJB69229.1|  hypothetical protein B456_011G011800                    134   1e-33   Gossypium raimondii
ref|XP_008458998.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    135   2e-33   Cucumis melo [Oriental melon]
gb|KDO78348.1|  hypothetical protein CISIN_1g005001mg                   134   2e-33   Citrus sinensis [apfelsine]
ref|XP_003571057.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    135   2e-33   Brachypodium distachyon [annual false brome]
gb|KDO78349.1|  hypothetical protein CISIN_1g005001mg                   134   2e-33   Citrus sinensis [apfelsine]
ref|XP_010244139.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    135   2e-33   Nelumbo nucifera [Indian lotus]
ref|XP_010928422.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    135   2e-33   
ref|XP_006389935.1|  hypothetical protein EUTSA_v10019668mg             135   3e-33   Eutrema salsugineum [saltwater cress]
ref|XP_010252506.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    135   3e-33   Nelumbo nucifera [Indian lotus]
ref|XP_008800485.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    135   3e-33   
ref|XP_006449794.1|  hypothetical protein CICLE_v10014418mg             135   3e-33   Citrus clementina [clementine]
ref|XP_006836581.1|  hypothetical protein AMTR_s00131p00083660          135   3e-33   Amborella trichopoda
gb|KJB69230.1|  hypothetical protein B456_011G011800                    134   3e-33   Gossypium raimondii
ref|XP_009386651.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    134   4e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006467381.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    134   4e-33   Citrus sinensis [apfelsine]
gb|KJB56462.1|  hypothetical protein B456_009G120500                    134   4e-33   Gossypium raimondii
ref|XP_007135353.1|  hypothetical protein PHAVU_010G122100g             134   4e-33   Phaseolus vulgaris [French bean]
ref|XP_011467514.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    134   4e-33   Fragaria vesca subsp. vesca
ref|XP_006467380.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    134   5e-33   Citrus sinensis [apfelsine]
gb|KEH18524.1|  strubbelig-receptor family 6 protein                    134   5e-33   Medicago truncatula
gb|KJB69228.1|  hypothetical protein B456_011G011800                    134   5e-33   Gossypium raimondii
emb|CDY33226.1|  BnaC01g36990D                                          134   6e-33   Brassica napus [oilseed rape]
gb|KDO78347.1|  hypothetical protein CISIN_1g005001mg                   134   6e-33   Citrus sinensis [apfelsine]
ref|XP_004488910.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    134   7e-33   Cicer arietinum [garbanzo]
ref|XP_003627481.1|  Protein STRUBBELIG-RECEPTOR FAMILY                 134   8e-33   Medicago truncatula
ref|XP_009346024.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    133   8e-33   Pyrus x bretschneideri [bai li]
gb|AFW70556.1|  putative STRUBBELIG family receptor protein kinase      133   1e-32   
ref|XP_010943264.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    133   1e-32   
ref|XP_004958321.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    133   1e-32   Setaria italica
ref|NP_178019.2|  STRUBBELIG-receptor family 5                          133   1e-32   Arabidopsis thaliana [mouse-ear cress]
gb|EPS69681.1|  hypothetical protein M569_05081                         133   1e-32   Genlisea aurea
ref|XP_002267170.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    133   1e-32   Vitis vinifera
gb|AFW87367.1|  putative STRUBBELIG family receptor protein kinase      133   1e-32   
emb|CDX87418.1|  BnaA07g34550D                                          133   1e-32   
ref|XP_009106613.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    133   1e-32   Brassica rapa
gb|AFW87368.1|  putative STRUBBELIG family receptor protein kinase      133   1e-32   
ref|XP_008659801.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    133   1e-32   Zea mays [maize]
ref|XP_009383597.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    133   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010943263.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    133   1e-32   Elaeis guineensis
ref|XP_008645353.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    133   1e-32   Zea mays [maize]
ref|XP_010686780.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    133   1e-32   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX88495.1|  BnaC06g39390D                                          132   1e-32   
ref|XP_010939841.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    132   2e-32   Elaeis guineensis
ref|XP_007139054.1|  hypothetical protein PHAVU_009G260900g             131   2e-32   Phaseolus vulgaris [French bean]
ref|XP_006357453.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    132   2e-32   
ref|XP_006598761.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    132   2e-32   
ref|XP_006583189.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    132   2e-32   Glycine max [soybeans]
ref|XP_004164349.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    132   2e-32   
gb|KFK42269.1|  hypothetical protein AALP_AA2G233600                    132   2e-32   Arabis alpina [alpine rockcress]
ref|XP_010322795.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    132   3e-32   Solanum lycopersicum
ref|XP_004965804.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    132   3e-32   Setaria italica
ref|XP_004241857.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    132   3e-32   Solanum lycopersicum
emb|CDP04441.1|  unnamed protein product                                132   3e-32   Coffea canephora [robusta coffee]
ref|XP_010537758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    132   3e-32   Tarenaya hassleriana [spider flower]
ref|XP_004145432.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    132   3e-32   Cucumis sativus [cucumbers]
ref|XP_007024796.1|  Strubbelig-receptor family 6                       132   4e-32   
ref|XP_009344017.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    132   4e-32   Pyrus x bretschneideri [bai li]
ref|XP_002889223.1|  ATP binding protein                                131   4e-32   
ref|XP_007139053.1|  hypothetical protein PHAVU_009G260900g             131   5e-32   Phaseolus vulgaris [French bean]
ref|XP_010417514.1|  PREDICTED: LOW QUALITY PROTEIN: protein STRU...    131   5e-32   Camelina sativa [gold-of-pleasure]
ref|XP_004951618.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    131   5e-32   Setaria italica
ref|XP_003563583.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    131   5e-32   
ref|XP_010474484.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    131   6e-32   
gb|ADM07445.1|  leucine-rich repeat receptor-like protein kinase        131   7e-32   Glycine soja [wild soybean]
ref|XP_008799289.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    131   9e-32   Phoenix dactylifera
ref|XP_009613682.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    130   1e-31   Nicotiana tomentosiformis
gb|EEE67594.1|  hypothetical protein OsJ_25142                          130   1e-31   Oryza sativa Japonica Group [Japonica rice]
ref|NP_193944.2|  STRUBBELIG-receptor family 8 protein                  130   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008380425.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    130   1e-31   
ref|XP_006413689.1|  hypothetical protein EUTSA_v10024563mg             130   2e-31   Eutrema salsugineum [saltwater cress]
ref|XP_006604929.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    130   2e-31   
gb|EEC82450.1|  hypothetical protein OsI_26884                          130   2e-31   Oryza sativa Indica Group [Indian rice]
gb|AAP12946.1|  putative leucine-rich repeat transmembrane protei...    130   2e-31   Oryza sativa Japonica Group [Japonica rice]
dbj|BAC10113.1|  putative leucine-rich repeat transmembrane prote...    130   2e-31   Oryza sativa Japonica Group [Japonica rice]
gb|EAY90345.1|  hypothetical protein OsI_11922                          130   2e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_010538738.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    130   2e-31   Tarenaya hassleriana [spider flower]
ref|NP_001060286.1|  Os07g0618400                                       130   2e-31   
ref|XP_010429764.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    129   2e-31   
gb|KHG11352.1|  protein strubbelig-receptor family 8                    130   2e-31   Gossypium arboreum [tree cotton]
ref|XP_002465165.1|  hypothetical protein SORBIDRAFT_01g033190          129   2e-31   Sorghum bicolor [broomcorn]
gb|KJB70030.1|  hypothetical protein B456_011G054100                    129   3e-31   Gossypium raimondii
gb|EAZ27223.1|  hypothetical protein OsJ_11161                          130   3e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010235400.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    129   3e-31   
ref|XP_008783430.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    129   3e-31   Phoenix dactylifera
gb|KHN01483.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    129   4e-31   Glycine soja [wild soybean]
emb|CDX79126.1|  BnaA01g11930D                                          129   4e-31   
gb|KHG18134.1|  protein strubbelig-receptor family 6                    129   4e-31   Gossypium arboreum [tree cotton]
ref|XP_008783422.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    129   4e-31   Phoenix dactylifera
ref|XP_006604928.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    129   4e-31   Glycine max [soybeans]
ref|XP_003562663.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    129   7e-31   Brachypodium distachyon [annual false brome]
gb|KHN16389.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    128   7e-31   Glycine soja [wild soybean]
ref|XP_006301930.1|  hypothetical protein CARUB_v10022406mg             128   7e-31   Capsella rubella
ref|XP_002316560.2|  hypothetical protein POPTR_0011s01540g             126   7e-31   
ref|XP_002869840.1|  kinase                                             128   8e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_009135627.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    128   8e-31   Brassica rapa
ref|XP_010539255.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    128   9e-31   Tarenaya hassleriana [spider flower]
ref|XP_009108553.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    128   9e-31   Brassica rapa
ref|XP_010539262.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    127   9e-31   Tarenaya hassleriana [spider flower]
ref|XP_010448928.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    128   9e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010539270.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    127   9e-31   Tarenaya hassleriana [spider flower]
ref|XP_006648399.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    127   1e-30   
gb|KFK28787.1|  hypothetical protein AALP_AA7G048200                    127   1e-30   Arabis alpina [alpine rockcress]
ref|XP_009777766.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    127   2e-30   Nicotiana sylvestris
gb|KGN45433.1|  hypothetical protein Csa_7G447950                       127   2e-30   Cucumis sativus [cucumbers]
ref|XP_004159012.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    127   2e-30   
ref|XP_006657962.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    127   2e-30   
ref|XP_006597598.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    127   2e-30   Glycine max [soybeans]
dbj|BAG99361.1|  unnamed protein product                                126   3e-30   
emb|CDX82908.1|  BnaC01g13580D                                          126   3e-30   
ref|XP_003557758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    126   5e-30   
ref|XP_009124710.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    125   5e-30   
ref|XP_010228524.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    125   5e-30   
ref|XP_010937237.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    125   5e-30   
ref|XP_010939842.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    125   6e-30   
ref|XP_009146553.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 4    125   6e-30   
ref|XP_006586762.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    125   6e-30   
ref|XP_006348158.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    125   6e-30   
emb|CDY44024.1|  BnaA05g26190D                                          125   6e-30   
ref|XP_010096526.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6               125   6e-30   
ref|XP_009386772.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    125   7e-30   
ref|XP_004232684.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    125   9e-30   
ref|XP_010439362.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    125   9e-30   
emb|CDY43376.1|  BnaA01g30070D                                          125   1e-29   
ref|XP_010434074.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    125   1e-29   
emb|CDX76385.1|  BnaA08g10150D                                          124   1e-29   
ref|XP_006650171.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    125   1e-29   
emb|CDY27444.1|  BnaC03g64840D                                          124   1e-29   
gb|KFK38641.1|  hypothetical protein AALP_AA3G141300                    124   2e-29   
emb|CDY23563.1|  BnaC05g40310D                                          124   2e-29   
ref|XP_008462232.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    124   3e-29   
ref|XP_006284970.1|  hypothetical protein CARUB_v10006274mg             124   3e-29   
dbj|BAK02781.1|  predicted protein                                      124   3e-29   
ref|XP_008462231.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    124   3e-29   
ref|XP_007147687.1|  hypothetical protein PHAVU_006G146100g             123   3e-29   
ref|XP_006300119.1|  hypothetical protein CARUB_v10016348mg             123   4e-29   
ref|XP_006407265.1|  hypothetical protein EUTSA_v10020193mg             123   4e-29   
emb|CAN80221.1|  hypothetical protein VITISV_027894                     123   5e-29   
ref|XP_010465107.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 4    123   5e-29   
ref|XP_009357487.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    123   6e-29   
ref|XP_004486188.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    122   8e-29   
ref|XP_008384096.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    122   8e-29   
ref|NP_566444.4|  STRUBBELIG-receptor family 4                          122   9e-29   
ref|XP_010696138.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    122   1e-28   
ref|XP_010696137.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    122   1e-28   
gb|KEH36931.1|  strubbelig-receptor family protein                      122   1e-28   
ref|XP_002468389.1|  hypothetical protein SORBIDRAFT_01g045010          122   1e-28   
ref|XP_010487048.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    121   2e-28   
dbj|BAB01397.1|  protein kinase-like protein                            122   2e-28   
ref|XP_002882805.1|  predicted protein                                  122   2e-28   
ref|XP_010499921.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    120   3e-28   
ref|XP_004159013.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    116   3e-28   
gb|KGN45432.1|  hypothetical protein Csa_7G447940                       116   3e-28   
ref|XP_008651693.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    120   4e-28   
gb|AAC27894.1|  leucine-rich repeat transmembrane protein kinase 1      120   4e-28   
ref|XP_004494892.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    119   8e-28   
gb|ACI49786.1|  At3g13065                                               119   1e-27   
gb|KEH24658.1|  strubbelig-receptor family protein                      119   1e-27   
ref|NP_001241934.1|  protein STRUBBELIG-RECEPTOR FAMILY 6-like          118   2e-27   
ref|XP_009616310.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    118   2e-27   
ref|XP_008803525.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    117   7e-27   
gb|EYU39916.1|  hypothetical protein MIMGU_mgv1a001954mg                117   9e-27   
ref|XP_004983096.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    116   1e-26   
emb|CDX98961.1|  BnaC09g48740D                                          116   1e-26   
ref|XP_006399158.1|  hypothetical protein EUTSA_v10012782mg             116   1e-26   
ref|XP_009781362.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    116   2e-26   
ref|XP_003558655.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    115   2e-26   
ref|XP_008659003.1|  PREDICTED: leucine-rich repeat transmembrane...    115   2e-26   
gb|KHG09080.1|  protein strubbelig-receptor family 5                    115   2e-26   
ref|XP_002451696.1|  hypothetical protein SORBIDRAFT_04g006110          115   2e-26   
ref|XP_009781363.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    115   2e-26   
ref|NP_001104882.1|  leucine-rich repeat transmembrane protein ki...    115   2e-26   
gb|AFW89442.1|  putative STRUBBELIG family receptor protein kinase      115   3e-26   
emb|CDX70063.1|  BnaA10g24120D                                          115   4e-26   
ref|XP_009122296.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    115   4e-26   
ref|XP_002467303.1|  hypothetical protein SORBIDRAFT_01g024160          114   5e-26   
dbj|BAK05038.1|  predicted protein                                      114   6e-26   
ref|NP_001049184.1|  Os03g0183800                                       114   6e-26   
ref|XP_004985465.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    114   7e-26   
ref|XP_004985464.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    114   1e-25   
tpg|DAA46921.1|  TPA: putative STRUBBELIG family receptor protein...    110   1e-25   
ref|NP_001064502.1|  Os10g0389800                                       113   2e-25   
ref|XP_006649512.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    113   2e-25   
ref|XP_006850050.1|  hypothetical protein AMTR_s00022p00198910          112   2e-25   
gb|EEC66871.1|  hypothetical protein OsI_33412                          113   2e-25   
gb|AAK52120.1|AC079936_16  Putative leucine-rich repeat transmemb...    113   2e-25   
gb|KFK25072.1|  hypothetical protein AALP_AA8G062600                    112   2e-25   
ref|XP_004510591.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    112   2e-25   
gb|EMS47769.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    112   2e-25   
gb|EMS56044.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5                    112   3e-25   
ref|XP_003576835.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    112   3e-25   
ref|XP_006661732.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    112   3e-25   
tpg|DAA46922.1|  TPA: putative STRUBBELIG family receptor protein...    111   4e-25   
ref|NP_001167741.1|  uncharacterized protein LOC100381429 precursor     112   5e-25   
ref|XP_010534354.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    111   5e-25   
ref|XP_010534352.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    111   6e-25   
ref|XP_010557935.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    111   6e-25   
gb|EEC72655.1|  hypothetical protein OsI_06182                          111   7e-25   
ref|XP_011075267.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    111   7e-25   
ref|NP_001046150.1|  Os02g0190500                                       111   7e-25   
emb|CDP20023.1|  unnamed protein product                                111   8e-25   
ref|XP_010228525.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    110   1e-24   
ref|XP_010913800.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    109   3e-24   
ref|XP_002532341.1|  Receptor protein kinase CLAVATA1 precursor, ...    109   4e-24   
gb|KDP24601.1|  hypothetical protein JCGZ_25517                         109   4e-24   
ref|XP_010057986.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    108   7e-24   
gb|KCW90298.1|  hypothetical protein EUGRSUZ_A02440                     108   7e-24   
ref|XP_010914020.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    108   9e-24   
ref|XP_010456423.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    107   2e-23   
ref|XP_010552382.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 4    107   2e-23   
gb|ACG49227.1|  leucine-rich repeat transmembrane protein kinase 1      107   2e-23   
gb|KDO50163.1|  hypothetical protein CISIN_1g039558mg                   107   2e-23   
ref|XP_006492890.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    107   2e-23   
ref|XP_009612111.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    106   3e-23   
gb|AAC27896.1|  leucine-rich repeat transmembrane protein kinase 3      103   5e-23   
ref|NP_196300.1|  STRUBBELIG-receptor family 2                          106   5e-23   
ref|XP_009797583.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    105   7e-23   
ref|XP_010491264.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    105   8e-23   
ref|XP_010423292.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    105   8e-23   
ref|XP_010423291.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    105   9e-23   
ref|XP_004136737.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    104   1e-22   
ref|XP_002871232.1|  hypothetical protein ARALYDRAFT_908613             104   2e-22   
ref|XP_010456422.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  98.2    2e-22   
ref|XP_010672691.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    104   2e-22   
ref|XP_006429833.1|  hypothetical protein CICLE_v10013344mg             104   2e-22   
ref|XP_002962278.1|  hypothetical protein SELMODRAFT_76873              103   3e-22   
ref|XP_007204855.1|  hypothetical protein PRUPE_ppa026263mg             103   3e-22   
gb|KGN59317.1|  hypothetical protein Csa_3G809930                       103   3e-22   
ref|XP_011004818.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    103   4e-22   
ref|XP_002308374.2|  leucine-rich repeat transmembrane protein ki...    103   4e-22   
ref|XP_008443075.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    103   6e-22   
ref|XP_010937238.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    102   6e-22   
ref|XP_006287140.1|  hypothetical protein CARUB_v10000312mg             102   7e-22   
gb|EPS64024.1|  hypothetical protein M569_10757                         102   1e-21   
gb|AFW76248.1|  putative STRUBBELIG family receptor protein kinase      102   2e-21   
gb|AFW76246.1|  putative STRUBBELIG family receptor protein kinas...    102   2e-21   
ref|XP_010557936.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    101   2e-21   
gb|KEH41669.1|  strubbelig-receptor family 2 protein                    101   2e-21   
ref|XP_004155578.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    101   3e-21   
ref|XP_004134722.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    100   3e-21   
ref|XP_008241034.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    100   3e-21   
ref|XP_010533880.1|  PREDICTED: protein STRUBBELIG                      100   4e-21   
ref|XP_009777356.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    100   4e-21   
ref|XP_001783845.1|  predicted protein                                  100   6e-21   
ref|XP_007028952.1|  STRUBBELIG-receptor family 2, putative             100   8e-21   
gb|EMT01284.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5                  99.8    8e-21   
ref|XP_010476010.1|  PREDICTED: protein STRUBBELIG-like               95.9    9e-21   
ref|XP_002533323.1|  leucine-rich repeat transmembrane protein ki...  99.4    1e-20   
ref|XP_008439889.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  99.4    1e-20   
gb|KHN07244.1|  Protein STRUBBELIG-RECEPTOR FAMILY 2                  99.0    1e-20   
ref|XP_009616311.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  98.2    3e-20   
ref|XP_010317941.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2  97.8    4e-20   
ref|XP_006467860.1|  PREDICTED: protein STRUBBELIG-like               97.4    5e-20   
ref|XP_006661536.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  97.1    5e-20   
ref|XP_006449268.1|  hypothetical protein CICLE_v10014419mg           97.4    5e-20   
ref|XP_011468063.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  97.1    7e-20   
ref|XP_008245351.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  94.0    9e-20   
gb|AAC17069.1|  Contains similarity to Cf-2.2 gene gb|U42445 from...  91.3    1e-19   
gb|EEE66066.1|  hypothetical protein OsJ_22073                        96.3    1e-19   
ref|XP_009370199.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  96.3    1e-19   
ref|XP_009781364.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  95.9    2e-19   
ref|XP_007145665.1|  hypothetical protein PHAVU_007G258000g           95.9    2e-19   
ref|XP_008392158.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2  95.9    2e-19   
ref|XP_010458496.1|  PREDICTED: protein STRUBBELIG                    95.9    2e-19   
ref|XP_010492393.1|  PREDICTED: protein STRUBBELIG-like               95.9    2e-19   
ref|XP_010476014.1|  PREDICTED: protein STRUBBELIG-like               95.5    3e-19   
ref|XP_006589916.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  94.7    3e-19   
emb|CBI30038.3|  unnamed protein product                              95.1    4e-19   
gb|KHN28754.1|  Protein STRUBBELIG-RECEPTOR FAMILY 2                  95.1    4e-19   
ref|XP_010654321.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2  94.7    4e-19   
ref|XP_006449793.1|  hypothetical protein CICLE_v10014418mg           94.0    7e-19   
gb|EMT07607.1|  Protein STRUBBELIG-RECEPTOR FAMILY 7                  94.7    8e-19   
ref|XP_010102562.1|  hypothetical protein L484_018034                 91.3    9e-19   
ref|XP_009376134.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  94.0    1e-18   
ref|XP_008651696.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  93.2    1e-18   
ref|XP_006306832.1|  hypothetical protein CARUB_v10008374mg           93.2    1e-18   
emb|CDY19342.1|  BnaC05g08510D                                        93.2    2e-18   
gb|KDP20913.1|  hypothetical protein JCGZ_21384                       93.2    2e-18   
ref|XP_010526524.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  92.4    2e-18   
gb|EMT02096.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                  92.8    2e-18   
ref|XP_006417386.1|  hypothetical protein EUTSA_v10006881mg           92.8    3e-18   
ref|XP_010236315.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  92.4    3e-18   
ref|XP_001763842.1|  predicted protein                                92.4    3e-18   
ref|XP_008646743.1|  PREDICTED: protein STRUBBELIG-like               92.4    3e-18   
ref|XP_010526526.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  92.4    3e-18   
emb|CDX97936.1|  BnaA06g06870D                                        92.0    4e-18   
ref|XP_009148445.1|  PREDICTED: protein STRUBBELIG                    92.0    4e-18   
emb|CDY34873.1|  BnaA09g47990D                                        89.7    4e-18   
ref|XP_002521411.1|  lrr receptor-linked protein kinase, putative     92.0    4e-18   
ref|NP_001045825.1|  Os02g0136900                                     91.7    5e-18   
ref|XP_010921975.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  91.3    8e-18   
ref|XP_009350757.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  91.3    8e-18   
ref|XP_009350736.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  91.3    8e-18   
emb|CDP14731.1|  unnamed protein product                              90.9    1e-17   
ref|XP_002889850.1|  hypothetical protein ARALYDRAFT_888407           90.9    1e-17   
emb|CDY34847.1|  BnaA09g47730D                                        90.9    1e-17   
gb|AAD50000.1|AC007259_13  Similar to protein kinases                 90.9    1e-17   
emb|CDY34659.1|  BnaC08g42180D                                        90.9    1e-17   
ref|XP_009118201.1|  PREDICTED: protein STRUBBELIG-like isoform X1    90.9    1e-17   
ref|NP_172580.2|  receptor-like kinase STRUBBELIG                     90.9    1e-17   
ref|XP_009118203.1|  PREDICTED: protein STRUBBELIG-like isoform X2    90.9    1e-17   
gb|AFW90526.1|  strubbelig-receptor family 6-like protein             90.5    1e-17   
gb|KHN39384.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5                  89.0    2e-17   
ref|XP_004507203.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  90.1    2e-17   
gb|KHG18089.1|  Protein STRUBBELIG -like protein                      89.7    3e-17   
ref|XP_009357082.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  89.4    3e-17   
gb|AFW66318.1|  putative STRUBBELIG family receptor protein kinase    89.0    4e-17   
ref|XP_002453383.1|  hypothetical protein SORBIDRAFT_04g005115        89.0    4e-17   
ref|XP_008680888.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  89.0    5e-17   
ref|XP_002451714.1|  hypothetical protein SORBIDRAFT_04g006475        89.0    5e-17   
gb|KJB69459.1|  hypothetical protein B456_011G024500                  88.6    6e-17   
gb|KJB69458.1|  hypothetical protein B456_011G024500                  88.2    6e-17   
ref|XP_004951728.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  88.6    7e-17   
ref|XP_006582789.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  88.2    7e-17   
gb|KHN41147.1|  Protein STRUBBELIG-RECEPTOR FAMILY 3                  88.2    8e-17   
ref|XP_010556827.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3  88.2    9e-17   
gb|KHN22911.1|  Protein STRUBBELIG-RECEPTOR FAMILY 3                  88.2    9e-17   
ref|XP_003560082.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3  87.8    1e-16   
ref|XP_010278328.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  87.8    1e-16   
ref|XP_010278322.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  87.8    1e-16   
ref|XP_008341912.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  87.8    1e-16   
ref|XP_004497928.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  87.4    1e-16   
ref|NP_001169655.1|  uncharacterized LOC100383536 precursor           87.4    2e-16   
gb|KJB67279.1|  hypothetical protein B456_010G183400                  87.0    2e-16   
ref|XP_010069855.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  87.0    2e-16   
ref|XP_006665106.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  87.0    2e-16   
ref|XP_006648364.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  87.0    2e-16   
ref|XP_007162306.1|  hypothetical protein PHAVU_001G140900g           87.0    2e-16   
ref|XP_011039757.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  87.0    2e-16   



>ref|XP_009619763.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Nicotiana 
tomentosiformis]
Length=707

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QLTKW+ANGGDPCGESW G++CSGNRVTEI+ISGL L+GSMGFQLD LKSVT
Sbjct  38   YTSLNSPAQLTKWSANGGDPCGESWTGITCSGNRVTEIKISGLGLSGSMGFQLDSLKSVT  97

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FDIS NN+G+ LP+QLPPNVQ+LNLA +GF GGLPYSISQM  L+Y
Sbjct  98   NFDISNNNMGSQLPFQLPPNVQRLNLAASGFNGGLPYSISQMTSLQY  144



>ref|XP_009788969.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
Length=705

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QL KW+ANGGDPCGESW G++CSGNRVTEI+ISGL L+GSMGFQLD LKSVT
Sbjct  36   YTSLNSPAQLKKWSANGGDPCGESWTGITCSGNRVTEIKISGLALSGSMGFQLDSLKSVT  95

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FDIS NN+G+ LP+QLPPNVQ+LNLA +GF+GGLPYSISQM  L+Y
Sbjct  96   NFDISNNNMGSQLPFQLPPNVQRLNLAASGFSGGLPYSISQMTSLQY  142



>ref|XP_009788970.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009788971.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Nicotiana sylvestris]
Length=698

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QL KW+ANGGDPCGESW G++CSGNRVTEI+ISGL L+GSMGFQLD LKSVT
Sbjct  29   YTSLNSPAQLKKWSANGGDPCGESWTGITCSGNRVTEIKISGLALSGSMGFQLDSLKSVT  88

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FDIS NN+G+ LP+QLPPNVQ+LNLA +GF+GGLPYSISQM  L+Y
Sbjct  89   NFDISNNNMGSQLPFQLPPNVQRLNLAASGFSGGLPYSISQMTSLQY  135



>ref|XP_009796493.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Nicotiana 
sylvestris]
Length=718

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 95/108 (88%), Gaps = 1/108 (1%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN-RVTEIQISGLQLTGSMGFQLDQLKSV  381
            + +LNSP QLTKWTANGGDPCGESWKG++CSGN RVTEI++SGLQL+GS+G+QL  L SV
Sbjct  41   YGALNSPGQLTKWTANGGDPCGESWKGITCSGNNRVTEIKLSGLQLSGSLGYQLASLTSV  100

Query  382  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T FDIS NNLGN LPYQLPPNVQ+LNLAGNGF GGLPYSISQM  L Y
Sbjct  101  TNFDISNNNLGNQLPYQLPPNVQRLNLAGNGFNGGLPYSISQMTSLRY  148



>ref|XP_009614011.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Nicotiana tomentosiformis]
Length=717

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 95/108 (88%), Gaps = 1/108 (1%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN-RVTEIQISGLQLTGSMGFQLDQLKSV  381
            + +LNSP QLTKWTANGGDPCGESWKG++CSGN RVTEI++SGLQL+GS+G+QL  L SV
Sbjct  41   YGALNSPGQLTKWTANGGDPCGESWKGITCSGNNRVTEIKLSGLQLSGSLGYQLASLTSV  100

Query  382  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T FDIS NNLGN LPYQLPPNVQ+LNLAGNGF GGLPYSISQM  L Y
Sbjct  101  TNFDISNNNLGNQLPYQLPPNVQRLNLAGNGFNGGLPYSISQMTSLRY  148



>ref|XP_011079189.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Sesamum 
indicum]
Length=688

 Score =   178 bits (452),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QLT W A+GGDPCGESWKG++CSG RVTEI ISGL L+G+MG+QLD+L SVT
Sbjct  36   YTSLNSPQQLTNWKASGGDPCGESWKGITCSGTRVTEINISGLGLSGNMGYQLDKLTSVT  95

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            TFDIS NNLGN +PYQLPPNVQ+LNLAGNGFT GLPYSIS M  L+Y
Sbjct  96   TFDISNNNLGNQIPYQLPPNVQRLNLAGNGFTAGLPYSISLMTSLKY  142



>ref|XP_009777352.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009777353.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009777354.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
Length=697

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 101/134 (75%), Gaps = 7/134 (5%)
 Frame = +1

Query  127  SLGFCSTRRPPPSLIQIRLMRQF*GGFSSLNSPPQLTKW-TANGGDPCGESWKGVSCSGN  303
            S  F +    P     +R+M      +SSLNSP QLT W +++G DPCGE WKG++CSGN
Sbjct  18   SHSFANADTDPSDASALRVM------YSSLNSPAQLTNWNSSDGSDPCGEFWKGITCSGN  71

Query  304  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  483
            RVTEIQISGL L+GSMG+QL  L SVT FDIS NNLGN +PYQLPPNVQ+LNLA NGFTG
Sbjct  72   RVTEIQISGLGLSGSMGYQLTSLTSVTNFDISNNNLGNQIPYQLPPNVQRLNLAANGFTG  131

Query  484  GLPYSISQMAPLEY  525
            GLPYSISQM  L+Y
Sbjct  132  GLPYSISQMTSLQY  145



>ref|XP_009777355.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Nicotiana sylvestris]
Length=693

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 101/134 (75%), Gaps = 7/134 (5%)
 Frame = +1

Query  127  SLGFCSTRRPPPSLIQIRLMRQF*GGFSSLNSPPQLTKW-TANGGDPCGESWKGVSCSGN  303
            S  F +    P     +R+M      +SSLNSP QLT W +++G DPCGE WKG++CSGN
Sbjct  18   SHSFANADTDPSDASALRVM------YSSLNSPAQLTNWNSSDGSDPCGEFWKGITCSGN  71

Query  304  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  483
            RVTEIQISGL L+GSMG+QL  L SVT FDIS NNLGN +PYQLPPNVQ+LNLA NGFTG
Sbjct  72   RVTEIQISGLGLSGSMGYQLTSLTSVTNFDISNNNLGNQIPYQLPPNVQRLNLAANGFTG  131

Query  484  GLPYSISQMAPLEY  525
            GLPYSISQM  L+Y
Sbjct  132  GLPYSISQMTSLQY  145



>emb|CDO97777.1| unnamed protein product [Coffea canephora]
Length=712

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            + SLNSP QLTKW  NGGDPC E+WKG++CSG+RVTEI++SGL LTGSMGF+LD+LKSVT
Sbjct  40   YKSLNSPSQLTKWNPNGGDPCNENWKGITCSGSRVTEIKLSGLGLTGSMGFELDKLKSVT  99

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FDIS NNLGN LP+QLP NVQ+LNLAGNGF GGLPYS+SQM  L+Y
Sbjct  100  NFDISNNNLGNQLPFQLPQNVQQLNLAGNGFNGGLPYSVSQMTSLKY  146



>ref|XP_011072711.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Sesamum indicum]
Length=712

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSPP LT W  NGGDPCGESWKGVSCSG++VTEI+I GL LTG+MG+QLD+L SVT
Sbjct  43   YTSLNSPPLLTNWKPNGGDPCGESWKGVSCSGSKVTEIKIPGLGLTGNMGYQLDRLTSVT  102

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            TFDIS NNLGN +P+QLPPNVQ+LNLAGNGF GGLPYSIS M  L Y
Sbjct  103  TFDISNNNLGNQIPFQLPPNVQRLNLAGNGFNGGLPYSISLMTSLRY  149



>ref|XP_009591325.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Nicotiana 
tomentosiformis]
Length=701

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 100/131 (76%), Gaps = 7/131 (5%)
 Frame = +1

Query  136  FCSTRRPPPSLIQIRLMRQF*GGFSSLNSPPQLTKW-TANGGDPCGESWKGVSCSGNRVT  312
            F +    P     +R+M      +SSLNSP QLTKW +++G DPCGESWKG++C GNRV 
Sbjct  21   FANAGTDPSDASALRVM------YSSLNSPAQLTKWNSSDGSDPCGESWKGITCYGNRVN  74

Query  313  EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLP  492
            EI +SGL L+GSMG+QL  L SV  FDIS NNLGN +PYQLPPNVQKLNLAGNGFTGGLP
Sbjct  75   EIHLSGLGLSGSMGYQLTSLTSVINFDISNNNLGNQIPYQLPPNVQKLNLAGNGFTGGLP  134

Query  493  YSISQMAPLEY  525
            YSISQMA L+Y
Sbjct  135  YSISQMASLQY  145



>ref|XP_006357429.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Solanum 
tuberosum]
Length=716

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 96/108 (89%), Gaps = 1/108 (1%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTA-NGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSV  381
            +SSLNSP QLTKW++ +GGDPCGESWKG++CSGNRVTEIQISGL L+GSMG+QL  L SV
Sbjct  61   YSSLNSPGQLTKWSSSDGGDPCGESWKGITCSGNRVTEIQISGLGLSGSMGYQLMSLTSV  120

Query  382  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T FDIS NNLGN +PYQLPPNV++LNLAGNGFTG LPYS+SQ+  L+Y
Sbjct  121  TNFDISNNNLGNQIPYQLPPNVKRLNLAGNGFTGVLPYSVSQITSLQY  168



>ref|XP_010654359.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Vitis vinifera]
Length=714

 Score =   173 bits (438),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 103/146 (71%), Gaps = 15/146 (10%)
 Frame = +1

Query  115  RWRFSLGFCSTR---------RPPPSLIQIRLMRQF*GGFSSLNSPPQLTKWTANGGDPC  267
            +WR  +  C  R           P     +R+M      FSSLNSP QL KW++NGGDPC
Sbjct  4    KWRMLVLICVLRWGPSFINGATDPQDASALRVM------FSSLNSPSQLAKWSSNGGDPC  57

Query  268  GESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNV  447
            GESW+G++C G+RVTEI++SGL+LTGSMG+QL  L SV   DIS NNLGN +PYQLPPN+
Sbjct  58   GESWQGITCKGSRVTEIELSGLRLTGSMGYQLTSLTSVVNLDISNNNLGNQIPYQLPPNL  117

Query  448  QKLNLAGNGFTGGLPYSISQMAPLEY  525
            Q+LNLAGNGF GG+PYSIS M  L+Y
Sbjct  118  QRLNLAGNGFNGGIPYSISLMISLKY  143



>emb|CBI35784.3| unnamed protein product [Vitis vinifera]
Length=708

 Score =   172 bits (436),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 103/140 (74%), Gaps = 8/140 (6%)
 Frame = +1

Query  106  CRGRWRFSLGFCSTRRPPPSLIQIRLMRQF*GGFSSLNSPPQLTKWTANGGDPCGESWKG  285
            C  RW  S  F +    P     +R+M      FSSLNSP QL KW++NGGDPCGESW+G
Sbjct  6    CVLRWGPS--FINGATDPQDASALRVM------FSSLNSPSQLAKWSSNGGDPCGESWQG  57

Query  286  VSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLA  465
            ++C G+RVTEI++SGL+LTGSMG+QL  L SV   DIS NNLGN +PYQLPPN+Q+LNLA
Sbjct  58   ITCKGSRVTEIELSGLRLTGSMGYQLTSLTSVVNLDISNNNLGNQIPYQLPPNLQRLNLA  117

Query  466  GNGFTGGLPYSISQMAPLEY  525
            GNGF GG+PYSIS M  L+Y
Sbjct  118  GNGFNGGIPYSISLMISLKY  137



>ref|XP_004241858.2| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Solanum 
lycopersicum]
Length=692

 Score =   169 bits (429),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 95/108 (88%), Gaps = 1/108 (1%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTAN-GGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSV  381
            +SSLNSP QLTKW+++ GGDPCGESWKG++CSGNRVTEIQISGL L+GSMG+QL  L SV
Sbjct  36   YSSLNSPGQLTKWSSSEGGDPCGESWKGITCSGNRVTEIQISGLGLSGSMGYQLTSLTSV  95

Query  382  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T FD+S NNLGN +PYQLPP V++LNLAGNGFTG LPYS+SQ+  L+Y
Sbjct  96   TNFDLSNNNLGNQIPYQLPPYVKRLNLAGNGFTGVLPYSVSQITSLQY  143



>gb|EYU21256.1| hypothetical protein MIMGU_mgv1a002171mg [Erythranthe guttata]
Length=704

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QLT W  +GGDPC ESWKG++CSG++VTEI I GL L G+MGFQLD+L SVT
Sbjct  33   YTSLNSPQQLTNWKPSGGDPCAESWKGITCSGSKVTEINIPGLGLNGNMGFQLDKLTSVT  92

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            TFDIS NNLGN +PYQLPPNV++LNLAGNGF  GLPYSIS M  L+Y
Sbjct  93   TFDISNNNLGNQIPYQLPPNVERLNLAGNGFNAGLPYSISLMGALKY  139



>gb|EYU21255.1| hypothetical protein MIMGU_mgv1a002171mg [Erythranthe guttata]
Length=705

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QLT W  +GGDPC ESWKG++CSG++VTEI I GL L G+MGFQLD+L SVT
Sbjct  33   YTSLNSPQQLTNWKPSGGDPCAESWKGITCSGSKVTEINIPGLGLNGNMGFQLDKLTSVT  92

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            TFDIS NNLGN +PYQLPPNV++LNLAGNGF  GLPYSIS M  L+Y
Sbjct  93   TFDISNNNLGNQIPYQLPPNVERLNLAGNGFNAGLPYSISLMGALKY  139



>ref|XP_004235517.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Solanum lycopersicum]
Length=710

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNSP QLTKW ANGGDPCGESW G++CSGNRVTEI+ISGL L+GS+G+QL  L SVT
Sbjct  36   YSSLNSPGQLTKWNANGGDPCGESWTGITCSGNRVTEIKISGLGLSGSLGYQLTSLTSVT  95

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FDIS NNLGN LP+QLPPNVQ+LNLA NGF GGLPYSISQM  L Y
Sbjct  96   NFDISNNNLGNQLPFQLPPNVQRLNLAANGFNGGLPYSISQMTSLRY  142



>ref|XP_006342885.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Solanum 
tuberosum]
Length=711

 Score =   161 bits (407),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNSP QLTKW ANGGDPCGESW G++CSGNRVTEI+ISGL L+GS+G+QL  L SVT
Sbjct  37   YSSLNSPGQLTKWNANGGDPCGESWTGITCSGNRVTEIKISGLGLSGSLGYQLASLTSVT  96

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FDIS NNLGN LPYQLPPNVQ+LNLA NGF G LPYS+SQM  L Y
Sbjct  97   NFDISNNNLGNQLPYQLPPNVQRLNLAANGFNGALPYSVSQMTSLRY  143



>ref|XP_011048642.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Populus euphratica]
Length=715

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSS+NSP QLT+W+ANG DPCG++WKG++CSG+RVTEI++ GL L+GS+G+QLD LK+VT
Sbjct  38   FSSMNSPAQLTQWSANGDDPCGQNWKGITCSGSRVTEIKLPGLGLSGSLGYQLDSLKAVT  97

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NNL  +LPYQLPPN+Q+LNLA N  +GG+PYSISQM  L Y
Sbjct  98   NLDLSNNNLAGALPYQLPPNLQRLNLANNRLSGGIPYSISQMPSLTY  144



>gb|ABO31100.1| ovule receptor-like kinase 28 [Solanum chacoense]
Length=711

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNSP QLTKW ANGG+PCGESW G++CSGNRVTEI+ISGL L+GS+G+QL  L SVT
Sbjct  37   YSSLNSPGQLTKWNANGGNPCGESWTGITCSGNRVTEIKISGLGLSGSLGYQLASLTSVT  96

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FDIS NNLGN LPYQLPPNVQ+LNLA NGF G LPYS+SQM  L Y
Sbjct  97   NFDISNNNLGNQLPYQLPPNVQRLNLAANGFNGALPYSVSQMTSLRY  143



>gb|EPS61932.1| ovule receptor-like kinase 28, partial [Genlisea aurea]
Length=704

 Score =   158 bits (400),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QLT W + GGDPCGESW+GV+CSG+RVT+I ISGL LTG+MG+QL  L +VT
Sbjct  32   YASLNSPQQLTNWKSTGGDPCGESWRGVTCSGSRVTQIVISGLGLTGNMGYQLLSLTAVT  91

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            TFDIS NNLGN +PYQLPPNVQ LNLAG  F  GLPYSIS M  L Y
Sbjct  92   TFDISNNNLGNQIPYQLPPNVQTLNLAGCNFNNGLPYSISYMNSLGY  138



>ref|NP_974311.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
 gb|AEE75504.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
Length=680

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSS+NSP QL++WTA+GGDPCG++WKG++CSG+RVT+I++  L L+GS+GF LD+L SVT
Sbjct  2    FSSMNSPGQLSQWTASGGDPCGQNWKGITCSGSRVTQIKLPSLGLSGSLGFMLDKLTSVT  61

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNLG  LPYQLPPN+++LNLA N FTG   YSIS MAPL+Y
Sbjct  62   EFDMSNNNLGGDLPYQLPPNLERLNLANNQFTGSAQYSISMMAPLKY  108



>ref|NP_974312.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
 gb|AEE75506.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
Length=689

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSS+NSP QL++WTA+GGDPCG++WKG++CSG+RVT+I++  L L+GS+GF LD+L SVT
Sbjct  39   FSSMNSPGQLSQWTASGGDPCGQNWKGITCSGSRVTQIKLPSLGLSGSLGFMLDKLTSVT  98

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNLG  LPYQLPPN+++LNLA N FTG   YSIS MAPL+Y
Sbjct  99   EFDMSNNNLGGDLPYQLPPNLERLNLANNQFTGSAQYSISMMAPLKY  145



>ref|NP_188052.2| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
 sp|Q9LUL4.1|SRF7_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY 7; AltName: 
Full=Leucine-rich repeat receptor kinase-like protein SRF7; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01040.1| serine/threonine protein kinase-like protein [Arabidopsis thaliana]
 gb|AAR99875.1| strubbelig receptor family 7 [Arabidopsis thaliana]
 gb|ACI49801.1| At3g14350 [Arabidopsis thaliana]
 gb|ACN59316.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE75505.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
Length=717

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSS+NSP QL++WTA+GGDPCG++WKG++CSG+RVT+I++  L L+GS+GF LD+L SVT
Sbjct  39   FSSMNSPGQLSQWTASGGDPCGQNWKGITCSGSRVTQIKLPSLGLSGSLGFMLDKLTSVT  98

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNLG  LPYQLPPN+++LNLA N FTG   YSIS MAPL+Y
Sbjct  99   EFDMSNNNLGGDLPYQLPPNLERLNLANNQFTGSAQYSISMMAPLKY  145



>gb|KFK38799.1| hypothetical protein AALP_AA3G161700 [Arabis alpina]
Length=714

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F+S+NSP QL++WTA+GGDPCG++WKG++CSG+RVT+I++SGL L+GS+GF LD+L SVT
Sbjct  39   FTSMNSPGQLSQWTASGGDPCGQNWKGITCSGSRVTQIKLSGLGLSGSIGFMLDKLTSVT  98

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNLG  +PYQLPPN+++LNLA N FTG   YSIS M P++Y
Sbjct  99   EFDLSNNNLGGDIPYQLPPNLERLNLANNQFTGSAQYSISMMTPIKY  145



>ref|XP_010655240.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 isoform X2 [Vitis 
vinifera]
Length=611

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QLT W ++GGDPCGESWKG+ CSG+ +TEI++SGL LTGSMG+QL  L SVT
Sbjct  37   YNSLNSPSQLTGWKSSGGDPCGESWKGIKCSGSSITEIKLSGLGLTGSMGYQLSSLTSVT  96

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNL   +PYQLPPNV  L+L+ NGFTGG+PYSISQM  L+Y
Sbjct  97   NFDMSKNNLKGDIPYQLPPNVLHLDLSRNGFTGGVPYSISQMTDLKY  143



>ref|XP_008781708.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Phoenix 
dactylifera]
Length=686

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F SLN+PPQLT W++ GGDPCG+ WKGV CSG+ VTEI +SGL LTGS+G+QL  L SVT
Sbjct  35   FKSLNAPPQLTGWSSTGGDPCGDDWKGVKCSGSSVTEISLSGLGLTGSLGYQLSSLTSVT  94

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNL   +PYQLPP V+ LNLA N FTGG+PYSISQM  L+Y
Sbjct  95   YFDMSKNNLKGDIPYQLPPKVEHLNLAENAFTGGIPYSISQMTDLKY  141



>emb|CBI18374.3| unnamed protein product [Vitis vinifera]
Length=694

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QLT W ++GGDPCGESWKG+ CSG+ +TEI++SGL LTGSMG+QL  L SVT
Sbjct  37   YNSLNSPSQLTGWKSSGGDPCGESWKGIKCSGSSITEIKLSGLGLTGSMGYQLSSLTSVT  96

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNL   +PYQLPPNV  L+L+ NGFTGG+PYSISQM  L+Y
Sbjct  97   NFDMSKNNLKGDIPYQLPPNVLHLDLSRNGFTGGVPYSISQMTDLKY  143



>ref|XP_010655239.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 isoform X1 [Vitis 
vinifera]
Length=687

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QLT W ++GGDPCGESWKG+ CSG+ +TEI++SGL LTGSMG+QL  L SVT
Sbjct  37   YNSLNSPSQLTGWKSSGGDPCGESWKGIKCSGSSITEIKLSGLGLTGSMGYQLSSLTSVT  96

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNL   +PYQLPPNV  L+L+ NGFTGG+PYSISQM  L+Y
Sbjct  97   NFDMSKNNLKGDIPYQLPPNVLHLDLSRNGFTGGVPYSISQMTDLKY  143



>emb|CDY36601.1| BnaC06g06540D [Brassica napus]
Length=698

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSS++SP QLT+WTA+ GDPCG++W+GV+CSG RVT+I+ISGL+L+G++G++LD L ++T
Sbjct  40   FSSMHSPAQLTQWTASAGDPCGQNWRGVTCSGTRVTQIKISGLELSGTLGYKLDSLTNLT  99

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S+NNLG  LPYQ PPN+++LNLA N FTG   YSISQ+ PL+Y
Sbjct  100  ELDVSSNNLGGDLPYQFPPNLERLNLAFNQFTGAAQYSISQIVPLKY  146



>ref|XP_009408730.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Musa acuminata 
subsp. malaccensis]
Length=703

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNSPPQLT W+++GGDPCG +WKG+ CSG+ VT+I +SGLQLTG+MG+QL  L SVT
Sbjct  37   YSSLNSPPQLTGWSSSGGDPCGNNWKGIKCSGSSVTKITLSGLQLTGTMGYQLSSLISVT  96

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNL   +PYQLPPN   LNLAGN  TGG+PYS+SQM  L+Y
Sbjct  97   YFDLSKNNLNGDIPYQLPPNTTHLNLAGNALTGGIPYSVSQMNHLKY  143



>ref|XP_006392757.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
 gb|ESQ30043.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
Length=717

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSS++SP QLT+WTA+ GDPCG++W+GV+CSG+RVT++++SGL+L+G++G+ LD+L S+T
Sbjct  38   FSSMHSPAQLTQWTASAGDPCGQNWRGVTCSGSRVTQVKLSGLELSGTLGYMLDRLTSLT  97

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S+NNLG  LPYQLPPN+Q+LNLA N FTG   YSISQM+ L+Y
Sbjct  98   ELDLSSNNLGGDLPYQLPPNLQRLNLAFNQFTGAAQYSISQMSSLKY  144



>ref|XP_006392758.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
 gb|ESQ30044.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
Length=719

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSS++SP QLT+WTA+ GDPCG++W+GV+CSG+RVT++++SGL+L+G++G+ LD+L S+T
Sbjct  40   FSSMHSPAQLTQWTASAGDPCGQNWRGVTCSGSRVTQVKLSGLELSGTLGYMLDRLTSLT  99

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S+NNLG  LPYQLPPN+Q+LNLA N FTG   YSISQM+ L+Y
Sbjct  100  ELDLSSNNLGGDLPYQLPPNLQRLNLAFNQFTGAAQYSISQMSSLKY  146



>ref|XP_009147586.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Brassica rapa]
Length=719

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSS++SP QLT+WTA+ GDPCG++W+GV+CSG RVT+I+ISGL+L+G++G++LD L ++T
Sbjct  40   FSSMHSPAQLTQWTASAGDPCGQNWRGVNCSGTRVTQIKISGLELSGTLGYKLDSLTNLT  99

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S+NNLG  LPYQ PPN+++LNLA N FTG   YSISQ+ PL+Y
Sbjct  100  ELDVSSNNLGGDLPYQFPPNLERLNLAFNQFTGAAQYSISQIVPLKY  146



>ref|XP_010462281.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Camelina 
sativa]
Length=721

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSS++SP QLT+WTA  GDPCG++W+GV+CSG+RVT+I++ GL+L+G++G+ LD+L S+T
Sbjct  40   FSSMHSPAQLTQWTAAAGDPCGQNWRGVTCSGSRVTQIKLPGLELSGTLGYMLDKLTSLT  99

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S+NNLG  LPYQLPPN+Q+LNLA N FTG   YSIS M PL+Y
Sbjct  100  ELDLSSNNLGGDLPYQLPPNLQRLNLANNQFTGAAQYSISHMTPLKY  146



>emb|CDY24077.1| BnaA06g00750D [Brassica napus]
Length=719

 Score =   155 bits (393),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSS++SP QLT+WTA+ GDPCG++W+GV+CSG RVT+I+ISGL+L+G++G++LD L ++T
Sbjct  40   FSSMHSPAQLTQWTASAGDPCGQNWRGVNCSGTRVTQIKISGLELSGTLGYKLDSLTNLT  99

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S+NNLG  LPYQ PPN+++LNLA N FTG   YSISQ+ PL+Y
Sbjct  100  ELDVSSNNLGGDLPYQFPPNLERLNLAFNQFTGAAQYSISQIVPLKY  146



>ref|XP_010501035.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Camelina sativa]
Length=721

 Score =   155 bits (393),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSS++SP QLT+WTA  GDPCG++W+GV+CSG+RVT+I++ GL+L+G++G+ LD+L S+T
Sbjct  41   FSSMHSPAQLTQWTAAAGDPCGQNWRGVTCSGSRVTQIKLPGLELSGTLGYMLDKLTSLT  100

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S+NNLG  LPYQLPPN+Q+LNLA N FTG   YSIS M PL+Y
Sbjct  101  ELDLSSNNLGGDLPYQLPPNLQRLNLANNQFTGAAQYSISHMTPLKY  147



>ref|XP_006304699.1| hypothetical protein CARUB_v10011957mg [Capsella rubella]
 gb|EOA37597.1| hypothetical protein CARUB_v10011957mg [Capsella rubella]
Length=719

 Score =   155 bits (393),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSS++SP QLT+WTA  GDPCG++W+GV+CSG+RVT+I++ GL+L+G++G+ LD+L S+T
Sbjct  40   FSSMHSPAQLTQWTAAAGDPCGQNWRGVTCSGSRVTQIKLPGLELSGTLGYMLDKLTSLT  99

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S+NNLG  LPYQLPPN+Q+LNLA N FTG   YSIS M PL+Y
Sbjct  100  ELDLSSNNLGGDLPYQLPPNLQRLNLANNQFTGAAQYSISHMTPLKY  146



>ref|XP_010479951.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Camelina 
sativa]
Length=721

 Score =   155 bits (393),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSS++SP QLT+WTA  GDPCG++W+GV+CSG+RVT+I++ GL+L+G++G+ LD+L S+T
Sbjct  40   FSSMHSPAQLTQWTAAAGDPCGQNWRGVTCSGSRVTQIKLPGLELSGTLGYMLDKLTSLT  99

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S+NNLG  LPYQLPPN+Q+LNLA N FTG   YSIS M PL+Y
Sbjct  100  ELDLSSNNLGGDLPYQLPPNLQRLNLANNQFTGAAQYSISHMTPLKY  146



>ref|XP_010489831.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Camelina 
sativa]
Length=404

 Score =   152 bits (385),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F+S+NSP QL++WTA+GGDPCG++W+GV+CSG+RVT+I++  L L+G++G+ LD+L SVT
Sbjct  41   FTSMNSPGQLSQWTASGGDPCGQNWRGVTCSGSRVTQIKLPSLGLSGTLGYTLDKLTSVT  100

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNLG  LPYQLPPN+++LNLA N FTG   YSIS MAPL+Y
Sbjct  101  EFDLSNNNLGGDLPYQLPPNLERLNLANNQFTGSAQYSISLMAPLKY  147



>ref|XP_004252624.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Solanum lycopersicum]
Length=706

 Score =   155 bits (392),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +++LNSP QLTKW+ANGGDPCGESW G++CSGN VTEI++SGL L+GS+G QLD LKSVT
Sbjct  39   YTTLNSPGQLTKWSANGGDPCGESWTGITCSGNNVTEIKLSGLGLSGSLGSQLDSLKSVT  98

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FDIS NN+G+ +PYQLPPNVQ+LNLA +GF+GGLPYSISQM  L+Y
Sbjct  99   NFDISNNNMGSQIPYQLPPNVQRLNLASSGFSGGLPYSISQMTSLQY  145



>gb|ABB20817.1| putative leucine-rich repeat transmembrane protein kinase [Isatis 
tinctoria]
 gb|ABF50792.1| leucine-rich repeat transmembrane protein kinase [Isatis tinctoria]
Length=719

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F+S++SP QLT+WTA+ GDPCG++W+GV+CSG RVT+I+I  L+L+G++G+ LD+L ++T
Sbjct  39   FTSMHSPAQLTQWTASAGDPCGQNWRGVTCSGTRVTQIKIPSLELSGTLGYMLDRLTNLT  98

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S+NNLG  LPYQLPPN+Q+LNLA N FTG   YSISQMAPL+Y
Sbjct  99   ELDLSSNNLGGDLPYQLPPNLQRLNLAYNQFTGAAQYSISQMAPLKY  145



>ref|XP_010501850.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Camelina sativa]
Length=721

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F S+NSP QL++WTA+GGDPCG++WKGV+CSG+RVT+I++ GL L+G++G+ LD+L SVT
Sbjct  42   FISMNSPGQLSQWTASGGDPCGQNWKGVTCSGSRVTQIKLPGLGLSGTLGYTLDKLTSVT  101

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNLG  LPYQLPPN+++LNLA N FTG   YSIS MAPL+Y
Sbjct  102  EFDLSNNNLGGDLPYQLPPNLERLNLANNQFTGSAQYSISLMAPLKY  148



>ref|XP_010465325.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Camelina 
sativa]
Length=721

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F+S+NSP QL++WTA+GGDPCG++WKGV+CSG R+T+I++ GL L+GS+G+ LD+L SVT
Sbjct  42   FNSMNSPGQLSQWTASGGDPCGQNWKGVTCSGLRITQIKLPGLGLSGSLGYMLDKLTSVT  101

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNLG  LPYQLPPN+++LNLA N FTG   YSIS MAPL+Y
Sbjct  102  EFDLSNNNLGGDLPYQLPPNLERLNLANNQFTGSAQYSISLMAPLKY  148



>ref|XP_009106960.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Brassica rapa]
Length=716

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSS++SP QLT+WTA+GGDPCG++W+GV+CSG+RVT++++ GL+L+G++G+ LD+L S+T
Sbjct  41   FSSMHSPGQLTQWTASGGDPCGQNWRGVTCSGSRVTQLKLPGLELSGTLGYMLDKLTSLT  100

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S+NNLG  LPYQLPPN+Q+LNLA N FTG   YSIS MA L+Y
Sbjct  101  ELDLSSNNLGGDLPYQLPPNLQRLNLANNQFTGAAQYSISNMASLKY  147



>ref|XP_009398614.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=694

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSL+SP +LT W++ GGDPCG  WKG+ CSG+ VTEI++SGL LTG+MG+QL  L SVT
Sbjct  38   YSSLSSPSKLTGWSSGGGDPCGNDWKGIKCSGSSVTEIKLSGLGLTGTMGYQLASLTSVT  97

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNL   +PYQLPPNV  +NLAGNG TGG+PYSISQM+ L+Y
Sbjct  98   YFDLSKNNLNGDIPYQLPPNVTHINLAGNGLTGGIPYSISQMSDLKY  144



>gb|KFK35699.1| hypothetical protein AALP_AA4G025700 [Arabis alpina]
Length=721

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSS++SP QLT+WTA+ GDPCG++W+GV+CSG+RVT+I+I GL+L+G++GF LD+L S+T
Sbjct  40   FSSMHSPAQLTQWTASAGDPCGQNWRGVTCSGSRVTQIKIPGLELSGTLGFMLDRLTSLT  99

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S+NNLG  LPY LPPN+++LNLA N FTG   YSISQMA L+Y
Sbjct  100  ELDLSSNNLGGDLPYPLPPNLEQLNLANNQFTGTAQYSISQMASLKY  146



>ref|XP_006362102.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Solanum 
tuberosum]
Length=706

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +++LNSP QLTKW ANGGDPCGESW G++CSGN+VTEI++SGL L+GS+G QLD LKSVT
Sbjct  39   YTTLNSPGQLTKWNANGGDPCGESWTGITCSGNKVTEIKMSGLGLSGSLGSQLDSLKSVT  98

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FDIS NN+G+ LPYQLPPNVQ+LNLA +GF+GGLPYSISQM  L+Y
Sbjct  99   NFDISNNNMGSQLPYQLPPNVQRLNLASSGFSGGLPYSISQMTSLQY  145



>emb|CDY02495.1| BnaA08g01020D [Brassica napus]
Length=716

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSS++SP QLT+WTA+GGDPCG++W+GV+CS +RVT++++SGL+L+G++G+ LD+L S+T
Sbjct  41   FSSMHSPGQLTQWTASGGDPCGQNWRGVTCSRSRVTQLKLSGLELSGTLGYMLDKLTSLT  100

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S+NNLG  LPYQLPPN+Q+LNLA N FTG   YSIS M  L+Y
Sbjct  101  ELDLSSNNLGGDLPYQLPPNLQRLNLANNQFTGAAQYSISNMVSLKY  147



>gb|KDP25030.1| hypothetical protein JCGZ_22565 [Jatropha curcas]
Length=705

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F+SLNSP QL+ W ++GGDPCG+SW+G++CSG+ VT I++SGL L+GSMG+QL  LKSVT
Sbjct  42   FTSLNSPSQLSNWKSSGGDPCGDSWEGITCSGSSVTTIRLSGLGLSGSMGYQLSNLKSVT  101

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNL N +PYQLPPN+  L+L+ N F+G +PYSISQM  LEY
Sbjct  102  YFDMSKNNLKNDIPYQLPPNMAHLDLSNNDFSGSVPYSISQMNDLEY  148



>ref|XP_002320001.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE98316.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=681

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F+SLNSP +L+ W + GGDPCG+SW+G+ CSG+ VT+I++SGL LTGS+G+QL  LKSVT
Sbjct  36   FTSLNSPSKLSGWKSRGGDPCGDSWEGIQCSGSSVTQIKLSGLGLTGSLGYQLSNLKSVT  95

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNL N +PYQLPPN   L+L+ NGFTG +PYSISQM  L+Y
Sbjct  96   YFDVSKNNLNNDIPYQLPPNTVNLDLSNNGFTGNVPYSISQMTKLQY  142



>ref|XP_011011656.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Populus 
euphratica]
Length=700

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F+SLNSP +L+ W + GGDPCG+SW+G+ CSG+ VT+I++SGL LTGS+G+QL  LKSVT
Sbjct  42   FTSLNSPSKLSGWKSRGGDPCGDSWEGIQCSGSSVTQIKLSGLGLTGSLGYQLSNLKSVT  101

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNL N +PYQLPPN   L+L+ NGFTG +PYSISQM  L+Y
Sbjct  102  YFDVSKNNLNNDIPYQLPPNTVNLDLSNNGFTGNVPYSISQMTKLQY  148



>ref|XP_006369070.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP65639.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=715

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSS+NSP QLT+W+ANG DPCG++WKG++CSG+RVTEI++ GL L+GS+G+QLD L +  
Sbjct  38   FSSMNSPGQLTQWSANGDDPCGQNWKGITCSGSRVTEIKLPGLALSGSLGYQLDSLTAAM  97

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NNL  +LPYQLPPN+Q+LNLA N  +GG+PYSIS M  L Y
Sbjct  98   NLDLSNNNLAGALPYQLPPNLQRLNLANNKLSGGIPYSISLMRSLTY  144



>ref|XP_006300068.1| hypothetical protein CARUB_v10016296mg [Capsella rubella]
 gb|EOA32966.1| hypothetical protein CARUB_v10016296mg [Capsella rubella]
Length=717

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F+S+NSP QL++WTA+GGDPCG++W+GV+CSG+RVT+I++  L L+GS+GF LD+L SVT
Sbjct  39   FTSMNSPGQLSQWTASGGDPCGQNWRGVTCSGSRVTQIKLPSLGLSGSLGFMLDKLTSVT  98

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NNLG  L YQLPPN+++LNLA N FTG   YSIS MAPL+Y
Sbjct  99   ELDLSNNNLGGDLSYQLPPNLERLNLANNQFTGSAQYSISLMAPLKY  145



>ref|XP_002513297.1| strubbelig receptor, putative [Ricinus communis]
 gb|EEF48700.1| strubbelig receptor, putative [Ricinus communis]
Length=694

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F+ LNSP QL+ W ++GGDPC +SW+G++CSG+ VT+I++SGL L+GSMG+QL  LKSVT
Sbjct  36   FTGLNSPSQLSGWKSSGGDPCDDSWEGITCSGSSVTQIKLSGLGLSGSMGYQLSNLKSVT  95

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNL N +PYQLPPN   L+L+ NGF+G +PYSISQM  LEY
Sbjct  96   YFDMSKNNLDNDIPYQLPPNTAHLDLSNNGFSGNVPYSISQMTDLEY  142



>ref|XP_010542346.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Tarenaya hassleriana]
Length=716

 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SS+NSP QL++W  +GGDPCGE WKGV+CSG+RVTE+++  L L+GS+G+ LD+L +VT
Sbjct  40   YSSMNSPSQLSEWKPSGGDPCGEHWKGVTCSGSRVTEVKLPNLGLSGSLGYMLDKLSAVT  99

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNLG  LPYQLPP VQ+LNLA N FTG   YSIS MA L+Y
Sbjct  100  EFDLSNNNLGGDLPYQLPPAVQRLNLANNQFTGSAQYSISLMASLKY  146



>ref|XP_010928729.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Elaeis 
guineensis]
Length=684

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F SLNSPPQLT W+++GGDPCGE WKGV CS   VTEI ++ L LTGS+G+QL  L S+T
Sbjct  35   FLSLNSPPQLTGWSSSGGDPCGEDWKGVKCSDLSVTEISLADLGLTGSLGYQLSSLTSIT  94

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNL  ++PYQLPP V+ LNLA N FTGG+PYSISQM  L+Y
Sbjct  95   YFDMSKNNLRGNIPYQLPPKVEHLNLAENAFTGGIPYSISQMTDLKY  141



>gb|AAG51973.1|AC024260_11 leucine-rich repeat transmembrane protein kinase 1, putative; 
10414-7611 [Arabidopsis thaliana]
Length=516

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 90/108 (83%), Gaps = 1/108 (1%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMG-FQLDQLKSV  381
            FS ++SP QLT+WTA  GDPCG++W+GV+CSG+RVT+I++SGL+L+G++G + LD+L S+
Sbjct  39   FSGMHSPAQLTQWTAAAGDPCGQNWRGVTCSGSRVTQIKLSGLELSGTLGGYMLDKLTSL  98

Query  382  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T  D+S+NNLG  LPYQ PPN+Q+LNLA N FTG   YS+SQ+ PL+Y
Sbjct  99   TELDLSSNNLGGDLPYQFPPNLQRLNLANNQFTGAASYSLSQITPLKY  146



>ref|XP_010245765.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Nelumbo 
nucifera]
Length=760

 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP +LT W ++GGDPCG+SWKG+ CSG+ V EI++SGL LTGS+G++L  L S+T
Sbjct  88   YTSLNSPSKLTNWKSSGGDPCGDSWKGIKCSGSHVKEIKLSGLGLTGSLGYKLSSLTSLT  147

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNL +S+PYQLPPNV  +NLAGN FTG +PYSISQM  L+Y
Sbjct  148  YFDLSNNNLKDSIPYQLPPNVLHINLAGNSFTGTVPYSISQMLNLKY  194



>ref|XP_011012291.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Populus 
euphratica]
Length=694

 Score =   150 bits (378),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F+SLNSP +L+ W + GGDPCG+SW+G+ CSG+ VT+I++ GL LTGS+G+QL  LKSVT
Sbjct  36   FTSLNSPSKLSGWKSRGGDPCGDSWEGIHCSGSSVTQIKLPGLGLTGSLGYQLSNLKSVT  95

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNL N +PYQLPPN   L+L+ NGFTG +PYSISQM  L+Y
Sbjct  96   YFDVSKNNLNNDIPYQLPPNTVNLDLSNNGFTGNVPYSISQMTKLQY  142



>emb|CDY25686.1| BnaC03g69890D [Brassica napus]
Length=716

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F+S++SP QLT+WTA+GGDPC ++W+GV+CS +R+T++++SGL+L+G++G+ LD+L S+T
Sbjct  41   FTSMHSPGQLTQWTASGGDPCVQNWRGVTCSKSRITQLKLSGLELSGTLGYMLDKLTSLT  100

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S+NNLG  LPYQLPPN+Q+LNLA N FTG   YSIS MA L+Y
Sbjct  101  ELDLSSNNLGGDLPYQLPPNLQRLNLANNQFTGAAQYSISNMASLKY  147



>ref|XP_009406399.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Musa acuminata 
subsp. malaccensis]
Length=723

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNSP QLT W ++GGDPCG  WKG+ CSG+ VTEI++SGL LTG+MG+QL  L SVT
Sbjct  63   YSSLNSPSQLTGWGSSGGDPCGNDWKGIKCSGSSVTEIKLSGLGLTGTMGYQLSSLTSVT  122

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNL   +PYQLPPN   +NLAGN  TGG+PYSISQM  L Y
Sbjct  123  YFDLSKNNLQGDVPYQLPPNAIHINLAGNALTGGVPYSISQMTDLNY  169



>ref|NP_001077716.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
 gb|AEE32991.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
Length=720

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 90/108 (83%), Gaps = 1/108 (1%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMG-FQLDQLKSV  381
            FS ++SP QLT+WTA  GDPCG++W+GV+CSG+RVT+I++SGL+L+G++G + LD+L S+
Sbjct  39   FSGMHSPAQLTQWTAAAGDPCGQNWRGVTCSGSRVTQIKLSGLELSGTLGGYMLDKLTSL  98

Query  382  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T  D+S+NNLG  LPYQ PPN+Q+LNLA N FTG   YS+SQ+ PL+Y
Sbjct  99   TELDLSSNNLGGDLPYQFPPNLQRLNLANNQFTGAASYSLSQITPLKY  146



>ref|NP_175777.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
 sp|Q9C8M9.1|SRF6_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY 6; AltName: 
Full=Leucine-rich repeat receptor kinase-like protein SRF6; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51974.1|AC024260_12 leucine-rich repeat transmembrane protein kinase 1, putative; 
10414-6710 [Arabidopsis thaliana]
 gb|AAQ89622.1| At1g53730 [Arabidopsis thaliana]
 gb|AAR99874.1| strubbelig receptor family 6 [Arabidopsis thaliana]
 dbj|BAE99117.1| LRR receptor-like protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59255.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE32990.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
Length=719

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 90/108 (83%), Gaps = 1/108 (1%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMG-FQLDQLKSV  381
            FS ++SP QLT+WTA  GDPCG++W+GV+CSG+RVT+I++SGL+L+G++G + LD+L S+
Sbjct  39   FSGMHSPAQLTQWTAAAGDPCGQNWRGVTCSGSRVTQIKLSGLELSGTLGGYMLDKLTSL  98

Query  382  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T  D+S+NNLG  LPYQ PPN+Q+LNLA N FTG   YS+SQ+ PL+Y
Sbjct  99   TELDLSSNNLGGDLPYQFPPNLQRLNLANNQFTGAASYSLSQITPLKY  146



>ref|XP_010685195.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Beta vulgaris 
subsp. vulgaris]
Length=707

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +1

Query  199  GGFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKS  378
            G F+S+N+P QLT WTA+GGDPCG+SWKGV+CSG+RVT+I++  L LTGS+G+QL  L S
Sbjct  34   GMFTSMNNPAQLTGWTASGGDPCGQSWKGVTCSGSRVTQIKLPNLGLTGSLGYQLQSLTS  93

Query  379  VTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            +T FD+S NN G SL Y LPPN+Q+LNLA   F G +PYSIS M PLE+
Sbjct  94   LTDFDLSHNNFGGSLTYNLPPNLQRLNLANCSFNGQIPYSISLMKPLEH  142



>gb|KCW53999.1| hypothetical protein EUGRSUZ_J03194, partial [Eucalyptus grandis]
Length=708

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNSP  LT W + GGDPCGESWKG+ CSG+ VTEI++S L LTGS+G+QL  LKSVT
Sbjct  43   YSSLNSPSALTGWKSGGGDPCGESWKGIKCSGSSVTEIKLSDLGLTGSIGYQLSSLKSVT  102

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNL   +PYQLPPN   ++L+ N FTG +PYSISQM  L+Y
Sbjct  103  YFDLSENNLRGDIPYQLPPNALHIDLSSNAFTGNVPYSISQMTDLKY  149



>ref|XP_010034888.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Eucalyptus 
grandis]
Length=716

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNSP  LT W + GGDPCGESWKG+ CSG+ VTEI++S L LTGS+G+QL  LKSVT
Sbjct  56   YSSLNSPSALTGWKSGGGDPCGESWKGIKCSGSSVTEIKLSDLGLTGSIGYQLSSLKSVT  115

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNL   +PYQLPPN   ++L+ N FTG +PYSISQM  L+Y
Sbjct  116  YFDLSENNLRGDIPYQLPPNALHIDLSSNAFTGNVPYSISQMTDLKY  162



>ref|XP_002310348.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE90798.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=672

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F+SLNSP +L+ W ++GGDPCG+SW+G+ CSG+ VT+I++SGL LTGS+G+QL  LKSVT
Sbjct  36   FTSLNSPSKLSGWQSSGGDPCGDSWEGIQCSGSSVTQIKLSGLGLTGSLGYQLSNLKSVT  95

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQM  510
             FD+S NNL N +PYQLPPN   L+L+ NGFTG +PYSISQM
Sbjct  96   YFDVSKNNLKNDIPYQLPPNAATLDLSNNGFTGSVPYSISQM  137



>ref|XP_008372915.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Malus domestica]
 ref|XP_008372916.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Malus domestica]
Length=714

 Score =   147 bits (372),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNSP QLT+W  NG DPCG+SWKGV CSG+RVTEI +SGLQL+G++G+QL  L ++T
Sbjct  40   YSSLNSPSQLTQWIQNGDDPCGQSWKGVKCSGSRVTEIDLSGLQLSGTLGYQLQTLTALT  99

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NNL  ++PYQLPPN+ +LNL GN F   +PYSISQ+  L Y
Sbjct  100  NLDMSNNNLAGTIPYQLPPNMTRLNLGGNNFNQDIPYSISQITSLTY  146



>ref|NP_001174920.1| Os06g0634500 [Oryza sativa Japonica Group]
 dbj|BAH93648.1| Os06g0634500 [Oryza sativa Japonica Group]
Length=155

 Score =   139 bits (349),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SS NSP QLT W+A GGDPCG +W GVSC G+ VT I++SG+ L G++G+QL  L ++ 
Sbjct  34   YSSWNSPAQLTGWSAGGGDPCGAAWMGVSCVGSAVTSIKLSGMGLNGTLGYQLSNLLALK  93

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S+NNL +S+PYQLPPN+  LNLAGN F+G LPYSIS M  L Y
Sbjct  94   TMDLSSNNLHDSIPYQLPPNLAYLNLAGNNFSGNLPYSISNMVSLNY  140



>ref|XP_010273793.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Nelumbo nucifera]
Length=725

 Score =   147 bits (372),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNS  QLT W++ GGDPCG SWKG++CSG  VTEI++SGL LTGSMG+QL  L S+T
Sbjct  47   YSSLNSAAQLTGWSSAGGDPCGNSWKGITCSGQAVTEIKLSGLGLTGSMGYQLSSLTSLT  106

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T DIS N LGN +PYQLPPNVQ+LNLAGN F GG+PYSISQM  L+Y
Sbjct  107  TLDISNNFLGNQIPYQLPPNVQQLNLAGNSFNGGIPYSISQMTSLKY  153



>gb|KGN45936.1| hypothetical protein Csa_6G024930 [Cucumis sativus]
Length=696

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 90/130 (69%), Gaps = 8/130 (6%)
 Frame = +1

Query  136  FCSTRRPPPSLIQIRLMRQF*GGFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTE  315
            F  T+ P  S + +         FSSLNSP QL+ W ++GGDPCG SW+G+ CSG+ VTE
Sbjct  21   FSKTKAPDVSALNVM--------FSSLNSPSQLSGWGSSGGDPCGNSWEGIQCSGSSVTE  72

Query  316  IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPY  495
            I +S   L+GSMG+QL  L SVT FD+S NNL   +PYQLPPN   ++L+GN FTG +PY
Sbjct  73   ISLSDFGLSGSMGYQLSNLASVTYFDLSKNNLNGEIPYQLPPNAVHIDLSGNSFTGSVPY  132

Query  496  SISQMAPLEY  525
            SISQM+ LE+
Sbjct  133  SISQMSELEF  142



>ref|XP_008445635.1| PREDICTED: LOW QUALITY PROTEIN: protein STRUBBELIG-RECEPTOR FAMILY 
5-like [Cucumis melo]
Length=706

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 90/130 (69%), Gaps = 8/130 (6%)
 Frame = +1

Query  136  FCSTRRPPPSLIQIRLMRQF*GGFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTE  315
            F  T+ P  S + +         FSSLNSP QLT W ++GGDPCG+SW+G+ CSG+ VTE
Sbjct  21   FSKTKAPDVSALNVM--------FSSLNSPSQLTGWGSSGGDPCGDSWEGIKCSGSSVTE  72

Query  316  IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPY  495
            I +S   L+GSMG+QL  L SVT FD+S N+L   +PYQLPPN   ++L+GN FTG +PY
Sbjct  73   ISLSDFGLSGSMGYQLSNLASVTYFDLSKNSLSGDIPYQLPPNAVHIDLSGNSFTGSVPY  132

Query  496  SISQMAPLEY  525
            SISQM  LE+
Sbjct  133  SISQMTELEF  142



>gb|KDO67050.1| hypothetical protein CISIN_1g040888mg, partial [Citrus sinensis]
Length=495

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SL+SP QL+ W A GGDPCGE WKG++CSG+ VTEI++SGL L G +G+QL  LKSV+
Sbjct  37   YTSLHSPSQLSNWKAGGGDPCGEHWKGITCSGSSVTEIKLSGLGLNGQLGYQLTNLKSVS  96

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NNL +S+PYQLPPN++ L+L+ N F+G +PYSISQM+ L+Y
Sbjct  97   YLDVSNNNLKDSIPYQLPPNLKHLDLSENQFSGTVPYSISQMSELKY  143



>ref|XP_006425179.1| hypothetical protein CICLE_v10030356mg, partial [Citrus clementina]
 gb|ESR38419.1| hypothetical protein CICLE_v10030356mg, partial [Citrus clementina]
Length=578

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SL+SP QL+ W A GGDPCGE WKG++CSG+ VTEI++SGL L G +G+QL  LKSV+
Sbjct  7    YTSLHSPSQLSNWKAGGGDPCGEHWKGITCSGSSVTEIKLSGLGLNGQLGYQLTNLKSVS  66

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NNL +S+PYQLPPN++ L+L+ N F+G +PYSISQM+ L+Y
Sbjct  67   YLDVSNNNLKDSIPYQLPPNLKHLDLSENQFSGTVPYSISQMSELKY  113



>ref|XP_008228094.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Prunus mume]
Length=717

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNSP QLT+W+ANG DPCG+SWKGV CSG+RVTEI +S LQL+GS+   L  L S+T
Sbjct  40   YSSLNSPSQLTQWSANGDDPCGQSWKGVKCSGSRVTEIDVSNLQLSGSLWSSLQSLTSLT  99

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NNL  S+PY LPPN+ +LNLA N F  G+PYSISQ+  LEY
Sbjct  100  NLDMSHNNLAGSIPYSLPPNMTRLNLAANNFNQGIPYSISQITSLEY  146



>gb|KDP40614.1| hypothetical protein JCGZ_24613 [Jatropha curcas]
Length=714

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = +1

Query  199  GGFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKS  378
            G F+SL SP QLT+W ANGGDPC ESWKGV+CSG RVTEI++SGL L+G MG+QL  L +
Sbjct  36   GMFTSLGSPGQLTQWKANGGDPCEESWKGVTCSGPRVTEIKLSGLALSGQMGYQLASLTA  95

Query  379  VTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            +T  D+S NN+G  +PY LPPN+ +LNLA N FTG +PYSIS M  L Y
Sbjct  96   LTNLDMSNNNIGGGIPYGLPPNLTQLNLASNQFTGDIPYSISMMTKLTY  144



>ref|XP_011031253.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 [Populus euphratica]
Length=672

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F+SLNSP +L+ W ++GGDPCG+SW+G+ CSG+ VT+I++SG  LTGS+G+QL  LKSVT
Sbjct  36   FTSLNSPSKLSGWQSSGGDPCGDSWEGIQCSGSSVTQIKLSGFGLTGSLGYQLSNLKSVT  95

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQM  510
             FD+S NNL N +PYQLPPN   L+L+ NGFTG +PYSISQM
Sbjct  96   YFDVSKNNLKNDMPYQLPPNAATLDLSNNGFTGSVPYSISQM  137



>gb|EYU33875.1| hypothetical protein MIMGU_mgv1a002066mg [Erythranthe guttata]
Length=720

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QLT W ++GGDPCGESWKG++C G+ V  IQISGL +TGSMG+ L  L S+ 
Sbjct  45   YTSLNSPSQLTGWKSSGGDPCGESWKGITCQGSSVVSIQISGLGITGSMGYLLSNLASLK  104

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S NN+ +S+PYQLPPN+  LNLAGN FTG +PYSI+ M  L Y
Sbjct  105  TLDMSNNNIHDSIPYQLPPNLTSLNLAGNNFTGNIPYSIATMGSLNY  151



>gb|KHG25534.1| protein strubbelig-receptor family 6 [Gossypium arboreum]
Length=724

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSSLNSP QLT WTAN GDPCG+SWKGV+CS  RVTEI++S L L+GSMG+ L  L S+ 
Sbjct  38   FSSLNSPQQLTGWTANNGDPCGQSWKGVTCSDQRVTEIKLSNLALSGSMGYSLQSLTSLK  97

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NNL   +PY +P N+Q+LNLA N FTG +PYSI+QM  L+Y
Sbjct  98   ELDLSNNNLAGDIPYDIPQNLQRLNLAFNQFTGSVPYSINQMHSLQY  144



>ref|XP_006488603.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Citrus 
sinensis]
Length=696

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SL+SP QL+ W A GGDPCGE WKG++CSG+ VTEI++SGL L G +G+QL  LKSV+
Sbjct  37   YTSLHSPSQLSNWKAGGGDPCGEHWKGITCSGSSVTEIKLSGLGLNGQLGYQLTNLKSVS  96

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NNL +S+PYQLPPN++ L+L+ N F+G +PYSISQM+ L+Y
Sbjct  97   YLDVSNNNLKDSIPYQLPPNLKHLDLSENQFSGTVPYSISQMSELKY  143



>ref|XP_004138532.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Cucumis 
sativus]
 ref|XP_004160222.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Cucumis 
sativus]
Length=662

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSSLNSP QL+ W ++GGDPCG SW+G+ CSG+ VTEI +S   L+GSMG+QL  L SVT
Sbjct  2    FSSLNSPSQLSGWGSSGGDPCGNSWEGIQCSGSSVTEISLSDFGLSGSMGYQLSNLASVT  61

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNL   +PYQLPPN   ++L+GN FTG +PYSISQM+ LE+
Sbjct  62   YFDLSKNNLNGEIPYQLPPNAVHIDLSGNSFTGSVPYSISQMSELEF  108



>gb|EPS68087.1| hypothetical protein M569_06686, partial [Genlisea aurea]
Length=632

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F+++NSP QL  W ++GGDPC +SWKG+SCSG++VTEI +SGL LTGS+G+ L  LKSV 
Sbjct  8    FATMNSPSQLDGWKSSGGDPCHDSWKGISCSGSKVTEIDLSGLGLTGSIGYMLSDLKSVV  67

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
             FD+S N   +S+PYQLPPNVQ+++L+GN F G +PYSIS+M+ L+
Sbjct  68   NFDVSKNKFKSSIPYQLPPNVQRIDLSGNEFQGTVPYSISEMSHLK  113



>ref|XP_008668240.1| PREDICTED: uncharacterized protein LOC100381414 isoform X2 [Zea 
mays]
Length=671

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 84/108 (78%), Gaps = 2/108 (2%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGES--WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKS  378
            F+S+N P QL+ W ++GGDPC +   WKG+ CSG+ VTEI +SGL+L+GS+G+QL  LKS
Sbjct  42   FNSMNKPSQLSGWKSSGGDPCDDDDEWKGIECSGSSVTEINLSGLELSGSLGYQLSSLKS  101

Query  379  VTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
            VT FD+S NNL   LPYQLPPNV +LNL GN  TGG+PYSISQM  LE
Sbjct  102  VTKFDLSNNNLNGDLPYQLPPNVVELNLYGNSLTGGVPYSISQMGDLE  149



>ref|XP_008668239.1| PREDICTED: uncharacterized protein LOC100381414 isoform X1 [Zea 
mays]
Length=685

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 84/108 (78%), Gaps = 2/108 (2%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGES--WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKS  378
            F+S+N P QL+ W ++GGDPC +   WKG+ CSG+ VTEI +SGL+L+GS+G+QL  LKS
Sbjct  42   FNSMNKPSQLSGWKSSGGDPCDDDDEWKGIECSGSSVTEINLSGLELSGSLGYQLSSLKS  101

Query  379  VTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
            VT FD+S NNL   LPYQLPPNV +LNL GN  TGG+PYSISQM  LE
Sbjct  102  VTKFDLSNNNLNGDLPYQLPPNVVELNLYGNSLTGGVPYSISQMGDLE  149



>ref|XP_011072790.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 [Sesamum indicum]
Length=717

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++S+NSP  L  WT++GGDPCGESWKG+SCSG++VTEI +SGL LTGS G++L  LKSVT
Sbjct  54   YTSMNSPSVLDGWTSSGGDPCGESWKGISCSGSKVTEINLSGLGLTGSFGYKLSDLKSVT  113

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
             FD+S N+   ++PYQLPPN+Q ++L+GN F G +PYSISQM  L+
Sbjct  114  RFDLSKNSFKGNIPYQLPPNLQLIDLSGNEFDGNVPYSISQMTDLK  159



>ref|XP_010087069.1| Protein STRUBBELIG-RECEPTOR FAMILY 5 [Morus notabilis]
 gb|EXB26124.1| Protein STRUBBELIG-RECEPTOR FAMILY 5 [Morus notabilis]
Length=697

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 94/142 (66%), Gaps = 10/142 (7%)
 Frame = +1

Query  112  GRWRFSLGFCSTR----RPPPSLIQIRLMRQF*GGFSSLNSPPQLTKWTANGGDPCGESW  279
            G W    G  +TR       P +  + +M      ++SLNSP QL+ W ++GGDPCG+SW
Sbjct  7    GLWIVFFGVIATRVLSKTNAPDVSALNVM------YTSLNSPSQLSGWQSSGGDPCGDSW  60

Query  280  KGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLN  459
            +G+ CSG+ VTEI +S L L+GSMG+QL  L SVT FD+S NN+   +PYQLPPN Q ++
Sbjct  61   EGIKCSGSSVTEINLSNLGLSGSMGYQLSSLTSVTYFDLSKNNIKGEIPYQLPPNAQYID  120

Query  460  LAGNGFTGGLPYSISQMAPLEY  525
            L+ NGFT  +PYS SQM  LEY
Sbjct  121  LSENGFTNNVPYSFSQMTDLEY  142



>ref|XP_004959657.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Setaria 
italica]
Length=693

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 84/108 (78%), Gaps = 2/108 (2%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCG--ESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKS  378
            F+S+N P QL+ W ++GGDPCG  E WKG+ CSG+ VTEI +SGL L+G++G+QL  LKS
Sbjct  43   FNSMNKPSQLSGWKSSGGDPCGGDEEWKGIECSGSSVTEINLSGLGLSGTLGYQLSSLKS  102

Query  379  VTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
            VT FD S NNL   +PYQLPPN+ +LNL GN FTGG+PYSISQM  LE
Sbjct  103  VTKFDASNNNLNGDIPYQLPPNMVQLNLYGNSFTGGVPYSISQMEDLE  150



>ref|XP_006426818.1| hypothetical protein CICLE_v10025011mg [Citrus clementina]
 gb|ESR40058.1| hypothetical protein CICLE_v10025011mg [Citrus clementina]
Length=723

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNSP QL++W+A G DPCG+SWKGV CSG RVTE+++SGL L+GS+G+QL  L ++T
Sbjct  44   YSSLNSPSQLSQWSATGDDPCGQSWKGVICSGQRVTELKLSGLGLSGSVGYQLSSLTALT  103

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NN G  +PY +PPN+++L+L  N FTG +PYSISQM  L+Y
Sbjct  104  NLDLSNNNFGGDIPYNIPPNLERLDLENNKFTGNVPYSISQMKTLKY  150



>ref|XP_008465036.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X3 [Cucumis 
melo]
 ref|XP_008465037.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X3 [Cucumis 
melo]
Length=686

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNSPP LT+W+++GGDPCG+ WKG++C G RVTEI +SGL L+G+MG+QL  L S+T
Sbjct  2    YSSLNSPPILTQWSSSGGDPCGQIWKGITCLGLRVTEISLSGLGLSGTMGYQLSSLTSLT  61

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  519
              D+S NNLG  +PYQLP N+QKLNL  N F+G +PYSISQM+ L
Sbjct  62   NLDVSNNNLGPDIPYQLPQNLQKLNLGWNNFSGSIPYSISQMSLL  106



>emb|CDO97730.1| unnamed protein product [Coffea canephora]
Length=749

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 87/125 (70%), Gaps = 8/125 (6%)
 Frame = +1

Query  136  FCSTRRPPPSLIQIRLMRQF*GGFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTE  315
             C T  P  S + +         ++S+NSP +L  W +NGGDPCG+SW G+ CSG+ VTE
Sbjct  60   LCKTNAPDVSALNVM--------YTSMNSPSKLDGWKSNGGDPCGQSWHGIKCSGSSVTE  111

Query  316  IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPY  495
            I +S L+LTGSMG+QL  L SVT FD+S NNL   +PYQLPPN Q ++L+ NGF+G +PY
Sbjct  112  IDLSDLELTGSMGYQLSSLTSVTYFDLSKNNLKGDIPYQLPPNAQYIDLSRNGFSGSVPY  171

Query  496  SISQM  510
            SISQM
Sbjct  172  SISQM  176



>gb|KJB67277.1| hypothetical protein B456_010G183400 [Gossypium raimondii]
 gb|KJB67281.1| hypothetical protein B456_010G183400 [Gossypium raimondii]
Length=568

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP +LT W  NGGDPCGESW+GV+C G+ V  + ISGL L+G+MG+ L  L S+ 
Sbjct  48   YTSLNSPSKLTNWKTNGGDPCGESWEGVTCEGSAVVSLDISGLGLSGTMGYLLSDLMSLK  107

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S NNL +++PYQLPPNV  +NLAGN F+G LPYSIS M  L Y
Sbjct  108  TLDLSNNNLHDTIPYQLPPNVTSVNLAGNNFSGNLPYSISAMITLTY  154



>gb|KJB67280.1| hypothetical protein B456_010G183400 [Gossypium raimondii]
Length=608

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP +LT W  NGGDPCGESW+GV+C G+ V  + ISGL L+G+MG+ L  L S+ 
Sbjct  48   YTSLNSPSKLTNWKTNGGDPCGESWEGVTCEGSAVVSLDISGLGLSGTMGYLLSDLMSLK  107

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S NNL +++PYQLPPNV  +NLAGN F+G LPYSIS M  L Y
Sbjct  108  TLDLSNNNLHDTIPYQLPPNVTSVNLAGNNFSGNLPYSISAMITLTY  154



>ref|XP_008465035.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X2 [Cucumis 
melo]
Length=722

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNSPP LT+W+++GGDPCG+ WKG++C G RVTEI +SGL L+G+MG+QL  L S+T
Sbjct  42   YSSLNSPPILTQWSSSGGDPCGQIWKGITCLGLRVTEISLSGLGLSGTMGYQLSSLTSLT  101

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  519
              D+S NNLG  +PYQLP N+QKLNL  N F+G +PYSISQM+ L
Sbjct  102  NLDVSNNNLGPDIPYQLPQNLQKLNLGWNNFSGSIPYSISQMSLL  146



>ref|XP_008380807.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Malus domestica]
Length=740

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            + SLNSPPQLT+W+ NG DPCG+SWKGV CSG+RVTEI +SGLQL+G++G+QL  L ++T
Sbjct  66   YGSLNSPPQLTQWSQNGDDPCGQSWKGVKCSGSRVTEIDLSGLQLSGTLGYQLQSLTALT  125

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NNL   +PY LPPN+ +LNL  N F   +PYSIS +  L+Y
Sbjct  126  NLDVSNNNLAGGIPYSLPPNMTRLNLGHNNFNQDIPYSISMITTLKY  172



>gb|EEC85048.1| hypothetical protein OsI_32379 [Oryza sativa Indica Group]
Length=677

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 83/108 (77%), Gaps = 2/108 (2%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGES--WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKS  378
            F S+N P +L  W A+GGDPCG+   WKG+ CS + VTEI++SGL L+G++G+QL  LKS
Sbjct  43   FESMNKPSELLGWKASGGDPCGDDDEWKGIECSDSSVTEIKLSGLGLSGTLGYQLSSLKS  102

Query  379  VTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
            VT FD+S NNL   +PYQLPPNV +LNL GN F+GG+PYSISQM  LE
Sbjct  103  VTKFDVSKNNLNGEIPYQLPPNVVQLNLRGNAFSGGVPYSISQMTDLE  150



>ref|XP_008465033.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Cucumis 
melo]
 ref|XP_008465034.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Cucumis 
melo]
Length=726

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNSPP LT+W+++GGDPCG+ WKG++C G RVTEI +SGL L+G+MG+QL  L S+T
Sbjct  42   YSSLNSPPILTQWSSSGGDPCGQIWKGITCLGLRVTEISLSGLGLSGTMGYQLSSLTSLT  101

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  519
              D+S NNLG  +PYQLP N+QKLNL  N F+G +PYSISQM+ L
Sbjct  102  NLDVSNNNLGPDIPYQLPQNLQKLNLGWNNFSGSIPYSISQMSLL  146



>gb|KJB67062.1| hypothetical protein B456_010G172500 [Gossypium raimondii]
Length=622

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FS LNSP QLT WTAN GDPCG+SWKGV+CS  RVTEI++S L L+GS+G+ L  L S+ 
Sbjct  38   FSGLNSPQQLTGWTANNGDPCGQSWKGVTCSDRRVTEIKLSNLALSGSVGYSLQSLTSLK  97

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NNL   +PY +P N+Q+LNLA N FTG +PYSI+QM  L+Y
Sbjct  98   ELDLSNNNLAGDIPYDIPQNLQRLNLAFNQFTGSVPYSINQMHSLQY  144



>gb|KJB67061.1| hypothetical protein B456_010G172500 [Gossypium raimondii]
Length=636

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FS LNSP QLT WTAN GDPCG+SWKGV+CS  RVTEI++S L L+GS+G+ L  L S+ 
Sbjct  38   FSGLNSPQQLTGWTANNGDPCGQSWKGVTCSDRRVTEIKLSNLALSGSVGYSLQSLTSLK  97

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NNL   +PY +P N+Q+LNLA N FTG +PYSI+QM  L+Y
Sbjct  98   ELDLSNNNLAGDIPYDIPQNLQRLNLAFNQFTGSVPYSINQMHSLQY  144



>ref|XP_006845114.1| hypothetical protein AMTR_s00005p00184180 [Amborella trichopoda]
 gb|ERN06789.1| hypothetical protein AMTR_s00005p00184180 [Amborella trichopoda]
Length=179

 Score =   135 bits (339),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +++LN P QLT W +NGGDPCGESWKG+SCSG  VT IQI GL L+G++G+ L  L S+ 
Sbjct  41   YNALNDPVQLTGWKSNGGDPCGESWKGISCSGTAVTSIQIPGLGLSGTLGYGLSGLLSLI  100

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S NNL + +PYQLPPN   LNLA N F+G LPYSIS M  L Y
Sbjct  101  TLDVSGNNLHDIIPYQLPPNTTFLNLANNNFSGNLPYSISGMTSLNY  147



>gb|KJB67278.1| hypothetical protein B456_010G183400 [Gossypium raimondii]
Length=672

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP +LT W  NGGDPCGESW+GV+C G+ V  + ISGL L+G+MG+ L  L S+ 
Sbjct  48   YTSLNSPSKLTNWKTNGGDPCGESWEGVTCEGSAVVSLDISGLGLSGTMGYLLSDLMSLK  107

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S NNL +++PYQLPPNV  +NLAGN F+G LPYSIS M  L Y
Sbjct  108  TLDLSNNNLHDTIPYQLPPNVTSVNLAGNNFSGNLPYSISAMITLTY  154



>gb|AFQ91933.1| leucine-rich repeat receptor-like kinase [Brassica rapa subsp. 
oleifera]
Length=707

 Score =   142 bits (358),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSSLNSP QL++WTA+GGDPCG++WKG++CS +RVT+I++SGL L+GS+GF LD+L SVT
Sbjct  41   FSSLNSPGQLSQWTASGGDPCGQNWKGITCSNSRVTQIKLSGLGLSGSLGFMLDKLTSVT  100

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNLG  LPYQLPPN+++LNLA N FTG   YSIS M PL+Y
Sbjct  101  EFDLSNNNLGGDLPYQLPPNLERLNLANNQFTGSAQYSISLMTPLKY  147



>gb|EEE70214.1| hypothetical protein OsJ_30326 [Oryza sativa Japonica Group]
Length=676

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 82/108 (76%), Gaps = 2/108 (2%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGES--WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKS  378
            F S+N P +L  W A+GGDPCG+   WKG+ CS + VTEI +SGL L+G++G+QL  LKS
Sbjct  41   FESMNKPSELLGWKASGGDPCGDDDEWKGIECSDSSVTEINLSGLGLSGTLGYQLSSLKS  100

Query  379  VTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
            VT FD+S NNL   +PYQLPPNV +LNL GN F+GG+PYSISQM  LE
Sbjct  101  VTKFDVSKNNLNGEIPYQLPPNVVQLNLRGNAFSGGVPYSISQMTDLE  148



>ref|XP_002891770.1| hypothetical protein ARALYDRAFT_474507 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68029.1| hypothetical protein ARALYDRAFT_474507 [Arabidopsis lyrata subsp. 
lyrata]
Length=721

 Score =   142 bits (358),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 87/108 (81%), Gaps = 1/108 (1%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSM-GFQLDQLKSV  381
            FS ++SP QLT+WTA  GDPCG++W+GV+CSG+RVT+I++ GL+L+G++ G+ LD+L S+
Sbjct  40   FSGMHSPAQLTQWTAAAGDPCGQNWRGVTCSGSRVTQIKLPGLELSGTLGGYMLDKLTSL  99

Query  382  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T  D+S+NNLG  LPYQ PPN+Q+L LA N FTG   YSISQ+  L+Y
Sbjct  100  TELDLSSNNLGGDLPYQFPPNLQRLYLANNQFTGAAAYSISQITTLKY  147



>gb|KJB67276.1| hypothetical protein B456_010G183400 [Gossypium raimondii]
Length=710

 Score =   142 bits (358),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP +LT W  NGGDPCGESW+GV+C G+ V  + ISGL L+G+MG+ L  L S+ 
Sbjct  48   YTSLNSPSKLTNWKTNGGDPCGESWEGVTCEGSAVVSLDISGLGLSGTMGYLLSDLMSLK  107

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S NNL +++PYQLPPNV  +NLAGN F+G LPYSIS M  L Y
Sbjct  108  TLDLSNNNLHDTIPYQLPPNVTSVNLAGNNFSGNLPYSISAMITLTY  154



>ref|XP_009146380.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Brassica rapa]
Length=723

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSSLNSP QL++WTA+GGDPCG++WKG++CS +RVT+I++SGL L+GS+GF LD+L SVT
Sbjct  45   FSSLNSPGQLSQWTASGGDPCGQNWKGITCSNSRVTQIKLSGLGLSGSLGFMLDKLTSVT  104

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNLG  LPYQLPPN+++LNLA N FTG   YSIS M PL+Y
Sbjct  105  EFDLSNNNLGGDLPYQLPPNLERLNLANNQFTGSAQYSISLMTPLKY  151



>gb|KDP20703.1| hypothetical protein JCGZ_21174 [Jatropha curcas]
Length=721

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QLT W ++GGDPC ESWKGV+C G+ V  +QISGL L G+MG+ L  L S+ 
Sbjct  49   YTSLNSPSQLTNWKSDGGDPCAESWKGVTCEGSAVVSLQISGLGLNGTMGYLLSNLMSLR  108

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            TFD+S NNL +S+PYQLPPN+  LNLAGN  +G LPYS+S M  L Y
Sbjct  109  TFDLSDNNLHDSIPYQLPPNLTSLNLAGNNLSGNLPYSLSTMFSLTY  155



>emb|CDX97567.1| BnaA05g25120D [Brassica napus]
Length=723

 Score =   142 bits (357),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSSLNSP QL++WTA+GGDPCG++WKG++CS +RVT+I++SGL L+GS+GF LD+L SVT
Sbjct  45   FSSLNSPGQLSQWTASGGDPCGQNWKGITCSNSRVTQIKLSGLGLSGSLGFMLDKLTSVT  104

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNLG  LPYQLPPN+++LNLA N FTG   YSIS M PL+Y
Sbjct  105  EFDLSNNNLGGDLPYQLPPNLERLNLANNQFTGSAQYSISLMTPLKY  151



>ref|XP_002885038.1| hypothetical protein ARALYDRAFT_478852 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61297.1| hypothetical protein ARALYDRAFT_478852 [Arabidopsis lyrata subsp. 
lyrata]
Length=716

 Score =   142 bits (357),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSS+NSP QL++WT +GGDPCG++WKG++CSG+RVT+I++SGL L+GS+G+ LD+L SVT
Sbjct  39   FSSMNSPGQLSQWTTSGGDPCGQNWKGITCSGSRVTQIKLSGLGLSGSLGYMLDKLTSVT  98

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NN+G  LPYQLPPN+++LNLA N FTG   YSIS MAPL+Y
Sbjct  99   EFDLSNNNIGGDLPYQLPPNLERLNLANNQFTGSAQYSISMMAPLKY  145



>ref|NP_001063921.1| Os09g0559900 [Oryza sativa Japonica Group]
 dbj|BAF25835.1| Os09g0559900 [Oryza sativa Japonica Group]
Length=685

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 82/108 (76%), Gaps = 2/108 (2%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGES--WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKS  378
            F S+N P +L  W A+GGDPCG+   WKG+ CS + VTEI +SGL L+G++G+QL  LKS
Sbjct  65   FESMNKPSELLGWKASGGDPCGDDDEWKGIECSDSSVTEINLSGLGLSGTLGYQLSSLKS  124

Query  379  VTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
            VT FD+S NNL   +PYQLPPNV +LNL GN F+GG+PYSISQM  LE
Sbjct  125  VTKFDVSKNNLNGEIPYQLPPNVVQLNLRGNAFSGGVPYSISQMTDLE  172



>ref|XP_010099162.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Morus notabilis]
 gb|EXB77034.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Morus notabilis]
Length=728

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QLT WT+NGGDPCGESWKG++C G+ V  I+ISGL L+G+MG+ L  L S+ 
Sbjct  56   YTSLNSPSQLTGWTSNGGDPCGESWKGITCEGSAVVSIEISGLGLSGTMGYMLANLVSLR  115

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NN+ +++PYQLPPN+  LNLA N  +G LPYS S M+ L Y
Sbjct  116  KFDLSDNNIHDTIPYQLPPNLTSLNLAKNNLSGNLPYSFSTMSSLNY  162



>ref|XP_009391183.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Musa acuminata 
subsp. malaccensis]
Length=689

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            + SLNSP QLT W+++GGDPCG  W+G+ CSG+ VTEI +SGL LTG++G+QL  L SVT
Sbjct  36   YRSLNSPSQLTGWSSSGGDPCGNDWQGIKCSGSSVTEIILSGLGLTGTIGYQLSSLTSVT  95

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNL   +PYQLPPN   ++L+GN FTGG+ YSISQM  L Y
Sbjct  96   YFDLSKNNLHGDIPYQLPPNAIHIDLSGNVFTGGISYSISQMTDLNY  142



>ref|XP_006407090.1| hypothetical protein EUTSA_v10020162mg [Eutrema salsugineum]
 gb|ESQ48543.1| hypothetical protein EUTSA_v10020162mg [Eutrema salsugineum]
Length=714

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSS+ SP QL++WTA+GGDPCG++WKG++CSG+RVT+I++SGL L+GS+G+ LD+L SVT
Sbjct  39   FSSMGSPGQLSQWTASGGDPCGQNWKGITCSGSRVTQIKLSGLGLSGSLGYMLDKLTSVT  98

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S+NNLG  LPYQLPPNV++LNLA N FTG   YSIS M PL+Y
Sbjct  99   EFDLSSNNLGGDLPYQLPPNVERLNLANNQFTGSAQYSISLMTPLKY  145



>ref|XP_010033635.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Eucalyptus 
grandis]
 gb|KCW53334.1| hypothetical protein EUGRSUZ_J02582 [Eucalyptus grandis]
Length=728

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 89/108 (82%), Gaps = 1/108 (1%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS-MGFQLDQLKSV  381
            +S LN P QLT+W+++GGDPCG+SWKG++CSG+RVTEI++ GL L+GS +G++L  L SV
Sbjct  47   YSFLNQPSQLTQWSSSGGDPCGQSWKGITCSGSRVTEIKLPGLGLSGSSIGYKLQSLTSV  106

Query  382  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T  D+S NNLG  LPY +PPNVQ+LNLA N FTG +P+SI+Q++ L+Y
Sbjct  107  TNLDLSNNNLGGQLPYGVPPNVQRLNLANNQFTGQIPWSIAQLSSLKY  154



>ref|XP_004144448.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cucumis 
sativus]
Length=726

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSPP LT+W+++GGDPCG+ WKG++C G RVTEI +SGL L+G++G+QL  L S+T
Sbjct  42   YTSLNSPPILTQWSSSGGDPCGQIWKGITCLGLRVTEISLSGLGLSGTLGYQLSSLTSLT  101

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  519
              D+S NNLG  +PYQLP N+QKLNL  N F+G +PYSISQM+ L
Sbjct  102  NLDVSNNNLGPDIPYQLPQNLQKLNLGWNNFSGSIPYSISQMSLL  146



>ref|XP_004165988.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cucumis 
sativus]
Length=726

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSPP LT+W+++GGDPCG+ WKG++C G RVTEI +SGL L+G++G+QL  L S+T
Sbjct  42   YTSLNSPPILTQWSSSGGDPCGQIWKGITCLGLRVTEISLSGLGLSGTLGYQLSSLTSLT  101

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  519
              D+S NNLG  +PYQLP N+QKLNL  N F+G +PYSISQM+ L
Sbjct  102  NLDVSNNNLGPDIPYQLPQNLQKLNLGWNNFSGSIPYSISQMSLL  146



>ref|XP_007217016.1| hypothetical protein PRUPE_ppa002092mg [Prunus persica]
 gb|EMJ18215.1| hypothetical protein PRUPE_ppa002092mg [Prunus persica]
Length=717

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNSP QLT+W+A+G DPCG+SWKGV CSG+RVTEI +S LQL+GS+   L  L ++T
Sbjct  40   YSSLNSPSQLTQWSASGDDPCGQSWKGVKCSGSRVTEIDVSNLQLSGSLWSSLQSLTALT  99

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NNL  S+PY LPPN+ +LNLA N F  G+PYSIS +  LEY
Sbjct  100  NLDMSHNNLAGSIPYSLPPNMTRLNLAANNFNQGIPYSISLITSLEY  146



>ref|XP_011460016.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Fragaria vesca 
subsp. vesca]
Length=730

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++S+NSPPQLT W ++GGDPCGESWKGV+C G  V  I++SGL L+G+MG+ L  L S+ 
Sbjct  59   YTSVNSPPQLTNWKSSGGDPCGESWKGVTCEGTAVVAIEVSGLGLSGTMGYLLSDLLSLR  118

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NN  + +PYQLPPN+  LNLA N F+G LPYSIS M  L Y
Sbjct  119  KFDLSDNNFHDIIPYQLPPNLTSLNLARNNFSGNLPYSISAMGSLNY  165



>ref|XP_011031832.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Populus 
euphratica]
Length=716

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNSP QLT+W+ NG DPCG++WKG+ CSG RVTEI++  L L+GS+G+QL  L +VT
Sbjct  39   YSSLNSPGQLTQWSPNGDDPCGQNWKGIICSGLRVTEIKLPSLGLSGSLGYQLTSLTAVT  98

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NNL  ++P QLPPN+Q+LNLA N F+GG+PYSISQ+  L+Y
Sbjct  99   NLDMSYNNLAGNIPDQLPPNLQQLNLANNQFSGGIPYSISQLPSLKY  145



>ref|XP_002316561.2| hypothetical protein POPTR_0011s01540g [Populus trichocarpa]
 gb|EEE97173.2| hypothetical protein POPTR_0011s01540g [Populus trichocarpa]
Length=689

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNSP QLT W + GGDPCGESWKG++C G+ V  +QISGL L G+MG+ L  L S+ 
Sbjct  42   YSSLNSPSQLTSWKSIGGDPCGESWKGITCEGSAVVSVQISGLGLDGTMGYMLSNLMSLR  101

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            TFD+S NN+ + LPYQLPPN+  LNLA N  +G LPYSIS M  L Y
Sbjct  102  TFDLSDNNIHDPLPYQLPPNLTSLNLAINNLSGNLPYSISTMVSLSY  148



>ref|XP_011002570.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Populus euphratica]
Length=692

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNSP QLT W + GGDPCGESWKG++C G+ V  +QISGL L G+MG+ L  L S+ 
Sbjct  19   YSSLNSPSQLTSWKSIGGDPCGESWKGITCEGSAVVSVQISGLGLDGTMGYMLSNLMSLR  78

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            TFD+S NN+ + LPYQLPPN+  LNLA N  +G LPYSIS M  L Y
Sbjct  79   TFDLSDNNIHDPLPYQLPPNLTSLNLAINNLSGNLPYSISTMVSLSY  125



>ref|XP_007026173.1| STRUBBELIG-receptor family 8 isoform 1 [Theobroma cacao]
 gb|EOY28795.1| STRUBBELIG-receptor family 8 isoform 1 [Theobroma cacao]
Length=719

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +++LNSP +LT W  NGGDPCGESWKGV+C G+ V  + ISGL L+G+MG+ L  L S+ 
Sbjct  48   YTALNSPAKLTNWKTNGGDPCGESWKGVTCEGSAVVSVDISGLGLSGAMGYLLSDLMSLR  107

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S NN+ +++PYQLPPN+  LNLAGN  +G LPYSIS M  L Y
Sbjct  108  TLDLSNNNIHDTIPYQLPPNLTSLNLAGNNLSGNLPYSISTMVTLTY  154



>ref|XP_004303773.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Fragaria vesca 
subsp. vesca]
Length=717

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNSP QLT+W+A+ GDPCG+SWKGV C+ +RVTEI +SGL L+GS G+ L  L ++T
Sbjct  40   YSSLNSPSQLTQWSASSGDPCGQSWKGVKCTRSRVTEIDLSGLGLSGSFGYNLQSLTALT  99

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NNL   +PY LPPN+ +LNL GN FT G+PYS+S M  L+Y
Sbjct  100  NLDMSNNNLAGGIPYNLPPNLTRLNLGGNQFTQGIPYSVSMMTSLKY  146



>ref|XP_011002569.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Populus euphratica]
Length=715

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNSP QLT W + GGDPCGESWKG++C G+ V  +QISGL L G+MG+ L  L S+ 
Sbjct  42   YSSLNSPSQLTSWKSIGGDPCGESWKGITCEGSAVVSVQISGLGLDGTMGYMLSNLMSLR  101

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            TFD+S NN+ + LPYQLPPN+  LNLA N  +G LPYSIS M  L Y
Sbjct  102  TFDLSDNNIHDPLPYQLPPNLTSLNLAINNLSGNLPYSISTMVSLSY  148



>ref|XP_009385265.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=725

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QL+ WT +GGDPCG+SWKGVSCSG+ VT +Q+SGL L GS+G+ L  L S+ 
Sbjct  42   YASLNSPSQLSGWTPSGGDPCGDSWKGVSCSGSSVTAVQLSGLGLNGSLGYLLSDLLSLK  101

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S N++  ++PYQLPPN+  LNLAGN  +G LPYSIS MA L Y
Sbjct  102  TLDLSNNDIRETIPYQLPPNLTYLNLAGNNLSGNLPYSISAMASLNY  148



>ref|XP_009385272.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=701

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QL+ WT +GGDPCG+SWKGVSCSG+ VT +Q+SGL L GS+G+ L  L S+ 
Sbjct  42   YASLNSPSQLSGWTPSGGDPCGDSWKGVSCSGSSVTAVQLSGLGLNGSLGYLLSDLLSLK  101

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S N++  ++PYQLPPN+  LNLAGN  +G LPYSIS MA L Y
Sbjct  102  TLDLSNNDIRETIPYQLPPNLTYLNLAGNNLSGNLPYSISAMASLNY  148



>gb|KJB57112.1| hypothetical protein B456_009G148500 [Gossypium raimondii]
 gb|KJB57113.1| hypothetical protein B456_009G148500 [Gossypium raimondii]
Length=728

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSSLNSP QLT WTAN GDPCG+ WKGV+CSG RVTEI++S L L+GSMG+ L  L S+ 
Sbjct  41   FSSLNSPQQLTGWTANNGDPCGQPWKGVTCSGQRVTEIKLSNLGLSGSMGYSLQSLTSLK  100

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NNL   +PY +P N+ + NLA N FTG +PYSI+QM  L+Y
Sbjct  101  ELDLSHNNLAGDIPYNIPLNLTRFNLAYNQFTGSVPYSINQMHSLQY  147



>gb|KHN38109.1| Protein STRUBBELIG-RECEPTOR FAMILY 5 [Glycine soja]
Length=690

 Score =   139 bits (351),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP +L+ W ++GGDPCG+SW+G+ CSG+ VTEI +S L L+GSMG+QL  LKSVT
Sbjct  40   YTSLNSPSKLSGWKSSGGDPCGDSWEGIKCSGSSVTEINLSDLGLSGSMGYQLSSLKSVT  99

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NN    +PYQLPPN + ++L+ N FTG +PYS S+M  L Y
Sbjct  100  DFDLSNNNFKGDIPYQLPPNARYIDLSKNDFTGSIPYSFSEMDDLNY  146



>gb|KHG12210.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Gossypium arboreum]
Length=689

 Score =   139 bits (351),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSSLNSP QLT WTAN GDPCG+ WKGV+CSG RVTEI++S L L+GSMG+ L  L S+ 
Sbjct  2    FSSLNSPQQLTGWTANNGDPCGQPWKGVTCSGQRVTEIKLSNLGLSGSMGYSLQSLTSLK  61

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NNL   +PY +P N+ + NLA N FTG +PYSI+QM  L+Y
Sbjct  62   ELDLSHNNLAGGIPYNIPLNLTRFNLAYNQFTGSVPYSINQMHSLQY  108



>ref|XP_006586431.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Glycine 
max]
Length=725

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP +L+ W ++GGDPCG+SW+G+ CSG+ VTEI +S L L+GSMG+QL  LKSVT
Sbjct  75   YTSLNSPSKLSGWKSSGGDPCGDSWEGIKCSGSSVTEINLSDLGLSGSMGYQLSSLKSVT  134

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NN    +PYQLPPN + ++L+ N FTG +PYS S+M  L Y
Sbjct  135  DFDLSNNNFKGDIPYQLPPNARYIDLSKNDFTGSIPYSFSEMDDLNY  181



>ref|XP_008355924.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Malus domestica]
Length=719

 Score =   139 bits (350),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++S+NSP QL  WT++GGDPCGESWKGV+C G+ V  +++SGL L+G+MG+ L  L S+ 
Sbjct  48   YTSVNSPSQLXGWTSSGGDPCGESWKGVTCEGSAVVAVEVSGLGLSGTMGYLLSDLLSLR  107

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NN  +++PYQLPPN+  LNLA N FTG LPYSI+ M  L Y
Sbjct  108  KFDLSDNNFHDTIPYQLPPNLTSLNLARNNFTGNLPYSIANMVSLSY  154



>gb|KHG12209.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Gossypium arboreum]
Length=728

 Score =   139 bits (350),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSSLNSP QLT WTAN GDPCG+ WKGV+CSG RVTEI++S L L+GSMG+ L  L S+ 
Sbjct  41   FSSLNSPQQLTGWTANNGDPCGQPWKGVTCSGQRVTEIKLSNLGLSGSMGYSLQSLTSLK  100

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NNL   +PY +P N+ + NLA N FTG +PYSI+QM  L+Y
Sbjct  101  ELDLSHNNLAGGIPYNIPLNLTRFNLAYNQFTGSVPYSINQMHSLQY  147



>gb|KCW77015.1| hypothetical protein EUGRSUZ_D01360 [Eucalyptus grandis]
Length=696

 Score =   139 bits (350),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QLT W ++GGDPC ESWKG++C G+ V  I++SGL L G+MG+ L  L S+ 
Sbjct  47   YTSLNSPSQLTNWKSSGGDPCAESWKGITCEGSAVVSIEVSGLGLNGTMGYLLTNLVSLK  106

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NN+ + +PYQLPPN+  LNLAGN  TG LPYSIS M  L Y
Sbjct  107  KFDLSNNNIHDGIPYQLPPNLTNLNLAGNNLTGNLPYSISNMVNLNY  153



>ref|XP_007213628.1| hypothetical protein PRUPE_ppa002088mg [Prunus persica]
 gb|EMJ14827.1| hypothetical protein PRUPE_ppa002088mg [Prunus persica]
Length=718

 Score =   139 bits (350),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++S+NSP QLT W  +GGDPCGESWKGV+C G+ V  I++SGL L+G+MG+ L  L S+ 
Sbjct  48   YTSVNSPSQLTGWKISGGDPCGESWKGVTCEGSAVVSIEVSGLGLSGTMGYLLSDLLSLR  107

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NN  ++LPYQLPPN+  LNLA N FTG LPYSI+ M  L Y
Sbjct  108  KFDLSDNNFHDTLPYQLPPNLTSLNLARNNFTGNLPYSIANMVSLGY  154



>ref|XP_006383865.1| hypothetical protein POPTR_0004s00710g [Populus trichocarpa]
 gb|ERP61662.1| hypothetical protein POPTR_0004s00710g [Populus trichocarpa]
Length=481

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QLT W +NGGDPC ESWKG++C G+ V  IQISGL L G+MG+ L  L S+ 
Sbjct  2    YTSLNSPSQLTTWKSNGGDPCAESWKGITCEGSAVVSIQISGLGLDGTMGYLLANLMSLR  61

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S N+L +S PYQLPPN+  LNLA N  +G +PYS+S M  L Y
Sbjct  62   TLDLSDNHLHDSFPYQLPPNLTSLNLAKNNLSGNIPYSMSSMVSLSY  108



>ref|XP_002304260.2| hypothetical protein POPTR_0003s07130g [Populus trichocarpa]
 gb|EEE79239.2| hypothetical protein POPTR_0003s07130g [Populus trichocarpa]
Length=716

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            + SL SP QLT+W+ANG DPCG++WKG+ CSG+RVTEI++  L L GS+G+QL  L +VT
Sbjct  39   YISLQSPGQLTQWSANGDDPCGQNWKGIICSGSRVTEIKLPSLGLPGSLGYQLTSLTAVT  98

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NNL  ++P QLPPN+Q+LNLA N F+GG+PYSISQ+  L+Y
Sbjct  99   NLDMSYNNLAGNIPDQLPPNLQQLNLANNQFSGGIPYSISQLPSLKY  145



>ref|XP_010913801.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X3 [Elaeis guineensis]
Length=589

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F SLNSPPQLT W++ GGDPCG+ WKGV CS + VTEI +SGL LTG +G+QL  L SVT
Sbjct  35   FKSLNSPPQLTGWSSTGGDPCGDDWKGVKCSDSSVTEISLSGLGLTGLLGYQLSSLTSVT  94

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNL   +PYQLPP V+ LNLA N FTGG+PYSISQM  +EY
Sbjct  95   YFDMSKNNLKGDIPYQLPPKVEHLNLAENAFTGGIPYSISQMTDIEY  141



>ref|XP_010052884.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X2 [Eucalyptus 
grandis]
 gb|KCW77014.1| hypothetical protein EUGRSUZ_D01360 [Eucalyptus grandis]
Length=720

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QLT W ++GGDPC ESWKG++C G+ V  I++SGL L G+MG+ L  L S+ 
Sbjct  47   YTSLNSPSQLTNWKSSGGDPCAESWKGITCEGSAVVSIEVSGLGLNGTMGYLLTNLVSLK  106

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NN+ + +PYQLPPN+  LNLAGN  TG LPYSIS M  L Y
Sbjct  107  KFDLSNNNIHDGIPYQLPPNLTNLNLAGNNLTGNLPYSISNMVNLNY  153



>ref|XP_010052883.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X1 [Eucalyptus 
grandis]
 gb|KCW77013.1| hypothetical protein EUGRSUZ_D01360 [Eucalyptus grandis]
Length=721

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QLT W ++GGDPC ESWKG++C G+ V  I++SGL L G+MG+ L  L S+ 
Sbjct  47   YTSLNSPSQLTNWKSSGGDPCAESWKGITCEGSAVVSIEVSGLGLNGTMGYLLTNLVSLK  106

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NN+ + +PYQLPPN+  LNLAGN  TG LPYSIS M  L Y
Sbjct  107  KFDLSNNNIHDGIPYQLPPNLTNLNLAGNNLTGNLPYSISNMVNLNY  153



>gb|EEC81030.1| hypothetical protein OsI_23812 [Oryza sativa Indica Group]
Length=712

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SS NSP QLT W+A GGDPCG +W GVSC G+ VT I++SG+ L G++G+QL  L ++ 
Sbjct  34   YSSWNSPAQLTGWSAGGGDPCGAAWMGVSCVGSAVTSIKLSGMGLNGTLGYQLSNLLALK  93

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S+NNL +S+PYQLPPN+  LNLAGN F+G LPYSIS M  L Y
Sbjct  94   TMDLSSNNLHDSIPYQLPPNLAYLNLAGNNFSGNLPYSISNMVSLNY  140



>ref|XP_007023606.1| Strubbelig-receptor family 5 isoform 2 [Theobroma cacao]
 gb|EOY26228.1| Strubbelig-receptor family 5 isoform 2 [Theobroma cacao]
Length=818

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F SLN+P QL+ W ANGGDPC +SW+G+ CSG+ VTEI++S  +L+G +G+QL  L SVT
Sbjct  242  FKSLNTPSQLSGWRANGGDPCDDSWEGIKCSGSSVTEIKLSDYELSGQLGYQLSSLTSVT  301

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
            TFD+S NNL   +PYQLPPN   ++L+ N F+G +PYSISQM  LE
Sbjct  302  TFDLSKNNLEGDIPYQLPPNAVHIDLSENKFSGTVPYSISQMTSLE  347



>ref|XP_007217699.1| hypothetical protein PRUPE_ppa002458mg [Prunus persica]
 gb|EMJ18898.1| hypothetical protein PRUPE_ppa002458mg [Prunus persica]
Length=670

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++S+NS  +L+ W ++GGDPCG+SWKG+ CSG+ VTEI +S L L+GSMG+QL  L SVT
Sbjct  2    YNSINSRSKLSGWKSSGGDPCGDSWKGIKCSGSSVTEIDLSDLGLSGSMGYQLASLTSVT  61

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
             FD+S NNL   +PYQLPPN + ++L+ NGFT  +PYSISQM+ LE
Sbjct  62   RFDLSKNNLNGDIPYQLPPNAKYIDLSQNGFTNTVPYSISQMSDLE  107



>ref|XP_007023605.1| Strubbelig-receptor family 5 isoform 1 [Theobroma cacao]
 gb|EOY26227.1| Strubbelig-receptor family 5 isoform 1 [Theobroma cacao]
Length=908

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F SLN+P QL+ W ANGGDPC +SW+G+ CSG+ VTEI++S  +L+G +G+QL  L SVT
Sbjct  242  FKSLNTPSQLSGWRANGGDPCDDSWEGIKCSGSSVTEIKLSDYELSGQLGYQLSSLTSVT  301

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
            TFD+S NNL   +PYQLPPN   ++L+ N F+G +PYSISQM  LE
Sbjct  302  TFDLSKNNLEGDIPYQLPPNAVHIDLSENKFSGTVPYSISQMTSLE  347



>ref|XP_008649054.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X4 [Zea mays]
Length=719

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SS NSP QLT W+A+GGDPCG +W GVSCSG+ VT I++SG++L G++G+QL  L+++ 
Sbjct  38   YSSWNSPAQLTGWSASGGDPCGAAWAGVSCSGSAVTSIKLSGMELNGTLGYQLSSLQALK  97

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S N+L +S+PYQLP N+  LNLA N F+G LPYSIS +  LEY
Sbjct  98   TMDLSNNHLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLEY  144



>ref|XP_008649053.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X3 [Zea mays]
Length=720

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SS NSP QLT W+A+GGDPCG +W GVSCSG+ VT I++SG++L G++G+QL  L+++ 
Sbjct  38   YSSWNSPAQLTGWSASGGDPCGAAWAGVSCSGSAVTSIKLSGMELNGTLGYQLSSLQALK  97

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S N+L +S+PYQLP N+  LNLA N F+G LPYSIS +  LEY
Sbjct  98   TMDLSNNHLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLEY  144



>ref|XP_009357210.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Pyrus x 
bretschneideri]
Length=719

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++S+NSP QLT W ++GGDPCGESWKGV+C G+ V  +++SGL L+G+MG+ L  L S+ 
Sbjct  48   YTSVNSPSQLTGWKSSGGDPCGESWKGVTCEGSAVVAVEVSGLGLSGTMGYLLSDLLSLR  107

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NN  +++PYQLPPN+  LNLA N FTG +PYSI+ M  L Y
Sbjct  108  KFDLSDNNFHDTIPYQLPPNLTSLNLARNNFTGNIPYSIANMVSLNY  154



>ref|XP_007135873.1| hypothetical protein PHAVU_010G165200g [Phaseolus vulgaris]
 gb|ESW07867.1| hypothetical protein PHAVU_010G165200g [Phaseolus vulgaris]
Length=689

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNSP +L+ W ++GGDPCGESWKG+ CSG+ VTEI +S + L+GS G+QL  L SVT
Sbjct  38   YSSLNSPSKLSGWKSSGGDPCGESWKGIKCSGSSVTEINLSDMGLSGSTGYQLSSLSSVT  97

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  519
             FD+S NNL   +PYQLPP  + ++L+ NGFTG +P+S+SQM  L
Sbjct  98   YFDLSNNNLKGDIPYQLPPKARHIDLSNNGFTGSIPFSVSQMDEL  142



>ref|XP_008224758.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Prunus mume]
Length=721

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++S+NSP QLT W  +GGDPCGESWKGV+C G+ V  I++SGL L+G+MG+ L  L S+ 
Sbjct  48   YTSVNSPSQLTGWKISGGDPCGESWKGVTCEGSAVVSIEVSGLGLSGTMGYLLSDLLSLR  107

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NN  ++LPYQLPPN+  LN+A N FTG LPYSI+ M  L Y
Sbjct  108  KFDLSDNNFHDTLPYQLPPNLTSLNIARNNFTGNLPYSIANMVSLGY  154



>ref|XP_006383864.1| hypothetical protein POPTR_0004s00710g [Populus trichocarpa]
 gb|ERP61661.1| hypothetical protein POPTR_0004s00710g [Populus trichocarpa]
Length=625

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QLT W +NGGDPC ESWKG++C G+ V  IQISGL L G+MG+ L  L S+ 
Sbjct  2    YTSLNSPSQLTTWKSNGGDPCAESWKGITCEGSAVVSIQISGLGLDGTMGYLLANLMSLR  61

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S N+L +S PYQLPPN+  LNLA N  +G +PYS+S M  L Y
Sbjct  62   TLDLSDNHLHDSFPYQLPPNLTSLNLAKNNLSGNIPYSMSSMVSLSY  108



>ref|XP_010913799.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Elaeis guineensis]
Length=685

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F SLNSPPQLT W++ GGDPCG+ WKGV CS + VTEI +SGL LTG +G+QL  L SVT
Sbjct  35   FKSLNSPPQLTGWSSTGGDPCGDDWKGVKCSDSSVTEISLSGLGLTGLLGYQLSSLTSVT  94

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S NNL   +PYQLPP V+ LNLA N FTGG+PYSISQM  +EY
Sbjct  95   YFDMSKNNLKGDIPYQLPPKVEHLNLAENAFTGGIPYSISQMTDIEY  141



>ref|XP_008653346.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Zea mays]
Length=687

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 84/107 (79%), Gaps = 1/107 (1%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++++NSPPQLT W +  GDPCG+SW GV+CSG+RVT I++SG++L G++G+ ++QL ++ 
Sbjct  8    YTTMNSPPQLTNWVSQNGDPCGQSWLGVTCSGSRVTAIKLSGMRLNGTLGYNMNQLTALV  67

Query  385  TFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
              D+S NNLG S +PY LPPN+Q LNLA N FTG +PYSISQM  L 
Sbjct  68   QLDMSNNNLGGSDIPYNLPPNLQSLNLAVNNFTGTVPYSISQMVALR  114



>ref|XP_008649051.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Zea mays]
Length=735

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SS NSP QLT W+A+GGDPCG +W GVSCSG+ VT I++SG++L G++G+QL  L+++ 
Sbjct  38   YSSWNSPAQLTGWSASGGDPCGAAWAGVSCSGSAVTSIKLSGMELNGTLGYQLSSLQALK  97

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S N+L +S+PYQLP N+  LNLA N F+G LPYSIS +  LEY
Sbjct  98   TMDLSNNHLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLEY  144



>ref|XP_008653345.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Zea mays]
 tpg|DAA63620.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=716

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 84/107 (79%), Gaps = 1/107 (1%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++++NSPPQLT W +  GDPCG+SW GV+CSG+RVT I++SG++L G++G+ ++QL ++ 
Sbjct  37   YTTMNSPPQLTNWVSQNGDPCGQSWLGVTCSGSRVTAIKLSGMRLNGTLGYNMNQLTALV  96

Query  385  TFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
              D+S NNLG S +PY LPPN+Q LNLA N FTG +PYSISQM  L 
Sbjct  97   QLDMSNNNLGGSDIPYNLPPNLQSLNLAVNNFTGTVPYSISQMVALR  143



>ref|XP_008649052.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Zea mays]
Length=734

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SS NSP QLT W+A+GGDPCG +W GVSCSG+ VT I++SG++L G++G+QL  L+++ 
Sbjct  38   YSSWNSPAQLTGWSASGGDPCGAAWAGVSCSGSAVTSIKLSGMELNGTLGYQLSSLQALK  97

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S N+L +S+PYQLP N+  LNLA N F+G LPYSIS +  LEY
Sbjct  98   TMDLSNNHLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLEY  144



>gb|AAV64203.1| leucine-rich repeat transmembrane protein kinase 1-like protein 
[Zea mays]
 gb|AAV64241.1| leucine-rich repeat transmembrane protein kinase 1-like protein 
[Zea mays]
 tpg|DAA63621.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=693

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 84/107 (79%), Gaps = 1/107 (1%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++++NSPPQLT W +  GDPCG+SW GV+CSG+RVT I++SG++L G++G+ ++QL ++ 
Sbjct  37   YTTMNSPPQLTNWVSQNGDPCGQSWLGVTCSGSRVTAIKLSGMRLNGTLGYNMNQLTALV  96

Query  385  TFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
              D+S NNLG S +PY LPPN+Q LNLA N FTG +PYSISQM  L 
Sbjct  97   QLDMSNNNLGGSDIPYNLPPNLQSLNLAVNNFTGTVPYSISQMVALR  143



>ref|XP_006465790.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Citrus 
sinensis]
Length=723

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNSP QL++W+A G DPCG+SWKGV CSG RVTE+++SGL L+GSMG+QL  L ++T
Sbjct  44   YSSLNSPSQLSQWSATGDDPCGQSWKGVICSGQRVTELKLSGLGLSGSMGYQLSSLTALT  103

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NN G  +PY +P N+++L+L  N FTG +PY  SQM  L+Y
Sbjct  104  NLDLSNNNFGPDIPYNVPQNLERLDLGNNKFTGNVPYYFSQMKTLKY  150



>ref|XP_003604115.1| Protein STRUBBELIG-RECEPTOR FAMILY [Medicago truncatula]
 gb|AES86312.1| strubbelig-receptor family 6 protein [Medicago truncatula]
Length=790

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QL+ W ++GGDPCGE+W+G+ CSG+ VTEI +S L L+GS+G+QL QL SVT
Sbjct  127  YTSLNSPSQLSGWKSSGGDPCGENWEGIKCSGSSVTEINLSDLGLSGSLGYQLSQLTSVT  186

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  519
             FD+S NN    +PYQLPPN + ++L+ N FTG +PYSI QM  L
Sbjct  187  DFDLSNNNFKGDIPYQLPPNARNVDLSKNAFTGNIPYSIGQMKEL  231



>ref|XP_011046989.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Populus 
euphratica]
Length=711

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QLT W +NGGDPC ESWKG++C G+ V  IQISGL L G+MG+ L  L S+ 
Sbjct  38   YTSLNSPSQLTNWKSNGGDPCAESWKGITCEGSAVVSIQISGLGLDGTMGYLLANLMSLR  97

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S N+L +S PYQLPPN+  LNLA N  +G +PYS+S M  L Y
Sbjct  98   TLDLSDNHLRDSFPYQLPPNLTSLNLAKNNLSGNIPYSMSSMVSLNY  144



>emb|CDY39110.1| BnaA01g29460D [Brassica napus]
Length=724

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 92/108 (85%), Gaps = 1/108 (1%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTAN-GGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSV  381
            FS++NSP QL++WT++ GGDPCG++WKGV+CS +RVT+I++SGL L+GS+G  LD+L SV
Sbjct  40   FSAMNSPGQLSQWTSSSGGDPCGQNWKGVTCSDSRVTQIKLSGLGLSGSLGSALDKLTSV  99

Query  382  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T FD+S NNLG  LPYQLPPN+++LNLA N FTG  PYS+SQM PL+Y
Sbjct  100  TEFDLSNNNLGGDLPYQLPPNLERLNLASNQFTGSAPYSVSQMTPLKY  147



>ref|XP_008228078.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 [Prunus mume]
Length=719

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++S+NS  +L+ W ++GGDPCG+SWKG+ CSG+ VTEI ++ L L+GSMG+QL  L SVT
Sbjct  48   YNSINSRSKLSGWKSSGGDPCGDSWKGIKCSGSSVTEIDLADLGLSGSMGYQLASLTSVT  107

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
             FD+S NNL   +PYQLPPN + ++L+ NGFT  +PYSISQM+ LE
Sbjct  108  RFDLSKNNLNGDIPYQLPPNAKYIDLSQNGFTNTVPYSISQMSDLE  153



>ref|XP_002461023.1| hypothetical protein SORBIDRAFT_02g039370 [Sorghum bicolor]
 gb|EER97544.1| hypothetical protein SORBIDRAFT_02g039370 [Sorghum bicolor]
Length=718

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 82/107 (77%), Gaps = 1/107 (1%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++++NSPPQLT W +  GDPCG+SW GV+CSG+RVT I +SG++L G++G+ ++QL ++ 
Sbjct  36   YTTMNSPPQLTNWVSQNGDPCGQSWLGVTCSGSRVTAINLSGMRLNGTLGYNMNQLTALV  95

Query  385  TFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
              D S NNLG S +PY LPPN+Q LNL GN FTG +PYSISQM  L 
Sbjct  96   QLDASNNNLGGSDIPYNLPPNLQSLNLEGNNFTGTVPYSISQMVALR  142



>ref|XP_009116969.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Brassica 
rapa]
Length=723

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 92/108 (85%), Gaps = 1/108 (1%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTAN-GGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSV  381
            FS++NSP QL++WT++ GGDPCG++WKGV+CS +RVT+I++SGL L+GS+G  LD+L SV
Sbjct  40   FSAMNSPGQLSQWTSSSGGDPCGQNWKGVTCSDSRVTQIKLSGLGLSGSLGSALDKLTSV  99

Query  382  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T FD+S NNLG  LPYQLPPN+++LNLA N FTG  PYS+SQM PL+Y
Sbjct  100  TEFDLSNNNLGGDLPYQLPPNLERLNLASNQFTGSAPYSVSQMTPLKY  147



>ref|XP_009388759.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=703

 Score =   136 bits (342),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 84/109 (77%), Gaps = 2/109 (2%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSSLNS  QLT W  +GGDPCGESW G++CSG+ VT I++SGL LTG++G+ ++QL S+T
Sbjct  43   FSSLNSASQLTGWKQSGGDPCGESWLGITCSGSSVTAIKLSGLGLTGTLGYNMNQLSSLT  102

Query  385  TFDISTNNLGN--SLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NNLGN  S+PY LPPN+ +L+L+ N + G LPYSIS M  LEY
Sbjct  103  ELDLSKNNLGNKSSIPYNLPPNLHRLDLSNNQYGGSLPYSISPMVTLEY  151



>ref|XP_009388758.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=705

 Score =   136 bits (342),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 84/109 (77%), Gaps = 2/109 (2%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSSLNS  QLT W  +GGDPCGESW G++CSG+ VT I++SGL LTG++G+ ++QL S+T
Sbjct  43   FSSLNSASQLTGWKQSGGDPCGESWLGITCSGSSVTAIKLSGLGLTGTLGYNMNQLSSLT  102

Query  385  TFDISTNNLGN--SLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NNLGN  S+PY LPPN+ +L+L+ N + G LPYSIS M  LEY
Sbjct  103  ELDLSKNNLGNKSSIPYNLPPNLHRLDLSNNQYGGSLPYSISPMVTLEY  151



>ref|XP_010534991.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Tarenaya 
hassleriana]
Length=718

 Score =   136 bits (342),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  SSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTT  387
            SS+NSP QL++W   GGDPCGE+W+G++C  +RVT++++  L L+GS+G+ LD+L +VT 
Sbjct  41   SSMNSPSQLSQWKPWGGDPCGENWQGITCLDSRVTQVKLPNLGLSGSLGYMLDKLTAVTE  100

Query  388  FDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            FD+S NNLG  LPY LPPNVQ+LNLA N FTG   YSIS MA L+Y
Sbjct  101  FDLSNNNLGGDLPYNLPPNVQQLNLANNQFTGNGQYSISLMASLKY  146



>ref|XP_010928424.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Elaeis guineensis]
Length=619

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNSPPQL+ WT++GGDPC +SWKG++CSG+ VT IQ+SG+ L G++G+ L  L S+ 
Sbjct  37   YSSLNSPPQLSGWTSSGGDPCRDSWKGITCSGSAVTAIQVSGMGLNGTLGYLLSDLLSLK  96

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T DIS NNL   +PYQLPPN+  LNLA    +G LP+SIS M  L Y
Sbjct  97   TLDISNNNLREGIPYQLPPNLTYLNLAKANLSGSLPFSISTMVSLNY  143



>dbj|BAK07184.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=713

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++S NSPPQL  W+A+GGDPCG  W+GVSC+G+ VTEI+++G  L GS+G++L  L S+ 
Sbjct  36   YTSWNSPPQLAGWSASGGDPCGAGWQGVSCTGSGVTEIKLAGTGLNGSLGYELSNLFSLK  95

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S N++  S+PYQLPPN+  LNLA N F+G LPYSIS MA +EY
Sbjct  96   TLDLSNNHIQGSIPYQLPPNLTYLNLATNNFSGNLPYSISNMASIEY  142



>ref|XP_006449792.1| hypothetical protein CICLE_v10014418mg [Citrus clementina]
 gb|ESR63032.1| hypothetical protein CICLE_v10014418mg [Citrus clementina]
Length=618

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP  LT W  NGGDPCGESWKGV+C G+ V  I +SGL L G+MG+ L  L S+ 
Sbjct  51   YTSLNSPSVLTNWKGNGGDPCGESWKGVACEGSAVVSIDVSGLGLNGTMGYLLSDLLSLR  110

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S N + +++PYQLPPN+  LNLA N F+G LPYSI+ M  L Y
Sbjct  111  KFDLSGNGIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSY  157



>emb|CDX98445.1| BnaC05g39300D [Brassica napus]
Length=722

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            FSS+NSP QL++WTA+GGDPCG++WKG++CS +RV +I++SGL L+GS+GF LD+L SVT
Sbjct  44   FSSMNSPGQLSQWTASGGDPCGQNWKGITCSVSRVIQIKLSGLGLSGSLGFMLDKLTSVT  103

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NNLG  LPYQLPPN+++LNLA N FTG   YSIS M PL+Y
Sbjct  104  ELDLSNNNLGGDLPYQLPPNLERLNLANNQFTGSAQYSISLMTPLKY  150



>gb|KDO78353.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
Length=442

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP  LT W  N GDPCGESWKGV+C G+ V  I ISGL L+G+MG+ L  L S+ 
Sbjct  51   YTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGTMGYLLSDLLSLR  110

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S N++ +++PYQLPPN+  LNLA N F+G LPYSI+ M  L Y
Sbjct  111  KFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSY  157



>gb|KDO78351.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
 gb|KDO78352.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
Length=577

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP  LT W  N GDPCGESWKGV+C G+ V  I ISGL L+G+MG+ L  L S+ 
Sbjct  51   YTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGTMGYLLSDLLSLR  110

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S N++ +++PYQLPPN+  LNLA N F+G LPYSI+ M  L Y
Sbjct  111  KFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSY  157



>gb|KJB69229.1| hypothetical protein B456_011G011800 [Gossypium raimondii]
Length=537

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP +LT W ++G DPC ESWKGV+C G+ V  I +SGL L+G+MG+ L+ L S+ 
Sbjct  54   YTSLNSPTELTNWNSDGNDPCEESWKGVACEGSAVVSIDVSGLGLSGTMGYLLNDLMSLK  113

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S NN+ +++PYQLPPN+  LN+AGN  +G LPYSIS M  L Y
Sbjct  114  TLDLSNNNIHDTIPYQLPPNLTSLNVAGNNLSGSLPYSISTMVTLTY  160



>ref|XP_008458998.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X1 [Cucumis 
melo]
Length=711

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SL+SPPQLT WT +GGDPC ESWKGV+C G+ V  I+ISGL L G+MG+ L    S+ 
Sbjct  37   YTSLDSPPQLTGWTVSGGDPCAESWKGVTCEGSAVVSIEISGLGLNGTMGYALSSFLSLK  96

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NN+ +++PYQLPPN+  LN+A N   G LPYS S MA L Y
Sbjct  97   KLDMSDNNIHDAIPYQLPPNLTSLNMAKNSLIGNLPYSFSTMASLNY  143



>gb|KDO78348.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
Length=621

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP  LT W  N GDPCGESWKGV+C G+ V  I ISGL L+G+MG+ L  L S+ 
Sbjct  51   YTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGTMGYLLSDLLSLR  110

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S N++ +++PYQLPPN+  LNLA N F+G LPYSI+ M  L Y
Sbjct  111  KFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSY  157



>ref|XP_003571057.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Brachypodium 
distachyon]
Length=715

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++S NSP QL  W+A+GGDPCG  W+GVSC+G+ VTEI+++G  L GS+G++L  L S+ 
Sbjct  34   YTSWNSPSQLAGWSASGGDPCGAGWQGVSCNGSGVTEIKLAGTGLNGSLGYELSNLYSLK  93

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S NN+  S+PYQLPPN+  LNLA N F+G LPYSIS MA +EY
Sbjct  94   TLDLSNNNIHGSIPYQLPPNLTYLNLATNNFSGNLPYSISNMASIEY  140



>gb|KDO78349.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
 gb|KDO78350.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
Length=618

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP  LT W  N GDPCGESWKGV+C G+ V  I ISGL L+G+MG+ L  L S+ 
Sbjct  51   YTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGTMGYLLSDLLSLR  110

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S N++ +++PYQLPPN+  LNLA N F+G LPYSI+ M  L Y
Sbjct  111  KFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSY  157



>ref|XP_010244139.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Nelumbo 
nucifera]
Length=729

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNS P LT W +N GDPCGESWKGV+C G+ V  IQISGL L+G++G+ L  L S+ 
Sbjct  51   YSSLNSSPLLTGWKSNAGDPCGESWKGVTCQGSSVVAIQISGLGLSGTLGYMLSSLFSLK  110

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NN+ +S+PYQLPPN+  LNLA N  +G LPYSIS M  L Y
Sbjct  111  ALDLSGNNIHDSIPYQLPPNLTSLNLANNNLSGNLPYSISTMVSLNY  157



>ref|XP_010928422.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010928423.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Elaeis guineensis]
Length=720

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNSPPQL+ WT++GGDPC +SWKG++CSG+ VT IQ+SG+ L G++G+ L  L S+ 
Sbjct  37   YSSLNSPPQLSGWTSSGGDPCRDSWKGITCSGSAVTAIQVSGMGLNGTLGYLLSDLLSLK  96

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T DIS NNL   +PYQLPPN+  LNLA    +G LP+SIS M  L Y
Sbjct  97   TLDISNNNLREGIPYQLPPNLTYLNLAKANLSGSLPFSISTMVSLNY  143



>ref|XP_006389935.1| hypothetical protein EUTSA_v10019668mg [Eutrema salsugineum]
 gb|ESQ27221.1| hypothetical protein EUTSA_v10019668mg [Eutrema salsugineum]
Length=699

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F+SLNSP +L  W ++GGDPC  SW+GV C G+ VTE+Q+SGL+L+GS+G+ L  LKS+T
Sbjct  36   FTSLNSPSKLKGWKSSGGDPCDGSWEGVKCKGSSVTELQLSGLELSGSLGYLLSNLKSLT  95

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
            TFD+S NNL  ++PYQLPPN+  L+L+ N   G +PYS+SQM  LE
Sbjct  96   TFDLSKNNLKGNIPYQLPPNIANLDLSENELDGNVPYSLSQMNRLE  141



>ref|XP_010252506.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Nelumbo 
nucifera]
Length=730

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            + SLNSPP+LT W + GGDPCGESWKGV C G+ V  IQ+ GL L+G++G+ L  L S+ 
Sbjct  52   YVSLNSPPRLTGWKSGGGDPCGESWKGVICQGSAVVAIQLPGLGLSGTLGYMLSSLFSLR  111

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S NN+ +S+PYQLPPN+  LNLA N  +G LPYSIS M  L Y
Sbjct  112  TLDLSDNNIHDSIPYQLPPNLTSLNLASNNLSGNLPYSISSMVSLNY  158



>ref|XP_008800485.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Phoenix 
dactylifera]
Length=725

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 85/109 (78%), Gaps = 2/109 (2%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            + SL SP QLT W ++GGDPC +SW GV+CSG+ VT I++SGL+L+GS+G+Q+  + S+T
Sbjct  45   YRSLQSPGQLTGWNSSGGDPCEQSWLGVTCSGSAVTAIKLSGLELSGSLGYQMSSMTSLT  104

Query  385  TFDISTNNL--GNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NNL  G  +PY LPPN+++LNLAGN F G +PYSIS++ PL+Y
Sbjct  105  ELDMSNNNLGGGQQIPYNLPPNLERLNLAGNQFAGNVPYSISRIVPLKY  153



>ref|XP_006449794.1| hypothetical protein CICLE_v10014418mg [Citrus clementina]
 gb|ESR63034.1| hypothetical protein CICLE_v10014418mg [Citrus clementina]
Length=720

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP  LT W  NGGDPCGESWKGV+C G+ V  I +SGL L G+MG+ L  L S+ 
Sbjct  51   YTSLNSPSVLTNWKGNGGDPCGESWKGVACEGSAVVSIDVSGLGLNGTMGYLLSDLLSLR  110

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S N + +++PYQLPPN+  LNLA N F+G LPYSI+ M  L Y
Sbjct  111  KFDLSGNGIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSY  157



>ref|XP_006836581.1| hypothetical protein AMTR_s00131p00083660 [Amborella trichopoda]
 gb|ERM99434.1| hypothetical protein AMTR_s00131p00083660 [Amborella trichopoda]
Length=721

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QL+ WT+NGGDPCG++W+GV+CSG+ VTE+++SGL L+GS+G+QL  L S+T
Sbjct  40   YNSLNSPGQLSGWTSNGGDPCGQNWRGVTCSGSSVTELKLSGLGLSGSLGYQLTSLTSLT  99

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            TFD+S NN GN +PYQLPPN+ +LNLA N FTG + YSI+QM+ L+Y
Sbjct  100  TFDVSNNNFGNDIPYQLPPNLSRLNLAENSFTGNIQYSIAQMSALQY  146



>gb|KJB69230.1| hypothetical protein B456_011G011800 [Gossypium raimondii]
Length=684

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP +LT W ++G DPC ESWKGV+C G+ V  I +SGL L+G+MG+ L+ L S+ 
Sbjct  54   YTSLNSPTELTNWNSDGNDPCEESWKGVACEGSAVVSIDVSGLGLSGTMGYLLNDLMSLK  113

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S NN+ +++PYQLPPN+  LN+AGN  +G LPYSIS M  L Y
Sbjct  114  TLDLSNNNIHDTIPYQLPPNLTSLNVAGNNLSGSLPYSISTMVTLTY  160



>ref|XP_009386651.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Musa acuminata 
subsp. malaccensis]
Length=735

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QL+ WT +GGDPCG SW GVSCSG+ V  I +SGL L GS+G+ L  L S+ 
Sbjct  55   YASLNSPRQLSGWTRSGGDPCGTSWLGVSCSGSAVVAIHLSGLGLNGSLGYLLSDLLSLK  114

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S NN+  ++PYQLPPN+  LNLAGN  +G LPYSIS M  L Y
Sbjct  115  TLDLSNNNIHETIPYQLPPNLTYLNLAGNDLSGNLPYSISSMVSLNY  161



>ref|XP_006467381.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Citrus sinensis]
Length=696

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP  LT W  N GDPCGESWKGV+C G+ V  I ISGL L+G+MG+ L  L S+ 
Sbjct  51   YTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGTMGYLLSDLLSLR  110

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S N++ +++PYQLPPN+  LNLA N F+G LPYSI+ M  L Y
Sbjct  111  KFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSY  157



>gb|KJB56462.1| hypothetical protein B456_009G120500 [Gossypium raimondii]
Length=710

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F SL +P QL+ W  +GGDPC +SW+GV CSG+RVTEI +S   L G +G+QL  L S+T
Sbjct  36   FKSLKAPSQLSGWRVSGGDPCSDSWQGVKCSGSRVTEISLSNYGLNGELGYQLSNLTSLT  95

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
            + D+S NNL + +PYQLPPN  ++NL+ N FTG +PYSISQM+ +E
Sbjct  96   SLDVSKNNLNDQIPYQLPPNAVRINLSHNQFTGNVPYSISQMSNIE  141



>ref|XP_007135353.1| hypothetical protein PHAVU_010G122100g [Phaseolus vulgaris]
 gb|ESW07347.1| hypothetical protein PHAVU_010G122100g [Phaseolus vulgaris]
Length=718

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 81/105 (77%), Gaps = 3/105 (3%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F S+NSPPQL  W  NG DPCG+SW+G++CSGNRVTEI++ G  L+GS+G+QL+ L  VT
Sbjct  37   FQSMNSPPQLN-W--NGDDPCGQSWQGITCSGNRVTEIKLPGRSLSGSLGYQLESLSLVT  93

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  519
              D+S NNLG ++PYQLPPN+Q LNLA N F G +PYS+SQ   L
Sbjct  94   NLDLSNNNLGGTIPYQLPPNLQYLNLANNNFNGEVPYSLSQKTSL  138



>ref|XP_011467514.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 [Fragaria vesca 
subsp. vesca]
Length=695

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 91/139 (65%), Gaps = 10/139 (7%)
 Frame = +1

Query  118  WRFSLGFCS----TRRPPPSLIQIRLMRQF*GGFSSLNSPPQLTKWTANGGDPCGESWKG  285
            W    GFC+    ++     +  + +M      ++SL S  +L+ W ++GGDPCG+SWKG
Sbjct  9    WGVLFGFCTVCVYSKTNTQDVTALNVM------YNSLTSKSKLSDWKSSGGDPCGDSWKG  62

Query  286  VSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLA  465
            + C G+ VTEI +S L L+G+MG+QL  L SVT+FD+S N     +PYQLPPN + ++L+
Sbjct  63   IKCKGSAVTEINLSDLDLSGTMGYQLASLSSVTSFDLSNNKFSGDIPYQLPPNAKYIDLS  122

Query  466  GNGFTGGLPYSISQMAPLE  522
             NGFT  +PYS+SQM+ LE
Sbjct  123  NNGFTNTVPYSVSQMSDLE  141



>ref|XP_006467380.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Citrus sinensis]
Length=720

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP  LT W  N GDPCGESWKGV+C G+ V  I ISGL L+G+MG+ L  L S+ 
Sbjct  51   YTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGTMGYLLSDLLSLR  110

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S N++ +++PYQLPPN+  LNLA N F+G LPYSI+ M  L Y
Sbjct  111  KFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSY  157



>gb|KEH18524.1| strubbelig-receptor family 6 protein [Medicago truncatula]
Length=685

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 77/105 (73%), Gaps = 3/105 (3%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F S+NSP QL  W  NG DPCG+SW G++CSGNR+TEI++ G QLTG++GFQL  L SVT
Sbjct  8    FQSMNSPSQLN-W--NGNDPCGQSWTGITCSGNRITEIKLPGRQLTGTLGFQLQSLSSVT  64

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  519
              D+S NNL  +LPYQ PPN+Q LNLA N F GG+PYS S    L
Sbjct  65   NLDLSNNNLAGTLPYQFPPNLQHLNLANNNFNGGIPYSFSDTPSL  109



>gb|KJB69228.1| hypothetical protein B456_011G011800 [Gossypium raimondii]
Length=726

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP +LT W ++G DPC ESWKGV+C G+ V  I +SGL L+G+MG+ L+ L S+ 
Sbjct  54   YTSLNSPTELTNWNSDGNDPCEESWKGVACEGSAVVSIDVSGLGLSGTMGYLLNDLMSLK  113

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S NN+ +++PYQLPPN+  LN+AGN  +G LPYSIS M  L Y
Sbjct  114  TLDLSNNNIHDTIPYQLPPNLTSLNVAGNNLSGSLPYSISTMVTLTY  160



>emb|CDY33226.1| BnaC01g36990D [Brassica napus]
Length=711

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 90/108 (83%), Gaps = 1/108 (1%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTAN-GGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSV  381
            FS++NSP QL+ WT++ GGDPC ++WKG++C G+RVT+I++SGL L+GS+G+ LD L SV
Sbjct  28   FSAMNSPGQLSHWTSSSGGDPCEQNWKGITCFGSRVTQIKLSGLGLSGSLGYALDNLTSV  87

Query  382  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T  D+S NNLG  LPYQLPPN+++LNLA N FTG LPYS+SQM PL+Y
Sbjct  88   TELDLSNNNLGGDLPYQLPPNLERLNLASNQFTGSLPYSVSQMTPLKY  135



>gb|KDO78347.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
Length=720

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP  LT W  N GDPCGESWKGV+C G+ V  I ISGL L+G+MG+ L  L S+ 
Sbjct  51   YTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGTMGYLLSDLLSLR  110

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
             FD+S N++ +++PYQLPPN+  LNLA N F+G LPYSI+ M  L Y
Sbjct  111  KFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSY  157



>ref|XP_004488910.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Cicer arietinum]
Length=706

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP +L+ W ++GGDPCG+SW+G+ CS + VTEI++S L L+GS+G+QL  L SVT
Sbjct  40   YTSLNSPSKLSGWKSSGGDPCGDSWEGIKCSSSSVTEIKLSDLGLSGSVGYQLASLTSVT  99

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  519
             FD+S NNL   +PYQLPPN + ++L+ N F+G +PYSISQM  L
Sbjct  100  YFDLSNNNLKGDIPYQLPPNARDIDLSKNQFSGSIPYSISQMKEL  144



>ref|XP_003627481.1| Protein STRUBBELIG-RECEPTOR FAMILY [Medicago truncatula]
 gb|AET01957.1| strubbelig-receptor family 6 protein [Medicago truncatula]
Length=716

 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 77/105 (73%), Gaps = 3/105 (3%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F S+NSP QL  W  NG DPCG+SW G++CSGNR+TEI++ G QLTG++GFQL  L SVT
Sbjct  39   FQSMNSPSQLN-W--NGNDPCGQSWTGITCSGNRITEIKLPGRQLTGTLGFQLQSLSSVT  95

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  519
              D+S NNL  +LPYQ PPN+Q LNLA N F GG+PYS S    L
Sbjct  96   NLDLSNNNLAGTLPYQFPPNLQHLNLANNNFNGGIPYSFSDTPSL  140



>ref|XP_009346024.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Pyrus x bretschneideri]
Length=698

 Score =   133 bits (335),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SL S  +L+ W ++GGDPCG+SWKG++CSG+ VT+I +S L L+GSMG+QL  L SVT
Sbjct  38   YNSLQSRSKLSGWKSSGGDPCGDSWKGITCSGSSVTQIDLSDLGLSGSMGYQLASLTSVT  97

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
             FD+S NNL   +PYQLPPN + ++L+ NGF+  +PYS+SQM+ LE
Sbjct  98   KFDLSKNNLNGDIPYQLPPNAKYIDLSQNGFSNTVPYSVSQMSDLE  143



>gb|AFW70556.1| putative STRUBBELIG family receptor protein kinase [Zea mays]
Length=668

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++S NSP QL  W+A+GGDPCG +W+GV+CSG  VTEI++ G  L GS+G++L  L S+ 
Sbjct  37   YTSWNSPSQLAGWSASGGDPCGAAWQGVACSGAGVTEIKLPGTGLDGSLGYELSNLFSLK  96

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S NNL  S+PYQLPPN+  LNL  N F G LPYSIS MA +EY
Sbjct  97   TLDLSNNNLHGSIPYQLPPNLTNLNLGSNNFNGNLPYSISNMASIEY  143



>ref|XP_010943264.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Elaeis guineensis]
Length=690

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNSPPQL+ WT +GGDPCG+SWKG++CSG+ VT +Q+SG+ L G++G+ L  L S+ 
Sbjct  58   YSSLNSPPQLSGWTWSGGDPCGDSWKGITCSGSAVTAMQVSGMGLNGTLGYLLSDLLSLK  117

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S N++ + +PYQLPPN+  LNLA N  +G LPYSI  M  L Y
Sbjct  118  TLDMSNNSIHDGIPYQLPPNLTYLNLANNNLSGNLPYSIYTMVSLNY  164



>ref|XP_004958321.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X1 [Setaria italica]
 ref|XP_004958322.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X2 [Setaria italica]
Length=714

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 84/107 (79%), Gaps = 1/107 (1%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++++NSPPQLT W +  GDPCG+SW GV+CSG+RVT I++ G++L G++G+ ++Q+ ++ 
Sbjct  36   YTTMNSPPQLTNWVSQNGDPCGQSWLGVTCSGSRVTTIKLPGMRLNGTLGYNMNQMTALI  95

Query  385  TFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
              D+S NNLG S +PY LPPN++ LNLA N FTG +PYSISQM  L+
Sbjct  96   QLDMSNNNLGGSDIPYNLPPNMEILNLASNNFTGTVPYSISQMVALK  142



>ref|NP_178019.2| STRUBBELIG-receptor family 5 [Arabidopsis thaliana]
 sp|Q6R2K1.1|SRF5_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY 5; AltName: 
Full=Leucine-rich repeat receptor kinase-like protein SRF5; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAR99873.1| strubbelig receptor family 5 [Arabidopsis thaliana]
 gb|ACN59278.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE36188.1| STRUBBELIG-receptor family 5 [Arabidopsis thaliana]
Length=699

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F+SLNSP +L  W ANGGDPC +SW+GV C G+ VTE+Q+SG +L GS G+ L  LKS+T
Sbjct  36   FTSLNSPSKLKGWKANGGDPCEDSWEGVKCKGSSVTELQLSGFELGGSRGYLLSNLKSLT  95

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
            TFD+S NNL  ++PYQLPPN+  L+ + N   G +PYS+SQM  L+
Sbjct  96   TFDLSKNNLKGNIPYQLPPNIANLDFSENELDGNVPYSLSQMKNLQ  141



>gb|EPS69681.1| hypothetical protein M569_05081 [Genlisea aurea]
Length=695

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 87/134 (65%), Gaps = 8/134 (6%)
 Frame = +1

Query  124  FSLGFCSTRRPPPSLIQIRLMRQF*GGFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  303
            F    CST       +Q+         +SSLNSP QL+ W ++GGDPCG+SW GV+C G+
Sbjct  28   FHTAHCSTDLSDVQALQVL--------YSSLNSPSQLSGWNSSGGDPCGDSWTGVTCLGS  79

Query  304  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  483
             V  + +SGL L G+MG+ L+ L S+TT D+S N++ + +PYQLPP +  LNLA N  TG
Sbjct  80   SVVSLNLSGLGLNGTMGYLLNNLASLTTLDLSNNSMNDRIPYQLPPKLTSLNLARNNLTG  139

Query  484  GLPYSISQMAPLEY  525
            GLPYSIS M+ L Y
Sbjct  140  GLPYSISAMSQLGY  153



>ref|XP_002267170.2| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Vitis vinifera]
 emb|CBI32991.3| unnamed protein product [Vitis vinifera]
Length=729

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLN P QLT WT + GDPCGESWKGV+C G+ V  IQISGL L G+MG+ L    S+ 
Sbjct  53   YNSLNGPSQLTGWTNSSGDPCGESWKGVTCEGSAVVSIQISGLGLNGTMGYLLSNFLSLR  112

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S NN+ +++PYQLPPN+  LNLA N  TG  PYSIS M  L Y
Sbjct  113  TLDMSDNNIHDTIPYQLPPNLTNLNLASNNLTGSFPYSISTMVSLNY  159



>gb|AFW87367.1| putative STRUBBELIG family receptor protein kinase, partial [Zea 
mays]
Length=743

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SS NSP +L  W+A+GGDPCG +W GVSCSG+ VT I++SG++L G++G+QL  L+++ 
Sbjct  38   YSSWNSPARLAGWSASGGDPCGAAWTGVSCSGSAVTSIKLSGMELNGTLGYQLSSLQALK  97

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S N L +S+PYQLP N+  LNLA N F+G LPYSIS +  LEY
Sbjct  98   TMDLSNNYLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLEY  144



>emb|CDX87418.1| BnaA07g34550D [Brassica napus]
Length=692

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F+SLNSPP+L  W ++GGDPC  SW+GV C G+ VTE+Q+SG +L+GS+G+ L  LKS+T
Sbjct  32   FTSLNSPPKLKGWKSSGGDPCDGSWEGVKCKGSSVTELQLSGYELSGSLGYLLSNLKSLT  91

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
            TFD+S NNL  ++PYQLPPN+  L+ + N   G +PYS+SQM  L+
Sbjct  92   TFDLSKNNLKGNIPYQLPPNIANLDFSDNELDGNVPYSLSQMNKLK  137



>ref|XP_009106613.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 [Brassica rapa]
Length=692

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F+SLNSPP+L  W ++GGDPC  SW+GV C G+ VTE+Q+SG +L+GS+G+ L  LKS+T
Sbjct  32   FTSLNSPPKLKGWKSSGGDPCDGSWEGVKCKGSSVTELQLSGYELSGSLGYLLSNLKSLT  91

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
            TFD+S NNL  ++PYQLPPN+  L+ + N   G +PYS+SQM  L+
Sbjct  92   TFDLSKNNLKGNIPYQLPPNIANLDFSDNELDGNVPYSLSQMNKLK  137



>gb|AFW87368.1| putative STRUBBELIG family receptor protein kinase [Zea mays]
Length=734

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SS NSP +L  W+A+GGDPCG +W GVSCSG+ VT I++SG++L G++G+QL  L+++ 
Sbjct  38   YSSWNSPARLAGWSASGGDPCGAAWTGVSCSGSAVTSIKLSGMELNGTLGYQLSSLQALK  97

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S N L +S+PYQLP N+  LNLA N F+G LPYSIS +  LEY
Sbjct  98   TMDLSNNYLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLEY  144



>ref|XP_008659801.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Zea mays]
Length=724

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SS NSP +L  W+A+GGDPCG +W GVSCSG+ VT I++SG++L G++G+QL  L+++ 
Sbjct  38   YSSWNSPARLAGWSASGGDPCGAAWTGVSCSGSAVTSIKLSGMELNGTLGYQLSSLQALK  97

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S N L +S+PYQLP N+  LNLA N F+G LPYSIS +  LEY
Sbjct  98   TMDLSNNYLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLEY  144



>ref|XP_009383597.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Musa acuminata 
subsp. malaccensis]
Length=720

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 83/109 (76%), Gaps = 2/109 (2%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F+SLNSP QLT W ANGGDPCG+SW GV+C+G+ +T I++SGL L+G++G+ L  + S+ 
Sbjct  43   FTSLNSPSQLTGWIANGGDPCGQSWLGVTCTGSAITTIKLSGLGLSGTLGYNLQTMTSLA  102

Query  385  TFDISTNNLGN--SLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NN+G+   LPY LPPN+Q LNL GN F+G +PYSIS M  L+Y
Sbjct  103  ELDMSNNNIGSGGQLPYNLPPNLQSLNLGGNQFSGNIPYSISLMVTLKY  151



>ref|XP_010943263.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Elaeis guineensis]
Length=742

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNSPPQL+ WT +GGDPCG+SWKG++CSG+ VT +Q+SG+ L G++G+ L  L S+ 
Sbjct  58   YSSLNSPPQLSGWTWSGGDPCGDSWKGITCSGSAVTAMQVSGMGLNGTLGYLLSDLLSLK  117

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S N++ + +PYQLPPN+  LNLA N  +G LPYSI  M  L Y
Sbjct  118  TLDMSNNSIHDGIPYQLPPNLTYLNLANNNLSGNLPYSIYTMVSLNY  164



>ref|XP_008645353.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Zea mays]
 gb|AFW70555.1| putative STRUBBELIG family receptor protein kinase [Zea mays]
Length=717

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++S NSP QL  W+A+GGDPCG +W+GV+CSG  VTEI++ G  L GS+G++L  L S+ 
Sbjct  37   YTSWNSPSQLAGWSASGGDPCGAAWQGVACSGAGVTEIKLPGTGLDGSLGYELSNLFSLK  96

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S NNL  S+PYQLPPN+  LNL  N F G LPYSIS MA +EY
Sbjct  97   TLDLSNNNLHGSIPYQLPPNLTNLNLGSNNFNGNLPYSISNMASIEY  143



>ref|XP_010686780.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Beta vulgaris 
subsp. vulgaris]
Length=712

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            + +LN+P QLT W A+GGDPCGESWKGV C G+ V  + ISGL ++G+MG+ L  L S+ 
Sbjct  37   YGALNNPSQLTGWKADGGDPCGESWKGVKCDGSAVVSLDISGLGVSGTMGYLLTNLASLK  96

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S NN+ +++P+QLPPN+  LNLA N  +GGLPYSI  M  L Y
Sbjct  97   TLDMSDNNIHDAIPFQLPPNLTSLNLAHNNLSGGLPYSIVSMVSLAY  143



>emb|CDX88495.1| BnaC06g39390D [Brassica napus]
Length=692

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F+SLNSPP+L  W ++GGDPC  SW+GV C G+ VTE+Q+SG +L+GS+G+ L  LKS+T
Sbjct  32   FTSLNSPPKLKGWKSSGGDPCDGSWEGVKCKGSSVTELQLSGYELSGSLGYLLSNLKSLT  91

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
            TFD+S NNL  ++PYQLPPN+  L+ + N   G +PYS+SQM  L+
Sbjct  92   TFDLSKNNLKGNIPYQLPPNIANLDFSENELDGNVPYSLSQMNKLK  137



>ref|XP_010939841.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Elaeis guineensis]
Length=699

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 86/111 (77%), Gaps = 2/111 (2%)
 Frame = +1

Query  199  GGFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKS  378
            G ++SL SP QLT WT+NGGDPCG+SW GV+CSG+ VT I++SGL L+G++G+Q+  + S
Sbjct  33   GLYNSLQSPGQLTGWTSNGGDPCGQSWLGVTCSGSAVTTIKLSGLGLSGTLGYQMLSMTS  92

Query  379  VTTFDISTNNL--GNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            +T  D+S N L  G  + Y LP N+++LNLAGN FTG +PYSISQM PL+Y
Sbjct  93   LTELDMSNNKLGGGQQITYNLPLNLERLNLAGNQFTGNVPYSISQMVPLKY  143



>ref|XP_007139054.1| hypothetical protein PHAVU_009G260900g [Phaseolus vulgaris]
 gb|ESW11048.1| hypothetical protein PHAVU_009G260900g [Phaseolus vulgaris]
Length=575

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 82/105 (78%), Gaps = 1/105 (1%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F ++NSP QL  W ANG DPCG+SWKG++C+GNRVTEI++S L LTGS+ + L  L S+T
Sbjct  39   FQNMNSPSQL-GWPANGDDPCGQSWKGITCAGNRVTEIKLSNLGLTGSLPYGLQVLTSLT  97

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  519
            + D+S+N+LG S+PYQLPP VQ+LNLA N  TG +PYSIS +  L
Sbjct  98   SLDMSSNSLGGSIPYQLPPYVQRLNLAYNNITGTVPYSISNLTAL  142



>ref|XP_006357453.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Solanum tuberosum]
Length=661

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +  L    +L  W ++GG+PC +SWKG+ CSG+ VTEI +SGL LTGS+GFQLD+L+ VT
Sbjct  2    YQYLKPHSKLDGWKSDGGNPCDDSWKGIKCSGSDVTEIDLSGLGLTGSLGFQLDKLEKVT  61

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
             FD+S NNL +++PYQLPP  + L+L+GN F G +PYSISQM  L+
Sbjct  62   YFDVSKNNLKDNIPYQLPPRTKHLDLSGNQFGGTVPYSISQMTELK  107



>ref|XP_006598761.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Glycine max]
 gb|KHN15854.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=715

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 81/105 (77%), Gaps = 3/105 (3%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F S+NSP QL  W  NG DPCG+SW+G++CSGNRVTEI++ G  L+GS+G+QL+ L SVT
Sbjct  37   FQSMNSPSQLN-W--NGDDPCGQSWQGITCSGNRVTEIKLPGRSLSGSLGYQLEPLSSVT  93

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  519
              D+S NN+G ++PYQLPPN+Q LNLA N F G +PYS+S+   L
Sbjct  94   NLDLSNNNIGGTIPYQLPPNLQYLNLANNNFNGAIPYSLSEKTSL  138



>ref|XP_006583189.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Glycine 
max]
Length=713

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 81/105 (77%), Gaps = 3/105 (3%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F S+NSP QL  W  NG DPCG+SW+G++CSGNRVTEI++ G  L+GS+G+QL+ + SVT
Sbjct  36   FQSMNSPSQLN-W--NGDDPCGQSWQGITCSGNRVTEIKLPGRSLSGSLGYQLEPMSSVT  92

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  519
              D+S NNLG ++PYQLPPN+Q LNLA N F G +PYS+S+   L
Sbjct  93   NLDLSNNNLGGTIPYQLPPNLQYLNLANNNFNGAIPYSLSEKTSL  137



>ref|XP_004164349.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Cucumis 
sativus]
Length=647

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SL+SPPQLT W  +GGDPC ESWKGV+C G+ V  I+ISGL L G+MG+ L    S+ 
Sbjct  2    YTSLDSPPQLTGWIVSGGDPCAESWKGVTCEGSAVVSIEISGLGLNGTMGYALSSFLSLK  61

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S N++ +++PYQLPPN+  LN+A N   G LPYS+S MA L Y
Sbjct  62   KLDMSDNSIHDAVPYQLPPNLTSLNMAKNSLIGNLPYSLSTMASLNY  108



>gb|KFK42269.1| hypothetical protein AALP_AA2G233600 [Arabis alpina]
Length=698

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F+SLNSP +L  W +NGGDPCG+SW+GV C G+ V+E+Q+SG +L+GS+G+ L  LKS+T
Sbjct  36   FTSLNSPSKLKGWKSNGGDPCGDSWEGVKCKGSSVSELQLSGFELSGSLGYLLSNLKSLT  95

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
            TFD+S NNL  ++PYQLPP +  L+ + N   G +PYS+SQM  L+
Sbjct  96   TFDLSKNNLKGNIPYQLPPKLANLDFSENEIDGNVPYSLSQMNHLQ  141



>ref|XP_010322795.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X2 [Solanum lycopersicum]
Length=700

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +  L    +L  W +NGG+PC +SW GV CSG+ VTEI +SGL LTGS+GFQLD+L  VT
Sbjct  41   YQYLKPHSKLDGWKSNGGNPCDDSWTGVKCSGSDVTEINLSGLGLTGSLGFQLDKLDKVT  100

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
             FD+S NNL +++PYQLPP  Q L+L+GN F G +PYSISQM  L+
Sbjct  101  YFDVSKNNLKDNIPYQLPPRTQHLDLSGNQFGGTVPYSISQMTELK  146



>ref|XP_004965804.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Setaria 
italica]
Length=716

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SS NSP QLT W+A GGDPCG +W GV+CSG  VT I++SG++L G++G++L  L+++ 
Sbjct  39   YSSWNSPAQLTGWSAAGGDPCGAAWAGVTCSGTAVTSIKLSGMELNGTLGYELSSLQALK  98

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S N L +S+PYQLP N+  LNLA N  +G LPYSIS M  LEY
Sbjct  99   TMDLSNNFLHDSIPYQLPSNLTYLNLAKNNLSGNLPYSISTMVSLEY  145



>ref|XP_004241857.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Solanum lycopersicum]
Length=720

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +  L    +L  W +NGG+PC +SW GV CSG+ VTEI +SGL LTGS+GFQLD+L  VT
Sbjct  61   YQYLKPHSKLDGWKSNGGNPCDDSWTGVKCSGSDVTEINLSGLGLTGSLGFQLDKLDKVT  120

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
             FD+S NNL +++PYQLPP  Q L+L+GN F G +PYSISQM  L+
Sbjct  121  YFDVSKNNLKDNIPYQLPPRTQHLDLSGNQFGGTVPYSISQMTELK  166



>emb|CDP04441.1| unnamed protein product [Coffea canephora]
Length=721

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++ LNSPPQLT W +NGGDPC ESWKG++C G+ V  +Q+SGL L G+MG+ L+ L S+ 
Sbjct  48   YNVLNSPPQLTGWKSNGGDPCAESWKGITCQGSAVVSLQLSGLGLNGTMGYSLNSLMSLK  107

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S N + + +PYQLPPN+  LNLA N  +G LPYS+S MA L Y
Sbjct  108  TLDLSGNMIYDPIPYQLPPNLTSLNLAYNNISGNLPYSLSGMAALSY  154



>ref|XP_010537758.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010537760.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 isoform X3 [Tarenaya 
hassleriana]
Length=700

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F+SLNSP +L  W ++GGDPC ++W G+ C GN+V EIQ+S LQL+GS+G+QL  LKS+T
Sbjct  38   FTSLNSPSKLKGWKSSGGDPCNDAWDGIKCDGNKVIEIQLSELQLSGSLGYQLSNLKSLT  97

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
            T D+S N L  ++PYQLPPN+  L+ + N   G +PYS+SQM  L+
Sbjct  98   TLDLSKNKLSGNMPYQLPPNIVHLDFSENEIDGNVPYSLSQMNHLQ  143



>ref|XP_004145432.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Cucumis 
sativus]
 gb|KGN66852.1| hypothetical protein Csa_1G701280 [Cucumis sativus]
Length=711

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SL+SPPQLT W  +GGDPC ESWKGV+C G+ V  I+ISGL L G+MG+ L    S+ 
Sbjct  37   YTSLDSPPQLTGWIVSGGDPCAESWKGVTCEGSAVVSIEISGLGLNGTMGYALSSFLSLK  96

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S N++ +++PYQLPPN+  LN+A N   G LPYS+S MA L Y
Sbjct  97   KLDMSDNSIHDAVPYQLPPNLTSLNMAKNSLIGNLPYSLSTMASLNY  143



>ref|XP_007024796.1| Strubbelig-receptor family 6 [Theobroma cacao]
 gb|EOY27418.1| Strubbelig-receptor family 6 [Theobroma cacao]
Length=721

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 80/109 (73%), Gaps = 1/109 (1%)
 Frame = +1

Query  199  GGFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKS  378
            G FSSLNSP QLT WT++ GDPCG+SWKGV+CSG RVTEI++S L L+GS+ + L  L S
Sbjct  40   GMFSSLNSPQQLTGWTSSNGDPCGQSWKGVTCSGQRVTEIKLSNLGLSGSI-YNLQSLTS  98

Query  379  VTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            +   D+S NN+   +PY LPPN+Q+LNLA N FTG +PY    M  L+Y
Sbjct  99   LKELDMSQNNIAGEIPYNLPPNLQQLNLAFNQFTGSVPYVFHDMPSLQY  147



>ref|XP_009344017.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Pyrus x bretschneideri]
Length=697

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++S  S  +L  W ++GGDPCGESWKG++CSG+ VTEI +S L L+GSMG+QL  L SVT
Sbjct  38   YNSFQSRSKLKGWKSSGGDPCGESWKGITCSGSSVTEIDLSDLGLSGSMGYQLASLTSVT  97

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
             FD+S NNL   +PYQLPP+ + ++L+ NGF+  +PYS+SQM+ LE
Sbjct  98   KFDLSKNNLNGDIPYQLPPSAKYIDLSQNGFSNTVPYSVSQMSGLE  143



>ref|XP_002889223.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65482.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata]
Length=699

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F+SLNSP +L  W  NGGDPC  SW+GV C G+ VTE+Q+SG +L+GS+G+ L  LKS+T
Sbjct  36   FTSLNSPSKLKGWKPNGGDPCDGSWEGVKCKGSSVTELQLSGFELSGSLGYLLSNLKSLT  95

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
            TFD+S NNL  ++PYQLPPN+  L+ + N   G +PYS+SQM  L+
Sbjct  96   TFDLSKNNLKGNIPYQLPPNIVNLDFSENELDGNVPYSLSQMKSLQ  141



>ref|XP_007139053.1| hypothetical protein PHAVU_009G260900g [Phaseolus vulgaris]
 gb|ESW11047.1| hypothetical protein PHAVU_009G260900g [Phaseolus vulgaris]
Length=720

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 82/105 (78%), Gaps = 1/105 (1%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F ++NSP QL  W ANG DPCG+SWKG++C+GNRVTEI++S L LTGS+ + L  L S+T
Sbjct  39   FQNMNSPSQL-GWPANGDDPCGQSWKGITCAGNRVTEIKLSNLGLTGSLPYGLQVLTSLT  97

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  519
            + D+S+N+LG S+PYQLPP VQ+LNLA N  TG +PYSIS +  L
Sbjct  98   SLDMSSNSLGGSIPYQLPPYVQRLNLAYNNITGTVPYSISNLTAL  142



>ref|XP_010417514.1| PREDICTED: LOW QUALITY PROTEIN: protein STRUBBELIG-RECEPTOR FAMILY 
5-like [Camelina sativa]
Length=697

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F+SLNSP +L  W ++GGDPC  SW+GV C G+ VTE+Q+SGL+L+GS+G+ L  LKS+T
Sbjct  36   FTSLNSPSKLKGWKSSGGDPCDGSWEGVKCKGSSVTELQLSGLELSGSLGYLLSNLKSLT  95

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
            TFD+S NNL  ++PYQLPPN+  L+ + N   G +PYS+SQM  ++
Sbjct  96   TFDLSKNNLKGNIPYQLPPNLANLDFSENELDGNVPYSLSQMKSIQ  141



>ref|XP_004951618.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Setaria 
italica]
Length=720

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++S N P QL  W+A GGDPCG +W+GV+CSG  VTEI++ G+ L GS+G++L  L S+ 
Sbjct  37   YASWNGPSQLAGWSAGGGDPCGAAWQGVTCSGAGVTEIKLPGIGLNGSLGYELSNLFSLK  96

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S NNL  S+PYQLPPN+  LNLA N F+G LPYSI+ +A +EY
Sbjct  97   TLDLSNNNLHGSIPYQLPPNLTYLNLASNDFSGNLPYSITNLASIEY  143



>ref|XP_003563583.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Brachypodium 
distachyon]
Length=720

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++S NSP QLT W+A GGDPCG +W GVSCSG+ +T I +SG+ L G++G+QL  L ++ 
Sbjct  37   YTSWNSPAQLTGWSAGGGDPCGAAWMGVSCSGSAITSINLSGMGLNGTLGYQLSDLVALK  96

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            T D+S NNL +++PYQLPPN+  L+LA N F+G LPYSIS M  L Y
Sbjct  97   TMDLSNNNLHDAIPYQLPPNLTYLSLASNNFSGNLPYSISNMLSLVY  143



>ref|XP_010474484.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Camelina 
sativa]
Length=701

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F+SLNSP +L  W ++GGDPC  SW+GV C G+ VTE+Q+SGL+L+GS+G+ L  LKS+T
Sbjct  36   FTSLNSPSKLKGWKSSGGDPCDGSWEGVKCKGSSVTELQLSGLELSGSLGYLLSNLKSLT  95

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
            TFD+S NNL  ++PYQLPPN+  L+ + N   G +PYS+SQM  ++
Sbjct  96   TFDLSKNNLKGNIPYQLPPNLANLDFSENELDGNVPYSLSQMKSIQ  141



>gb|ADM07445.1| leucine-rich repeat receptor-like protein kinase [Glycine soja]
Length=714

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 80/105 (76%), Gaps = 3/105 (3%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F S+NSP QL  W  NG DPCG+SW+G++CSGNRVTEI++ G  L+GS+G+QL+ L SVT
Sbjct  36   FQSMNSPSQLN-W--NGDDPCGQSWQGITCSGNRVTEIKLPGRSLSGSLGYQLEPLSSVT  92

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  519
              D+S NN+G ++PYQ PPN+Q LNLA N F G +PYS+S+   L
Sbjct  93   NLDLSNNNIGGTIPYQFPPNLQYLNLANNNFNGAIPYSLSEKTSL  137



>ref|XP_008799289.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Phoenix dactylifera]
Length=737

 Score =   131 bits (329),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +1

Query  214  LNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFD  393
            LNSPPQL  WT++GGDPC +SWKG++CSG+ VT I++SG+ L G++G+ L  L S+ T D
Sbjct  56   LNSPPQLAGWTSSGGDPCRDSWKGITCSGSAVTAIEVSGMGLNGTLGYLLSDLLSLKTLD  115

Query  394  ISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
            IS NN+   +PYQLPPN+  LNLA N  +G LP+SIS M  L Y
Sbjct  116  ISNNNVHEGIPYQLPPNLTYLNLAKNNLSGNLPFSISTMVSLNY  159



>ref|XP_009613682.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Nicotiana tomentosiformis]
Length=725

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            +SSLNSP QLT W +NGGDPC ESWKG+SC G  V  IQI  L L G++G+ L+ L S+ 
Sbjct  52   YSSLNSPSQLTNWKSNGGDPCNESWKGISCQGTSVVSIQIPDLGLNGTLGYMLNGLTSLK  111

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NN+ +S+PYQLPPN+  LNLA N  +G +PYSI+ M  L Y
Sbjct  112  NLDMSGNNIHDSIPYQLPPNLTSLNLAKNNISGNVPYSIAGMVTLNY  158



>gb|EEE67594.1| hypothetical protein OsJ_25142 [Oryza sativa Japonica Group]
Length=680

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 81/107 (76%), Gaps = 1/107 (1%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++S+NSP QLT W +  GDPCG+SW G++CSG+RVT I++SG+ + G++G+ ++ L S+ 
Sbjct  35   YTSMNSPSQLTNWVSQNGDPCGQSWLGITCSGSRVTAIKLSGMGINGTLGYNMNLLTSLV  94

Query  385  TFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
              D S NNLG S +PY LPPN+++LNLA N FTG +PYSISQM  L 
Sbjct  95   ELDTSKNNLGGSDIPYNLPPNLERLNLAENNFTGSIPYSISQMIALR  141



>ref|NP_193944.2| STRUBBELIG-receptor family 8 protein [Arabidopsis thaliana]
 sp|Q6R2J8.1|SRF8_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY 8; AltName: 
Full=Leucine-rich repeat receptor kinase-like protein SRF8; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAR99876.1| strubbelig receptor family 8 [Arabidopsis thaliana]
 gb|ACN59345.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE84560.1| STRUBBELIG-receptor family 8 protein [Arabidopsis thaliana]
Length=703

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QLT W   GGDPCGESWKG++C G+ V  I IS L ++G++G+ L  LKS+ 
Sbjct  41   YTSLNSPSQLTNWKNGGGDPCGESWKGITCEGSAVVTIDISDLGVSGTLGYLLSDLKSLR  100

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S N++ ++LPYQLPPN+  LNLA N  +G LPYSIS M  L Y
Sbjct  101  KLDVSGNSIHDTLPYQLPPNLTSLNLARNNLSGNLPYSISAMGSLSY  147



>ref|XP_008380425.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Malus domestica]
Length=697

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++S  S  +L  W ++GGDPCGESWKG++CSG+ VTEI +  L L+GSMG+QL  L SVT
Sbjct  38   YNSFQSRSKLKGWKSSGGDPCGESWKGITCSGSSVTEIDLXDLGLSGSMGYQLASLTSVT  97

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
             FD+S NNL   +PYQLPP+ + ++L+ NGF+  +PYS+SQM+ LE
Sbjct  98   XFDLSKNNLNGDIPYQLPPSAKYIDLSQNGFSNTVPYSVSQMSGLE  143



>ref|XP_006413689.1| hypothetical protein EUTSA_v10024563mg [Eutrema salsugineum]
 gb|ESQ55142.1| hypothetical protein EUTSA_v10024563mg [Eutrema salsugineum]
Length=700

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 84/134 (63%), Gaps = 8/134 (6%)
 Frame = +1

Query  124  FSLGFCSTRRPPPSLIQIRLMRQF*GGFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  303
            FSL  C T       +Q+         ++SLNSP QLT W   GGDPCGESWKG++C G+
Sbjct  17   FSLVRCVTDPSDVQALQVL--------YTSLNSPSQLTNWKNGGGDPCGESWKGITCEGS  68

Query  304  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  483
             V  I IS L ++G++G+ L  L S+   D+S NN+ ++LPYQLPPN+  LNLA N  +G
Sbjct  69   AVVTIDISDLGVSGTLGYLLSDLMSLRKLDVSGNNIHDTLPYQLPPNLTSLNLARNNLSG  128

Query  484  GLPYSISQMAPLEY  525
             LPYSIS M  L Y
Sbjct  129  NLPYSISAMGSLSY  142



>ref|XP_006604929.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Glycine max]
Length=708

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 87/128 (68%), Gaps = 7/128 (5%)
 Frame = +1

Query  154  PPPSLIQIRLMRQF*GG------FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTE  315
            P P  IQ+   R F         F ++NSPPQL  W  NG DPCG+SWKG++CSGNRVTE
Sbjct  3    PLPPQIQMMNFRVFDAAAAVRFLFQNMNSPPQL-GWPPNGDDPCGQSWKGITCSGNRVTE  61

Query  316  IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPY  495
            I++S L LTGS+ + L  L S+T  D+S+N+LG S+PYQLPP +Q LNLA N  TG +PY
Sbjct  62   IKLSNLGLTGSLPYGLQVLTSLTYVDMSSNSLGGSIPYQLPPYLQHLNLAYNNITGTVPY  121

Query  496  SISQMAPL  519
            SIS +  L
Sbjct  122  SISNLTAL  129



>gb|EEC82450.1| hypothetical protein OsI_26884 [Oryza sativa Indica Group]
Length=720

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 81/107 (76%), Gaps = 1/107 (1%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++S+NSP QLT W +  GDPCG+SW G++CSG+RVT I++SG+ + G++G+ ++ L S+ 
Sbjct  35   YTSMNSPSQLTNWVSQNGDPCGQSWLGITCSGSRVTAIKLSGMGINGTLGYNMNLLTSLV  94

Query  385  TFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
              D S NNLG S +PY LPPN+++LNLA N FTG +PYSISQM  L 
Sbjct  95   ELDTSKNNLGGSDIPYNLPPNLERLNLAENNFTGSIPYSISQMIALR  141



>gb|AAP12946.1| putative leucine-rich repeat transmembrane protein kinase [Oryza 
sativa Japonica Group]
 gb|ABF96436.1| leucine-rich repeat transmembrane protein kinase 1, putative, 
expressed [Oryza sativa Japonica Group]
Length=753

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 80/108 (74%), Gaps = 1/108 (1%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QLT W A  GDPCG+SW G++CSG+RV  I++ G+ L G++G+ ++ + ++ 
Sbjct  54   YTSLNSPSQLTNWVAQNGDPCGQSWLGITCSGSRVITIKLPGMGLKGTLGYNMNVMTALV  113

Query  385  TFDISTNNL-GNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D S NNL G  +PY LPPN+++LNL  N FTG LPYSISQMA L+Y
Sbjct  114  ELDASNNNLGGGDIPYNLPPNLERLNLENNSFTGTLPYSISQMASLKY  161



>dbj|BAC10113.1| putative leucine-rich repeat transmembrane protein kinase 2 [Oryza 
sativa Japonica Group]
 dbj|BAC16030.1| putative leucine-rich repeat transmembrane protein kinase 2 [Oryza 
sativa Japonica Group]
 dbj|BAC21507.1| putative leucine-rich repeat transmembrane protein kinase 2 [Oryza 
sativa Japonica Group]
Length=720

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 81/107 (76%), Gaps = 1/107 (1%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++S+NSP QLT W +  GDPCG+SW G++CSG+RVT I++SG+ + G++G+ ++ L S+ 
Sbjct  35   YTSMNSPSQLTNWVSQNGDPCGQSWLGITCSGSRVTAIKLSGMGINGTLGYNMNLLTSLV  94

Query  385  TFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
              D S NNLG S +PY LPPN+++LNLA N FTG +PYSISQM  L 
Sbjct  95   ELDTSKNNLGGSDIPYNLPPNLERLNLAENNFTGSIPYSISQMIALR  141



>gb|EAY90345.1| hypothetical protein OsI_11922 [Oryza sativa Indica Group]
Length=753

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 80/108 (74%), Gaps = 1/108 (1%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLNSP QLT W A  GDPCG+SW G++CSG+RV  I++ G+ L G++G+ ++ + ++ 
Sbjct  54   YTSLNSPSQLTNWVAQNGDPCGQSWLGITCSGSRVITIKLPGMGLKGTLGYNMNVMTALV  113

Query  385  TFDISTNNL-GNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D S NNL G  +PY LPPN+++LNL  N FTG LPYSISQMA L+Y
Sbjct  114  ELDASNNNLGGGDIPYNLPPNLERLNLENNSFTGTLPYSISQMASLKY  161



>ref|XP_010538738.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Tarenaya 
hassleriana]
Length=701

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++SLN+PPQLT W +NGGDPCGESWKGV+C G+ V  I +S L ++G++G+ L  L S+ 
Sbjct  41   YASLNNPPQLTNWKSNGGDPCGESWKGVTCEGSAVVSIDMSELGVSGTLGYLLSDLMSLR  100

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  525
              D+S NN+ +++ YQLPPN+  LNLA N  +G LPYS+S M  L Y
Sbjct  101  KLDVSGNNIHDTIAYQLPPNLTSLNLARNNLSGSLPYSLSTMVSLSY  147



>ref|NP_001060286.1| Os07g0618400 [Oryza sativa Japonica Group]
 dbj|BAF22200.1| Os07g0618400 [Oryza sativa Japonica Group]
Length=732

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 81/107 (76%), Gaps = 1/107 (1%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            ++S+NSP QLT W +  GDPCG+SW G++CSG+RVT I++SG+ + G++G+ ++ L S+ 
Sbjct  47   YTSMNSPSQLTNWVSQNGDPCGQSWLGITCSGSRVTAIKLSGMGINGTLGYNMNLLTSLV  106

Query  385  TFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
              D S NNLG S +PY LPPN+++LNLA N FTG +PYSISQM  L 
Sbjct  107  ELDTSKNNLGGSDIPYNLPPNLERLNLAENNFTGSIPYSISQMIALR  153



>ref|XP_010429764.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Camelina 
sativa]
Length=621

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT  384
            F+SLNSP +L  W ++GGDPC  SW+GV C G+ VTE+Q+SGL+L+GS+G+ L  LKS+T
Sbjct  36   FTSLNSPSKLKGWKSSGGDPCDGSWEGVKCKGSSVTELQLSGLELSGSLGYLLSNLKSLT  95

Query  385  TFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  522
             FD+S NNL  ++PYQLPPN+  L+ + N   G +PYS+SQM  ++
Sbjct  96   NFDLSKNNLKGNIPYQLPPNLANLDFSENELDGNVPYSLSQMKSIQ  141



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561572122600