BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF010M19

Length=521
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009605315.1|  PREDICTED: protein transport protein Sec24B        298   2e-93   Nicotiana tomentosiformis
ref|XP_009783888.1|  PREDICTED: protein transport protein SEC24         294   1e-91   Nicotiana sylvestris
ref|XP_004251061.1|  PREDICTED: protein transport protein SEC24         286   6e-89   Solanum lycopersicum
gb|KDO58110.1|  hypothetical protein CISIN_1g0053621mg                  271   1e-85   Citrus sinensis [apfelsine]
gb|KDO58108.1|  hypothetical protein CISIN_1g0053621mg                  271   1e-85   Citrus sinensis [apfelsine]
gb|KDO58109.1|  hypothetical protein CISIN_1g0053621mg                  270   2e-85   Citrus sinensis [apfelsine]
ref|XP_006487894.1|  PREDICTED: protein transport protein Sec24-l...    274   6e-84   Citrus sinensis [apfelsine]
ref|XP_006424228.1|  hypothetical protein CICLE_v10027862mg             273   1e-83   Citrus clementina [clementine]
ref|XP_002275292.1|  PREDICTED: protein transport protein Sec24-l...    272   2e-83   Vitis vinifera
emb|CDP06905.1|  unnamed protein product                                271   3e-83   Coffea canephora [robusta coffee]
emb|CAN62128.1|  hypothetical protein VITISV_037581                     271   4e-83   Vitis vinifera
ref|XP_007015800.1|  Sec23/sec24 transport family protein isoform 2     263   4e-81   
ref|XP_006362886.1|  PREDICTED: protein transport protein sec24-like    266   4e-81   Solanum tuberosum [potatoes]
gb|EYU36066.1|  hypothetical protein MIMGU_mgv1a001880mg                266   5e-81   Erythranthe guttata [common monkey flower]
gb|KGN64935.1|  hypothetical protein Csa_1G164690                       258   1e-80   Cucumis sativus [cucumbers]
ref|XP_010245214.1|  PREDICTED: protein transport protein Sec24-l...    264   2e-80   Nelumbo nucifera [Indian lotus]
ref|XP_007015799.1|  Sec23/sec24 transport family protein isoform 1     264   3e-80   
gb|KJB21717.1|  hypothetical protein B456_004G010100                    258   3e-80   Gossypium raimondii
ref|XP_004167882.1|  PREDICTED: protein transport protein Sec24-l...    258   1e-79   
ref|XP_010045202.1|  PREDICTED: protein transport protein Sec24-l...    261   3e-79   Eucalyptus grandis [rose gum]
gb|KJB21718.1|  hypothetical protein B456_004G010100                    259   5e-79   Gossypium raimondii
gb|KJB21716.1|  hypothetical protein B456_004G010100                    260   7e-79   Gossypium raimondii
gb|KHG08020.1|  transport protein sec24-1                               260   7e-79   Gossypium arboreum [tree cotton]
ref|XP_004139490.1|  PREDICTED: protein transport protein SEC24-1...    259   2e-78   Cucumis sativus [cucumbers]
ref|XP_008461390.1|  PREDICTED: protein transport protein SEC24         259   2e-78   Cucumis melo [Oriental melon]
ref|XP_009103601.1|  PREDICTED: protein transport protein SEC24 i...    259   2e-78   Brassica rapa
ref|XP_009103600.1|  PREDICTED: protein transport protein SEC24 i...    258   3e-78   Brassica rapa
emb|CDY04496.1|  BnaA07g13220D                                          258   4e-78   
ref|XP_002313596.1|  hypothetical protein POPTR_0009s16480g             258   4e-78   Populus trichocarpa [western balsam poplar]
ref|XP_010542559.1|  PREDICTED: protein transport protein SEC24-l...    258   5e-78   Tarenaya hassleriana [spider flower]
ref|XP_010542560.1|  PREDICTED: protein transport protein SEC24-l...    258   6e-78   Tarenaya hassleriana [spider flower]
emb|CDX71451.1|  BnaC04g16860D                                          257   9e-78   
ref|XP_006293742.1|  hypothetical protein CARUB_v10022704mg             257   1e-77   Capsella rubella
ref|XP_010510770.1|  PREDICTED: protein transport protein sec24         256   3e-77   Camelina sativa [gold-of-pleasure]
ref|XP_006487893.1|  PREDICTED: protein transport protein Sec24-l...    256   3e-77   Citrus sinensis [apfelsine]
ref|XP_010417884.1|  PREDICTED: protein transport protein sec24-like    255   7e-77   Camelina sativa [gold-of-pleasure]
emb|CDY30546.1|  BnaA04g15870D                                          255   7e-77   Brassica napus [oilseed rape]
ref|XP_006424227.1|  hypothetical protein CICLE_v10027862mg             256   7e-77   Citrus clementina [clementine]
ref|XP_011090338.1|  PREDICTED: protein transport protein SEC24         254   2e-76   Sesamum indicum [beniseed]
ref|XP_009140802.1|  PREDICTED: protein transport protein SEC24-like    254   2e-76   Brassica rapa
ref|XP_008360983.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    247   2e-76   
ref|XP_011043111.1|  PREDICTED: protein transport protein SEC24         253   3e-76   Populus euphratica
ref|XP_010473124.1|  PREDICTED: protein transport protein sec24-like    253   3e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010557420.1|  PREDICTED: protein transport protein SEC23         252   8e-76   Tarenaya hassleriana [spider flower]
ref|XP_002879090.1|  sec23/sec24 transport family protein               252   1e-75   
ref|NP_565651.1|  sec23/sec24 transport family protein                  251   1e-75   Arabidopsis thaliana [mouse-ear cress]
emb|CDX77118.1|  BnaC04g39130D                                          251   1e-75   
ref|XP_006384797.1|  sec23/sec24 transport family protein               250   3e-75   Populus trichocarpa [western balsam poplar]
ref|XP_002523817.1|  expressed protein, putative                        248   2e-74   
ref|XP_009339600.1|  PREDICTED: protein transport protein sec24-like    248   3e-74   Pyrus x bretschneideri [bai li]
ref|XP_008228686.1|  PREDICTED: protein transport protein SEC24 i...    248   3e-74   Prunus mume [ume]
ref|XP_009346558.1|  PREDICTED: protein transport protein sec24-like    248   3e-74   Pyrus x bretschneideri [bai li]
ref|XP_010685999.1|  PREDICTED: protein transport protein sec24         248   4e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007208430.1|  hypothetical protein PRUPE_ppa001892mg             246   9e-74   Prunus persica
ref|XP_006409731.1|  hypothetical protein EUTSA_v10016271mg             246   4e-73   
ref|XP_010089815.1|  Protein transport protein SEC24-1                  244   6e-73   Morus notabilis
gb|KFK36699.1|  hypothetical protein AALP_AA4G157700                    243   2e-72   Arabis alpina [alpine rockcress]
ref|XP_008351295.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    237   5e-72   
ref|XP_004291596.2|  PREDICTED: protein transport protein Sec24-l...    242   8e-72   Fragaria vesca subsp. vesca
ref|XP_009404358.1|  PREDICTED: protein transport protein sec24-like    239   7e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008787674.1|  PREDICTED: protein transport protein sec24-like    238   1e-70   Phoenix dactylifera
ref|XP_009411948.1|  PREDICTED: protein transport protein SEC23-like    237   3e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004517293.1|  PREDICTED: protein transport protein SEC24-l...    236   8e-70   
ref|XP_004506195.1|  PREDICTED: protein transport protein SEC24-like    232   2e-69   Cicer arietinum [garbanzo]
ref|XP_003539835.1|  PREDICTED: protein transport protein Sec24-l...    235   2e-69   Glycine max [soybeans]
ref|XP_010927800.1|  PREDICTED: protein transport protein sec24-like    234   3e-69   Elaeis guineensis
gb|KEH29852.1|  Sec23/Sec24 transport family protein                    234   4e-69   Medicago truncatula
ref|XP_010931128.1|  PREDICTED: protein transport protein SEC24-l...    233   5e-69   Elaeis guineensis
ref|XP_007132444.1|  hypothetical protein PHAVU_011G094800g             234   5e-69   Phaseolus vulgaris [French bean]
ref|XP_010931127.1|  PREDICTED: protein transport protein SEC24-l...    234   6e-69   Elaeis guineensis
ref|XP_004517291.1|  PREDICTED: protein transport protein SEC24-l...    233   8e-69   Cicer arietinum [garbanzo]
ref|XP_008788954.1|  PREDICTED: protein transport protein Sec24-l...    233   9e-69   Phoenix dactylifera
ref|XP_004517292.1|  PREDICTED: protein transport protein SEC24-l...    233   9e-69   Cicer arietinum [garbanzo]
ref|XP_009342740.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    231   1e-68   
gb|KHN21153.1|  Protein transport protein SEC24-1                       232   3e-68   Glycine soja [wild soybean]
ref|XP_003538113.1|  PREDICTED: protein transport protein Sec24-l...    232   3e-68   Glycine max [soybeans]
ref|XP_006591072.1|  PREDICTED: protein transport protein Sec24-l...    232   3e-68   
gb|EPS61152.1|  hypothetical protein M569_13647                         225   5e-67   Genlisea aurea
ref|XP_006855085.1|  hypothetical protein AMTR_s00031p00165880          228   1e-66   Amborella trichopoda
gb|KHN38627.1|  Protein transport protein Sec24-like                    226   3e-66   Glycine soja [wild soybean]
ref|XP_010042360.1|  PREDICTED: uncharacterized protein C4.03c-like     210   5e-66   Eucalyptus grandis [rose gum]
gb|KDP24980.1|  hypothetical protein JCGZ_24318                         218   1e-63   Jatropha curcas
gb|ACN25159.1|  unknown                                                 207   6e-62   Zea mays [maize]
ref|XP_004961931.1|  PREDICTED: uncharacterized protein C4.03c-like     211   2e-60   Setaria italica
ref|XP_008647340.1|  PREDICTED: uncharacterized protein LOC100192...    208   1e-59   
gb|AFW81781.1|  hypothetical protein ZEAMMB73_245204                    208   1e-59   
ref|XP_002441179.1|  hypothetical protein SORBIDRAFT_09g021790          206   1e-58   Sorghum bicolor [broomcorn]
ref|XP_003568355.1|  PREDICTED: protein transport protein sec24         205   1e-58   Brachypodium distachyon [annual false brome]
ref|NP_001170139.1|  uncharacterized protein LOC100384066               204   4e-58   Zea mays [maize]
dbj|BAJ95494.1|  predicted protein                                      203   1e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAT69610.1|  unknown protein                                         187   5e-53   Oryza sativa Japonica Group [Japonica rice]
gb|KJB55613.1|  hypothetical protein B456_009G085000                    187   2e-52   Gossypium raimondii
gb|EEE63885.1|  hypothetical protein OsJ_18710                          188   2e-52   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001055673.1|  Os05g0443300                                       188   2e-52   
gb|EAY98220.1|  hypothetical protein OsI_20132                          186   2e-51   Oryza sativa Indica Group [Indian rice]
ref|XP_001777420.1|  predicted protein                                  184   6e-51   
ref|XP_003579703.1|  PREDICTED: protein transport protein SEC24-like    179   2e-49   Brachypodium distachyon [annual false brome]
ref|XP_011015487.1|  PREDICTED: protein transport protein SEC24-like    178   5e-49   Populus euphratica
ref|XP_002976124.1|  hypothetical protein SELMODRAFT_104389             178   6e-49   
ref|XP_002968253.1|  hypothetical protein SELMODRAFT_440407             177   1e-48   Selaginella moellendorffii
ref|NP_001052744.1|  Os04g0412900                                       176   4e-48   
emb|CAH67359.1|  OSIGBa0134P10.5                                        176   5e-48   Oryza sativa [red rice]
gb|EEC77245.1|  hypothetical protein OsI_15817                          176   5e-48   Oryza sativa Indica Group [Indian rice]
gb|EEE60965.1|  hypothetical protein OsJ_14735                          170   6e-46   Oryza sativa Japonica Group [Japonica rice]
gb|AFW58189.1|  hypothetical protein ZEAMMB73_262773                    168   2e-45   
ref|XP_008663179.1|  PREDICTED: protein transport protein SEC24-like    168   2e-45   Zea mays [maize]
ref|XP_004975570.1|  PREDICTED: protein transport protein Sec24C-...    164   1e-43   Setaria italica
gb|EMS67454.1|  Protein transport protein Sec24A                        160   3e-42   Triticum urartu
gb|EMT28162.1|  Protein transport protein Sec24B                        158   7e-42   
ref|XP_001757713.1|  predicted protein                                  158   1e-41   
dbj|BAK03991.1|  predicted protein                                      158   1e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006655364.1|  PREDICTED: protein transport protein SEC24-like    120   3e-28   
gb|EMT05114.1|  Protein transport protein SEC24                         100   6e-21   
ref|XP_005650920.1|  vWA-like protein                                 99.4    1e-20   Coccomyxa subellipsoidea C-169
ref|XP_005839653.1|  secretory protein Sec24B                         95.5    3e-19   Guillardia theta CCMP2712
ref|XP_003058885.1|  predicted protein                                89.7    3e-17   Micromonas pusilla CCMP1545
ref|XP_002947745.1|  hypothetical protein VOLCADRAFT_87927            84.7    1e-15   Volvox carteri f. nagariensis
ref|XP_002501401.1|  predicted protein                                83.2    4e-15   Micromonas commoda
ref|XP_001694580.1|  COP-II coat subunit                              74.3    4e-12   Chlamydomonas reinhardtii
gb|EPS70068.1|  hypothetical protein M569_04697                       68.6    9e-12   Genlisea aurea
gb|EMS61482.1|  Protein transport protein Sec24C                      70.1    8e-11   Triticum urartu
ref|XP_004350752.1|  hypothetical protein DFA_11807                   64.7    6e-09   Cavenderia fasciculata
ref|XP_003284541.1|  hypothetical protein DICPUDRAFT_96735            60.8    1e-07   Dictyostelium purpureum
ref|XP_005839376.1|  secretory protein Sec23B                         57.0    2e-06   Guillardia theta CCMP2712
ref|XP_006684382.1|  hypothetical protein CANTEDRAFT_96903            56.6    3e-06   Yamadazyma tenuis ATCC 10573
ref|XP_005713593.1|  unnamed protein product                          55.8    4e-06   Chondrus crispus [carageen]
gb|EPY49350.1|  COPII-coated vesicle component Sfb3                   54.3    1e-05   Schizosaccharomyces cryophilus OY26
gb|KDO30095.1|  hypothetical protein SPRG_05286                       53.5    2e-05   Saprolegnia parasitica CBS 223.65
ref|XP_003677551.1|  hypothetical protein NCAS_0G03120                53.1    3e-05   Naumovozyma castellii CBS 4309
emb|CEP19247.1|  hypothetical protein                                 53.1    3e-05   Parasitella parasitica
emb|CEP64674.1|  LALA0S13e00386g1_1                                   53.1    3e-05   Lachancea lanzarotensis
emb|CEG82188.1|  hypothetical protein RMATCC62417_16297               53.1    3e-05   Rhizopus microsporus
ref|XP_001455165.1|  hypothetical protein                             52.8    4e-05   Paramecium tetraurelia strain d4-2
ref|XP_008610658.1|  hypothetical protein SDRG_06644                  52.4    6e-05   Saprolegnia diclina VS20
ref|XP_001327619.1|  Sec23/Sec24 trunk domain containing protein      52.4    6e-05   Trichomonas vaginalis G3
emb|CCF74209.1|  unnamed protein product                              52.4    6e-05   
ref|XP_003645324.1|  hypothetical protein Ecym_2811                   52.4    6e-05   Eremothecium cymbalariae DBVPG#7215
ref|XP_003959352.1|  hypothetical protein KAFR_0J01510                52.4    6e-05   Kazachstania africana CBS 2517
pdb|1PCX|A  Chain A, Crystal Structure Of The Copii Coat Subunit,...  52.0    7e-05   Saccharomyces cerevisiae [brewer's yeast]
emb|CEI85981.1|  hypothetical protein RMCBS344292_00428               52.0    7e-05   Rhizopus microsporus
ref|XP_003958894.1|  hypothetical protein KAFR_0H03490                51.6    8e-05   Kazachstania africana CBS 2517
dbj|GAA29645.2|  protein transport protein SEC24                      51.6    9e-05   Clonorchis sinensis [oriental liver fluke]
gb|EPX74228.1|  COPII-coated vesicle component Sfb3                   51.6    1e-04   Schizosaccharomyces octosporus yFS286
emb|CEG84091.1|  hypothetical protein RMATCC62417_17939               51.6    1e-04   Rhizopus microsporus
ref|XP_011103888.1|  sec24p                                           51.6    1e-04   
emb|CEG73237.1|  hypothetical protein RMATCC62417_08657               51.6    1e-04   Rhizopus microsporus
gb|KHF97872.1|  transport protein sec23                               51.6    1e-04   Gossypium arboreum [tree cotton]
gb|EIW09905.1|  Sec24p                                                51.6    1e-04   Saccharomyces cerevisiae CEN.PK113-7D
gb|AJR52369.1|  Sec24p                                                51.6    1e-04   Saccharomyces cerevisiae YJM1478
gb|AJR51422.1|  Sec24p                                                51.6    1e-04   Saccharomyces cerevisiae YJM1447
gb|AJR49140.1|  Sec24p                                                51.6    1e-04   Saccharomyces cerevisiae YJM1400
gb|AJR48812.1|  Sec24p                                                51.6    1e-04   Saccharomyces cerevisiae YJM1389
gb|AJR48427.1|  Sec24p                                                51.6    1e-04   Saccharomyces cerevisiae YJM1387
gb|AJR46151.1|  Sec24p                                                51.6    1e-04   Saccharomyces cerevisiae YJM1326
gb|AJR44817.1|  Sec24p                                                51.6    1e-04   Saccharomyces cerevisiae YJM1250
gb|AJR42896.1|  Sec24p                                                51.6    1e-04   Saccharomyces cerevisiae YJM1083
gb|AJR38532.1|  Sec24p                                                51.6    1e-04   Saccharomyces cerevisiae YJM450
gb|EDV09587.1|  vesicle coat component                                51.6    1e-04   Saccharomyces cerevisiae RM11-1a
ref|NP_012157.3|  COPII subunit SEC24                                 51.6    1e-04   Saccharomyces cerevisiae S288C
dbj|GAA24012.1|  K7_Sec24p                                            51.6    1e-04   Saccharomyces cerevisiae Kyokai no. 7
gb|AJR49516.1|  Sec24p                                                51.2    1e-04   Saccharomyces cerevisiae YJM1402
gb|AJR48620.1|  Sec24p                                                51.2    1e-04   Saccharomyces cerevisiae YJM1388
gb|AJR51045.1|  Sec24p                                                51.2    1e-04   Saccharomyces cerevisiae YJM1443
gb|AJR51986.1|  Sec24p                                                51.2    1e-04   Saccharomyces cerevisiae YJM1463
pdb|4BZI|F  Chain F, The Structure Of The Copii Coat Assembled On...  51.2    1e-04   Saccharomyces cerevisiae [brewer's yeast]
sp|Q876F5.1|SC242_SACU7  RecName: Full=Protein transport protein ...  51.2    1e-04   Saccharomyces uvarum MCYC 623
gb|EHN06600.1|  Sec24p                                                51.2    1e-04   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gb|AJR44625.1|  Sec24p                                                51.2    1e-04   Saccharomyces cerevisiae YJM1248
emb|CEI95000.1|  hypothetical protein RMCBS344292_09201               51.2    1e-04   Rhizopus microsporus
emb|CEJ04406.1|  hypothetical protein RMCBS344292_18368               50.8    1e-04   Rhizopus microsporus
gb|KII87578.1|  hypothetical protein PLICRDRAFT_162293                50.8    2e-04   Plicaturopsis crispa FD-325 SS-3
ref|XP_008610639.1|  hypothetical protein SDRG_06627                  50.8    2e-04   Saprolegnia diclina VS20
ref|NP_984588.1|  AEL272Wp                                            50.8    2e-04   Eremothecium gossypii ATCC 10895
ref|XP_002551498.1|  KLTH0A00814p                                     50.8    2e-04   Lachancea thermotolerans CBS 6340
ref|XP_003675093.1|  hypothetical protein NCAS_0B06380                50.8    2e-04   Naumovozyma castellii CBS 4309
emb|CEI93473.1|  hypothetical protein RMCBS344292_07705               50.4    2e-04   Rhizopus microsporus
gb|AGO12094.1|  AaceriAEL272Wp                                        50.4    2e-04   Saccharomycetaceae sp. 'Ashbya aceri'
gb|KDO30079.1|  hypothetical protein SPRG_05270                       50.4    2e-04   Saprolegnia parasitica CBS 223.65
ref|XP_003687261.1|  hypothetical protein TPHA_0I03260                50.4    2e-04   Tetrapisispora phaffii CBS 4417
gb|EPY23307.1|  protein transport protein SEC24                       50.1    3e-04   Angomonas deanei
emb|CDR97836.1|  Sec 24 protein transport protein, putative           50.1    3e-04   Babesia bigemina
ref|XP_001644575.1|  hypothetical protein Kpol_1003p22                50.1    3e-04   Vanderwaltozyma polyspora DSM 70294
gb|KFH64876.1|  hypothetical protein MVEG_09605                       50.1    3e-04   Mortierella verticillata NRRL 6337
emb|CCK70453.1|  hypothetical protein KNAG_0E01910                    50.1    3e-04   Kazachstania naganishii CBS 8797
emb|CDO94311.1|  unnamed protein product                              50.1    3e-04   Kluyveromyces dobzhanskii CBS 2104
ref|XP_001580499.1|  hypothetical protein                             49.7    4e-04   Trichomonas vaginalis G3
gb|EFA82261.1|  hypothetical protein PPL_04684                        49.7    4e-04   Heterostelium album PN500
ref|XP_454166.1|  hypothetical protein                                49.7    4e-04   Kluyveromyces lactis
ref|XP_003680499.1|  hypothetical protein TDEL_0C03990                49.7    4e-04   Torulaspora delbrueckii
emb|CCK71056.1|  hypothetical protein KNAG_0F03920                    49.3    5e-04   Kazachstania naganishii CBS 8797
emb|CEG70265.1|  hypothetical protein RMATCC62417_06195               49.3    5e-04   Rhizopus microsporus
gb|KJB41726.1|  hypothetical protein B456_007G117000                  49.3    6e-04   Gossypium raimondii
emb|CBK24810.2|  unnamed protein product                              49.3    6e-04   Blastocystis hominis
ref|XP_009164005.1|  hypothetical protein T265_01675                  49.3    6e-04   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_455249.1|  hypothetical protein                                49.3    6e-04   Kluyveromyces lactis
ref|XP_001326967.1|  Sec23/Sec24 trunk domain containing protein      48.9    6e-04   Trichomonas vaginalis G3
gb|KDN38703.1|  putative SEC24-COPII coated vesicle component         49.3    6e-04   Tilletiaria anomala UBC 951
gb|EFO62780.1|  Sec24-like protein                                    48.9    7e-04   Giardia lamblia P15
ref|XP_007051293.1|  Sec23/Sec24 protein transport family protein...  48.9    7e-04   
ref|XP_001276901.1|  Sec23/Sec24 trunk domain containing protein      48.9    7e-04   Trichomonas vaginalis G3
emb|CDS06613.1|  hypothetical protein LRAMOSA09141                    48.9    7e-04   Lichtheimia ramosa
ref|XP_007051294.1|  Sec23/Sec24 protein transport family protein...  48.9    7e-04   
ref|XP_007051295.1|  Sec23/Sec24 protein transport family protein...  48.9    7e-04   
gb|EIJ94381.1|  hypothetical protein NEPG_01049                       48.9    7e-04   Nematocida parisii ERTm1
ref|XP_007051292.1|  Sec23/Sec24 protein transport family protein...  48.9    7e-04   
ref|XP_001609240.1|  Sec 24 protein transport protein                 48.5    0.001   Babesia bovis T2Bo
ref|XP_004030860.1|  hypothetical protein IMG5_151710                 48.5    0.001   Ichthyophthirius multifiliis
gb|EHJ70415.1|  hypothetical protein KGM_15898                        48.5    0.001   
ref|XP_459434.1|  DEHA2E02332p                                        48.5    0.001   Debaryomyces hansenii CBS767



>ref|XP_009605315.1| PREDICTED: protein transport protein Sec24B [Nicotiana tomentosiformis]
Length=742

 Score =   298 bits (764),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MA+RA+V+RFPGD DALE AGLPWGVT++PFA+KDENGNPPVYGSDGHLLPRCENCWAYY
Sbjct  1    MALRATVSRFPGDQDALEEAGLPWGVTVSPFASKDENGNPPVYGSDGHLLPRCENCWAYY  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEEMQARP  369
            NTYCEQEQWAWTCALCGTLNGL SQA+ RYSLP+SCPEN+SSFIDLELP++ SEEMQARP
Sbjct  61   NTYCEQEQWAWTCALCGTLNGLSSQAVTRYSLPESCPENLSSFIDLELPMDESEEMQARP  120

Query  370  VYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            VYVAAVDLASSEEFLELVKSALLAALE LGPGSLFGLATFSHKIGLYDVQ
Sbjct  121  VYVAAVDLASSEEFLELVKSALLAALEALGPGSLFGLATFSHKIGLYDVQ  170



>ref|XP_009783888.1| PREDICTED: protein transport protein SEC24 [Nicotiana sylvestris]
Length=742

 Score =   294 bits (752),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFPGD DALE +GLPWGVT++PFA+KDENGNPPVYGS GHLLPRCENCWAYY
Sbjct  1    MAVRATVSRFPGDQDALEESGLPWGVTVSPFASKDENGNPPVYGSGGHLLPRCENCWAYY  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEEMQARP  369
            NTYCEQEQWAWTCALCGTL+GL SQA+ RYSLP+SCPEN+SSFIDLELP++ SEEMQARP
Sbjct  61   NTYCEQEQWAWTCALCGTLSGLSSQAVTRYSLPESCPENLSSFIDLELPMDESEEMQARP  120

Query  370  VYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            VYVAAVDLASSEEFLELVKSALLAALE LGPGSLFGLATFSHKIGLYDVQ
Sbjct  121  VYVAAVDLASSEEFLELVKSALLAALEALGPGSLFGLATFSHKIGLYDVQ  170



>ref|XP_004251061.1| PREDICTED: protein transport protein SEC24 [Solanum lycopersicum]
Length=742

 Score =   286 bits (733),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V RFP D ++L  +GLPWGVT++PFAAKDENGNPPVYGS+GHLLPRCENCWAYY
Sbjct  1    MAVRATVTRFPIDLESLMDSGLPWGVTVSPFAAKDENGNPPVYGSEGHLLPRCENCWAYY  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEEMQARP  369
            NTYCEQEQWAWTC+LCGTLNGL SQ+++RYS P+SCPENMSSFIDLELP+E SEEMQARP
Sbjct  61   NTYCEQEQWAWTCSLCGTLNGLSSQSVSRYSQPESCPENMSSFIDLELPMEESEEMQARP  120

Query  370  VYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            VYVAAVDLASSEEFLELVKSALLAALE LGPGSLFGLATFSHKIGLYDVQ
Sbjct  121  VYVAAVDLASSEEFLELVKSALLAALEALGPGSLFGLATFSHKIGLYDVQ  170



>gb|KDO58110.1| hypothetical protein CISIN_1g0053621mg, partial [Citrus sinensis]
 gb|KDO58111.1| hypothetical protein CISIN_1g0053621mg, partial [Citrus sinensis]
Length=466

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 153/172 (89%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP DPDA E +GLPWGVT+TPFA KDENG  PVYGSDGH+LPRCENC+AY+
Sbjct  1    MAVRATVSRFPSDPDAQEASGLPWGVTVTPFATKDENGAAPVYGSDGHMLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE EQWAWTC+LCG+LNGL SQAIARY+ P SC E +SSFIDL+LPLEGSEE  MQA
Sbjct  61   NTYCELEQWAWTCSLCGSLNGLSSQAIARYTHPQSCAEMISSFIDLDLPLEGSEEETMQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAAVDL+SSEEFLEL +SAL AALE +  G+LFGLATFSHKIGLYDVQ
Sbjct  121  RPVYVAAVDLSSSEEFLELTRSALQAALEAVPSGALFGLATFSHKIGLYDVQ  172



>gb|KDO58108.1| hypothetical protein CISIN_1g0053621mg, partial [Citrus sinensis]
Length=468

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 153/172 (89%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP DPDA E +GLPWGVT+TPFA KDENG  PVYGSDGH+LPRCENC+AY+
Sbjct  1    MAVRATVSRFPSDPDAQEASGLPWGVTVTPFATKDENGAAPVYGSDGHMLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE EQWAWTC+LCG+LNGL SQAIARY+ P SC E +SSFIDL+LPLEGSEE  MQA
Sbjct  61   NTYCELEQWAWTCSLCGSLNGLSSQAIARYTHPQSCAEMISSFIDLDLPLEGSEEETMQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAAVDL+SSEEFLEL +SAL AALE +  G+LFGLATFSHKIGLYDVQ
Sbjct  121  RPVYVAAVDLSSSEEFLELTRSALQAALEAVPSGALFGLATFSHKIGLYDVQ  172



>gb|KDO58109.1| hypothetical protein CISIN_1g0053621mg [Citrus sinensis]
Length=457

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 153/172 (89%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP DPDA E +GLPWGVT+TPFA KDENG  PVYGSDGH+LPRCENC+AY+
Sbjct  1    MAVRATVSRFPSDPDAQEASGLPWGVTVTPFATKDENGAAPVYGSDGHMLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE EQWAWTC+LCG+LNGL SQAIARY+ P SC E +SSFIDL+LPLEGSEE  MQA
Sbjct  61   NTYCELEQWAWTCSLCGSLNGLSSQAIARYTHPQSCAEMISSFIDLDLPLEGSEEETMQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAAVDL+SSEEFLEL +SAL AALE +  G+LFGLATFSHKIGLYDVQ
Sbjct  121  RPVYVAAVDLSSSEEFLELTRSALQAALEAVPSGALFGLATFSHKIGLYDVQ  172



>ref|XP_006487894.1| PREDICTED: protein transport protein Sec24-like At3g07100-like 
isoform X2 [Citrus sinensis]
Length=744

 Score =   274 bits (700),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 153/172 (89%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP DPDA E +GLPWGVT+TPFA KDENG  PVYGSDGH+LPRCENC+AY+
Sbjct  1    MAVRATVSRFPSDPDAQEASGLPWGVTVTPFATKDENGAAPVYGSDGHMLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE EQWAWTC+LCG+LNGL SQAIARYS P SC E +SSFIDL+LPLEGSEE  MQA
Sbjct  61   NTYCELEQWAWTCSLCGSLNGLSSQAIARYSHPHSCAEMISSFIDLDLPLEGSEEETMQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAAVDL+SSEEFLEL +SAL AALE +  G+LFGLATFSHKIGLYDVQ
Sbjct  121  RPVYVAAVDLSSSEEFLELTRSALQAALEAVPSGALFGLATFSHKIGLYDVQ  172



>ref|XP_006424228.1| hypothetical protein CICLE_v10027862mg [Citrus clementina]
 gb|ESR37468.1| hypothetical protein CICLE_v10027862mg [Citrus clementina]
Length=744

 Score =   273 bits (697),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 153/172 (89%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP DPDA E +GLPWGVT+TPFA KDENG  PVYGSDGH+LPRCENC+AY+
Sbjct  1    MAVRATVSRFPSDPDAQEASGLPWGVTVTPFATKDENGAAPVYGSDGHMLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE EQWAWTC+LCG+LNGL SQAIARY+ P SC E +SSFIDL+LPLEGSEE  MQA
Sbjct  61   NTYCELEQWAWTCSLCGSLNGLSSQAIARYTHPQSCAEMISSFIDLDLPLEGSEEETMQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAAVDL+SSEEFLEL +SAL AALE +  G+LFGLATFSHKIGLYDVQ
Sbjct  121  RPVYVAAVDLSSSEEFLELTRSALQAALEAVPSGALFGLATFSHKIGLYDVQ  172



>ref|XP_002275292.1| PREDICTED: protein transport protein Sec24-like At3g07100 [Vitis 
vinifera]
 emb|CBI28313.3| unnamed protein product [Vitis vinifera]
Length=744

 Score =   272 bits (696),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 155/172 (90%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+++RFP DPDA E +GLPWGVT+TPFA KDENGN PVYGSDGHLLPRCENCWAY+
Sbjct  1    MAVRATMSRFPMDPDAQEGSGLPWGVTVTPFATKDENGNSPVYGSDGHLLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGS--EEMQA  363
            NTYCE EQWAW C+LCGTLNGL S+AI RYS P SC E MSSFIDLELP+EGS  E MQA
Sbjct  61   NTYCELEQWAWNCSLCGTLNGLTSEAITRYSQPQSCAEMMSSFIDLELPVEGSEGEAMQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAA+DL+SSEEFLEL+KS+LLAALE LGPG+LFGLATFSHKIGLYDVQ
Sbjct  121  RPVYVAAIDLSSSEEFLELIKSSLLAALEALGPGALFGLATFSHKIGLYDVQ  172



>emb|CDP06905.1| unnamed protein product [Coffea canephora]
Length=742

 Score =   271 bits (694),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V RFP + +ALE +G+PWGVT+TPFA KDENG+PP YG DG+LLPRCENCWAYY
Sbjct  1    MAVRATVGRFPENQEALESSGIPWGVTVTPFAGKDENGSPPAYGLDGNLLPRCENCWAYY  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEEMQARP  369
            NT+C+QEQWAWTCALCGTLNGL SQAIARYSLP SC EN+SSFIDLELPL+ SEEMQAR 
Sbjct  61   NTFCDQEQWAWTCALCGTLNGLSSQAIARYSLPHSCAENLSSFIDLELPLDESEEMQARL  120

Query  370  VYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            VYVAAVDL+SSEEFLEL+KSALLAALE LGPGSLFGLATFSHK+GL+DVQ
Sbjct  121  VYVAAVDLSSSEEFLELIKSALLAALEALGPGSLFGLATFSHKVGLFDVQ  170



>emb|CAN62128.1| hypothetical protein VITISV_037581 [Vitis vinifera]
Length=746

 Score =   271 bits (694),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 155/172 (90%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+++RFP DPDA E +GLPWGVT+TPFA KDENGN PVYGSDGHLLPRCENCWAY+
Sbjct  1    MAVRATMSRFPMDPDAQEGSGLPWGVTVTPFATKDENGNSPVYGSDGHLLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGS--EEMQA  363
            NTYCE EQWAW C+LCGTLNGL S+AI RYS P SC E MSSFIDLELP+EGS  E MQA
Sbjct  61   NTYCELEQWAWNCSLCGTLNGLTSEAITRYSQPQSCAEMMSSFIDLELPVEGSEGEAMQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAA+DL+SSEEFLEL+KS+LLAALE LGPG+LFGLATFSHKIGLYDVQ
Sbjct  121  RPVYVAAIDLSSSEEFLELIKSSLLAALEALGPGALFGLATFSHKIGLYDVQ  172



>ref|XP_007015800.1| Sec23/sec24 transport family protein isoform 2 [Theobroma cacao]
 gb|EOY33419.1| Sec23/sec24 transport family protein isoform 2 [Theobroma cacao]
Length=612

 Score =   263 bits (673),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 151/172 (88%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E +G+PWG+TLTPF AKDENG  PVYGSDGHLLPRCENC+AY+
Sbjct  1    MAVRATVSRFPVDSDAQEASGVPWGITLTPFTAKDENGQSPVYGSDGHLLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE +QWAW C+LCGTLNGL SQAIARYS P SC E MSSFIDLELPLEGS+E  + A
Sbjct  61   NTYCELDQWAWNCSLCGTLNGLSSQAIARYSHPQSCAEMMSSFIDLELPLEGSDEEMLHA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAAVDL+SSEEFLEL KSAL AALE L PGSLFGLATFSHK+GLYDVQ
Sbjct  121  RPVYVAAVDLSSSEEFLELTKSALQAALEALAPGSLFGLATFSHKLGLYDVQ  172



>ref|XP_006362886.1| PREDICTED: protein transport protein sec24-like [Solanum tuberosum]
Length=742

 Score =   266 bits (680),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V RFP D ++LE +GLPWGVT++PFAAKDENGNPPVYGS+GHLLPRCENCW YY
Sbjct  1    MAVRATVTRFPIDVESLEESGLPWGVTVSPFAAKDENGNPPVYGSEGHLLPRCENCWGYY  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEEMQARP  369
            NTYCEQEQWAWTC+LCGTLNGL S++++RYS P+SCPEN+SSFIDLEL +E SEEMQARP
Sbjct  61   NTYCEQEQWAWTCSLCGTLNGLSSESVSRYSQPESCPENISSFIDLELSIEESEEMQARP  120

Query  370  VYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            VYVAAVDLASSEEFLELVKSALLAALE LGPGSLFGLATFSHKIGLYDVQ
Sbjct  121  VYVAAVDLASSEEFLELVKSALLAALEALGPGSLFGLATFSHKIGLYDVQ  170



>gb|EYU36066.1| hypothetical protein MIMGU_mgv1a001880mg [Erythranthe guttata]
Length=745

 Score =   266 bits (679),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVR +  RFPG+P   E  G+PWGVTLTPFAAKDEN  PPVYGS G LLPRCENCWAYY
Sbjct  1    MAVRPTTIRFPGNPIEQEACGVPWGVTLTPFAAKDENDIPPVYGSGGELLPRCENCWAYY  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEEMQARP  369
            NTYCEQ+QW+W CALCGT NGL S++I RYSLP S PENMSSFIDLELPLEGSEEMQARP
Sbjct  61   NTYCEQDQWSWDCALCGTTNGLSSESIMRYSLPHSSPENMSSFIDLELPLEGSEEMQARP  120

Query  370  VYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            VYVAAVDL+SSEEFLEL KSALLAALE L PGSLFGLAT SHKIGLYDVQ
Sbjct  121  VYVAAVDLSSSEEFLELTKSALLAALEALSPGSLFGLATISHKIGLYDVQ  170



>gb|KGN64935.1| hypothetical protein Csa_1G164690 [Cucumis sativus]
Length=458

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 154/172 (90%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E +GLPWGV++TPFA+KDENG PP YGSD HLLPRCE+CWAY+
Sbjct  1    MAVRATVSRFPVDADAQENSGLPWGVSVTPFASKDENGRPPAYGSDAHLLPRCEHCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGS--EEMQA  363
            N+YC+ E WAWTCALCGTLNGL S+AIAR+S P+SCPE MSSFIDLELP EGS  E MQ+
Sbjct  61   NSYCDLEHWAWTCALCGTLNGLSSKAIARFSNPESCPEMMSSFIDLELPDEGSGAEAMQS  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAA+DL+SSEEFLEL KSALLAALE LGPGSLFGLATFSHK+GLYDVQ
Sbjct  121  RPVYVAAIDLSSSEEFLELTKSALLAALEALGPGSLFGLATFSHKLGLYDVQ  172



>ref|XP_010245214.1| PREDICTED: protein transport protein Sec24-like At3g07100 [Nelumbo 
nucifera]
Length=743

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 150/172 (87%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E  G+PWGVT TPFA  DENGNPP YG +GHLLPRCENCWAY+
Sbjct  1    MAVRATVSRFPMDTDAQEAGGVPWGVTATPFATTDENGNPPAYGPNGHLLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGS--EEMQA  363
            NTYCE EQWAWTC LCGTLNGL S+AI+RYS P SCPE  SSFIDLE+P+EGS  E MQA
Sbjct  61   NTYCELEQWAWTCVLCGTLNGLSSEAISRYSHPQSCPEMTSSFIDLEMPVEGSEGETMQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAAVDL+SSEEFLEL KSALLAALE LGPGSLFGLATFSHKIGLYDVQ
Sbjct  121  RPVYVAAVDLSSSEEFLELTKSALLAALEALGPGSLFGLATFSHKIGLYDVQ  172



>ref|XP_007015799.1| Sec23/sec24 transport family protein isoform 1 [Theobroma cacao]
 gb|EOY33418.1| Sec23/sec24 transport family protein isoform 1 [Theobroma cacao]
Length=745

 Score =   264 bits (674),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 151/172 (88%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E +G+PWG+TLTPF AKDENG  PVYGSDGHLLPRCENC+AY+
Sbjct  1    MAVRATVSRFPVDSDAQEASGVPWGITLTPFTAKDENGQSPVYGSDGHLLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE +QWAW C+LCGTLNGL SQAIARYS P SC E MSSFIDLELPLEGS+E  + A
Sbjct  61   NTYCELDQWAWNCSLCGTLNGLSSQAIARYSHPQSCAEMMSSFIDLELPLEGSDEEMLHA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAAVDL+SSEEFLEL KSAL AALE L PGSLFGLATFSHK+GLYDVQ
Sbjct  121  RPVYVAAVDLSSSEEFLELTKSALQAALEALAPGSLFGLATFSHKLGLYDVQ  172



>gb|KJB21717.1| hypothetical protein B456_004G010100 [Gossypium raimondii]
Length=512

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 149/172 (87%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E  G+PWG+T+TPFAAKDENG  PVYGSDGHLLPRCENC+AY+
Sbjct  1    MAVRATVSRFPIDSDAQEACGIPWGLTVTPFAAKDENGQAPVYGSDGHLLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE +QWAW C+LCGTLNGL S+AIARYS P SC E MSSF+DLE PLEGSEE  + A
Sbjct  61   NTYCELDQWAWNCSLCGTLNGLSSEAIARYSRPQSCAEMMSSFVDLEFPLEGSEEEILHA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAAVDL+SSEEFLEL KSAL AALE L P SLFGLATFSHK+GLYDVQ
Sbjct  121  RPVYVAAVDLSSSEEFLELTKSALQAALEALAPESLFGLATFSHKLGLYDVQ  172



>ref|XP_004167882.1| PREDICTED: protein transport protein Sec24-like At3g07100-like, 
partial [Cucumis sativus]
Length=559

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 154/172 (90%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E +GLPWGV++TPFA+KDENG PP YGSD HLLPRCE+CWAY+
Sbjct  1    MAVRATVSRFPVDADAQENSGLPWGVSVTPFASKDENGRPPAYGSDAHLLPRCEHCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGS--EEMQA  363
            N+YC+ E WAWTCALCGTLNGL S+AIAR+S P+SCPE MSSFIDLELP EGS  E MQ+
Sbjct  61   NSYCDLEHWAWTCALCGTLNGLSSKAIARFSNPESCPEMMSSFIDLELPDEGSGGEAMQS  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAA+DL+SSEEFLEL KSALLAALE LGPGSLFGLATFSHK+GLYDVQ
Sbjct  121  RPVYVAAIDLSSSEEFLELTKSALLAALEALGPGSLFGLATFSHKLGLYDVQ  172



>ref|XP_010045202.1| PREDICTED: protein transport protein Sec24-like At3g07100 [Eucalyptus 
grandis]
 gb|KCW87363.1| hypothetical protein EUGRSUZ_B03845 [Eucalyptus grandis]
Length=743

 Score =   261 bits (667),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 152/171 (89%), Gaps = 1/171 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP DPDA E +GLPWG+T+TPFAAKDENGNPP YGS GHLLPRCENCWAY+
Sbjct  1    MAVRATVSRFPIDPDAQEGSGLPWGITVTPFAAKDENGNPPAYGSGGHLLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE-MQAR  366
            NTYCE +QWAW C+LCGTLNGLPS+ I +YS   S PE  SSFIDLELP EGSEE ++AR
Sbjct  61   NTYCELDQWAWNCSLCGTLNGLPSECIEKYSRSQSSPEMTSSFIDLELPAEGSEEPVEAR  120

Query  367  PVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            PVYVAAVDL+SSEEFLEL KSALLAALE LGPGSLFGLATFSHKIGLYDVQ
Sbjct  121  PVYVAAVDLSSSEEFLELTKSALLAALEALGPGSLFGLATFSHKIGLYDVQ  171



>gb|KJB21718.1| hypothetical protein B456_004G010100 [Gossypium raimondii]
Length=698

 Score =   259 bits (663),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 149/172 (87%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E  G+PWG+T+TPFAAKDENG  PVYGSDGHLLPRCENC+AY+
Sbjct  1    MAVRATVSRFPIDSDAQEACGIPWGLTVTPFAAKDENGQAPVYGSDGHLLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE +QWAW C+LCGTLNGL S+AIARYS P SC E MSSF+DLE PLEGSEE  + A
Sbjct  61   NTYCELDQWAWNCSLCGTLNGLSSEAIARYSRPQSCAEMMSSFVDLEFPLEGSEEEILHA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAAVDL+SSEEFLEL KSAL AALE L P SLFGLATFSHK+GLYDVQ
Sbjct  121  RPVYVAAVDLSSSEEFLELTKSALQAALEALAPESLFGLATFSHKLGLYDVQ  172



>gb|KJB21716.1| hypothetical protein B456_004G010100 [Gossypium raimondii]
Length=746

 Score =   260 bits (665),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 149/172 (87%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E  G+PWG+T+TPFAAKDENG  PVYGSDGHLLPRCENC+AY+
Sbjct  1    MAVRATVSRFPIDSDAQEACGIPWGLTVTPFAAKDENGQAPVYGSDGHLLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE +QWAW C+LCGTLNGL S+AIARYS P SC E MSSF+DLE PLEGSEE  + A
Sbjct  61   NTYCELDQWAWNCSLCGTLNGLSSEAIARYSRPQSCAEMMSSFVDLEFPLEGSEEEILHA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAAVDL+SSEEFLEL KSAL AALE L P SLFGLATFSHK+GLYDVQ
Sbjct  121  RPVYVAAVDLSSSEEFLELTKSALQAALEALAPESLFGLATFSHKLGLYDVQ  172



>gb|KHG08020.1| transport protein sec24-1 [Gossypium arboreum]
Length=746

 Score =   260 bits (665),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 148/172 (86%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V RFP D DA E  G+PWG+T+TPFAAKDENG  PVYGSDGHLLPRCENC+AY+
Sbjct  1    MAVRATVTRFPIDSDAQEACGIPWGLTVTPFAAKDENGQAPVYGSDGHLLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE +QWAW C+LCGTLNGL S+AIARYS P SC E MSSF+DLE PLEGSEE  + A
Sbjct  61   NTYCELDQWAWNCSLCGTLNGLSSEAIARYSRPQSCAEMMSSFVDLEFPLEGSEEEILHA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAAVDL+SSEEFLEL KSAL AALE L P SLFGLATFSHK+GLYDVQ
Sbjct  121  RPVYVAAVDLSSSEEFLELTKSALQAALEALAPESLFGLATFSHKLGLYDVQ  172



>ref|XP_004139490.1| PREDICTED: protein transport protein SEC24-1-like [Cucumis sativus]
Length=742

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 154/172 (90%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E +GLPWGV++TPFA+KDENG PP YGSD HLLPRCE+CWAY+
Sbjct  1    MAVRATVSRFPVDADAQENSGLPWGVSVTPFASKDENGRPPAYGSDAHLLPRCEHCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGS--EEMQA  363
            N+YC+ E WAWTCALCGTLNGL S+AIAR+S P+SCPE MSSFIDLELP EGS  E MQ+
Sbjct  61   NSYCDLEHWAWTCALCGTLNGLSSKAIARFSNPESCPEMMSSFIDLELPDEGSGAEAMQS  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAA+DL+SSEEFLEL KSALLAALE LGPGSLFGLATFSHK+GLYDVQ
Sbjct  121  RPVYVAAIDLSSSEEFLELTKSALLAALEALGPGSLFGLATFSHKLGLYDVQ  172



>ref|XP_008461390.1| PREDICTED: protein transport protein SEC24 [Cucumis melo]
Length=742

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 154/172 (90%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E +GLPWGV++TPFA+KDENG PP YGSD HLLPRCE+CWAY+
Sbjct  1    MAVRATVSRFPIDADAQENSGLPWGVSVTPFASKDENGRPPAYGSDAHLLPRCEHCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGS--EEMQA  363
            N+YC+ E WAWTCALCGTLNGL S+AIAR+S P+SCPE MSSFIDLELP EGS  E MQ+
Sbjct  61   NSYCDLEHWAWTCALCGTLNGLSSKAIARFSNPESCPEMMSSFIDLELPDEGSGGEAMQS  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAA+DL+SSEEFLEL KSALLAALE LGPGSLFGLATFSHK+GLYDVQ
Sbjct  121  RPVYVAAIDLSSSEEFLELTKSALLAALEALGPGSLFGLATFSHKLGLYDVQ  172



>ref|XP_009103601.1| PREDICTED: protein transport protein SEC24 isoform X2 [Brassica 
rapa]
Length=745

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 151/172 (88%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DALE +GLPWG+T+TPFAAKDENG  P  GS+GHLLPRCENC+AY+
Sbjct  1    MAVRATVSRFPIDSDALEASGLPWGLTVTPFAAKDENGIAPARGSNGHLLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE +QWAW C+LCGTLNGLPS AIARYS P S PE  SSFIDLELPL+GSEE   QA
Sbjct  61   NTYCELDQWAWNCSLCGTLNGLPSDAIARYSNPHSIPEMSSSFIDLELPLDGSEEEMTQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAA+DL+SSEEFLEL KS+LLAALE L PGSLFGLATFSHKIGLYDVQ
Sbjct  121  RPVYVAAIDLSSSEEFLELTKSSLLAALEALSPGSLFGLATFSHKIGLYDVQ  172



>ref|XP_009103600.1| PREDICTED: protein transport protein SEC24 isoform X1 [Brassica 
rapa]
Length=746

 Score =   258 bits (660),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 151/172 (88%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DALE +GLPWG+T+TPFAAKDENG  P  GS+GHLLPRCENC+AY+
Sbjct  1    MAVRATVSRFPIDSDALEASGLPWGLTVTPFAAKDENGIAPARGSNGHLLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE +QWAW C+LCGTLNGLPS AIARYS P S PE  SSFIDLELPL+GSEE   QA
Sbjct  61   NTYCELDQWAWNCSLCGTLNGLPSDAIARYSNPHSIPEMSSSFIDLELPLDGSEEEMTQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAA+DL+SSEEFLEL KS+LLAALE L PGSLFGLATFSHKIGLYDVQ
Sbjct  121  RPVYVAAIDLSSSEEFLELTKSSLLAALEALSPGSLFGLATFSHKIGLYDVQ  172



>emb|CDY04496.1| BnaA07g13220D [Brassica napus]
Length=745

 Score =   258 bits (660),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 151/172 (88%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DALE +GLPWG+T+TPFAAKDENG  P  GS+GHLLPRCENC+AY+
Sbjct  1    MAVRATVSRFPIDSDALEASGLPWGLTVTPFAAKDENGIAPARGSNGHLLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE +QWAW C+LCGTLNGLPS AIARYS P S PE  SSFIDLELPL+GSEE   QA
Sbjct  61   NTYCELDQWAWNCSLCGTLNGLPSDAIARYSNPHSIPEMSSSFIDLELPLDGSEEEMTQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAA+DL+SSEEFLEL KS+LLAALE L PGSLFGLATFSHKIGLYDVQ
Sbjct  121  RPVYVAAIDLSSSEEFLELTKSSLLAALEALSPGSLFGLATFSHKIGLYDVQ  172



>ref|XP_002313596.1| hypothetical protein POPTR_0009s16480g [Populus trichocarpa]
 gb|EEE87551.1| hypothetical protein POPTR_0009s16480g [Populus trichocarpa]
Length=744

 Score =   258 bits (659),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 150/172 (87%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP + D LE +GLPWGVT+TPFA+KDENG  PVYG DG LLPRCENC+AY+
Sbjct  1    MAVRATVSRFPKNEDELESSGLPWGVTVTPFASKDENGLSPVYGLDGDLLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE +QWAW C+LCGTLNGL SQAIARYS P SC E MSSFIDLEL +EGSEE  MQA
Sbjct  61   NTYCELDQWAWNCSLCGTLNGLTSQAIARYSHPRSCAETMSSFIDLELSMEGSEEEMMQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAAVDL+SSEEFLEL KSAL AALE L PGSLFGLATFSHK+GLYDVQ
Sbjct  121  RPVYVAAVDLSSSEEFLELTKSALQAALEALAPGSLFGLATFSHKMGLYDVQ  172



>ref|XP_010542559.1| PREDICTED: protein transport protein SEC24-like isoform X1 [Tarenaya 
hassleriana]
Length=746

 Score =   258 bits (659),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 153/172 (89%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAV+A+V+RFP D DA E +GLPWG+T+TPFAAKDENG  P YGS+GHLLPRCENC+AY+
Sbjct  1    MAVQATVSRFPFDADAQEASGLPWGLTVTPFAAKDENGVGPAYGSNGHLLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            N+YCE +QWAW C+LCGTLNGL S+AIARYSLP S PE +SSFIDLELPL+GSEE   QA
Sbjct  61   NSYCELDQWAWNCSLCGTLNGLSSEAIARYSLPQSSPEMISSFIDLELPLDGSEEEMTQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAA+DL+SSEEFLEL KSALLAALE L PG+LFGLATFSHKIGLYDVQ
Sbjct  121  RPVYVAAIDLSSSEEFLELTKSALLAALEALSPGALFGLATFSHKIGLYDVQ  172



>ref|XP_010542560.1| PREDICTED: protein transport protein SEC24-like isoform X2 [Tarenaya 
hassleriana]
Length=745

 Score =   258 bits (658),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 153/172 (89%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAV+A+V+RFP D DA E +GLPWG+T+TPFAAKDENG  P YGS+GHLLPRCENC+AY+
Sbjct  1    MAVQATVSRFPFDADAQEASGLPWGLTVTPFAAKDENGVGPAYGSNGHLLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            N+YCE +QWAW C+LCGTLNGL S+AIARYSLP S PE +SSFIDLELPL+GSEE   QA
Sbjct  61   NSYCELDQWAWNCSLCGTLNGLSSEAIARYSLPQSSPEMISSFIDLELPLDGSEEEMTQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAA+DL+SSEEFLEL KSALLAALE L PG+LFGLATFSHKIGLYDVQ
Sbjct  121  RPVYVAAIDLSSSEEFLELTKSALLAALEALSPGALFGLATFSHKIGLYDVQ  172



>emb|CDX71451.1| BnaC04g16860D [Brassica napus]
Length=745

 Score =   257 bits (657),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 151/172 (88%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DALE +GLPWG+T+TPFAA+DENG  P  GS+GHLLPRCENC+AY+
Sbjct  1    MAVRATVSRFPIDSDALEASGLPWGLTVTPFAAQDENGIAPARGSNGHLLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE +QWAW C+LCGTLNGLPS AIARYS P S PE  SSFIDLELPL+GSEE   QA
Sbjct  61   NTYCELDQWAWNCSLCGTLNGLPSDAIARYSNPHSIPEMSSSFIDLELPLDGSEEEMTQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAA+DL+SSEEFLEL KS+LLAALE L PGSLFGLATFSHKIGLYDVQ
Sbjct  121  RPVYVAAIDLSSSEEFLELTKSSLLAALEALSPGSLFGLATFSHKIGLYDVQ  172



>ref|XP_006293742.1| hypothetical protein CARUB_v10022704mg [Capsella rubella]
 gb|EOA26640.1| hypothetical protein CARUB_v10022704mg [Capsella rubella]
Length=745

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 150/172 (87%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E +GLPWG+T+TPFAAKDENG  P YGS+GHLLPRCENC+AY+
Sbjct  1    MAVRATVSRFPIDVDAQEASGLPWGLTVTPFAAKDENGIGPAYGSNGHLLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE +QWAW C+LCGTLNGLPS AIARYS P S PE  SSFIDLELPL+GSEE   QA
Sbjct  61   NTYCELDQWAWNCSLCGTLNGLPSDAIARYSNPQSIPEMTSSFIDLELPLDGSEEEMTQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAA+D++SSEEFLEL KS+LLAALE L PG+LFGL TFSHKIGLYDVQ
Sbjct  121  RPVYVAAIDISSSEEFLELTKSSLLAALEALSPGALFGLVTFSHKIGLYDVQ  172



>ref|XP_010510770.1| PREDICTED: protein transport protein sec24 [Camelina sativa]
Length=744

 Score =   256 bits (654),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 151/172 (88%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E +GLPWG+T+TPFAAKDENG  P YGS+GHLLPRCENC+AY+
Sbjct  1    MAVRATVSRFPIDVDAQEASGLPWGLTVTPFAAKDENGIGPAYGSNGHLLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE +QWAW+C+LCGTLNGLPS AIARYS P S PE  SSFIDLELPL+GSEE   QA
Sbjct  61   NTYCELDQWAWSCSLCGTLNGLPSDAIARYSNPQSIPEMSSSFIDLELPLDGSEEEMTQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAA+D++SSEEFLEL KSALLAALE L PG+LFGL TFSHKIGLYDVQ
Sbjct  121  RPVYVAAIDISSSEEFLELTKSALLAALEALSPGALFGLVTFSHKIGLYDVQ  172



>ref|XP_006487893.1| PREDICTED: protein transport protein Sec24-like At3g07100-like 
isoform X1 [Citrus sinensis]
Length=778

 Score =   256 bits (655),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 138/206 (67%), Positives = 151/206 (73%), Gaps = 36/206 (17%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP DPDA E +GLPWGVT+TPFA KDENG  PVYGSDGH+LPRCENC+AY+
Sbjct  1    MAVRATVSRFPSDPDAQEASGLPWGVTVTPFATKDENGAAPVYGSDGHMLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE EQWAWTC+LCG+LNGL SQAIARYS P SC E +SSFIDL+LPLEGSEE  MQA
Sbjct  61   NTYCELEQWAWTCSLCGSLNGLSSQAIARYSHPHSCAEMISSFIDLDLPLEGSEEETMQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgsl------------------------  471
            RPVYVAAVDL+SSEEFLEL +SAL AALEGL                             
Sbjct  121  RPVYVAAVDLSSSEEFLELTRSALQAALEGLQLLIQNDILISLLYELCLRSVDFSFIFFP  180

Query  472  ----------FGLATFSHKIGLYDVQ  519
                      FGLATFSHKIGLYDVQ
Sbjct  181  SFAAVPSGALFGLATFSHKIGLYDVQ  206



>ref|XP_010417884.1| PREDICTED: protein transport protein sec24-like [Camelina sativa]
Length=745

 Score =   255 bits (651),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 150/172 (87%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E +GLPWG+T+TPFAAKDENG  P YGS+GHLLPRCENC+AY+
Sbjct  1    MAVRATVSRFPIDVDAQEASGLPWGLTVTPFAAKDENGIGPAYGSNGHLLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE +QWAW+C+LCGTLNGLPS AIARYS P S PE  SSFIDLE PL+GSEE   QA
Sbjct  61   NTYCELDQWAWSCSLCGTLNGLPSDAIARYSNPQSIPEMSSSFIDLEFPLDGSEEEMTQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAA+D++SSEEFLEL KSALLAALE L PG+LFGL TFSHKIGLYDVQ
Sbjct  121  RPVYVAAIDISSSEEFLELTKSALLAALEALSPGALFGLVTFSHKIGLYDVQ  172



>emb|CDY30546.1| BnaA04g15870D [Brassica napus]
Length=746

 Score =   255 bits (651),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 137/173 (79%), Positives = 152/173 (88%), Gaps = 3/173 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+ +RFP D DALE +GLPWG+T+TPFAAKDE+G  P YGS+GHLLPRCENC+AY+
Sbjct  1    MAVRATASRFPIDSDALEASGLPWGLTVTPFAAKDESGIGPAYGSNGHLLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLP-DSCPENMSSFIDLELPLEGSEE--MQ  360
            NTYCE +QWAWTC+LCGTLNGL S AIARYS P DS PE  SSF+DLELPL+GSEE   Q
Sbjct  61   NTYCELDQWAWTCSLCGTLNGLSSDAIARYSYPHDSIPETSSSFVDLELPLDGSEEEMTQ  120

Query  361  ARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            ARPVYVAA+DL+SSEEFLEL KSALLAALE L PGSLFGLATFSHKIGLYDVQ
Sbjct  121  ARPVYVAAIDLSSSEEFLELTKSALLAALEALSPGSLFGLATFSHKIGLYDVQ  173



>ref|XP_006424227.1| hypothetical protein CICLE_v10027862mg [Citrus clementina]
 gb|ESR37467.1| hypothetical protein CICLE_v10027862mg [Citrus clementina]
Length=778

 Score =   256 bits (653),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 151/206 (73%), Gaps = 36/206 (17%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP DPDA E +GLPWGVT+TPFA KDENG  PVYGSDGH+LPRCENC+AY+
Sbjct  1    MAVRATVSRFPSDPDAQEASGLPWGVTVTPFATKDENGAAPVYGSDGHMLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE EQWAWTC+LCG+LNGL SQAIARY+ P SC E +SSFIDL+LPLEGSEE  MQA
Sbjct  61   NTYCELEQWAWTCSLCGSLNGLSSQAIARYTHPQSCAEMISSFIDLDLPLEGSEEETMQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgsl------------------------  471
            RPVYVAAVDL+SSEEFLEL +SAL AALEGL                             
Sbjct  121  RPVYVAAVDLSSSEEFLELTRSALQAALEGLQLLIQNDILISLLYELCLRSVDFSFIFFP  180

Query  472  ----------FGLATFSHKIGLYDVQ  519
                      FGLATFSHKIGLYDVQ
Sbjct  181  SFAAVPSGALFGLATFSHKIGLYDVQ  206



>ref|XP_011090338.1| PREDICTED: protein transport protein SEC24 [Sesamum indicum]
Length=750

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVR ++ RFPGDP   E  G+PWG+TLTPFAAKDENG PPVYGS G LLPRCENCWAYY
Sbjct  1    MAVRPTMARFPGDPREQEACGVPWGLTLTPFAAKDENGIPPVYGSGGELLPRCENCWAYY  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEEMQARP  369
            NTYCEQ+QW+W CALCGT NGL S +IARYSLP+SCPENMSSFIDLELPLE SEEMQARP
Sbjct  61   NTYCEQDQWSWDCALCGTTNGLSSGSIARYSLPESCPENMSSFIDLELPLEESEEMQARP  120

Query  370  VYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            VYVAAVDL+SSEEFLEL KSALLAALE LGPGSLFGLATFSHKIGLYDVQ
Sbjct  121  VYVAAVDLSSSEEFLELTKSALLAALEALGPGSLFGLATFSHKIGLYDVQ  170



>ref|XP_009140802.1| PREDICTED: protein transport protein SEC24-like [Brassica rapa]
Length=746

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/173 (79%), Positives = 151/173 (87%), Gaps = 3/173 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+ +RFP D DALE +GLPWG+T+TPFA+KDE G  P YGS+GHLLPRCENC+AY+
Sbjct  1    MAVRATASRFPIDSDALEASGLPWGLTVTPFASKDETGIGPAYGSNGHLLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLP-DSCPENMSSFIDLELPLEGSEE--MQ  360
            NTYCE +QWAWTC+LCGTLNGL S AIARYS P DS PE  SSF+DLELPL+GSEE   Q
Sbjct  61   NTYCELDQWAWTCSLCGTLNGLSSDAIARYSYPHDSIPETSSSFVDLELPLDGSEEEMTQ  120

Query  361  ARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            ARPVYVAA+DL+SSEEFLEL KSALLAALE L PGSLFGLATFSHKIGLYDVQ
Sbjct  121  ARPVYVAAIDLSSSEEFLELTKSALLAALEALSPGSLFGLATFSHKIGLYDVQ  173



>ref|XP_008360983.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein C4.03c 
[Malus domestica]
Length=453

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 147/171 (86%), Gaps = 1/171 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRASV+RFP D  A E +G+PWGV++TPFA KDENG  P YGSDG LLPRCENCWAY+
Sbjct  1    MAVRASVSRFPIDAGAHESSGIPWGVSVTPFATKDENGQXPAYGSDGQLLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE-MQAR  366
            NT+CE +QW+W CALCG   GL SQAIARYS P SCPE MSSF+DLELP+E S+E MQ R
Sbjct  61   NTFCELDQWSWNCALCGNPQGLSSQAIARYSHPQSCPEMMSSFVDLELPVEESDEVMQPR  120

Query  367  PVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            PVYVA +DL+SSEEFLEL+KSALLA+LE LGPGSLFGLATFSHK+GLYDVQ
Sbjct  121  PVYVAVIDLSSSEEFLELIKSALLASLEALGPGSLFGLATFSHKLGLYDVQ  171



>ref|XP_011043111.1| PREDICTED: protein transport protein SEC24 [Populus euphratica]
Length=744

 Score =   253 bits (647),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 149/172 (87%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP + D  E +GLPWGVT+TPFA+KDENG  PVYGSDG LLPRCENC+AY+
Sbjct  1    MAVRATVSRFPKNEDEQESSGLPWGVTVTPFASKDENGLSPVYGSDGDLLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE +QWAW C+LCGTLNGL SQAIARYS P SC E MSSFIDLEL +EGSEE  MQA
Sbjct  61   NTYCELDQWAWNCSLCGTLNGLTSQAIARYSHPRSCAETMSSFIDLELSMEGSEEEMMQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
             PVYVAAVDL+SSEEFLEL KSAL AALE L PGSLFGLATFSHK+GLYDVQ
Sbjct  121  CPVYVAAVDLSSSEEFLELTKSALQAALEALAPGSLFGLATFSHKMGLYDVQ  172



>ref|XP_010473124.1| PREDICTED: protein transport protein sec24-like [Camelina sativa]
Length=745

 Score =   253 bits (647),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 150/172 (87%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E +GLPWG+T+TPFAAKDENG  P YGS+GHLLPRCENC+AY+
Sbjct  1    MAVRATVSRFPIDIDAQEASGLPWGLTVTPFAAKDENGIGPAYGSNGHLLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE +QWAW+C+LCGTLNGLPS AIARYS P S PE  SSFIDLELPL+GSEE   QA
Sbjct  61   NTYCELDQWAWSCSLCGTLNGLPSDAIARYSNPQSIPEMSSSFIDLELPLDGSEEEMTQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAA+D++SSEEFLE  KSALLAALE L PG+LFGL TFSHKIGLYDVQ
Sbjct  121  RPVYVAAIDISSSEEFLEHTKSALLAALEALSPGALFGLVTFSHKIGLYDVQ  172



>ref|XP_010557420.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
Length=734

 Score =   252 bits (643),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 152/172 (88%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            M+VRA+V RFP D DA E AGLPWG+T+TPFA+KDENG  P YGS+GHLLPRCE+C+AY+
Sbjct  1    MSVRAAVTRFPIDADAQEAAGLPWGLTVTPFASKDENGVGPAYGSNGHLLPRCEHCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            N+YCE +QWAW C+LCGTLNGL S+AIARYS+P S PE +SSFIDLELPL+GSE+   QA
Sbjct  61   NSYCEVDQWAWNCSLCGTLNGLSSEAIARYSVPQSSPEMLSSFIDLELPLDGSEDEMTQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            +PVYVAA+DL+SSEEFLEL KSALLAALE L PG+LFGLATFSHKIGLYDVQ
Sbjct  121  QPVYVAAIDLSSSEEFLELTKSALLAALEALSPGALFGLATFSHKIGLYDVQ  172



>ref|XP_002879090.1| sec23/sec24 transport family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55349.1| sec23/sec24 transport family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=745

 Score =   252 bits (643),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 149/172 (87%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E +GLPWG+T+TPFAAKDEN   P YGS+GHLLPRCENC+AY+
Sbjct  1    MAVRATVSRFPIDADAQEASGLPWGLTVTPFAAKDENEVGPAYGSNGHLLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE +QWAW C+LCGTLNGLPS A+ARYS P S PE  SSFIDLE+PL+GSEE   QA
Sbjct  61   NTYCELDQWAWNCSLCGTLNGLPSDAVARYSNPQSIPEMTSSFIDLEMPLDGSEEEMTQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAA+D++SSEEFLEL KSALLAALE L PG+LFGL TFSHKIGLYDVQ
Sbjct  121  RPVYVAAIDISSSEEFLELTKSALLAALEALSPGALFGLVTFSHKIGLYDVQ  172



>ref|NP_565651.1| sec23/sec24 transport family protein [Arabidopsis thaliana]
 gb|AAD15598.1| expressed protein [Arabidopsis thaliana]
 gb|AAK96686.1| Unknown protein [Arabidopsis thaliana]
 gb|AAQ56782.1| At2g27460 [Arabidopsis thaliana]
 gb|AEC07999.1| sec23/sec24 transport family protein [Arabidopsis thaliana]
Length=745

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 149/172 (87%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E +GLPWG+T+TPFAAKDENG  P  GS+GHLLPRCENC+AY+
Sbjct  1    MAVRATVSRFPIDSDAQEASGLPWGLTVTPFAAKDENGIGPACGSNGHLLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE +QWAW C+LCGTLNGLPS AIARYS P S PE  SSFIDLE+PL+GSEE   QA
Sbjct  61   NTYCELDQWAWNCSLCGTLNGLPSDAIARYSNPHSIPEMTSSFIDLEMPLDGSEEEMTQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAA+D++SSEEFLEL KSALLAALE L PG+LFGL TFSHKIGLYDVQ
Sbjct  121  RPVYVAAIDISSSEEFLELTKSALLAALEALSPGALFGLVTFSHKIGLYDVQ  172



>emb|CDX77118.1| BnaC04g39130D [Brassica napus]
Length=746

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 153/173 (88%), Gaps = 3/173 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+ +RFP D DALE +GLPWG+T+TPFA+KDE+G  P YGS+GHLLPRCE+C+AY+
Sbjct  1    MAVRATASRFPIDSDALEASGLPWGLTVTPFASKDESGIGPAYGSNGHLLPRCEHCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLP-DSCPENMSSFIDLELPLEGSEE--MQ  360
            NTYCE +QWAWTC+LCGTLNGLPS AIARYS P DS PE  SSF+DLELPL+GSE+   Q
Sbjct  61   NTYCELDQWAWTCSLCGTLNGLPSDAIARYSYPHDSIPEMSSSFVDLELPLDGSEQEMTQ  120

Query  361  ARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            ARPVY+AA+DL+SSEEFLEL KSALLAALE L PGSLFGLATFSHKIGLYDVQ
Sbjct  121  ARPVYLAAIDLSSSEEFLELTKSALLAALEALSPGSLFGLATFSHKIGLYDVQ  173



>ref|XP_006384797.1| sec23/sec24 transport family protein [Populus trichocarpa]
 gb|ERP62594.1| sec23/sec24 transport family protein [Populus trichocarpa]
Length=744

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 150/172 (87%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+++RFP + D  E +GLPWG+T+TPFA+KDENG  PVYGS+G LLPRCENC+AY+
Sbjct  1    MAVRATMSRFPMEEDVQESSGLPWGITVTPFASKDENGLSPVYGSNGDLLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE +QWAW C+LCGTLNGL SQAIARYS P SC E MSSF+DLELP+EGS+E  MQA
Sbjct  61   NTYCELDQWAWNCSLCGTLNGLDSQAIARYSHPQSCAEMMSSFVDLELPMEGSDEEMMQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
             PVYVAAVDL+SSEEFLEL KSAL AALE L PGSLFGLATFSHK+GLYDVQ
Sbjct  121  CPVYVAAVDLSSSEEFLELTKSALQAALEALAPGSLFGLATFSHKMGLYDVQ  172



>ref|XP_002523817.1| expressed protein, putative [Ricinus communis]
 gb|EEF38543.1| expressed protein, putative [Ricinus communis]
Length=740

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 145/170 (85%), Gaps = 2/170 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E +GLPWGVT+TPFA KDENG  PVYGSDG  LPRCENC+ Y+
Sbjct  1    MAVRATVSRFPLDQDAQEASGLPWGVTVTPFAPKDENGQSPVYGSDGDSLPRCENCYGYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEEMQARP  369
            NTYCE +QWAW+CALCGTLNGL S+AIARYS P SC E MSSFIDLELP E  E MQA P
Sbjct  61   NTYCELDQWAWSCALCGTLNGLSSRAIARYSHPQSCAEMMSSFIDLELPNE--EMMQACP  118

Query  370  VYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            VYVAAVDL+SSEEFLEL KSAL AALE L PG+LFGLATFSHKIGLYDVQ
Sbjct  119  VYVAAVDLSSSEEFLELTKSALQAALEALAPGALFGLATFSHKIGLYDVQ  168



>ref|XP_009339600.1| PREDICTED: protein transport protein sec24-like [Pyrus x bretschneideri]
Length=746

 Score =   248 bits (633),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 147/171 (86%), Gaps = 1/171 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRASV+RFP D  A E +G+PWGV++TPFA KDENG  P YGSDG LLPRCENCWAY+
Sbjct  1    MAVRASVSRFPIDAGAHESSGIPWGVSVTPFATKDENGQSPAYGSDGQLLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE-MQAR  366
            NT+CE +QW+W CALCG   GL SQAIARYS P SCPE MSSF+DLELP+E S+E MQ R
Sbjct  61   NTFCELDQWSWNCALCGNPQGLSSQAIARYSHPQSCPEMMSSFVDLELPVEESDEVMQPR  120

Query  367  PVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            PVYVA +DL+SSEEFLEL+KSALLA+LE LGPGSLFGLATFSHK+GLYDVQ
Sbjct  121  PVYVAVIDLSSSEEFLELIKSALLASLEALGPGSLFGLATFSHKLGLYDVQ  171



>ref|XP_008228686.1| PREDICTED: protein transport protein SEC24 isoform X1 [Prunus 
mume]
 ref|XP_008228693.1| PREDICTED: protein transport protein SEC24 isoform X2 [Prunus 
mume]
Length=746

 Score =   248 bits (633),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 147/171 (86%), Gaps = 1/171 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D  A E +G+PWGV++TPFA KDENG  PVYGSDG LLPRCENCWAY+
Sbjct  1    MAVRATVSRFPIDAGAHESSGIPWGVSVTPFATKDENGQSPVYGSDGELLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE-MQAR  366
            NTYCE +QW+W CALCG   GL SQAIARYS P SCPE MSSF+DLELP+E S+E MQ R
Sbjct  61   NTYCELDQWSWNCALCGNPQGLSSQAIARYSHPQSCPEMMSSFVDLELPVEESDEAMQPR  120

Query  367  PVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            PVYVAA+DL+SSEEFLEL KSALLA+LE L PGSLFGLATFSHK+GLYDVQ
Sbjct  121  PVYVAAIDLSSSEEFLELTKSALLASLEALAPGSLFGLATFSHKLGLYDVQ  171



>ref|XP_009346558.1| PREDICTED: protein transport protein sec24-like [Pyrus x bretschneideri]
Length=746

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 147/171 (86%), Gaps = 1/171 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRASV+RFP D  A E +G+PWGV++TPFA KDENG  P YGSDG LLPRCENCWAY+
Sbjct  1    MAVRASVSRFPIDAGAHESSGIPWGVSVTPFATKDENGQSPAYGSDGQLLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE-MQAR  366
            NT+CE +QW+W CALCG   GL SQAIARYS P SCPE MSSF+DLELP+E S+E MQ R
Sbjct  61   NTFCELDQWSWNCALCGNPQGLSSQAIARYSHPQSCPEMMSSFVDLELPVEESDEVMQPR  120

Query  367  PVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            PVYVA +DL+SSEEFLEL+KSALLA+LE LGPGSLFGLATFSHK+GLYDVQ
Sbjct  121  PVYVAVIDLSSSEEFLELIKSALLASLEALGPGSLFGLATFSHKLGLYDVQ  171



>ref|XP_010685999.1| PREDICTED: protein transport protein sec24 [Beta vulgaris subsp. 
vulgaris]
Length=745

 Score =   248 bits (632),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 148/172 (86%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRAS+ RFP +PD  E +GLPWG+T+TPF+ KDENGNPP+ GSDG  LPRCENCWAY+
Sbjct  1    MAVRASLTRFPINPDEQESSGLPWGITVTPFSRKDENGNPPLMGSDGENLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            N+YCE +QWAWTC+LCGTLNGL + +IA+YS P SCPE  SSFIDL+LPLEG E+  MQA
Sbjct  61   NSYCELDQWAWTCSLCGTLNGLSAHSIAKYSHPQSCPEMSSSFIDLQLPLEGYEDESMQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAAVDL+SSEEFL+L+KSALLAALE L  G+LFGLA FS K+GLYDVQ
Sbjct  121  RPVYVAAVDLSSSEEFLDLIKSALLAALEALPVGALFGLAVFSVKLGLYDVQ  172



>ref|XP_007208430.1| hypothetical protein PRUPE_ppa001892mg [Prunus persica]
 gb|EMJ09629.1| hypothetical protein PRUPE_ppa001892mg [Prunus persica]
Length=746

 Score =   246 bits (629),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 147/171 (86%), Gaps = 1/171 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D  A E +G+PWGV++TPFA KDENG  PVYGSDG LLPRCENCWAY+
Sbjct  1    MAVRATVSRFPIDAGAHESSGIPWGVSVTPFATKDENGQSPVYGSDGELLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE-MQAR  366
            NTYCE +QW+W CALCG   GL SQAIARYS P+SCPE MSSF+DLELP+E S+E MQ R
Sbjct  61   NTYCELDQWSWNCALCGNPQGLSSQAIARYSHPESCPEMMSSFVDLELPVEESDEAMQPR  120

Query  367  PVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            PVYVAA+DL+SSEEFLEL KSALLA+LE L PGSLFGLA FSHK+GLYDVQ
Sbjct  121  PVYVAAIDLSSSEEFLELTKSALLASLEALAPGSLFGLAAFSHKLGLYDVQ  171



>ref|XP_006409731.1| hypothetical protein EUTSA_v10016271mg [Eutrema salsugineum]
 gb|ESQ51184.1| hypothetical protein EUTSA_v10016271mg [Eutrema salsugineum]
Length=793

 Score =   246 bits (627),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 151/172 (88%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E +GLPWG+T+TPFAAKDE+G  P YGS+GHLLPRCENC+AY+
Sbjct  49   MAVRATVSRFPIDSDAQEASGLPWGLTVTPFAAKDESGIGPAYGSNGHLLPRCENCYAYF  108

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE +QWAW C+LCGTLNGLPS AIARYS P S PE  SSFIDLELPL+GSEE   QA
Sbjct  109  NTYCELDQWAWNCSLCGTLNGLPSDAIARYSNPQSIPEMTSSFIDLELPLDGSEEEMTQA  168

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAA+D++SSEEFLEL KSALLAALE L PGSLFGLATFSHKIGLYDVQ
Sbjct  169  RPVYVAAIDISSSEEFLELAKSALLAALEALSPGSLFGLATFSHKIGLYDVQ  220



>ref|XP_010089815.1| Protein transport protein SEC24-1 [Morus notabilis]
 gb|EXB38431.1| Protein transport protein SEC24-1 [Morus notabilis]
Length=744

 Score =   244 bits (624),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 148/171 (87%), Gaps = 1/171 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E +GLPWGVT+TPFAAKDE G  P YG+DGHLLPRCENCWAY+
Sbjct  1    MAVRATVSRFPIDSDAQESSGLPWGVTVTPFAAKDEEGRSPAYGTDGHLLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE-MQAR  366
            +T+C+ +QW+WTC LC  LNG  S+AIARYS P+SCPE  SSF+DLELP E S+E MQ +
Sbjct  61   STFCDLDQWSWTCCLCSQLNGFSSKAIARYSHPESCPEMTSSFVDLELPEERSDEGMQPQ  120

Query  367  PVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            PVYVAA+DL+SSEEFLEL KSALLAALE LGPGSLFGLATFSHK+GLYDVQ
Sbjct  121  PVYVAAIDLSSSEEFLELTKSALLAALEALGPGSLFGLATFSHKLGLYDVQ  171



>gb|KFK36699.1| hypothetical protein AALP_AA4G157700 [Arabis alpina]
Length=742

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 146/171 (85%), Gaps = 3/171 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVR++V+RFP D DA E +GLPWGVT+TPF+AKDENG  PVYGS+GHLLPRCENC+AY+
Sbjct  1    MAVRSTVSRFPIDSDAQEASGLPWGVTVTPFSAKDENGIEPVYGSNGHLLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEEM-QAR  366
            NTY + +QWAW C+LCGTLNGL S +IARYS P S PE  SSFIDLELPLE  EEM QA 
Sbjct  61   NTYGQLDQWAWNCSLCGTLNGLSSDSIARYSNPHSIPEMSSSFIDLELPLE--EEMTQAN  118

Query  367  PVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            PVYVAA+DL+SSEEFLEL KSAL AALE L PGSLFGL TFSHKIGLYDVQ
Sbjct  119  PVYVAAIDLSSSEEFLELTKSALQAALEALSPGSLFGLVTFSHKIGLYDVQ  169



>ref|XP_008351295.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein C4.03c-like 
[Malus domestica]
Length=520

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 144/171 (84%), Gaps = 1/171 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRASV+RFP D  A E +G+PWGV++TPFA  DE+ + P YGSDG LLPRCENCWAY+
Sbjct  1    MAVRASVSRFPIDARAHESSGIPWGVSVTPFATXDESSHSPAYGSDGQLLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE-MQAR  366
            NTYCE +QW+W CALCG   GL SQ IARYS P+SCPE MSSF+DLELP E S+E MQ R
Sbjct  61   NTYCELDQWSWNCALCGNPQGLSSQTIARYSHPESCPETMSSFVDLELPAEESDEAMQPR  120

Query  367  PVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            PVYVAA+DL+SSEEFLEL KSALLA+LE LGPGSLFGLATFSHK+GL DVQ
Sbjct  121  PVYVAAIDLSSSEEFLELTKSALLASLEALGPGSLFGLATFSHKLGLCDVQ  171



>ref|XP_004291596.2| PREDICTED: protein transport protein Sec24-like At3g07100 [Fragaria 
vesca subsp. vesca]
Length=772

 Score =   242 bits (617),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 146/172 (85%), Gaps = 1/172 (1%)
 Frame = +1

Query  7    AMAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAY  186
             MAVRA+V+RFP D  A E +G+PWG+T+TPFA KDENG  P YGS G LLPRCENCWAY
Sbjct  28   TMAVRATVSRFPIDAGAHENSGIPWGLTVTPFATKDENGQAPAYGSGGQLLPRCENCWAY  87

Query  187  YNTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE-MQA  363
            +NTYCE +QW+W CALCG   GL S+AIARYS P SCPE MSSF+DLELP+E S+E MQ 
Sbjct  88   FNTYCELDQWSWNCALCGNPQGLSSEAIARYSQPQSCPEMMSSFVDLELPVEESDEAMQP  147

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAA+DL+SS+EFLEL KSALLAALE LGPGSLFGLATFSHK+GLYDVQ
Sbjct  148  RPVYVAAIDLSSSDEFLELTKSALLAALEALGPGSLFGLATFSHKLGLYDVQ  199



>ref|XP_009404358.1| PREDICTED: protein transport protein sec24-like [Musa acuminata 
subsp. malaccensis]
Length=740

 Score =   239 bits (609),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 145/172 (84%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRASV  FP D +ALE  G+PWG+ +TPF+A DE GN P  GS+GHLLPRC+NCWAY+
Sbjct  1    MAVRASVACFPVDSEALETCGIPWGIAVTPFSAVDERGNLPARGSEGHLLPRCDNCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE +QW W+CA+CG+LNGL S A++RYS P+SCP+  SSF+DLE+P +GSEE   QA
Sbjct  61   NTYCELDQWTWSCAICGSLNGLTSHAVSRYSQPESCPDLSSSFVDLEIPGDGSEEGMTQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAAVDL SSEEFLELVKSALLAALE L PGSLFGL TFSHKIGLYDVQ
Sbjct  121  RPVYVAAVDLCSSEEFLELVKSALLAALEALAPGSLFGLVTFSHKIGLYDVQ  172



>ref|XP_008787674.1| PREDICTED: protein transport protein sec24-like [Phoenix dactylifera]
Length=743

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 146/172 (85%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA ++RFP D +A E  G+PW +T+TPFAA DE+GNP  YGSDGHLLPRCENCW Y+
Sbjct  1    MAVRACLSRFPVDAEAQESCGIPWALTVTPFAAVDEHGNPAAYGSDGHLLPRCENCWGYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEG--SEEMQA  363
            N++CE + W+W+CALCG+LNGL S+AI RYS P +C E  SSFIDLE+P+EG  S+ +QA
Sbjct  61   NSHCELDHWSWSCALCGSLNGLTSEAIDRYSQPQACAEMRSSFIDLEIPVEGSASDALQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAAVDL+SSEEFLEL+KSALLAALE L PGSLFGL TFSHKIGLYDVQ
Sbjct  121  RPVYVAAVDLSSSEEFLELIKSALLAALEALSPGSLFGLVTFSHKIGLYDVQ  172



>ref|XP_009411948.1| PREDICTED: protein transport protein SEC23-like [Musa acuminata 
subsp. malaccensis]
Length=742

 Score =   237 bits (604),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 142/172 (83%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DALE +GLPWG T+TPFA  DE G  P+YGS GHLLPRC+NCWAY 
Sbjct  1    MAVRATVSRFPVDADALESSGLPWGATVTPFAPADERGAVPIYGSGGHLLPRCDNCWAYL  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGS--EEMQA  363
            +T CE E+W WTCALCG+ NGL S  + RY+ P  CPE  SSFIDLE+P+EGS   E+QA
Sbjct  61   STLCELERWGWTCALCGSFNGLDSATLDRYARPHDCPELSSSFIDLEIPVEGSGEAEIQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAAVDL+SSEEFLELVKS+LLAALE L PGSLFGL TFSHK+G+YDVQ
Sbjct  121  RPVYVAAVDLSSSEEFLELVKSSLLAALEALVPGSLFGLVTFSHKVGIYDVQ  172



>ref|XP_004517293.1| PREDICTED: protein transport protein SEC24-like isoform X3 [Cicer 
arietinum]
Length=745

 Score =   236 bits (602),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 144/172 (84%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E +GL WGVT+TPFAA DENG  P YGS G LLPRCENCWAY+
Sbjct  1    MAVRATVSRFPIDTDAREGSGLLWGVTVTPFAASDENGQSPAYGSGGDLLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE--MQA  363
            NTYCE EQW+W+C+LCG LNGL S AI RYS P SC E MSSF+DLELP + S+E  ++A
Sbjct  61   NTYCELEQWSWSCSLCGNLNGLSSDAIERYSRPQSCAEMMSSFVDLELPPQESDEAALEA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
             PVYVAA+DL+SSEEFLEL KSALLAALE L PGSLFGLATFSHK+GLYDVQ
Sbjct  121  CPVYVAAIDLSSSEEFLELTKSALLAALEALAPGSLFGLATFSHKLGLYDVQ  172



>ref|XP_004506195.1| PREDICTED: protein transport protein SEC24-like [Cicer arietinum]
Length=605

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 144/173 (83%), Gaps = 3/173 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E +GL WGVT+TPFAA DENG  P YGS G LLPRCENCWAY+
Sbjct  1    MAVRATVSRFPIDTDAREGSGLLWGVTVTPFAASDENGQSPAYGSGGDLLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLEL-PLEGSEE--MQ  360
            NTYCE EQW+W+C+LCG LNGL S AI RYS P SC E MSSF+DLEL P E S+E  ++
Sbjct  61   NTYCELEQWSWSCSLCGNLNGLSSDAIERYSRPQSCAEMMSSFVDLELPPQEESDEAALE  120

Query  361  ARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            A PVYVAA+DL+SSEEFLEL KSALLAALE L PGSLFGLATFSHK+GLYDVQ
Sbjct  121  ACPVYVAAIDLSSSEEFLELTKSALLAALEALAPGSLFGLATFSHKLGLYDVQ  173



>ref|XP_003539835.1| PREDICTED: protein transport protein Sec24-like At3g07100-like 
[Glycine max]
Length=747

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 143/173 (83%), Gaps = 3/173 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVR++V+RFP D DA E +GL WGVT+TPFAA DEN   P YGS G LLPRCENCWAY+
Sbjct  1    MAVRSTVSRFPMDTDAREGSGLLWGVTVTPFAATDENTRAPSYGSGGDLLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE---MQ  360
            NTYCE EQW+W+C+LCG LNGL S AI RYS P SC E MSSF+DLELP + S E   MQ
Sbjct  61   NTYCELEQWSWSCSLCGNLNGLSSDAIDRYSRPQSCAEMMSSFVDLELPSQESAEVAAMQ  120

Query  361  ARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            A PVYVAAVDL+SSEEFLEL+KSALLAALE L PGSLFGLATFSHK+GLYDVQ
Sbjct  121  ACPVYVAAVDLSSSEEFLELIKSALLAALEALAPGSLFGLATFSHKLGLYDVQ  173



>ref|XP_010927800.1| PREDICTED: protein transport protein sec24-like [Elaeis guineensis]
 ref|XP_010927801.1| PREDICTED: protein transport protein sec24-like [Elaeis guineensis]
Length=737

 Score =   234 bits (597),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVR +++RFP D +A E   LPWGVTLTPF+  DE+G  P YGSDGHLLPRCENCW Y+
Sbjct  1    MAVRPTLSRFPIDAEAQESCALPWGVTLTPFSLGDEHGVAPAYGSDGHLLPRCENCWGYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEEMQARP  369
            NTYCE EQWAWTCALCG+LN L  QAI RYS  ++C E  SSFIDLELP+EGS E +ARP
Sbjct  61   NTYCELEQWAWTCALCGSLNYLSVQAIERYSQSETCAEMCSSFIDLELPVEGSGE-EARP  119

Query  370  VYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            VYVAAVDLA SEEFLELVKSALLAALE LGPGSLFGL TFSHKIGLYDVQ
Sbjct  120  VYVAAVDLACSEEFLELVKSALLAALEALGPGSLFGLVTFSHKIGLYDVQ  169



>gb|KEH29852.1| Sec23/Sec24 transport family protein [Medicago truncatula]
Length=745

 Score =   234 bits (597),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 142/174 (82%), Gaps = 4/174 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E +GL WGVT+ PFAA DEN   PVYGS G LLPRCENCWAY+
Sbjct  1    MAVRATVSRFPLDTDAREASGLLWGVTVAPFAAVDENNQSPVYGSSGELLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLE----GSEEM  357
            NTYC+ EQW+W C+LCG LNGL S+AI RYS P SC E MSSF+DLELP E    G+  +
Sbjct  61   NTYCDLEQWSWGCSLCGNLNGLTSEAIERYSRPQSCAEMMSSFVDLELPQEEESSGNAAL  120

Query  358  QARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            QA PVYVAAVDL+SSEEFLEL KSALLAALE L PGSLFGLATFSHK+GLYDVQ
Sbjct  121  QACPVYVAAVDLSSSEEFLELTKSALLAALEALAPGSLFGLATFSHKLGLYDVQ  174



>ref|XP_010931128.1| PREDICTED: protein transport protein SEC24-like isoform X2 [Elaeis 
guineensis]
Length=709

 Score =   233 bits (595),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 145/172 (84%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVR  ++RFP D +A E  G+PW +T+TPF+A DE+G PP  GSDGHLLPRCENCWAY+
Sbjct  1    MAVRTCLSRFPADAEAQESCGIPWALTVTPFSAVDEHGKPPECGSDGHLLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGS--EEMQA  363
            NT+CE + W+W+CALCG+LNGL S+A+ RYS P +C E  S+FIDLE+P+EGS  + M+A
Sbjct  61   NTHCELDHWSWSCALCGSLNGLTSEAVDRYSQPQACAELRSAFIDLEIPVEGSAGDAMRA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAAVDL+SSEEFLEL+KSALLAALE L PGSLFGL TFSHKIGLYDVQ
Sbjct  121  RPVYVAAVDLSSSEEFLELIKSALLAALEALSPGSLFGLVTFSHKIGLYDVQ  172



>ref|XP_007132444.1| hypothetical protein PHAVU_011G094800g [Phaseolus vulgaris]
 gb|ESW04438.1| hypothetical protein PHAVU_011G094800g [Phaseolus vulgaris]
Length=745

 Score =   234 bits (596),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 141/173 (82%), Gaps = 3/173 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E +GL WGVT+TPFAA DEN   P YGS G LLPRCENCWAY+
Sbjct  1    MAVRATVSRFPMDTDAREASGLLWGVTVTPFAAADENNRAPSYGSGGDLLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE---MQ  360
            NTYCE EQW+W+C+LCG LNGL S AI RYS P SC E MSSF+DLELP + S E   M 
Sbjct  61   NTYCELEQWSWSCSLCGNLNGLSSDAIERYSSPQSCAEMMSSFVDLELPTQESAEEAAML  120

Query  361  ARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            A PVYVAAVDL+SSEEFLEL KSALLAALE L PGSLFGLATFSHK+GLYDVQ
Sbjct  121  ACPVYVAAVDLSSSEEFLELTKSALLAALEALAPGSLFGLATFSHKLGLYDVQ  173



>ref|XP_010931127.1| PREDICTED: protein transport protein SEC24-like isoform X1 [Elaeis 
guineensis]
Length=743

 Score =   234 bits (596),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 145/172 (84%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVR  ++RFP D +A E  G+PW +T+TPF+A DE+G PP  GSDGHLLPRCENCWAY+
Sbjct  1    MAVRTCLSRFPADAEAQESCGIPWALTVTPFSAVDEHGKPPECGSDGHLLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGS--EEMQA  363
            NT+CE + W+W+CALCG+LNGL S+A+ RYS P +C E  S+FIDLE+P+EGS  + M+A
Sbjct  61   NTHCELDHWSWSCALCGSLNGLTSEAVDRYSQPQACAELRSAFIDLEIPVEGSAGDAMRA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAAVDL+SSEEFLEL+KSALLAALE L PGSLFGL TFSHKIGLYDVQ
Sbjct  121  RPVYVAAVDLSSSEEFLELIKSALLAALEALSPGSLFGLVTFSHKIGLYDVQ  172



>ref|XP_004517291.1| PREDICTED: protein transport protein SEC24-like isoform X1 [Cicer 
arietinum]
Length=746

 Score =   233 bits (595),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 144/173 (83%), Gaps = 3/173 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E +GL WGVT+TPFAA DENG  P YGS G LLPRCENCWAY+
Sbjct  1    MAVRATVSRFPIDTDAREGSGLLWGVTVTPFAASDENGQSPAYGSGGDLLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLEL-PLEGSEE--MQ  360
            NTYCE EQW+W+C+LCG LNGL S AI RYS P SC E MSSF+DLEL P E S+E  ++
Sbjct  61   NTYCELEQWSWSCSLCGNLNGLSSDAIERYSRPQSCAEMMSSFVDLELPPQEESDEAALE  120

Query  361  ARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            A PVYVAA+DL+SSEEFLEL KSALLAALE L PGSLFGLATFSHK+GLYDVQ
Sbjct  121  ACPVYVAAIDLSSSEEFLELTKSALLAALEALAPGSLFGLATFSHKLGLYDVQ  173



>ref|XP_008788954.1| PREDICTED: protein transport protein Sec24-like At3g07100 [Phoenix 
dactylifera]
 ref|XP_008788955.1| PREDICTED: protein transport protein Sec24-like At3g07100 [Phoenix 
dactylifera]
Length=737

 Score =   233 bits (594),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 140/170 (82%), Gaps = 1/170 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MA R +++RFP D D  E  GLPWGVTLTPF++ DE G  P YGSDGHLLPRCENCWAY+
Sbjct  1    MAARPTLSRFPIDADTQESCGLPWGVTLTPFSSVDEQGVAPAYGSDGHLLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEEMQARP  369
            NTYCE EQWAWTCALCG+LN L  Q I RYS  ++C E  SSFIDLELP+EG  E ++RP
Sbjct  61   NTYCELEQWAWTCALCGSLNYLTMQVIERYSQSEACAEMCSSFIDLELPVEGYRE-ESRP  119

Query  370  VYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            VYVAAVDLA SEEFLELVKSALLAALE LGPGSLFGL TFSHKIGLYDVQ
Sbjct  120  VYVAAVDLACSEEFLELVKSALLAALEALGPGSLFGLVTFSHKIGLYDVQ  169



>ref|XP_004517292.1| PREDICTED: protein transport protein SEC24-like isoform X2 [Cicer 
arietinum]
Length=745

 Score =   233 bits (595),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 144/173 (83%), Gaps = 3/173 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E +GL WGVT+TPFAA DENG  P YGS G LLPRCENCWAY+
Sbjct  1    MAVRATVSRFPIDTDAREGSGLLWGVTVTPFAASDENGQSPAYGSGGDLLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLEL-PLEGSEE--MQ  360
            NTYCE EQW+W+C+LCG LNGL S AI RYS P SC E MSSF+DLEL P E S+E  ++
Sbjct  61   NTYCELEQWSWSCSLCGNLNGLSSDAIERYSRPQSCAEMMSSFVDLELPPQEESDEAALE  120

Query  361  ARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            A PVYVAA+DL+SSEEFLEL KSALLAALE L PGSLFGLATFSHK+GLYDVQ
Sbjct  121  ACPVYVAAIDLSSSEEFLELTKSALLAALEALAPGSLFGLATFSHKLGLYDVQ  173



>ref|XP_009342740.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103934714 
[Pyrus x bretschneideri]
Length=673

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 140/171 (82%), Gaps = 1/171 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRASV+ FP D  A E +G+PWGV +TPFA KDENG+ P YGSDG LLPRCENCWAY+
Sbjct  1    MAVRASVSLFPIDAGAHESSGIPWGVLVTPFATKDENGHSPAYGSDGQLLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE-MQAR  366
            NTYCE +QW+W  ALCG   GL SQAIARYS P+SCPE MSSF+DLELP E S+E MQ R
Sbjct  61   NTYCELDQWSWNXALCGNPQGLSSQAIARYSHPESCPETMSSFVDLELPGEESDEAMQPR  120

Query  367  PVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            PVYVAA+DL+   EFLEL KSALLA+L  LGPGSLFGLATFSHK+G YDVQ
Sbjct  121  PVYVAAIDLSCKREFLELTKSALLASLXALGPGSLFGLATFSHKLGXYDVQ  171



>gb|KHN21153.1| Protein transport protein SEC24-1 [Glycine soja]
Length=747

 Score =   232 bits (591),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 142/173 (82%), Gaps = 3/173 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVR++V+RFP D DA E +GL WGVT+T FAA DEN   P YGS G LLPRCENCWAY+
Sbjct  1    MAVRSTVSRFPMDTDAREGSGLLWGVTVTSFAATDENTRAPSYGSGGDLLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE---MQ  360
            NTYCE EQW+W+C+LCG LNGL S AI RYS P SC E MSSF+DLELP + S E   MQ
Sbjct  61   NTYCELEQWSWSCSLCGNLNGLSSDAIDRYSRPQSCAEMMSSFVDLELPSQESAEVAAMQ  120

Query  361  ARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            A PVYVAAVDL+SSEEFLEL+KSALLAALE L PGSLFGLATFSHK+GLYDVQ
Sbjct  121  ACPVYVAAVDLSSSEEFLELIKSALLAALEALAPGSLFGLATFSHKLGLYDVQ  173



>ref|XP_003538113.1| PREDICTED: protein transport protein Sec24-like At3g07100-like 
isoform X1 [Glycine max]
Length=747

 Score =   232 bits (591),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 143/173 (83%), Gaps = 3/173 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E +GL WGVT+TPF+A DEN   P YGS G LLPRCENCWAY+
Sbjct  1    MAVRATVSRFPMDTDAREGSGLLWGVTVTPFSAADENARAPSYGSGGDLLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELP-LEGSEE--MQ  360
            NTYCE EQW+W+C+LCG LNGL S AI RYS P SC E MSSF+DLELP  E +EE  MQ
Sbjct  61   NTYCELEQWSWSCSLCGNLNGLSSDAIDRYSRPQSCAEMMSSFVDLELPSQELAEEAAMQ  120

Query  361  ARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            A PVYVAAVDL+SSEEFLEL KSALLAALE L PGSLFGLATFSHK+GLYDVQ
Sbjct  121  ACPVYVAAVDLSSSEEFLELTKSALLAALEALAPGSLFGLATFSHKLGLYDVQ  173



>ref|XP_006591072.1| PREDICTED: protein transport protein Sec24-like At3g07100-like 
isoform X2 [Glycine max]
Length=746

 Score =   232 bits (591),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 143/173 (83%), Gaps = 3/173 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E +GL WGVT+TPF+A DEN   P YGS G LLPRCENCWAY+
Sbjct  1    MAVRATVSRFPMDTDAREGSGLLWGVTVTPFSAADENARAPSYGSGGDLLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELP-LEGSEE--MQ  360
            NTYCE EQW+W+C+LCG LNGL S AI RYS P SC E MSSF+DLELP  E +EE  MQ
Sbjct  61   NTYCELEQWSWSCSLCGNLNGLSSDAIDRYSRPQSCAEMMSSFVDLELPSQELAEEAAMQ  120

Query  361  ARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            A PVYVAAVDL+SSEEFLEL KSALLAALE L PGSLFGLATFSHK+GLYDVQ
Sbjct  121  ACPVYVAAVDLSSSEEFLELTKSALLAALEALAPGSLFGLATFSHKLGLYDVQ  173



>gb|EPS61152.1| hypothetical protein M569_13647, partial [Genlisea aurea]
Length=574

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +1

Query  82   GVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYNTYCEQEQWAWTCALCGTLNGLPS  261
            G+TLTPFA+KDENG PPVYGS G  LPRCENCW YY+TYCEQ+QW+W CALCGT NGL +
Sbjct  1    GMTLTPFASKDENGVPPVYGSGGESLPRCENCWGYYSTYCEQDQWSWDCALCGTTNGLSA  60

Query  262  QAIARYSLPDSCPENMSSFIDLELPLEGSEEMQARPVYVAAVDLASSEEFLELVKSalla  441
             +I RYS P+SCPENMSSFIDLELPLEGS+ MQA PVYVAAVDL+SSEEFLEL K +LLA
Sbjct  61   DSIDRYSRPESCPENMSSFIDLELPLEGSDVMQANPVYVAAVDLSSSEEFLELTKISLLA  120

Query  442  aleglgpgslFGLATFSHKIGLYDVQ  519
            ALE LGPGSLFGLATFSHKIGLYDVQ
Sbjct  121  ALEALGPGSLFGLATFSHKIGLYDVQ  146



>ref|XP_006855085.1| hypothetical protein AMTR_s00031p00165880 [Amborella trichopoda]
 gb|ERN16552.1| hypothetical protein AMTR_s00031p00165880 [Amborella trichopoda]
Length=743

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 140/172 (81%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRAS++RFP D + LE  G+PWG++LTPF+  DE G+ P YG D HLLPRCENCWAY+
Sbjct  1    MAVRASISRFPLDTEVLEGGGVPWGISLTPFSPTDELGHKPAYGRDAHLLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELP--LEGSEEMQA  363
            ++ CE +QWAW C LCGTLNGL SQ I R + P+SCPE  SSF+DLELP  +   EE QA
Sbjct  61   SSLCELDQWAWNCVLCGTLNGLSSQCITRLAHPESCPELSSSFVDLELPDDVPPEEEGQA  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            RPVYVAA+DL++SEEFLELVKS LLAALE LGPGSLFGL TFSHKIGLYDVQ
Sbjct  121  RPVYVAAIDLSASEEFLELVKSGLLAALEALGPGSLFGLITFSHKIGLYDVQ  172



>gb|KHN38627.1| Protein transport protein Sec24-like [Glycine soja]
Length=747

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 141/173 (82%), Gaps = 3/173 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E +GL WGVT+T FAA  EN     YGSDG LLPRCENCWAY+
Sbjct  1    MAVRATVSRFPMDTDAREGSGLLWGVTVTSFAATGENTRALSYGSDGDLLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELP-LEGSEE--MQ  360
            NTYCE EQW+W+C+LCG LNGL S AI RYS P SC E MSSF+DLELP  E +EE  MQ
Sbjct  61   NTYCELEQWSWSCSLCGNLNGLSSDAIDRYSRPQSCAEMMSSFVDLELPSQELAEEAAMQ  120

Query  361  ARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            A PVYVAAVDL+SSEEFLEL KSALLAALE L PGSLFGLATFSHK+GLYDVQ
Sbjct  121  ACPVYVAAVDLSSSEEFLELTKSALLAALEALAPGSLFGLATFSHKLGLYDVQ  173



>ref|XP_010042360.1| PREDICTED: uncharacterized protein C4.03c-like [Eucalyptus grandis]
Length=135

 Score =   210 bits (534),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 113/130 (87%), Gaps = 1/130 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP DPDA E +GLPWG+T+TPFAAKDENGNPP YGS GHLLPRCENCWAY+
Sbjct  1    MAVRATVSRFPIDPDAQEGSGLPWGITVTPFAAKDENGNPPAYGSGGHLLPRCENCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE-MQAR  366
            NTYCE +QWAW C+LCGTLNGLPS+ I +YS   S PE  SSFIDLELP EGSEE ++AR
Sbjct  61   NTYCELDQWAWNCSLCGTLNGLPSECIEKYSRSQSSPEMTSSFIDLELPAEGSEEPVEAR  120

Query  367  PVYVAAVDLA  396
            PVYVAAVDL+
Sbjct  121  PVYVAAVDLS  130



>gb|KDP24980.1| hypothetical protein JCGZ_24318 [Jatropha curcas]
Length=677

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP D DA E +GLPWGVT+TPFA+KDEN   P YGSDGHLLPRCENC+AY+
Sbjct  1    MAVRATVSRFPMDQDAQESSGLPWGVTVTPFASKDENSQSPTYGSDGHLLPRCENCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELP--LEGSEEMQA  363
            NT+CE EQWAW+C+LCGTLNGL S+AIARYS P SC E MSSF+DLELP      E M+A
Sbjct  61   NTFCELEQWAWSCSLCGTLNGLTSRAIARYSHPQSCAEMMSSFVDLELPMEGSEEEMMEA  120

Query  364  RPVYVAAVDLASSEEFLELVKS  429
            RPVYVAA+DL+SSEEFLEL KS
Sbjct  121  RPVYVAAIDLSSSEEFLELTKS  142



>gb|ACN25159.1| unknown [Zea mays]
Length=393

 Score =   207 bits (528),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 135/174 (78%), Gaps = 4/174 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP  P+ALE   + WGV +TPFAA DE G PP  G+ G  +PRCE+CWAY 
Sbjct  1    MAVRATVSRFPATPEALESCAVQWGVAVTPFAAVDERGQPPTTGAGGDRIPRCEHCWAYL  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLE----GSEEM  357
            +++C+ E+W WTCALCGTLNG   +A  R+  PD+CPE  SSF+DLE+ ++    G + +
Sbjct  61   SSHCDLERWGWTCALCGTLNGFDDEAERRFQRPDACPELNSSFVDLEIAVDEAGAGGDGV  120

Query  358  QARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            QA PVYVAAVDLA SEEFLEL+KSALLAALE L PGSLFGL TFSHKIGLYDVQ
Sbjct  121  QALPVYVAAVDLACSEEFLELIKSALLAALEALIPGSLFGLMTFSHKIGLYDVQ  174



>ref|XP_004961931.1| PREDICTED: uncharacterized protein C4.03c-like [Setaria italica]
Length=747

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 136/174 (78%), Gaps = 4/174 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP  P+ALE   + WGV +TPFAA DE G PP  G+ G  +PRCE+CWAY+
Sbjct  1    MAVRATVSRFPATPEALESCAVQWGVAVTPFAAADERGQPPTTGAGGDRVPRCEHCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLE----GSEEM  357
            +++C+ E+W W+CALCGTLNG       R+  PD+CPE  +SF+DLE+P++    G + +
Sbjct  61   SSHCDLERWGWSCALCGTLNGFDDDTARRFQRPDACPELNASFVDLEIPVDEAEGGGDGV  120

Query  358  QARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            QARPVYVAAVDLA SEEFLEL+KS+LLAALE L PGSLFGL TFSHKIG+YD+Q
Sbjct  121  QARPVYVAAVDLACSEEFLELIKSSLLAALEALIPGSLFGLMTFSHKIGVYDLQ  174



>ref|XP_008647340.1| PREDICTED: uncharacterized protein LOC100192686 isoform X1 [Zea 
mays]
 gb|ACN28654.1| unknown [Zea mays]
 gb|AFW78123.1| hypothetical protein ZEAMMB73_612731 [Zea mays]
Length=747

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 135/174 (78%), Gaps = 4/174 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP  P+ALE   + WGV +TPFAA DE G PP  G+ G  +PRCE+CWAY 
Sbjct  1    MAVRATVSRFPATPEALESCAVQWGVAVTPFAAVDERGQPPTTGAGGDRIPRCEHCWAYL  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLE----GSEEM  357
            +++C+ E+W WTCALCGTLNG   +A  R+  PD+CPE  SSF+DLE+ ++    G + +
Sbjct  61   SSHCDLERWGWTCALCGTLNGFDDEAERRFQRPDACPELNSSFVDLEIAVDEAGAGGDGV  120

Query  358  QARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            QA PVYVAAVDLA SEEFLEL+KSALLAALE L PGSLFGL TFSHKIGLYDVQ
Sbjct  121  QALPVYVAAVDLACSEEFLELIKSALLAALEALIPGSLFGLMTFSHKIGLYDVQ  174



>gb|AFW81781.1| hypothetical protein ZEAMMB73_245204 [Zea mays]
Length=746

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 135/174 (78%), Gaps = 4/174 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP  P+ALE   + WGV +TPFAA DE+G PP  G+ G  +PRCE+CWAY 
Sbjct  1    MAVRATVSRFPATPEALESCAVQWGVAVTPFAAADEHGQPPTTGAGGDRVPRCEHCWAYL  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLE----GSEEM  357
            +++C+ E+W WTCALCGTLNG   +A  R+  PD CPE  SSF+DLE+ ++    G + +
Sbjct  61   SSHCDLERWGWTCALCGTLNGFDDEAERRFQRPDVCPELKSSFVDLEILVDEAEGGGDGV  120

Query  358  QARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            QA PVYVAAVDLA SEEFLELVKSALLAALE L PGSLFGL TFSHKIGLYDVQ
Sbjct  121  QALPVYVAAVDLACSEEFLELVKSALLAALEALVPGSLFGLMTFSHKIGLYDVQ  174



>ref|XP_002441179.1| hypothetical protein SORBIDRAFT_09g021790 [Sorghum bicolor]
 gb|EES19609.1| hypothetical protein SORBIDRAFT_09g021790 [Sorghum bicolor]
Length=747

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 134/174 (77%), Gaps = 4/174 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP  P+ALE   + WGV +TPFAA DE G PP  G+ G  +PRCE+CWAY 
Sbjct  1    MAVRATVSRFPATPEALESCAVQWGVAVTPFAAADERGQPPTTGAGGDRVPRCEHCWAYL  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLE----GSEEM  357
            +++C+ E+W WTCALCGTLNG   +   R+  P +CPE  SSF+DLE+P++    G + +
Sbjct  61   SSHCDLERWGWTCALCGTLNGFDDETERRFQRPAACPELNSSFVDLEIPVDEAEGGGDGV  120

Query  358  QARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            QA PVYVAAVDLA SE+FLEL+KSALLAALE L PGSLFGL TFSHKIGLYDVQ
Sbjct  121  QALPVYVAAVDLACSEDFLELIKSALLAALEALIPGSLFGLMTFSHKIGLYDVQ  174



>ref|XP_003568355.1| PREDICTED: protein transport protein sec24 [Brachypodium distachyon]
Length=746

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 134/174 (77%), Gaps = 4/174 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVR++V+RFP   +AL+  G+ WG+++TPFAA DE G PP  G+ G  +PRCE+CWAY+
Sbjct  1    MAVRSTVSRFPVTQEALDACGIQWGISVTPFAAADERGQPPAAGASGDRVPRCEHCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLE----GSEEM  357
            NT+C+ E+W W CALCGTLNG    A+ R   P++CPE  SSF+D E+P++      + +
Sbjct  61   NTFCDVERWGWGCALCGTLNGFDDDALRRLDRPETCPELNSSFVDFEIPVDEVDGAGDGV  120

Query  358  QARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
             ARPVYVAAVDLA SEEFLEL+KSALLAALE L PGSLFGL TFSHKIGLYDVQ
Sbjct  121  PARPVYVAAVDLACSEEFLELIKSALLAALEALIPGSLFGLMTFSHKIGLYDVQ  174



>ref|NP_001170139.1| uncharacterized protein LOC100384066 [Zea mays]
 gb|ACN35960.1| unknown [Zea mays]
Length=746

 Score =   204 bits (519),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 134/174 (77%), Gaps = 4/174 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP  P+ALE   +  GV +TPFAA DE+G PP  G+ G  +PRCE+CWAY 
Sbjct  1    MAVRATVSRFPATPEALESCAVQLGVAVTPFAAADEHGQPPTTGAGGDRVPRCEHCWAYL  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLE----GSEEM  357
            +++C+ E+W WTCALCGTLNG   +A  R+  PD CPE  SSF+DLE+ ++    G + +
Sbjct  61   SSHCDLERWGWTCALCGTLNGFDDEAERRFQRPDVCPELKSSFVDLEILVDEAEGGGDGV  120

Query  358  QARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            QA PVYVAAVDLA SEEFLELVKSALLAALE L PGSLFGL TFSHKIGLYDVQ
Sbjct  121  QALPVYVAAVDLACSEEFLELVKSALLAALEALVPGSLFGLMTFSHKIGLYDVQ  174



>dbj|BAJ95494.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=747

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 130/174 (75%), Gaps = 4/174 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP    AL+  G+ WG+++TPFAA DE G PP     G  LPRCE CWAY+
Sbjct  1    MAVRATVSRFPVTQAALDECGIQWGISVTPFAAADELGQPPAIADRGDRLPRCERCWAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLE----GSEEM  357
            NT+C+ E+W W CALC TLNG    A+ R+  P++CPE  +SFID E+P++      E +
Sbjct  61   NTFCDVERWGWACALCSTLNGFDDDAVRRFQRPEACPELSASFIDFEIPVDEADGAGEGV  120

Query  358  QARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
             ARPVYVAAVDLA SEEFLEL+KSALLAALE L PGSLFGL TFSHKIGLYDVQ
Sbjct  121  TARPVYVAAVDLACSEEFLELIKSALLAALEALVPGSLFGLITFSHKIGLYDVQ  174



>gb|AAT69610.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAU90101.1| unknown protein [Oryza sativa Japonica Group]
Length=538

 Score =   187 bits (476),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 131/174 (75%), Gaps = 4/174 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MA RA+ +RFP   +ALE   + WG+ +TPFAA DE G  P  G+ G  +PRCE+CWAY 
Sbjct  1    MAARATFSRFPVTAEALEACAVQWGIAVTPFAAADERGQAPAAGAGGDRVPRCEHCWAYL  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSE----EM  357
            N++C+ E+W W+CALCGTLNG    A+ R   P+  PE  SSF+DLE+P++GSE     +
Sbjct  61   NSHCDMERWGWSCALCGTLNGFDDDALRRLQHPEGWPELTSSFVDLEIPVDGSEGAGDGV  120

Query  358  QARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            QARPVYVAAVDLA SEEFLEL+KSALLAALE L PGSLFGL TFSHKIGLYDVQ
Sbjct  121  QARPVYVAAVDLACSEEFLELIKSALLAALEALIPGSLFGLMTFSHKIGLYDVQ  174



>gb|KJB55613.1| hypothetical protein B456_009G085000 [Gossypium raimondii]
 gb|KJB55614.1| hypothetical protein B456_009G085000 [Gossypium raimondii]
Length=670

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 104/140 (74%), Gaps = 20/140 (14%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRA+V+RFP DPD+ E +G+PWG+T+TPFAAKDEN   P YG DGHLLPRCE+C+AY+
Sbjct  1    MAVRATVSRFPIDPDSQEASGVPWGLTVTPFAAKDENDQAPAYGLDGHLLPRCESCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEEMQARP  369
            NTYCE +QWAW C+LCGTLNGL +QAI+RYS P SC E MSSFIDLELP           
Sbjct  61   NTYCELDQWAWNCSLCGTLNGLSAQAISRYSHPQSCAEMMSSFIDLELP-----------  109

Query  370  VYVAAVDLASSEEFLELVKS  429
                     SSEEFLEL KS
Sbjct  110  ---------SSEEFLELTKS  120



>gb|EEE63885.1| hypothetical protein OsJ_18710 [Oryza sativa Japonica Group]
Length=747

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 131/174 (75%), Gaps = 4/174 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MA RA+ +RFP   +ALE   + WG+ +TPFAA DE G  P  G+ G  +PRCE+CWAY 
Sbjct  1    MAARATFSRFPVTAEALEACAVQWGIAVTPFAAADERGQAPAAGAGGDRVPRCEHCWAYL  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSE----EM  357
            N++C+ E+W W+CALCGTLNG    A+ R   P+  PE  SSF+DLE+P++GSE     +
Sbjct  61   NSHCDMERWGWSCALCGTLNGFDDDALRRLQHPEGWPELTSSFVDLEIPVDGSEGAGDGV  120

Query  358  QARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            QARPVYVAAVDLA SEEFLEL+KSALLAALE L PGSLFGL TFSHKIGLYDVQ
Sbjct  121  QARPVYVAAVDLACSEEFLELIKSALLAALEALIPGSLFGLMTFSHKIGLYDVQ  174



>ref|NP_001055673.1| Os05g0443300 [Oryza sativa Japonica Group]
 dbj|BAF17587.1| Os05g0443300 [Oryza sativa Japonica Group]
Length=761

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 131/174 (75%), Gaps = 4/174 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MA RA+ +RFP   +ALE   + WG+ +TPFAA DE G  P  G+ G  +PRCE+CWAY 
Sbjct  1    MAARATFSRFPVTAEALEACAVQWGIAVTPFAAADERGQAPAAGAGGDRVPRCEHCWAYL  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSE----EM  357
            N++C+ E+W W+CALCGTLNG    A+ R   P+  PE  SSF+DLE+P++GSE     +
Sbjct  61   NSHCDMERWGWSCALCGTLNGFDDDALRRLQHPEGWPELTSSFVDLEIPVDGSEGAGDGV  120

Query  358  QARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            QARPVYVAAVDLA SEEFLEL+KSALLAALE L PGSLFGL TFSHKIGLYDVQ
Sbjct  121  QARPVYVAAVDLACSEEFLELIKSALLAALEALIPGSLFGLMTFSHKIGLYDVQ  174



>gb|EAY98220.1| hypothetical protein OsI_20132 [Oryza sativa Indica Group]
Length=747

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 130/174 (75%), Gaps = 4/174 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MA RA+ +RFP   +ALE   + WG+ +TPFAA DE G  P  G+ G  +PRCE+CWAY 
Sbjct  1    MAARATFSRFPVTAEALEACAVQWGIAVTPFAAADERGQAPAAGAGGDRVPRCEHCWAYL  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSE----EM  357
            N++C+ E+W W+CALCGTLNG    A+ R   P+  PE  SSF+DLE+P++G E     +
Sbjct  61   NSHCDMERWGWSCALCGTLNGFDDDALRRLQHPEGWPELTSSFVDLEIPVDGLEGAGDGV  120

Query  358  QARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            QARPVYVAAVDLA SEEFLEL+KSALLAALE L PGSLFGL TFSHKIGLYDVQ
Sbjct  121  QARPVYVAAVDLACSEEFLELIKSALLAALEALIPGSLFGLMTFSHKIGLYDVQ  174



>ref|XP_001777420.1| predicted protein [Physcomitrella patens]
 gb|EDQ57824.1| predicted protein [Physcomitrella patens]
Length=749

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 126/171 (74%), Gaps = 3/171 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            M+VR ++ R P D +A E  G+PWGVT+ PFAA DE   PP  G  G  LPRC++CWAY 
Sbjct  1    MSVRRTLGRCPADNEAQEGCGIPWGVTVQPFAATDELKRPPEQGDRGEALPRCDSCWAYL  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDS-CPENMSSFIDLELPLEGSEEMQAR  366
            N++CE ++WAWTCALCG L     +  ARY    S  PE +SSFID+E  L+  ++ QAR
Sbjct  61   NSFCEIDKWAWTCALCGQLIAFSEEEAARYWQSSSPRPEVLSSFIDVE--LDDVDDFQAR  118

Query  367  PVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            PV+VAAVDL++SEEFLELVKS+LLAALE L  G+LFGL TFSHKIGLYDVQ
Sbjct  119  PVFVAAVDLSASEEFLELVKSSLLAALEALNAGALFGLITFSHKIGLYDVQ  169



>ref|XP_003579703.1| PREDICTED: protein transport protein SEC24-like [Brachypodium 
distachyon]
Length=739

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 123/172 (72%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRAS+  FP DP      GLPWGV +TPF++ DE G+ P  G +GHLLPRC +C+AY+
Sbjct  1    MAVRASLACFPSDPVLHNSCGLPWGVAVTPFSSTDERGSSPATGDEGHLLPRCSSCFAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSC--PENMSSFIDLELPLEGSEEMQA  363
            N  C   +W+WTC +C   N LP++A ARY+   S   PE  S+F+DL LP EG      
Sbjct  61   NILCPLHRWSWTCPICSEDNDLPAEAAARYARDGSHDPPELRSAFVDLLLPEEGEAAAVT  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
             PVYVAA+DL+SSEEFLELVKSALLAALE L PGSLFG+ TFS KIGLYDVQ
Sbjct  121  TPVYVAAIDLSSSEEFLELVKSALLAALEALSPGSLFGILTFSSKIGLYDVQ  172



>ref|XP_011015487.1| PREDICTED: protein transport protein SEC24-like [Populus euphratica]
Length=699

 Score =   178 bits (452),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 108/122 (89%), Gaps = 2/122 (2%)
 Frame = +1

Query  160  PRCENCWAYYNTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPL  339
            PRCENC+AY+NTYCE +QWAW C+LCGTLNGL S+AIARYS P SC E MSSFIDLELP+
Sbjct  6    PRCENCYAYFNTYCELDQWAWNCSLCGTLNGLDSEAIARYSHPQSCAEMMSSFIDLELPM  65

Query  340  EGSEE--MQARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYD  513
            EGS+E  MQA PVYVAAVDL+SSEEFLEL KSAL AALE L PGSLFGLATFSHK+GLYD
Sbjct  66   EGSDEEMMQACPVYVAAVDLSSSEEFLELTKSALQAALEALAPGSLFGLATFSHKMGLYD  125

Query  514  VQ  519
            VQ
Sbjct  126  VQ  127



>ref|XP_002976124.1| hypothetical protein SELMODRAFT_104389 [Selaginella moellendorffii]
 gb|EFJ23029.1| hypothetical protein SELMODRAFT_104389 [Selaginella moellendorffii]
Length=740

 Score =   178 bits (452),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 122/170 (72%), Gaps = 2/170 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVR ++ R PG+P+  E +GLPWG TLTPFAA+DE G P +       LPRC++CW Y 
Sbjct  1    MAVRLALGRCPGNPEMQEASGLPWGATLTPFAAEDETGRPSLRVKCAEPLPRCDSCWGYM  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEEMQARP  369
            N  CE +Q AW+C LCG  N L   A  R++      E  SSF+DLEL  EGS+++  RP
Sbjct  61   NFLCEVDQSAWSCVLCGERNFLSRDAADRFA--RDAKELRSSFVDLELEEEGSQDLNLRP  118

Query  370  VYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            VYVAAVDL++SEEFL+LVK++LLAALE +  GSLFGL T+SHKIGLYDVQ
Sbjct  119  VYVAAVDLSASEEFLDLVKNSLLAALEAIRAGSLFGLVTYSHKIGLYDVQ  168



>ref|XP_002968253.1| hypothetical protein SELMODRAFT_440407 [Selaginella moellendorffii]
 gb|EFJ30507.1| hypothetical protein SELMODRAFT_440407 [Selaginella moellendorffii]
Length=733

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 121/170 (71%), Gaps = 2/170 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVR ++ R PG+P+  E +GLPWG TLTPFAA+DE G P +       LPRC++CW Y 
Sbjct  1    MAVRLALGRCPGNPEMQEASGLPWGATLTPFAAEDETGRPSLRVKCAAPLPRCDSCWGYM  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEEMQARP  369
            N  CE +Q AW+C LCG  N L   A  R+       E  SSF+DLEL  EGS+++  RP
Sbjct  61   NFLCEVDQSAWSCVLCGERNFLSRDAADRFG--RDAKELRSSFVDLELEEEGSQDLNLRP  118

Query  370  VYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            VYVAAVDL++SEEFL+LVK++LLAALE +  GSLFGL T+SHKIGLYDVQ
Sbjct  119  VYVAAVDLSASEEFLDLVKNSLLAALEAIRAGSLFGLVTYSHKIGLYDVQ  168



>ref|NP_001052744.1| Os04g0412900 [Oryza sativa Japonica Group]
 emb|CAD40593.2| OJ000126_13.4 [Oryza sativa Japonica Group]
 dbj|BAF14658.1| Os04g0412900 [Oryza sativa Japonica Group]
Length=739

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 123/172 (72%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRAS+  FP D    E +G+PWGV +TPF+A DE G  P  G++GHLLPRC++C+AY+
Sbjct  1    MAVRASLACFPSDAALQESSGIPWGVAVTPFSAADERGAAPATGAEGHLLPRCDSCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLP--DSCPENMSSFIDLELPLEGSEEMQA  363
            +T C   +W+W+CA+C   N L   A ARY+       PE  S+F+DL LP E  E    
Sbjct  61   STLCPLHRWSWSCAICSADNDLTPDASARYARDGGQDPPEMRSAFVDLLLPGEEGEAATT  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
             PVYVAA+DL+SSEEFLELVKSALLAALE + PGSLFGL TFS KIGLYDVQ
Sbjct  121  TPVYVAAIDLSSSEEFLELVKSALLAALEAIPPGSLFGLLTFSSKIGLYDVQ  172



>emb|CAH67359.1| OSIGBa0134P10.5 [Oryza sativa Indica Group]
Length=739

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 123/172 (72%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRAS+  FP D    E +G+PWGV +TPF+A DE G  P  G++GHLLPRC++C+AY+
Sbjct  1    MAVRASLACFPSDAALQESSGIPWGVAVTPFSAADERGAAPATGAEGHLLPRCDSCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLP--DSCPENMSSFIDLELPLEGSEEMQA  363
            +T C   +W+W+CA+C   N L   A ARY+       PE  S+F+DL LP E  E    
Sbjct  61   STLCPLHRWSWSCAICSADNDLTPDASARYARDGGQDPPEMRSAFVDLLLPGEEGEAATT  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
             PVYVAA+DL+SSEEFLELVKSALLAALE + PGSLFGL TFS KIGLYDVQ
Sbjct  121  TPVYVAAIDLSSSEEFLELVKSALLAALEAIPPGSLFGLLTFSSKIGLYDVQ  172



>gb|EEC77245.1| hypothetical protein OsI_15817 [Oryza sativa Indica Group]
Length=739

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 123/172 (72%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRAS+  FP D    E +G+PWGV +TPF+A DE G  P  G++GHLLPRC++C+AY+
Sbjct  1    MAVRASLACFPSDAALQESSGIPWGVAVTPFSAADERGAAPATGAEGHLLPRCDSCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLP--DSCPENMSSFIDLELPLEGSEEMQA  363
            +T C   +W+W+CA+C   N L   A ARY+       PE  S+F+DL LP E  E    
Sbjct  61   STLCPLHRWSWSCAICSADNDLTPDASARYARDGGQDPPEMRSAFVDLLLPGEEGEAATT  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
             PVYVAA+DL+SSEEFLELVKSALLAALE + PGSLFGL TFS KIGLYDVQ
Sbjct  121  TPVYVAAIDLSSSEEFLELVKSALLAALEAIPPGSLFGLLTFSSKIGLYDVQ  172



>gb|EEE60965.1| hypothetical protein OsJ_14735 [Oryza sativa Japonica Group]
Length=739

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRAS+  FP D    E +G+PWGV +TPF+A DE G  P  G++GHLLPR ++C+AY+
Sbjct  1    MAVRASLACFPSDAALQESSGIPWGVAVTPFSAADERGAAPATGAEGHLLPRWDSCYAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLP--DSCPENMSSFIDLELPLEGSEEMQA  363
            +T C    W+W+CA+C   N L   A ARY+       PE  S+F+DL LP E  E    
Sbjct  61   STLCPLHGWSWSCAICSADNDLTPDASARYARDGGQDPPEMRSAFVDLLLPGEEGEAATT  120

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
             PVYVAA+DL+SSEEFLELVKSALLAALE + PGSLFGL TFS KIGLYDVQ
Sbjct  121  TPVYVAAIDLSSSEEFLELVKSALLAALEAIPPGSLFGLLTFSSKIGLYDVQ  172



>gb|AFW58189.1| hypothetical protein ZEAMMB73_262773 [Zea mays]
Length=707

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 125/175 (71%), Gaps = 5/175 (3%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRAS+  FP DP      G+PWGV +TPF+A DE G PP  G++GHLLPRC++C+AY+
Sbjct  1    MAVRASLACFPSDPALHAACGMPWGVAITPFSATDERGFPPATGTEGHLLPRCQSCFAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSC--PENMSSFIDLELPLEGSEEMQA  363
            N  C  ++W+W CA+CG  N L + A ARY+       PE  S+F+DL LP+E  E   A
Sbjct  61   NLLCPLDRWSWNCAICGAENDLSADAAARYARDGGHDPPEMRSAFVDLLLPVEEGEAAAA  120

Query  364  ---RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
                PVYVAA+DL+SSEEFLELVKSAL AALE L PGSLFGL TFS KIGLYDVQ
Sbjct  121  AAPTPVYVAAIDLSSSEEFLELVKSALQAALEALLPGSLFGLLTFSSKIGLYDVQ  175



>ref|XP_008663179.1| PREDICTED: protein transport protein SEC24-like [Zea mays]
Length=740

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 125/175 (71%), Gaps = 5/175 (3%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRAS+  FP DP      G+PWGV +TPF+A DE G PP  G++GHLLPRC++C+AY+
Sbjct  1    MAVRASLACFPSDPALHAACGMPWGVAITPFSATDERGFPPATGTEGHLLPRCQSCFAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLP--DSCPENMSSFIDLELPLEGSEEMQA  363
            N  C  ++W+W CA+CG  N L + A ARY+       PE  S+F+DL LP+E  E   A
Sbjct  61   NLLCPLDRWSWNCAICGAENDLSADAAARYARDGGHDPPEMRSAFVDLLLPVEEGEAAAA  120

Query  364  ---RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
                PVYVAA+DL+SSEEFLELVKSAL AALE L PGSLFGL TFS KIGLYDVQ
Sbjct  121  AAPTPVYVAAIDLSSSEEFLELVKSALQAALEALLPGSLFGLLTFSSKIGLYDVQ  175



>ref|XP_004975570.1| PREDICTED: protein transport protein Sec24C-like [Setaria italica]
Length=739

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 124/174 (71%), Gaps = 4/174 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVRAS+  FP DP       +PWGV +TPF+A DE G+PP  G +GHLLPRC++C+AY+
Sbjct  1    MAVRASLGCFPSDPALHASCAIPWGVAVTPFSAADERGSPPATGDEGHLLPRCQSCFAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSC--PENMSSFIDLELPLEGSEEMQA  363
            +  C  ++W+WTC +CG  N +P+ A ARY+   +   PE  S+F+DL L  E  E   A
Sbjct  61   SLLCPLDRWSWTCTVCGGENDMPADAAARYARDGAHDPPEMRSAFVDLLLQGEEGEAAVA  120

Query  364  --RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
               PVYVAA+DL+SSEEFLELVKSAL AALE L PGSLFGL TFS KIGLYDVQ
Sbjct  121  APTPVYVAAIDLSSSEEFLELVKSALQAALEALSPGSLFGLLTFSSKIGLYDVQ  174



>gb|EMS67454.1| Protein transport protein Sec24A [Triticum urartu]
Length=800

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 124/173 (72%), Gaps = 3/173 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVR S+  FP D   LE +GLPWGV +TPF++ DE G+ PV G +G L+PRC +C+AY+
Sbjct  1    MAVRPSLAYFPSDNALLESSGLPWGVAVTPFSSTDERGSSPVTGDEGDLIPRCTSCFAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSC--PENMSSFIDLELPLEGSEEMQA  363
            +T C   +W+WTC +C   N L + A ARY+   S   PE  S+F+DL LP E  E   A
Sbjct  61   STLCSLHRWSWTCPICSEDNDLSADAAARYARDGSHDPPELRSAFVDLLLPGEEGEAAAA  120

Query  364  -RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
              PVYVAA+DL+SSEEFLELVKSALLAALE L PGSLFG+ TFS KIGLYDVQ
Sbjct  121  TTPVYVAAIDLSSSEEFLELVKSALLAALEALSPGSLFGILTFSSKIGLYDVQ  173



>gb|EMT28162.1| Protein transport protein Sec24B [Aegilops tauschii]
Length=726

 Score =   158 bits (400),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 124/173 (72%), Gaps = 3/173 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVR S+  FP D   L+ +GLPWGV +TPF++ DE G+ PV G +G L+PRC +C+AY+
Sbjct  1    MAVRPSLAYFPSDNALLDSSGLPWGVAVTPFSSTDERGSFPVTGDEGDLIPRCTSCFAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSC--PENMSSFIDLELPLEGSEEMQA  363
            +T C   +W+WTC +C   N L + A ARY+   S   PE  S+F+DL LP E  E   A
Sbjct  61   STLCSLHRWSWTCPICSEDNDLSADAAARYARDGSHDPPELRSAFVDLLLPGEEGEAAAA  120

Query  364  -RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
              PVYVAA+DL+SSEEFLELVKSALLAALE L PGSLFG+ TFS KIGLYDVQ
Sbjct  121  TTPVYVAAIDLSSSEEFLELVKSALLAALEALSPGSLFGILTFSSKIGLYDVQ  173



>ref|XP_001757713.1| predicted protein [Physcomitrella patens]
 gb|EDQ77353.1| predicted protein [Physcomitrella patens]
Length=754

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 120/175 (69%), Gaps = 5/175 (3%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            M+VR +  R P D +A E  G+PWG T+ PFAA DE G  P     G  LPRC+NC+AY 
Sbjct  1    MSVRRTSARCPIDTEAQEGCGIPWGATVQPFAATDELGRSPEECERGQALPRCDNCYAYL  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDS-CPENMSSFIDLELPLEG----SEE  354
            N+ CE ++WAWTC LCG L G   +  ARY    S  PE +SS +D+EL  +     +  
Sbjct  61   NSLCEIDKWAWTCVLCGQLIGFTEEEFARYQSASSPRPEVLSSLVDVELDDDEEDNVAAN  120

Query  355  MQARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
             QARPV+VAAVDL++SEEFLELVKS+LLAALE L  G+LFGL TFSHKIGLYD+Q
Sbjct  121  FQARPVFVAAVDLSASEEFLELVKSSLLAALEALNAGALFGLITFSHKIGLYDLQ  175



>dbj|BAK03991.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=740

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 123/173 (71%), Gaps = 3/173 (2%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            MAVR S+  FP D   L+ +GLPWGV +TPF++ DE G+PPV G +G L+PRC +C+AY+
Sbjct  1    MAVRPSLAYFPSDNTLLDSSGLPWGVAVTPFSSTDERGSPPVTGDEGDLIPRCTSCFAYF  60

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSC--PENMSSFIDLELP-LEGSEEMQ  360
            +T C   +W+WTC +C   N L + A ARY+   S   PE  S+F+DL LP  EG     
Sbjct  61   STLCSLHRWSWTCPICSEDNDLSADAAARYARDGSHDPPELRSAFVDLLLPGAEGEAAAA  120

Query  361  ARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
              PVYVAAVDL SSEEFLELVKSALLAALE L PGSLFG+ TFS KIGLYDVQ
Sbjct  121  TTPVYVAAVDLCSSEEFLELVKSALLAALEALSPGSLFGILTFSSKIGLYDVQ  173



>ref|XP_006655364.1| PREDICTED: protein transport protein SEC24-like [Oryza brachyantha]
Length=681

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = +1

Query  208  EQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE----MQARPVY  375
            E+W W+CALCGTLNG    A+ R    D+ PE   SF+DLE+ ++GSE+    +QARPVY
Sbjct  2    ERWGWSCALCGTLNGFDDDALGRLQRSDAWPELSFSFVDLEIQVDGSEDAGVGVQARPVY  61

Query  376  VAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            VAAVDLA SEEFLEL+KSALLAALE L PGSLFGL TFSHKIGLYDVQ
Sbjct  62   VAAVDLACSEEFLELIKSALLAALEALIPGSLFGLMTFSHKIGLYDVQ  109



>gb|EMT05114.1| Protein transport protein SEC24 [Aegilops tauschii]
Length=970

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 76/99 (77%), Gaps = 4/99 (4%)
 Frame = +1

Query  235  CGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLE----GSEEMQARPVYVAAVDLASS  402
            C TLNG    A+ R+  P++CPE  +SFID E+P++      + + ARPVYVAAVDLA S
Sbjct  286  CCTLNGFDDDALHRFQRPEACPELNASFIDFEMPVDVADGAGDGVLARPVYVAAVDLACS  345

Query  403  EEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            EEFLEL+KSALLAALE L PGSLFGL TFSHKIGLYDVQ
Sbjct  346  EEFLELIKSALLAALEALIPGSLFGLMTFSHKIGLYDVQ  384



>ref|XP_005650920.1| vWA-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE26376.1| vWA-like protein [Coccomyxa subellipsoidea C-169]
Length=828

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 99/183 (54%), Gaps = 17/183 (9%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKD----ENGNPPVYGSDGHLLPRCENC  177
            MA+  ++N  P +    +  GLP+   + PFA  D     N +  V   D   + RC  C
Sbjct  1    MAIYLTLNAAPQNGSLRDQCGLPFACVVEPFARYDGPSISNNSDAVLAED---IGRCAEC  57

Query  178  WAYYNTYCEQEQWAWTCALCGTLNGLPSQAIARYSLP--DSCPENMSSFI------DLEL  333
            +AY N +C  +Q AW C+LCG  N   +    RY+    +SCPE   S +      D  L
Sbjct  58   YAYVNYWCSFQQRAWMCSLCGACNEYATVKNQRYARKPRESCPEVKRSLVEVACSLDATL  117

Query  334  P--LEGSEEMQARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGL  507
            P   EG  E +  P+YVA VD    EE+LELVKSALLAALE L   +LFGLAT++ +I L
Sbjct  118  PEDTEGPVEQEVTPIYVALVDTTGGEEYLELVKSALLAALEALPSCALFGLATYNDQIEL  177

Query  508  YDV  516
            YDV
Sbjct  178  YDV  180



>ref|XP_005839653.1| secretory protein Sec24B [Guillardia theta CCMP2712]
 gb|EKX52673.1| secretory protein Sec24B [Guillardia theta CCMP2712]
Length=725

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 98/180 (54%), Gaps = 14/180 (8%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLL----PRCENCWA  183
            +R S+ R P +    + AGLPWG  L P A    +GN P   +   +L    PRC+ C+ 
Sbjct  2    IRPSLRRTPENASVKDAAGLPWGCALIPLAPA--SGNVPRPSAVDEILAEEIPRCQQCFG  59

Query  184  YYNTYCEQEQWAWTCALCGTLNGLPSQ---AIARYSLPDSCPENMSSFIDLELPLEG---  345
            Y N YC  E+ AW C+LCG  N L S+   +  R SL +     +    +      G   
Sbjct  60   YINAYCMFEKKAWICSLCGNKNDLSSRYATSAVRASLQELQRGIVDVVEECVEVDVGDIF  119

Query  346  SEEM--QARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            S+++  Q RP  VA VD++ SE+F+E+VKS +LA LE L P  LFGL T S  IG+YD++
Sbjct  120  SKDLKPQERPAVVAVVDVSGSEDFVEVVKSGILALLEALPPYVLFGLITVSDSIGVYDMR  179



>ref|XP_003058885.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57340.1| predicted protein [Micromonas pusilla CCMP1545]
Length=818

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 94/188 (50%), Gaps = 20/188 (11%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLP-----RCEN  174
            + +R + ++ P D D  E  GLP+G  + PF    E    P   S   L P     RC+ 
Sbjct  11   LCMRLTTSKAPRDADVKERTGLPFGAVVRPFKPLAEYDLDP--SSIDRLAPADAIARCKE  68

Query  175  CWAYYNTYCEQEQWAWTCALCGTLNGLPSQAI------------ARYSLPDSCPENMSSF  318
            C+ Y N YC  E+  W C LCG      S+A              R SLP+ C +   S 
Sbjct  69   CFGYVNGYCGLERDGWICILCGAFVPWDSRAHDGVGPPRYRKNPHRNSLPEICRQEHESL  128

Query  319  IDLE-LPLEGSEEMQARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSH  495
            +  E L       +   PVYVA +DL +SEE L++V++ ++AA+E +G  +LFG+ +F  
Sbjct  129  VASEVLTARPDAPIGTSPVYVALIDLTASEEVLDVVRAGVVAAIEAVGEDALFGVVSFDD  188

Query  496  KIGLYDVQ  519
            ++GLYDV 
Sbjct  189  RVGLYDVS  196



>ref|XP_002947745.1| hypothetical protein VOLCADRAFT_87927 [Volvox carteri f. nagariensis]
 gb|EFJ51278.1| hypothetical protein VOLCADRAFT_87927 [Volvox carteri f. nagariensis]
Length=815

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 92/194 (47%), Gaps = 25/194 (13%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPF---AAKDENGNPPVYGSDGHLLPRCENCW  180
            M V  ++ RFP +    E +GLP+   L P+     KD           G +  RC  C+
Sbjct  1    MKVDFTLKRFPINGSLKEQSGLPFSCVLQPYHRLGEKDAAAGDATAVRSGAIA-RCAQCY  59

Query  181  AYYNTYCEQEQWAWTCALCGTLNGLPSQAIARYSLPDSC----PENMSSFIDLEL-----  333
            +Y N YC  +   W C+LC   N L  Q   RY L  S     PE  S   +        
Sbjct  60   SYINCYCVFDTAGWVCSLCNRHNALKPQQQKRYRLDPSILQVLPEVRSEVFETLAEEPIP  119

Query  334  ----PLEGSEEMQ--------ARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFG  477
                PLEGS+             PV VA VD A+ EEFLELV+S+L AALE L P + F 
Sbjct  120  VAMPPLEGSQAALHDPGSVSGPAPVVVALVDTAAGEEFLELVRSSLEAALEALPPVTRFA  179

Query  478  LATFSHKIGLYDVQ  519
            L T S+++GL+DV+
Sbjct  180  LITMSNRLGLHDVR  193



>ref|XP_002501401.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62659.1| predicted protein [Micromonas sp. RCC299]
Length=806

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 95/190 (50%), Gaps = 26/190 (14%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLL-------PRC  168
            + +R +  R P +    +  GLP+GVT+ PF         P +  D   L        RC
Sbjct  14   LCLRLTSRRVPENAAQKDRTGLPFGVTVQPFKPL------PHFPVDASALLDPADEVARC  67

Query  169  ENCWAYYNTYCEQEQWAWTCALCGTLN----------GLP--SQAIARYSLPD-SCPENM  309
             +C+ Y N +C  E+  W C LCG  +          G P   +   R  LP+ + PE  
Sbjct  68   GDCFGYVNGFCGLERDGWVCILCGNFSYWSSDPVGDGGKPRYKRNARRNELPEIALPEYE  127

Query  310  SSFIDLELPLEGSEEMQARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATF  489
                   L +   E +   PVYVA +D  + EE LELV+SA+LAA+E +GP +LFG+ TF
Sbjct  128  IEVAREVLTVNPREPLGTAPVYVALIDTTAPEETLELVRSAVLAAIEAVGPDALFGIVTF  187

Query  490  SHKIGLYDVQ  519
            + +IGLYDVQ
Sbjct  188  ADRIGLYDVQ  197



>ref|XP_001694580.1| COP-II coat subunit [Chlamydomonas reinhardtii]
 gb|EDP02575.1| COP-II coat subunit [Chlamydomonas reinhardtii]
Length=825

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 86/178 (48%), Gaps = 18/178 (10%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDEN----GNPPVYGSDGHLLPRCENC  177
            M V  ++ RFP +    E  GLP+   L P+    E     G+     S+   + RC +C
Sbjct  1    MKVDFTLKRFPINGRLKEHCGLPFSCVLQPYHRLSEKEAAAGDASSVRSEA--IARCSHC  58

Query  178  WAYYNTYCEQEQWAWTCALCGTLNGLPSQAIARYSLP----DSCPENMSSFIDLELPLEG  345
            +AY N YC  +   W C+LC   N L  Q + RY L      S PE  S   +    L+ 
Sbjct  59   YAYINCYCAFDTAGWVCSLCNRHNALKPQQLKRYRLDPAVLQSLPEVRSDCFET---LDA  115

Query  346  SEEMQARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
                   PV VA VD A+ E     V+S+L AALE L P + F L T S++IGL+DV+
Sbjct  116  GYVSGPAPVVVALVDTAAGE-----VRSSLEAALEALPPVTRFALITMSNRIGLHDVR  168



>gb|EPS70068.1| hypothetical protein M569_04697, partial [Genlisea aurea]
Length=101

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  1    NCAMAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVY  138
               MAVR ++ RFPGDP   E +GLPWG+TLTPFA+KDENG PPVY
Sbjct  56   GSGMAVRPTMVRFPGDPAEQESSGLPWGMTLTPFASKDENGVPPVY  101



>gb|EMS61482.1| Protein transport protein Sec24C [Triticum urartu]
Length=656

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  355  MQARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDVQ  519
            ++ARPVYVAAVDLA SEEFLEL+KSALLAALE L PGSLFGL TFSHKIGLYDVQ
Sbjct  13   VKARPVYVAAVDLACSEEFLELIKSALLAALEALIPGSLFGLMTFSHKIGLYDVQ  67



>ref|XP_004350752.1| hypothetical protein DFA_11807 [Dictyostelium fasciculatum]
 gb|EGG14044.1| hypothetical protein DFA_11807 [Dictyostelium fasciculatum]
Length=752

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 53/185 (29%), Positives = 86/185 (46%), Gaps = 22/185 (12%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            M V+ S  RFP +P   + +G  WG  + PF       N      +   + RC+ C  Y 
Sbjct  1    MNVKFSTQRFPHNPSIKDASGTIWGCVVQPFR------NNYRCNENAKNIDRCKKCLGYI  54

Query  190  NTYCEQEQWAWTCALCGTLNGLP----SQAIARYSLPDS---CPENMSSFIDLELPLEGS  348
            N +   E+  W C LC   N +          +Y+  D     PE  +S + L++  E  
Sbjct  55   NPFVTFEKSTWICNLCKHANHISDDDNEDTSFKYADVDQRNIYPELTNSNLVLQVDQEDD  114

Query  349  EEMQAR---------PVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKI  501
            +E Q           P Y+A VD++ + E +E++KS L A +  L   SLFG+  +S+KI
Sbjct  115  DEDQDNLSDSIYNNNPTYIALVDISGNNEQMEVIKSGLEALVHALPDNSLFGMIVYSYKI  174

Query  502  GLYDV  516
            G++++
Sbjct  175  GIFNL  179



>ref|XP_003284541.1| hypothetical protein DICPUDRAFT_96735 [Dictyostelium purpureum]
 gb|EGC38976.1| hypothetical protein DICPUDRAFT_96735 [Dictyostelium purpureum]
Length=778

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 56/205 (27%), Positives = 90/205 (44%), Gaps = 41/205 (20%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYY  189
            M V+ S  RFP +    +     WG  + P     +N +   + +  ++  RC  C AY 
Sbjct  1    MNVKFSTQRFPTNQYVKDGTNSIWGCVVQPL----KNTSIQCHENSKNI-GRCSKCNAYI  55

Query  190  NTYCEQEQWAWTCALCGTLNGLPSQ-----AIARYSLPD--SCPENMSSFIDLELP----  336
            N+    E+  W C LC TLN +          +RY+ PD  + PE  ++  +L +     
Sbjct  56   NSLVVFERVGWVCNLCQTLNPIDYDIGRDGTRSRYATPDRNNLPELSNTSYELFVENNFN  115

Query  337  -----------LEGSEEMQA--------------RPVYVAAVDLASSEEFLELVKSalla  441
                       ++GS E+                 P+Y+A VD + S+E  E++ S L A
Sbjct  116  NNTTADRNNQVVDGSNEINNLPDSIPYSIIPLIDNPIYIAVVDYSGSKEQDEVITSGLEA  175

Query  442  aleglgpgslFGLATFSHKIGLYDV  516
             +  L   +LFGL  FS KIG+Y++
Sbjct  176  LVHALPDNALFGLIVFSKKIGIYNL  200



>ref|XP_005839376.1| secretory protein Sec23B [Guillardia theta CCMP2712]
 gb|EKX52396.1| secretory protein Sec23B [Guillardia theta CCMP2712]
Length=734

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 73/157 (46%), Gaps = 10/157 (6%)
 Frame = +1

Query  55   ALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYNTY--CEQEQWAWTC  228
            +L   GLP+G  ++PFAA D++       ++     RC++C A  N Y   E     W C
Sbjct  57   SLTKGGLPFGFIVSPFAAPDDSNRWLRKAAE-----RCQSCGAVRNLYIAVESNTGRWAC  111

Query  229  ALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEEMQA-RPVYVAAVDLASSE  405
              CG +N   S+ +      +SC E   + I+   P  GS   Q  R V +  +D A  +
Sbjct  112  NFCGAIN--KSEDLKGRDAIESCRELRDAVIEYVEPTVGSISTQVKRKVTMLVIDTAMRQ  169

Query  406  EFLELVKSallaaleglgpgslFGLATFSHKIGLYDV  516
            + L+ ++ +LL AL  L      G  TF   + +YD+
Sbjct  170  KDLDELQDSLLKALSVLDKNEEIGFITFDAVVKVYDL  206



>ref|XP_006684382.1| hypothetical protein CANTEDRAFT_96903 [Candida tenuis ATCC 10573]
 gb|EGV65808.1| hypothetical protein CANTEDRAFT_96903 [Candida tenuis ATCC 10573]
Length=757

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 50/171 (29%), Positives = 82/171 (48%), Gaps = 10/171 (6%)
 Frame = +1

Query  13   AVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN  192
             +R S N  P          +P G   TP + ++E G+ PV   D  +    +NC A  N
Sbjct  11   GIRFSWNTLPSTKMEANKIVVPTGCLYTPLSTREE-GDLPVAQYDP-IYCMNQNCKAILN  68

Query  193  TYCEQE-QWAWTCALCGTLNGLPS--QAIARYSLPDSCPENMSSFIDLELPLEGSEEMQA  363
             YC  +   +W+C LCG+ N LP+    I + +LP     N S+     +    S  +Q 
Sbjct  69   PYCSIDPTGSWSCPLCGSRNPLPTHYHGITQENLPLELTSNAST-----IEYITSRPVQN  123

Query  364  RPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDV  516
             P+++  VDL   ++ L  +K +L+ +L  L P +L GL T+   + L+D+
Sbjct  124  PPIFLFVVDLCQDDDNLTALKDSLVVSLNLLPPNALIGLITYGTMVQLHDL  174



>ref|XP_005713593.1| unnamed protein product [Chondrus crispus]
 emb|CDF33774.1| unnamed protein product [Chondrus crispus]
Length=715

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 81/196 (41%), Gaps = 32/196 (16%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSD----------------  147
            +R + +R+P D    E + LP+GV + P A   +    P+  SD                
Sbjct  2    LRPTGSRWPIDAAVSEASALPFGVLIAPLAPSPKPRFTPLSESDLTETARATHIAAAAPG  61

Query  148  GHLLPRCENCWAYYNTYCEQEQWAWTCALCGTLNGLPSQAIARYSLP---------DSCP  300
             H LPRC  C  Y +  C      W CALC   N LPS    RYS           +  P
Sbjct  62   AHDLPRCRPCGGYISAKCNMNARYWRCALCNAKNDLPS----RYSSTVLSTASDAIEHVP  117

Query  301  ENMSSFIDLEL---PLEGSEEMQARPVYVAAVDLASSEEFLELVKSallaaleglgpgsl  471
            E      D+ +   P    E       Y+  +D +  +++L+  ++A+ +AL+ +   SL
Sbjct  118  EISRDVYDVPVFDNPATHDEGAVQPAAYIFLIDESGDQQYLDAARTAVKSALDVIEGESL  177

Query  472  FGLATFSHKIGLYDVQ  519
             G+  +S  +   DV+
Sbjct  178  VGVMLYSEYLSFLDVR  193



>gb|EPY49350.1| COPII-coated vesicle component Sfb3 [Schizosaccharomyces cryophilus 
OY26]
Length=894

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 60/138 (43%), Gaps = 11/138 (8%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNP-PVYGSDGHLLPRCENCWAYYN  192
            V+ +    P   D L  +G+P G+ + PFA    +  P PV        PRC+ C  Y N
Sbjct  167  VQMTTYAIPSSNDVLNSSGVPLGMIVQPFAELRPDEAPVPVVDYTTSSPPRCKKCRGYIN  226

Query  193  TYCE--QEQWAWTCALCGTLNGL------PSQAIARYSLPDSCPENMSSFIDLELPLE--  342
             + +    Q  WTC LCGT N L      P     + +  +S PE     +D E+  +  
Sbjct  227  AFVQFTLSQSGWTCNLCGTENSLSNEVYNPMLFTNQQNALNSQPEFNVGTVDFEVGKDYW  286

Query  343  GSEEMQARPVYVAAVDLA  396
             SEE      YV  +D++
Sbjct  287  ASEETPQPAQYVFVIDVS  304



>gb|KDO30095.1| hypothetical protein SPRG_05286 [Saprolegnia parasitica CBS 223.65]
Length=1003

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 82/187 (44%), Gaps = 26/187 (14%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPV--YGSDGHLLPRCENCWAYY  189
            +R +VN      +    + LP+G+ L P A  DE    PV  +G+ G +  RC++C AY 
Sbjct  274  LRMTVNAIAHSQEHATKSALPYGLVLQPLAEPDEGKELPVVNFGASGVV--RCKSCRAYI  331

Query  190  NTYCEQEQWA-----WTCALCGTLNGLPSQAI-------ARYSLPDSCPENMSSFIDLEL  333
            N Y    QW      W C LCG  N +PS           R+ + D  PE +   +++  
Sbjct  332  NPYI---QWMDNGRRWRCNLCGIANDVPSSYFCHLNANGVRHDI-DERPE-LRGSVEIIA  386

Query  334  PLEGSEEMQARPVYVAAVDLASSEEFLELVKSallaaleglgp-----gslFGLATFSHK  498
            P E +      P +V  +D+++      +V+ A    L  L        + FGL T+   
Sbjct  387  PSEYTVRPPIPPAFVFVIDVSAQAVASGMVQVAAETILAQLDNLPGDGRTRFGLITYDSA  446

Query  499  IGLYDVQ  519
            +  Y+++
Sbjct  447  VHFYNLK  453



>ref|XP_003677551.1| hypothetical protein NCAS_0G03120 [Naumovozyma castellii CBS 
4309]
 sp|Q875V8.1|SC241_NAUCC RecName: Full=Protein transport protein SEC24-1 [Naumovozyma 
castellii CBS 4309]
 gb|AAO32524.1| SEC24 [Naumovozyma castellii]
 emb|CCC71199.1| hypothetical protein NCAS_0G03120 [Naumovozyma castellii CBS 
4309]
Length=911

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/84 (30%), Positives = 43/84 (51%), Gaps = 3/84 (4%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYNT  195
            +R+++N  P     L+   LP+ + +TP+    ++ NPP    DG ++ RC  C +Y N 
Sbjct  177  IRSTLNAVPKSNSLLKKTKLPFSLVITPYQHLHDDINPPPLNEDGTIV-RCRRCRSYMNP  235

Query  196  YCE--QEQWAWTCALCGTLNGLPS  261
            +    Q+   W C +C   N +PS
Sbjct  236  FVHFNQDGRRWKCNICNLFNEVPS  259



>emb|CEP19247.1| hypothetical protein [Parasitella parasitica]
Length=992

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 65/138 (47%), Gaps = 16/138 (12%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAA--KDENGNPPVYGSDGHLLPRCENCWAYY  189
            +R ++   PG  D +   GLP+G+ L P A    D+   P V      L  RC  C AY 
Sbjct  265  MRCTLQTIPGASDLIRDTGLPFGLVLQPLAKLHADDAALPVV-----PLAARCSRCKAYV  319

Query  190  NTYCEQEQ--WAWTCALCGTLNGL------PSQAIARYSLPDSCPENMSSFIDLELPLEG  345
            N +C+  Q    + C LC   N +      PS A  R    D  PE M   ++ + P E 
Sbjct  320  NPWCKFTQGGQRFVCNLCDFENMVKPEDVCPSDASGRRMDADQRPEFMLGSVEFDAPEEY  379

Query  346  SEEMQARPVY-VAAVDLA  396
             E+++ +P++ + A+D++
Sbjct  380  WEDVEPKPLHWLIAIDVS  397



>emb|CEP64674.1| LALA0S13e00386g1_1 [Lachancea lanzarotensis]
Length=767

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 53/173 (31%), Positives = 85/173 (49%), Gaps = 19/173 (11%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDE----NGNPPVYGSDGHLLPRCENCWA  183
            VR S N FP          +P G   TP   K++    + NP V G      P+C+   A
Sbjct  12   VRFSWNVFPSSRADANKNVVPVGCLYTPLKEKEDLEIMSYNPVVCGG-----PQCK---A  63

Query  184  YYNTYCEQE--QWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEEM  357
              N YCE +    AWTC +C + N LP+   A  S  D+ P  +S   +  +    +  +
Sbjct  64   VLNPYCEIDLRSNAWTCPICNSRNHLPAH-YANMS-QDNMPAELS---NTTIEYITNRPV  118

Query  358  QARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDV  516
            Q  P+Y   VD+ + EE L+ +K +++A+L  L P ++ GL T+ + + L+D+
Sbjct  119  QVPPIYFFVVDITAEEENLQALKESIIASLSLLPPNAMVGLITYGNVVQLHDI  171



>emb|CEG82188.1| hypothetical protein RMATCC62417_16297 [Rhizopus microsporus]
Length=902

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 82/184 (45%), Gaps = 18/184 (10%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAA-KDENGNPPVYGSDGHLLPRCENCWAYYN  192
            +R ++   P D + ++  GLP+G+ + P A    E+ N P+         RC  C  Y N
Sbjct  180  MRPTLRDIPSDNNLVQDTGLPFGIIIQPLAQLHPEDANVPLIPLSTDNPVRCSRCKGYIN  239

Query  193  TYCE--QEQWAWTCALCGTLNGLPSQAI-------ARYSLPDSCPENMSSFIDLELPLEG  345
             +C+       + C LC   N +P            R    D  PE M   ++ ++P E 
Sbjct  240  PWCQYIDAGRKFICNLCEFTNIVPEHQFCPVDIVSGRRMDIDQHPELMHGSVEFQVPEEY  299

Query  346  SEEMQARPV-YVAAVDLASS-----EEFLELVKSallaaleglgpgslFGLATFSHKIGL  507
               +Q RP+ Y+ A+D++ +      +F  ++K   + +     PG+  G+ TF + +  
Sbjct  300  WLGIQPRPLHYLFAIDVSRNATGMLHQFCGVIKE--MISSNCFQPGTKLGIMTFDNSLHF  357

Query  508  YDVQ  519
            Y++Q
Sbjct  358  YNLQ  361



>ref|XP_001455165.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK87768.1| unnamed protein product [Paramecium tetraurelia]
Length=753

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 49/183 (27%), Positives = 80/183 (44%), Gaps = 21/183 (11%)
 Frame = +1

Query  1    NCAMAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPV-YGSDGHLLPRCENC  177
            N   ++R++   FP        A +P+ V + P     E G P V YG++  L  RC+NC
Sbjct  54   NSINSIRSTSRVFPRTKQVYMDAKIPFAVIIQPHGQSIEQGFPTVNYGNNPIL--RCQNC  111

Query  178  WAYYNTYCEQ--EQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSE  351
             AY N + EQ  E+    C +C  +  +P+  +    L     E  S        ++  +
Sbjct  112  RAYINPFMEQLKEEEYMRCNICTCIIKIPNNLLKPVDL-----EKRSDLTTGSYDIKAGQ  166

Query  352  EMQAR----PVYVAAVDLAS-SEEFL----ELVKSallaaleglgpgslFGLATFSHKIG  504
            E Q R    P Y   +D++  S+E L    +++K   +   +     +LFG  TF   I 
Sbjct  167  EYQVRPPMAPAYFFMIDVSQKSQELLGIMGQIIKD--MILEDKFNERTLFGFITFDTSIH  224

Query  505  LYD  513
            LY+
Sbjct  225  LYN  227



>ref|XP_008610658.1| hypothetical protein SDRG_06644 [Saprolegnia diclina VS20]
 gb|EQC35896.1| hypothetical protein SDRG_06644 [Saprolegnia diclina VS20]
Length=829

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 74/184 (40%), Gaps = 20/184 (11%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYNT  195
            +R +VN  P   +    + LP GV + P A  +     PV       + RC++C  Y N 
Sbjct  97   MRMTVNALPHSQEHATKSALPMGVIIQPLAEPEGGKELPVVNFGATGVVRCKSCRTYINP  156

Query  196  YCEQEQWA-----WTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDL--ELPLEGSEE  354
            +    QW      W C LCG  N +PS        PD   ++     +L   + +  S E
Sbjct  157  FV---QWVDNGRRWRCNLCGVSNDVPSSYFCHLG-PDGQRQDKDERPELCGSVEIVASSE  212

Query  355  MQAR----PVYVAAVDLASSEEFLELVKSallaaleglgp-----gslFGLATFSHKIGL  507
               R    PVYV  +D+++      +V+ A       L        + FGL T+   +  
Sbjct  213  YMMRPPTPPVYVFVIDVSAQAIASGMVQVAAETIQSQLDSLPGDPRTRFGLITYDSAVHF  272

Query  508  YDVQ  519
            Y+++
Sbjct  273  YNLK  276



>ref|XP_001327619.1| Sec23/Sec24 trunk domain containing protein [Trichomonas vaginalis 
G3]
 gb|EAY15396.1| Sec23/Sec24 trunk domain containing protein [Trichomonas vaginalis 
G3]
Length=677

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 35/139 (25%), Positives = 58/139 (42%), Gaps = 18/139 (13%)
 Frame = +1

Query  40   PGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYNTYC--EQEQ  213
            P  P+   ++ LP+G+ + P       G  P        +PRC  C AY + +C  ++ +
Sbjct  57   PNSPELEALSKLPYGIVVEPGTV----GKLPRVDLSNSTIPRCNKCQAYISCFCKVDERK  112

Query  214  WAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEEMQARPVYVAAVDL  393
              W C LCG     P        +P     NM    D+  P +  ++    P +V  +DL
Sbjct  113  KQWICGLCGAKTNFPENMP---EIPQMLTGNM--VYDVVAPQDYVQKAFVMPSFVFIIDL  167

Query  394  AS-------SEEFLELVKS  429
            +S       + +F+  VKS
Sbjct  168  SSQAVDSGFTAQFIRSVKS  186



>emb|CCF74209.1| unnamed protein product [Babesia microti strain RI]
Length=857

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 66/152 (43%), Gaps = 19/152 (13%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYNT  195
            +R +   FP   + ++ A +P G  +TP A  +   N PV      L+ RC+ C  Y N 
Sbjct  93   IRTTCGLFPSSTNLIQKANIPVGAVITPMAPIET--NVPVVSHGNSLVIRCKLCRTYINP  150

Query  196  YCEQE---QWAWTCALCGTLNGLPSQAI----ARYSLPDS--CPENMSSFIDLELPLEGS  348
            + + +    W W C +CG  N  P Q I     + S PD+  C E+    ++  +    S
Sbjct  151  FIKVKGNGSW-WLCNMCGVSNETPEQYIHLLAKQASQPDTIPCDEDPLGILNGSVEFVAS  209

Query  349  EEMQAR----PVYVAAVDL---ASSEEFLELV  423
             +   R    P ++  +D+   A     LELV
Sbjct  210  VDYMVRPPQPPTFMFVIDVSAPAVQSGMLELV  241



>ref|XP_003645324.1| hypothetical protein Ecym_2811 [Eremothecium cymbalariae DBVPG#7215]
 gb|AET38507.1| Hypothetical protein Ecym_2811 [Eremothecium cymbalariae DBVPG#7215]
Length=756

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 50/173 (29%), Positives = 77/173 (45%), Gaps = 19/173 (11%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENG----NPPVYGSDGHLLPRCENCWA  183
            +R S N FP          +P G   TP    ++      NP V G          NC +
Sbjct  12   IRFSWNVFPASRTDANKNVVPVGCLYTPLKEIEDLSVVAYNPVVCGG--------PNCKS  63

Query  184  YYNTYCEQEQWA--WTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEEM  357
              N YCE +  A  W C LCGT N LP   +      D+ P  +SS     +    +  +
Sbjct  64   VLNPYCEIDVRASLWACPLCGTRNHLPQHYVNITQ--DTMPSELSS---TTIEYITNRPV  118

Query  358  QARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDV  516
            Q  PV+   +D+ + EE L+ +K +++ +L  L P +L GL T+   + L+D+
Sbjct  119  QIPPVFFYVIDVTAEEENLQALKDSVITSLSLLPPNALVGLITYGKVVQLHDL  171



>ref|XP_003959352.1| hypothetical protein KAFR_0J01510 [Kazachstania africana CBS 
2517]
 emb|CCF60217.1| hypothetical protein KAFR_0J01510 [Kazachstania africana CBS 
2517]
Length=892

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 27/85 (32%), Positives = 42/85 (49%), Gaps = 3/85 (4%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYNT  195
            VR+++N  P +   L+ + LP  + + P+    +N +PP   +DG ++ RC  C AY N 
Sbjct  162  VRSTLNAVPKNGGLLKKSKLPLALIIRPYQYLHDNVHPPPLNTDG-IIVRCRRCRAYMNP  220

Query  196  YCE--QEQWAWTCALCGTLNGLPSQ  264
            Y     +   W C  C   N LP Q
Sbjct  221  YASFIPQTRRWRCNFCRLANDLPMQ  245



>pdb|1PCX|A Chain A, Crystal Structure Of The Copii Coat Subunit, Sec24, 
Complexed With A Peptide From The Snare Protein Bet1
 pdb|1PD0|A Chain A, Crystal Structure Of The Copii Coat Subunit, Sec24, 
Complexed With A Peptide From The Snare Protein Sed5 (Yeast 
Syntaxin-5)
 pdb|1PD1|A Chain A, Crystal Structure Of The Copii Coat Subunit, Sec24, 
Complexed With A Peptide Containing The Dxe Cargo Sorting Signal 
Of Yeast Sys1 Protein
Length=810

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 5/86 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN-  192
            +R+++N  P +   L+ + LP+G+ + P+    ++ +PP    DG L+ RC  C +Y N 
Sbjct  66   IRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDG-LIVRCRRCRSYMNP  124

Query  193  --TYCEQEQWAWTCALCGTLNGLPSQ  264
              T+ EQ +  W C  C   N +P Q
Sbjct  125  FVTFIEQGR-RWRCNFCRLANDVPMQ  149



>emb|CEI85981.1| hypothetical protein RMCBS344292_00428 [Rhizopus microsporus]
Length=859

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 47/186 (25%), Positives = 85/186 (46%), Gaps = 22/186 (12%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAA-KDENGNPPV--YGSDGHLLPRCENCWAY  186
            +R ++   P D + ++  GLP+G+ + P A    E+ N P+    +DG +  RC  C  Y
Sbjct  180  MRPTLRDIPSDSNLVQDTGLPFGIIIQPLAQLHPEDANVPLIPLSTDGPV--RCSRCKGY  237

Query  187  YNTYCE--QEQWAWTCALCGTLNGLPSQAI-------ARYSLPDSCPENMSSFIDLELPL  339
             N +C+       + C LC   N +P            R    D  PE M   ++ ++P 
Sbjct  238  INPWCQYIDAGRKFICNLCEFTNIVPEHQFCPVDIVSGRRMDMDQHPELMHGSVEFQVPE  297

Query  340  EGSEEMQARPV-YVAAVDLASS-----EEFLELVKSallaaleglgpgslFGLATFSHKI  501
            E    +Q RP+ Y+ A+D++ +      +F   +K   + +     PG+  G+ TF + +
Sbjct  298  EYWLGVQPRPLHYMFAIDVSRNATGMLHQFCGAIKE--MISSNCFQPGTKLGIMTFDNSL  355

Query  502  GLYDVQ  519
              Y++Q
Sbjct  356  HFYNLQ  361



>ref|XP_003958894.1| hypothetical protein KAFR_0H03490 [Kazachstania africana CBS 
2517]
 emb|CCF59759.1| hypothetical protein KAFR_0H03490 [Kazachstania africana CBS 
2517]
Length=891

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 43/86 (50%), Gaps = 5/86 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN-  192
            VR+++N  P     L+ + LP  + + P+    +N NPP    DG L+ RC  C +Y N 
Sbjct  158  VRSTLNAMPKTNTLLKKSKLPLALVIRPYQHLQDNINPPPLNEDG-LVVRCRRCRSYMNP  216

Query  193  --TYCEQEQWAWTCALCGTLNGLPSQ  264
              T+ EQ +  W C  C   N +P Q
Sbjct  217  FVTFIEQGR-RWRCNFCRLANDVPMQ  241



>dbj|GAA29645.2| protein transport protein SEC24 [Clonorchis sinensis]
Length=864

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 62/139 (45%), Gaps = 7/139 (5%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLP-RCENCWAYYN  192
            +R+S+   P   D ++  G+P+ +T++PFA+   +  P V    G   P RC  C AY N
Sbjct  114  IRSSLYAVPTTSDLMKTVGIPFTLTISPFASLHADDQPIVVSDMGEQGPVRCMRCRAYMN  173

Query  193  TYCE--QEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEEMQAR  366
             +         + C+LCG +  +P    A     D       ++   EL L GS E+ A 
Sbjct  174  PFASFIDGGRRFQCSLCGGVTEVPVNYFAHL---DHTGRRTDTYHRPELCL-GSYELTAT  229

Query  367  PVYVAAVDLASSEEFLELV  423
              Y    +L S   FL L+
Sbjct  230  AEYCKNNELPSPPAFLFLL  248



>gb|EPX74228.1| COPII-coated vesicle component Sfb3 [Schizosaccharomyces octosporus 
yFS286]
Length=894

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 39/83 (47%), Gaps = 3/83 (4%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNP-PVYGSDGHLLPRCENCWAYYN  192
            V+ +    P   D L  +GLP G+ + PFA    +  P PV        PRC+ C  Y N
Sbjct  167  VQMTTYAIPSSNDVLNTSGLPLGMIVQPFAETRPDEAPVPVVDYTTSSPPRCKKCRGYIN  226

Query  193  TYCE--QEQWAWTCALCGTLNGL  255
             + +    +  WTC LCG+ N L
Sbjct  227  PFVQFTLSRSGWTCNLCGSENSL  249



>emb|CEG84091.1| hypothetical protein RMATCC62417_17939 [Rhizopus microsporus]
Length=950

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 41/144 (28%), Positives = 68/144 (47%), Gaps = 17/144 (12%)
 Frame = +1

Query  1    NCAMA-VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPV----YGSDGHLLPR  165
            NC+   +R++++R P   +  + + LP G+ + P A K++    PV    +G DG +  R
Sbjct  219  NCSSRFMRSTMDRIPFSKELADKSKLPLGLVIQPLA-KNKPEEVPVQVVDHGPDGPI--R  275

Query  166  CENCWAYYNTYCEQEQWA--WTCALCGTLNGLPSQAIARYSLP------DSCPENMSSFI  321
            C  C AY N +C+       + C +C  LN +PS   A   +       +  PE     +
Sbjct  276  CSRCRAYINPWCQFTHGGSRFECNVCAHLNEVPSWYFANIDMSGRRIDANERPELRYGTV  335

Query  322  DLELPLEGSEEMQARPV-YVAAVD  390
            + E+P E     Q  P+ YV A+D
Sbjct  336  EFEVPKEYYSTRQPAPLTYVFAID  359



>ref|XP_011103888.1| sec24p [Saccharomyces arboricola H-6]
 gb|EJS43322.1| sec24p [Saccharomyces arboricola H-6]
Length=931

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 5/86 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN-  192
            +R+++N  P +   L+ + LP+G+ + P+    ++ +PP    DG L+ RC  C +Y N 
Sbjct  187  IRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDG-LIVRCRRCRSYMNP  245

Query  193  --TYCEQEQWAWTCALCGTLNGLPSQ  264
              T+ EQ +  W C  C   N +P Q
Sbjct  246  FITFIEQGR-RWRCNFCRLANDVPMQ  270



>emb|CEG73237.1| hypothetical protein RMATCC62417_08657 [Rhizopus microsporus]
Length=884

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 47/186 (25%), Positives = 85/186 (46%), Gaps = 22/186 (12%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAA-KDENGNPPV--YGSDGHLLPRCENCWAY  186
            +R ++   P D + ++  GLP+G+ + P A    E+ N P+    +DG +  RC  C  Y
Sbjct  180  MRPTLRDIPSDSNLVQDTGLPFGIIIQPLAQLHPEDANVPLIPLSTDGPV--RCSRCKGY  237

Query  187  YNTYCE--QEQWAWTCALCGTLNGLPSQAI-------ARYSLPDSCPENMSSFIDLELPL  339
             N +C+       + C LC   N +P            R    D  PE M   ++ ++P 
Sbjct  238  INPWCQYIDAGRKFICNLCEFTNIVPEHQFCPVDIVSGRRMDMDQHPELMHGSVEFQVPE  297

Query  340  EGSEEMQARPV-YVAAVDLASS-----EEFLELVKSallaaleglgpgslFGLATFSHKI  501
            E    +Q RP+ Y+ A+D++ +      +F   +K   + +     PG+  G+ TF + +
Sbjct  298  EYWLGVQPRPLHYMFAIDVSRNATGMLHQFCGAIKE--MISSNCFQPGTKLGIMTFDNSL  355

Query  502  GLYDVQ  519
              Y++Q
Sbjct  356  HFYNLQ  361



>gb|KHF97872.1| transport protein sec23 [Gossypium arboreum]
Length=875

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 74/165 (45%), Gaps = 26/165 (16%)
 Frame = +1

Query  64   VAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYNTYCEQ--EQWAWTCALC  237
            V  L +GV ++P   +D +  P V   D H   RC +C AY N Y         W C +C
Sbjct  170  VPSLGFGVLVSP--GRDTSPGPQVIQRDPH---RCLDCGAYSNLYSNILIGSGQWQCVIC  224

Query  238  GTLNGLPSQAIARYSLPDSCPENMSSFIDLELPL-EGSEEMQARPVYVAAVDLASS----  402
            G LNG   + IA         E + +F +L  PL +  +    RP +V   DL +S    
Sbjct  225  GNLNGSEGEYIALSK------EELRNFPELSSPLVDFIQTGNKRPSFVPVTDLRTSAPVF  278

Query  403  --------EEFLELVKSallaaleglgpgslFGLATFSHKIGLYD  513
                    E+ L+ ++S+L A ++ L P +  G+  +   I +YD
Sbjct  279  LVIDECLDEQHLQYLQSSLHAFVDSLPPTTRIGIILYGRAISVYD  323



>gb|EIW09905.1| Sec24p [Saccharomyces cerevisiae CEN.PK113-7D]
Length=926

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 5/86 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN-  192
            +R+++N  P +   L+ + LP+G+ + P+    ++ +PP    DG L+ RC  C +Y N 
Sbjct  182  IRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDG-LIVRCRRCRSYMNP  240

Query  193  --TYCEQEQWAWTCALCGTLNGLPSQ  264
              T+ EQ +  W C  C   N +P Q
Sbjct  241  FVTFIEQGR-RWRCNFCRLANDVPMQ  265



>gb|AJR52369.1| Sec24p [Saccharomyces cerevisiae YJM1478]
Length=926

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 5/86 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN-  192
            +R+++N  P +   L+ + LP+G+ + P+    ++ +PP    DG L+ RC  C +Y N 
Sbjct  182  IRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDG-LIVRCRRCRSYMNP  240

Query  193  --TYCEQEQWAWTCALCGTLNGLPSQ  264
              T+ EQ +  W C  C   N +P Q
Sbjct  241  FVTFIEQGR-RWRCNFCRLANDVPMQ  265



>gb|AJR51422.1| Sec24p [Saccharomyces cerevisiae YJM1447]
Length=926

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 5/86 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN-  192
            +R+++N  P +   L+ + LP+G+ + P+    ++ +PP    DG L+ RC  C +Y N 
Sbjct  182  IRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDG-LIVRCRRCRSYMNP  240

Query  193  --TYCEQEQWAWTCALCGTLNGLPSQ  264
              T+ EQ +  W C  C   N +P Q
Sbjct  241  FVTFIEQGR-RWRCNFCRLANDVPMQ  265



>gb|AJR49140.1| Sec24p [Saccharomyces cerevisiae YJM1400]
 gb|AJR52558.1| Sec24p [Saccharomyces cerevisiae YJM1479]
Length=926

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 5/86 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN-  192
            +R+++N  P +   L+ + LP+G+ + P+    ++ +PP    DG L+ RC  C +Y N 
Sbjct  182  IRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDG-LIVRCRRCRSYMNP  240

Query  193  --TYCEQEQWAWTCALCGTLNGLPSQ  264
              T+ EQ +  W C  C   N +P Q
Sbjct  241  FVTFIEQGR-RWRCNFCRLANDVPMQ  265



>gb|AJR48812.1| Sec24p [Saccharomyces cerevisiae YJM1389]
 gb|AJR53639.1| Sec24p [Saccharomyces cerevisiae YJM1592]
Length=926

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 5/86 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN-  192
            +R+++N  P +   L+ + LP+G+ + P+    ++ +PP    DG L+ RC  C +Y N 
Sbjct  182  IRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDG-LIVRCRRCRSYMNP  240

Query  193  --TYCEQEQWAWTCALCGTLNGLPSQ  264
              T+ EQ +  W C  C   N +P Q
Sbjct  241  FVTFIEQGR-RWRCNFCRLANDVPMQ  265



>gb|AJR48427.1| Sec24p [Saccharomyces cerevisiae YJM1387]
Length=926

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 5/86 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN-  192
            +R+++N  P +   L+ + LP+G+ + P+    ++ +PP    DG L+ RC  C +Y N 
Sbjct  182  IRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDG-LIVRCRRCRSYMNP  240

Query  193  --TYCEQEQWAWTCALCGTLNGLPSQ  264
              T+ EQ +  W C  C   N +P Q
Sbjct  241  FVTFIEQGR-RWRCNFCRLANDVPMQ  265



>gb|AJR46151.1| Sec24p [Saccharomyces cerevisiae YJM1326]
Length=926

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 5/86 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN-  192
            +R+++N  P +   L+ + LP+G+ + P+    ++ +PP    DG L+ RC  C +Y N 
Sbjct  182  IRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDG-LIVRCRRCRSYMNP  240

Query  193  --TYCEQEQWAWTCALCGTLNGLPSQ  264
              T+ EQ +  W C  C   N +P Q
Sbjct  241  FVTFIEQGR-RWRCNFCRLANDVPMQ  265



>gb|AJR44817.1| Sec24p [Saccharomyces cerevisiae YJM1250]
Length=926

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 5/86 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN-  192
            +R+++N  P +   L+ + LP+G+ + P+    ++ +PP    DG L+ RC  C +Y N 
Sbjct  182  IRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDG-LIVRCRRCRSYMNP  240

Query  193  --TYCEQEQWAWTCALCGTLNGLPSQ  264
              T+ EQ +  W C  C   N +P Q
Sbjct  241  FVTFIEQGR-RWRCNFCRLANDVPMQ  265



>gb|AJR42896.1| Sec24p [Saccharomyces cerevisiae YJM1083]
Length=926

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 5/86 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN-  192
            +R+++N  P +   L+ + LP+G+ + P+    ++ +PP    DG L+ RC  C +Y N 
Sbjct  182  IRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDG-LIVRCRRCRSYMNP  240

Query  193  --TYCEQEQWAWTCALCGTLNGLPSQ  264
              T+ EQ +  W C  C   N +P Q
Sbjct  241  FVTFIEQGR-RWRCNFCRLANDVPMQ  265



>gb|AJR38532.1| Sec24p [Saccharomyces cerevisiae YJM450]
 gb|AJR40614.1| Sec24p [Saccharomyces cerevisiae YJM683]
 gb|AJR40804.1| Sec24p [Saccharomyces cerevisiae YJM689]
Length=926

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 5/86 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN-  192
            +R+++N  P +   L+ + LP+G+ + P+    ++ +PP    DG L+ RC  C +Y N 
Sbjct  182  IRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDG-LIVRCRRCRSYMNP  240

Query  193  --TYCEQEQWAWTCALCGTLNGLPSQ  264
              T+ EQ +  W C  C   N +P Q
Sbjct  241  FVTFIEQGR-RWRCNFCRLANDVPMQ  265



>gb|EDV09587.1| vesicle coat component [Saccharomyces cerevisiae RM11-1a]
Length=926

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 5/86 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN-  192
            +R+++N  P +   L+ + LP+G+ + P+    ++ +PP    DG L+ RC  C +Y N 
Sbjct  182  IRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDG-LIVRCRRCRSYMNP  240

Query  193  --TYCEQEQWAWTCALCGTLNGLPSQ  264
              T+ EQ +  W C  C   N +P Q
Sbjct  241  FVTFIEQGR-RWRCNFCRLANDVPMQ  265



>ref|NP_012157.3| COPII subunit SEC24 [Saccharomyces cerevisiae S288c]
 sp|P40482.1|SEC24_YEAST RecName: Full=Protein transport protein SEC24; AltName: Full=Abnormal 
nuclear morphology 1 [Saccharomyces cerevisiae S288c]
 pdb|1M2V|B Chain B, Crystal Structure Of The Yeast Sec2324 HETERODIMER
 pdb|4BZI|E Chain E, The Structure Of The Copii Coat Assembled On Membranes
 pdb|4BZI|L Chain L, The Structure Of The Copii Coat Assembled On Membranes
 pdb|4BZI|M Chain M, The Structure Of The Copii Coat Assembled On Membranes
 emb|CAA86271.1| unnamed protein product [Saccharomyces cerevisiae]
 gb|AAT92907.1| YIL109C [Saccharomyces cerevisiae]
 gb|EDN61393.1| vesicle coat component [Saccharomyces cerevisiae YJM789]
 gb|EEU08647.1| Sec24p [Saccharomyces cerevisiae JAY291]
 tpg|DAA08444.1| TPA: COPII subunit SEC24 [Saccharomyces cerevisiae S288c]
 gb|EGA78414.1| Sec24p [Saccharomyces cerevisiae Vin13]
 gb|EGA86399.1| Sec24p [Saccharomyces cerevisiae VL3]
 gb|EWG85298.1| Sec24p [Saccharomyces cerevisiae R008]
 gb|EWG90467.1| Sec24p [Saccharomyces cerevisiae P301]
 gb|EWG95436.1| Sec24p [Saccharomyces cerevisiae R103]
 gb|EWH17873.1| Sec24p [Saccharomyces cerevisiae P283]
 gb|AHY75897.1| Sec24p [Saccharomyces cerevisiae YJM993]
 gb|AJP39365.1| Sec24p [Saccharomyces cerevisiae YJM1078]
 gb|AJR36658.1| Sec24p [Saccharomyces cerevisiae YJM189]
 gb|AJR36853.1| Sec24p [Saccharomyces cerevisiae YJM193]
 gb|AJR37044.1| Sec24p [Saccharomyces cerevisiae YJM195]
 gb|AJR37192.1| Sec24p [Saccharomyces cerevisiae YJM244]
 gb|AJR37384.1| Sec24p [Saccharomyces cerevisiae YJM248]
 gb|AJR37774.1| Sec24p [Saccharomyces cerevisiae YJM271]
 gb|AJR37967.1| Sec24p [Saccharomyces cerevisiae YJM320]
 gb|AJR38147.1| Sec24p [Saccharomyces cerevisiae YJM326]
 gb|AJR38340.1| Sec24p [Saccharomyces cerevisiae YJM428]
 gb|AJR38723.1| Sec24p [Saccharomyces cerevisiae YJM451]
 gb|AJR38917.1| Sec24p [Saccharomyces cerevisiae YJM453]
 gb|AJR39110.1| Sec24p [Saccharomyces cerevisiae YJM456]
 gb|AJR39299.1| Sec24p [Saccharomyces cerevisiae YJM470]
 gb|AJR39488.1| Sec24p [Saccharomyces cerevisiae YJM541]
 gb|AJR39667.1| Sec24p [Saccharomyces cerevisiae YJM554]
 gb|AJR39847.1| Sec24p [Saccharomyces cerevisiae YJM555]
 gb|AJR40039.1| Sec24p [Saccharomyces cerevisiae YJM627]
 gb|AJR40232.1| Sec24p [Saccharomyces cerevisiae YJM681]
 gb|AJR40420.1| Sec24p [Saccharomyces cerevisiae YJM682]
 gb|AJR40987.1| Sec24p [Saccharomyces cerevisiae YJM693]
 gb|AJR41159.1| Sec24p [Saccharomyces cerevisiae YJM969]
 gb|AJR41353.1| Sec24p [Saccharomyces cerevisiae YJM972]
 gb|AJR41546.1| Sec24p [Saccharomyces cerevisiae YJM975]
 gb|AJR41740.1| Sec24p [Saccharomyces cerevisiae YJM978]
 gb|AJR41933.1| Sec24p [Saccharomyces cerevisiae YJM981]
 gb|AJR42127.1| Sec24p [Saccharomyces cerevisiae YJM984]
 gb|AJR42317.1| Sec24p [Saccharomyces cerevisiae YJM987]
 gb|AJR42511.1| Sec24p [Saccharomyces cerevisiae YJM990]
 gb|AJR42705.1| Sec24p [Saccharomyces cerevisiae YJM996]
 gb|AJR43086.1| Sec24p [Saccharomyces cerevisiae YJM1129]
 gb|AJR43280.1| Sec24p [Saccharomyces cerevisiae YJM1133]
 gb|AJR43474.1| Sec24p [Saccharomyces cerevisiae YJM1190]
 gb|AJR43667.1| Sec24p [Saccharomyces cerevisiae YJM1199]
 gb|AJR43860.1| Sec24p [Saccharomyces cerevisiae YJM1202]
 gb|AJR44045.1| Sec24p [Saccharomyces cerevisiae YJM1208]
 gb|AJR44239.1| Sec24p [Saccharomyces cerevisiae YJM1242]
 gb|AJR44432.1| Sec24p [Saccharomyces cerevisiae YJM1244]
 gb|AJR45011.1| Sec24p [Saccharomyces cerevisiae YJM1615]
 gb|AJR45198.1| Sec24p [Saccharomyces cerevisiae YJM1252]
 gb|AJR45390.1| Sec24p [Saccharomyces cerevisiae YJM1273]
 gb|AJR45587.1| Sec24p [Saccharomyces cerevisiae YJM1304]
 gb|AJR45775.1| Sec24p [Saccharomyces cerevisiae YJM1307]
 gb|AJR45960.1| Sec24p [Saccharomyces cerevisiae YJM1311]
 gb|AJR46340.1| Sec24p [Saccharomyces cerevisiae YJM1332]
 gb|AJR46533.1| Sec24p [Saccharomyces cerevisiae YJM1336]
 gb|AJR46726.1| Sec24p [Saccharomyces cerevisiae YJM1338]
 gb|AJR46919.1| Sec24p [Saccharomyces cerevisiae YJM1341]
 gb|AJR47110.1| Sec24p [Saccharomyces cerevisiae YJM1342]
 gb|AJR47299.1| Sec24p [Saccharomyces cerevisiae YJM1355]
 gb|AJR47492.1| Sec24p [Saccharomyces cerevisiae YJM1356]
 gb|AJR47684.1| Sec24p [Saccharomyces cerevisiae YJM1381]
 gb|AJR47876.1| Sec24p [Saccharomyces cerevisiae YJM1383]
 gb|AJR48042.1| Sec24p [Saccharomyces cerevisiae YJM1385]
 gb|AJR48233.1| Sec24p [Saccharomyces cerevisiae YJM1386]
 gb|AJR49332.1| Sec24p [Saccharomyces cerevisiae YJM1401]
 gb|AJR49709.1| Sec24p [Saccharomyces cerevisiae YJM1415]
 gb|AJR49902.1| Sec24p [Saccharomyces cerevisiae YJM1417]
 gb|AJR50091.1| Sec24p [Saccharomyces cerevisiae YJM1418]
 gb|AJR50278.1| Sec24p [Saccharomyces cerevisiae YJM1419]
 gb|AJR50471.1| Sec24p [Saccharomyces cerevisiae YJM1433]
 gb|AJR50664.1| Sec24p [Saccharomyces cerevisiae YJM1434]
 gb|AJR51236.1| Sec24p [Saccharomyces cerevisiae YJM1444]
 gb|AJR51608.1| Sec24p [Saccharomyces cerevisiae YJM1450]
 gb|AJR52178.1| Sec24p [Saccharomyces cerevisiae YJM1477]
 gb|AJR52869.1| Sec24p [Saccharomyces cerevisiae YJM1527]
 gb|AJR53065.1| Sec24p [Saccharomyces cerevisiae YJM1549]
Length=926

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 5/86 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN-  192
            +R+++N  P +   L+ + LP+G+ + P+    ++ +PP    DG L+ RC  C +Y N 
Sbjct  182  IRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDG-LIVRCRRCRSYMNP  240

Query  193  --TYCEQEQWAWTCALCGTLNGLPSQ  264
              T+ EQ +  W C  C   N +P Q
Sbjct  241  FVTFIEQGR-RWRCNFCRLANDVPMQ  265



>dbj|GAA24012.1| K7_Sec24p [Saccharomyces cerevisiae Kyokai no. 7]
Length=926

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 5/86 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN-  192
            +R+++N  P +   L+ + LP+G+ + P+    ++ +PP    DG L+ RC  C +Y N 
Sbjct  182  IRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDG-LIVRCRRCRSYMNP  240

Query  193  --TYCEQEQWAWTCALCGTLNGLPSQ  264
              T+ EQ +  W C  C   N +P Q
Sbjct  241  FVTFIEQGR-RWRCNFCRLANDVPMQ  265



>gb|AJR49516.1| Sec24p [Saccharomyces cerevisiae YJM1402]
 gb|AJR53256.1| Sec24p [Saccharomyces cerevisiae YJM1573]
Length=926

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 5/86 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN-  192
            +R+++N  P +   L+ + LP+G+ + P+    ++ +PP    DG L+ RC  C +Y N 
Sbjct  182  IRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDG-LIVRCRRCRSYMNP  240

Query  193  --TYCEQEQWAWTCALCGTLNGLPSQ  264
              T+ EQ +  W C  C   N +P Q
Sbjct  241  FVTFIEQGR-RWRCNFCRLANDVPMQ  265



>gb|AJR48620.1| Sec24p [Saccharomyces cerevisiae YJM1388]
 gb|AJR51799.1| Sec24p [Saccharomyces cerevisiae YJM1460]
Length=926

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 5/86 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN-  192
            +R+++N  P +   L+ + LP+G+ + P+    ++ +PP    DG L+ RC  C +Y N 
Sbjct  182  IRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDG-LIVRCRRCRSYMNP  240

Query  193  --TYCEQEQWAWTCALCGTLNGLPSQ  264
              T+ EQ +  W C  C   N +P Q
Sbjct  241  FVTFIEQGR-RWRCNFCRLANDVPMQ  265



>gb|AJR51045.1| Sec24p [Saccharomyces cerevisiae YJM1443]
Length=926

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 5/86 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN-  192
            +R+++N  P +   L+ + LP+G+ + P+    ++ +PP    DG L+ RC  C +Y N 
Sbjct  182  IRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDG-LIVRCRRCRSYMNP  240

Query  193  --TYCEQEQWAWTCALCGTLNGLPSQ  264
              T+ EQ +  W C  C   N +P Q
Sbjct  241  FVTFIEQGR-RWRCNFCRLANDVPMQ  265



>gb|AJR51986.1| Sec24p [Saccharomyces cerevisiae YJM1463]
Length=926

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 5/86 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN-  192
            +R+++N  P +   L+ + LP+G+ + P+    ++ +PP    DG L+ RC  C +Y N 
Sbjct  182  IRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDG-LIVRCRRCRSYMNP  240

Query  193  --TYCEQEQWAWTCALCGTLNGLPSQ  264
              T+ EQ +  W C  C   N +P Q
Sbjct  241  FVTFIEQGR-RWRCNFCRLANDVPMQ  265



>pdb|4BZI|F Chain F, The Structure Of The Copii Coat Assembled On Membranes
 pdb|4BZI|N Chain N, The Structure Of The Copii Coat Assembled On Membranes
 pdb|4BZI|O Chain O, The Structure Of The Copii Coat Assembled On Membranes
 emb|CAY80399.1| Sec24p [Saccharomyces cerevisiae EC1118]
 gb|AJR53445.1| Sec24p [Saccharomyces cerevisiae YJM1574]
Length=926

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 5/86 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN-  192
            +R+++N  P +   L+ + LP+G+ + P+    ++ +PP    DG L+ RC  C +Y N 
Sbjct  182  IRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDG-LIVRCRRCRSYMNP  240

Query  193  --TYCEQEQWAWTCALCGTLNGLPSQ  264
              T+ EQ +  W C  C   N +P Q
Sbjct  241  FVTFIEQGR-RWRCNFCRLANDVPMQ  265



>sp|Q876F5.1|SC242_SACU7 RecName: Full=Protein transport protein SEC24-2 [Saccharomyces 
uvarum MCYC 623]
 gb|AAO32424.1| SEC24 [Saccharomyces bayanus]
Length=926

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 5/86 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN-  192
            +R+++N  P +   L+ + LP+G+ + P+    ++ +PP    DG L+ RC  C +Y N 
Sbjct  182  IRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDG-LIVRCRRCRSYMNP  240

Query  193  --TYCEQEQWAWTCALCGTLNGLPSQ  264
              T+ EQ +  W C  C   N +P Q
Sbjct  241  FITFIEQGR-RWRCNFCRLANDVPMQ  265



>gb|EHN06600.1| Sec24p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|AJR37579.1| Sec24p [Saccharomyces cerevisiae YJM270]
 gb|AJR49004.1| Sec24p [Saccharomyces cerevisiae YJM1399]
Length=926

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 5/86 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN-  192
            +R+++N  P +   L+ + LP+G+ + P+    ++ +PP    DG L+ RC  C +Y N 
Sbjct  182  IRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDG-LIVRCRRCRSYMNP  240

Query  193  --TYCEQEQWAWTCALCGTLNGLPSQ  264
              T+ EQ +  W C  C   N +P Q
Sbjct  241  FVTFIEQGR-RWRCNFCRLANDVPMQ  265



>gb|AJR44625.1| Sec24p [Saccharomyces cerevisiae YJM1248]
 gb|AJR50856.1| Sec24p [Saccharomyces cerevisiae YJM1439]
Length=926

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 5/86 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN-  192
            +R+++N  P +   L+ + LP+G+ + P+    ++ +PP    DG L+ RC  C +Y N 
Sbjct  182  IRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDG-LIVRCRRCRSYMNP  240

Query  193  --TYCEQEQWAWTCALCGTLNGLPSQ  264
              T+ EQ +  W C  C   N +P Q
Sbjct  241  FVTFIEQGR-RWRCNFCRLANDVPMQ  265



>emb|CEI95000.1| hypothetical protein RMCBS344292_09201 [Rhizopus microsporus]
Length=471

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 52/193 (27%), Positives = 86/193 (45%), Gaps = 24/193 (12%)
 Frame = +1

Query  1    NCAMA-VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPV----YGSDGHLLPR  165
            NC+   +R++++R P   +  + + LP G+ + P A K++    PV    +G DG +  R
Sbjct  248  NCSPRFMRSTMDRIPFSKELADKSKLPLGLVIQPLA-KNKPEEVPVQVVDHGPDGPI--R  304

Query  166  CENCWAYYNTYCEQEQWA--WTCALCGTLNGLPSQAIARYSLP------DSCPENMSSFI  321
            C  C AY N +C+       + C +C  LN +PS   A   +       +  PE     +
Sbjct  305  CSRCRAYINPWCQFTHGGSKFECNVCAHLNEVPSWYFANIDMSGRRIDANERPELRYGTV  364

Query  322  DLELPLEGSEEMQARPV-YVAAVD---LASSEEFLELV----KSallaaleglgpgslFG  477
            + E+P E     Q  P+ YV A+D   LA     L+ V    K+AL          +  G
Sbjct  365  EFEVPKEYYSTRQPAPLTYVFAIDASVLAIQSGMLQAVCEGIKTALYDEHGNAKVKNRIG  424

Query  478  LATFSHKIGLYDV  516
            + TF   +  Y++
Sbjct  425  IITFDKDVQFYNL  437



>emb|CEJ04406.1| hypothetical protein RMCBS344292_18368 [Rhizopus microsporus]
Length=466

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 52/193 (27%), Positives = 86/193 (45%), Gaps = 24/193 (12%)
 Frame = +1

Query  1    NCAMA-VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPV----YGSDGHLLPR  165
            NC+   +R++++R P   +  + + LP G+ + P A K++    PV    +G DG +  R
Sbjct  243  NCSPRFMRSTMDRIPFSKELADKSKLPLGLVIQPLA-KNKPEEVPVQVVDHGPDGPI--R  299

Query  166  CENCWAYYNTYCEQEQWA--WTCALCGTLNGLPSQAIARYSLP------DSCPENMSSFI  321
            C  C AY N +C+       + C +C  LN +PS   A   +       +  PE     +
Sbjct  300  CSRCRAYINPWCQFTHGGSKFECNVCAHLNEVPSWYFANIDMSGRRIDANERPELRYGTV  359

Query  322  DLELPLEGSEEMQARPV-YVAAVD---LASSEEFLELV----KSallaaleglgpgslFG  477
            + E+P E     Q  P+ YV A+D   LA     L+ V    K+AL          +  G
Sbjct  360  EFEVPKEYYSTRQPAPLTYVFAIDVSVLAIQSGMLQAVCEGIKAALYDEHGNAKMKNRIG  419

Query  478  LATFSHKIGLYDV  516
            + TF   +  Y++
Sbjct  420  IITFDKDVQFYNL  432



>gb|KII87578.1| hypothetical protein PLICRDRAFT_162293 [Plicaturopsis crispa 
FD-325 SS-3]
Length=880

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 39/82 (48%), Gaps = 4/82 (5%)
 Frame = +1

Query  19   RASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYNTY  198
            R+++N  P     L  + +P  + +TP+   DE G  PV  SD H++ RC  C  Y N Y
Sbjct  160  RSTINAIPTTSSLLHKSKIPLALVITPYRTLDE-GEEPVAVSD-HIIARCRRCRTYINPY  217

Query  199  CEQEQWA--WTCALCGTLNGLP  258
             +       W C +C   N +P
Sbjct  218  VQFMDGGNRWRCCMCNLANEVP  239



>ref|XP_008610639.1| hypothetical protein SDRG_06627 [Saprolegnia diclina VS20]
 gb|EQC35877.1| hypothetical protein SDRG_06627 [Saprolegnia diclina VS20]
Length=985

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 82/187 (44%), Gaps = 26/187 (14%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPV--YGSDGHLLPRCENCWAYY  189
            +R +VN      +    + LP+G+ L P A  ++    PV  +G+ G +  RC++C AY 
Sbjct  256  LRMTVNAVAHSQEHATKSALPYGLVLQPLAEPEDGKELPVVNFGASGVV--RCKSCRAYI  313

Query  190  NTYCEQEQWA-----WTCALCGTLNGLPSQAI-------ARYSLPDSCPENMSSFIDLEL  333
            N Y    QW      W C LCG  N +PS           R+ + D  PE   S +++  
Sbjct  314  NPYI---QWMDNGRRWRCNLCGIANDVPSSYFCHLNANGVRHDI-DERPELRGS-VEIIA  368

Query  334  PLEGSEEMQARPVYVAAVDLASSEEFLELVKSallaalegl-----gpgslFGLATFSHK  498
            P E +      P +V  VD+++      +V+ A    L  L        + FGL T+   
Sbjct  369  PSEYTVRPPIPPAFVFVVDVSAQAVASGMVQVAAETILAQLDNLPGEGRTRFGLITYDSH  428

Query  499  IGLYDVQ  519
            +  Y+++
Sbjct  429  VHFYNLK  435



>ref|NP_984588.1| AEL272Wp [Ashbya gossypii ATCC 10895]
 sp|Q758M7.1|SEC23_ASHGO RecName: Full=Protein transport protein SEC23 [Ashbya gossypii 
ATCC 10895]
 gb|AAS52412.1| AEL272Wp [Ashbya gossypii ATCC 10895]
 gb|AEY96710.1| FAEL272Wp [Ashbya gossypii FDAG1]
Length=756

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 50/175 (29%), Positives = 80/175 (46%), Gaps = 23/175 (13%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDE----NGNPPVYGSDGHLLPRCENCWA  183
            VR S N FP          +P G   TP    +E    + NP V G      P C+   A
Sbjct  12   VRFSWNVFPASRTDANKNVVPVGCLYTPLKEIEELAVVSYNPVVCGG-----PHCK---A  63

Query  184  YYNTYCEQEQWA--WTCALCGTLNGLPSQ--AIARYSLPDSCPENMSSFIDLELPLEGSE  351
              N YCE +  +  W C LCGT N LP     +++ ++P         +I        + 
Sbjct  64   VLNPYCEIDVRSNVWACPLCGTRNHLPQHYANMSQEAMPAELNSTTVEYI-------TNR  116

Query  352  EMQARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDV  516
             +Q  P++   VD+ + EE L+ +K +++ +L  L P +L GL T+ + + L+D+
Sbjct  117  PVQVAPIFFYVVDVTAEEENLQALKDSIITSLSLLPPNALVGLITYGNVVQLHDL  171



>ref|XP_002551498.1| KLTH0A00814p [Lachancea thermotolerans]
 emb|CAR21056.1| KLTH0A00814p [Lachancea thermotolerans CBS 6340]
Length=766

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 86/174 (49%), Gaps = 21/174 (12%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDE----NGNPPVYGSDGHLLPRCENCWA  183
            +R S N FP          +P G   TP  +K++    + NP V G      P+C+   A
Sbjct  12   IRFSWNVFPSSRTDANKNVVPVGCLYTPLKSKEDLMVMSYNPVVCGG-----PQCK---A  63

Query  184  YYNTYCEQE--QWAWTCALCGTLNGLPSQAIARYSLPDSCPENM-SSFIDLELPLEGSEE  354
              N YCE +    AW C +C + N LP    A Y+  +   ENM +   +  +    +  
Sbjct  64   VLNPYCEIDLRSNAWACPICNSRNHLP----AHYA--NMSQENMPAELSNTTIEYITNRP  117

Query  355  MQARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDV  516
            +Q  PV++  VD+ + EE L+ +K +++A+L  L P +L GL T+ + + L+D+
Sbjct  118  VQVPPVFLFVVDITAEEENLQALKESIIASLSLLPPNALVGLITYGNVVHLHDL  171



>ref|XP_003675093.1| hypothetical protein NCAS_0B06380 [Naumovozyma castellii CBS 
4309]
 sp|Q875V7.1|SC242_NAUCC RecName: Full=Protein transport protein SEC24-2 [Naumovozyma 
castellii CBS 4309]
 gb|AAO32525.1| SEC24 [Naumovozyma castellii]
 emb|CCC68722.1| hypothetical protein NCAS_0B06380 [Naumovozyma castellii CBS 
4309]
Length=912

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 33/133 (25%), Positives = 65/133 (49%), Gaps = 8/133 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYNT  195
            +R+++N  P     L+ + LP+ + + PF     + N P+  ++   + RC  C  Y N 
Sbjct  177  IRSTLNAVPQSNALLKKSKLPFALIIKPFKHL-HDMNAPLPCNEDEFVIRCRRCRGYLNP  235

Query  196  YCE--QEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLE-LPLEG-SEEMQA  363
            + +  Q +  W C  CG +NG P  +   + LP+    N  ++  ++ LP    S++++ 
Sbjct  236  FVKILQVESKWRCNFCGCINGFPDGS-EHFQLPNLYNRNELTYSSMDFLPSSSYSQQVKE  294

Query  364  RP--VYVAAVDLA  396
             P  VY   +D++
Sbjct  295  EPPAVYTFVIDVS  307



>emb|CEI93473.1| hypothetical protein RMCBS344292_07705 [Rhizopus microsporus]
Length=407

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 80/184 (43%), Gaps = 18/184 (10%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAA-KDENGNPPVYGSDGHLLPRCENCWAYYN  192
            +R ++   P D   ++  GLP+G+ + P A    E+   P+         RC  C  Y N
Sbjct  180  MRPTLRDIPSDSSLVQDTGLPFGIIIQPLAQLHPEDAKVPLIPLSTDSPVRCNRCKGYIN  239

Query  193  TYCE--QEQWAWTCALCGTLNGLPSQAI-------ARYSLPDSCPENMSSFIDLELPLEG  345
             +C+       + C LC   N +P            R    D  PE M   ++ ++P E 
Sbjct  240  PWCQYIDAGRKFICNLCEFTNIVPEHQFCPVDVVSGRRMDMDQHPELMYGSVEFQVPEEY  299

Query  346  SEEMQARPV-YVAAVDLASS-----EEFLELVKSallaaleglgpgslFGLATFSHKIGL  507
               +Q RP+ Y+ A+D++ +      +F  ++K   + +     PG+  G+ TF + +  
Sbjct  300  WLGVQPRPLHYMFAIDVSRNATGMLHQFCGVIKE--MISSNCFQPGTKLGIMTFDNSLHF  357

Query  508  YDVQ  519
            Y++Q
Sbjct  358  YNLQ  361



>gb|AGO12094.1| AaceriAEL272Wp [Saccharomycetaceae sp. 'Ashbya aceri']
Length=756

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/173 (31%), Positives = 82/173 (47%), Gaps = 19/173 (11%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDE----NGNPPVYGSDGHLLPRCENCWA  183
            VR S N FP          +P G   TP    ++    + NP V G      P C+   A
Sbjct  12   VRFSWNVFPASRTDANKNVVPVGCLYTPLKEIEDLAVVSYNPVVCGG-----PHCK---A  63

Query  184  YYNTYCEQEQWA--WTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEEM  357
              N YCE +  +  W C LCGT N LP Q  A  S  ++ P  +SS     +    +  +
Sbjct  64   VLNPYCEIDVRSNVWACPLCGTRNHLP-QHYANMS-QEAMPAELSS---TTIEYITNRPV  118

Query  358  QARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDV  516
            Q  P++   VD+ + EE L+ +K +++ +L  L P +L GL T+ + + L+D+
Sbjct  119  QVAPIFFYVVDVTAEEENLQALKDSIITSLSLLPPNALVGLITYGNVVQLHDL  171



>gb|KDO30079.1| hypothetical protein SPRG_05270 [Saprolegnia parasitica CBS 223.65]
Length=815

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 58/139 (42%), Gaps = 15/139 (11%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYNT  195
            +R +VN  P   +    + LP GV + P A  +     PV       + RC++C  Y N 
Sbjct  199  MRMTVNALPHSQEYATKSALPMGVIIQPLAEPEGGKELPVVNFGATGVVRCKSCRTYINP  258

Query  196  YCEQEQWA-----WTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDL--ELPLEGSEE  354
            +    QW      W C LCG  N +PS        PD   ++     +L   + +  S E
Sbjct  259  FV---QWVDNGRRWRCNLCGVSNDVPSSYFCHLG-PDGQRQDKDERPELCGSVEIVASSE  314

Query  355  MQAR----PVYVAAVDLAS  399
               R    PVYV  +D+++
Sbjct  315  YMMRPPTPPVYVFVIDVSA  333



>ref|XP_003687261.1| hypothetical protein TPHA_0I03260 [Tetrapisispora phaffii CBS 
4417]
 emb|CCE64827.1| hypothetical protein TPHA_0I03260 [Tetrapisispora phaffii CBS 
4417]
Length=832

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 53/185 (29%), Positives = 87/185 (47%), Gaps = 25/185 (14%)
 Frame = +1

Query  13   AVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKD-ENGNPPVYGSDGHLLPR--------  165
             +R S N FP D        +P G   TP    D +N +  V  +DG ++ +        
Sbjct  49   GIRFSWNVFPNDKIDSAKNVVPLGCMYTPLKEFDNDNEDAVVIDADGTVMNKKILNYNPV  108

Query  166  -CEN--CWAYYNTYC--EQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLE  330
             C    C A  N YC  +    +W C +C + N LPSQ    YS  +   ENM   I+L+
Sbjct  109  YCTQPQCKAILNPYCIIDPRNNSWICPICSSRNHLPSQ----YS--NMSQENMP--IELQ  160

Query  331  ---LPLEGSEEMQARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKI  501
               +    ++ +Q  P++   VD+ + +E L+ +K  L+++L  + P +L GL T+   I
Sbjct  161  YTSVEYITNKPIQIPPIFFLVVDITTEDENLDALKEYLISSLSLMPPNALIGLITYGTVI  220

Query  502  GLYDV  516
             L+D+
Sbjct  221  RLHDL  225



>gb|EPY23307.1| protein transport protein SEC24 [Angomonas deanei]
Length=685

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/143 (31%), Positives = 63/143 (44%), Gaps = 19/143 (13%)
 Frame = +1

Query  10   MAVRASVNRFPGDPDA---LEVAGLPWGVTLTPFAAKDENGNPPV--YGSDGHLLPRCEN  174
            ++VR +   FP    A   L+  GLP GV + PFA +D     PV  + S G  + RC  
Sbjct  25   LSVRPTFATFPKSTKANNLLQSIGLPVGVVVRPFAEQDV----PVADFTSFGDKMIRCRK  80

Query  175  CWAYYNTYCEQEQ--WAWTCALCGTLNGLPS-------QAIARYSLPDSCPENMSSFIDL  327
            C AY N +C   +    W C+LC   N  P        ++  R  + D   E ++  IDL
Sbjct  81   CTAYINPFCTFSEGGRKWMCSLCRYSNETPKSYYCPADESGLRQDINDR-QELLNCSIDL  139

Query  328  ELPLEGSEEMQARPVYVAAVDLA  396
                E  +    RPV V  +D +
Sbjct  140  LATPEFLKSPPMRPVIVFLLDFS  162



>emb|CDR97836.1| Sec 24 protein transport protein, putative [Babesia bigemina]
Length=838

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 45/92 (49%), Gaps = 7/92 (8%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENG-NPPVYGSDGHLLPRCENCWAYYN  192
            +R+SVN  P     ++   +P G+ + P A   E+    P+  S    + RC  C  Y N
Sbjct  137  IRSSVNVLPSSATLMQKTHVPLGIVIRPMAPLSEDDPEIPLANSGSEAITRCTRCRTYIN  196

Query  193  TYC--EQEQWAWTCALCGTLNGLPSQAIARYS  282
             +   ++ +  WTC +C    G+P++A  RY+
Sbjct  197  PFVTFDRARRYWTCNIC----GVPNEAPMRYT  224



>ref|XP_001644575.1| hypothetical protein Kpol_1003p22 [Vanderwaltozyma polyspora 
DSM 70294]
 gb|EDO16717.1| hypothetical protein Kpol_1003p22 [Vanderwaltozyma polyspora 
DSM 70294]
Length=926

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/84 (31%), Positives = 44/84 (52%), Gaps = 5/84 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN-  192
            +R+++N  P +   L+ + LP  + + P+   D++ +PP    DG L+ RC  C +Y N 
Sbjct  193  IRSTLNAIPKNNSLLKKSKLPLALVIRPYQYLDDDVSPPPLNEDG-LVVRCRRCRSYMNP  251

Query  193  --TYCEQEQWAWTCALCGTLNGLP  258
              T+ +Q +  W C  C   N LP
Sbjct  252  FVTFTDQGR-RWRCNFCRLANDLP  274



>gb|KFH64876.1| hypothetical protein MVEG_09605 [Mortierella verticillata NRRL 
6337]
Length=1144

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 43/83 (52%), Gaps = 3/83 (4%)
 Frame = +1

Query  19   RASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYNTY  198
            R+++N  P     L  + LP+G+ +TP+ +  E G+ PV      ++ RC  C  Y N +
Sbjct  424  RSTLNAIPATSQLLTKSRLPFGLIITPYRSVKE-GDDPVPVVTDSIIARCRRCRTYINPF  482

Query  199  CE--QEQWAWTCALCGTLNGLPS  261
             +  +    W C +C TLN +PS
Sbjct  483  VKFVEGGQRWKCNMCYTLNEVPS  505



>emb|CCK70453.1| hypothetical protein KNAG_0E01910 [Kazachstania naganishii CBS 
8797]
Length=900

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 5/86 (6%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYN-  192
            +R ++N  P     L+ + +P+ + + P+    +N +PP   SDG L+ RC  C +Y N 
Sbjct  163  LRCTLNAVPKTQSLLDKSKVPFALVIRPYQHLHDNVDPPPLNSDG-LIVRCRRCRSYLNP  221

Query  193  --TYCEQEQWAWTCALCGTLNGLPSQ  264
              T+  Q +  W C  C   N LP Q
Sbjct  222  FVTFIPQSR-RWRCNFCRLANDLPMQ  246



>emb|CDO94311.1| unnamed protein product [Kluyveromyces dobzhanskii CBS 2104]
Length=760

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 77/175 (44%), Gaps = 23/175 (13%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENG----NPPVYGSDGHLLPRCENCWA  183
            VR S N FP          +P G   TP   +++      NP V G+         NC +
Sbjct  12   VRFSWNVFPASRTDANKNVVPVGCLYTPLKEREDLAIAAYNPVVCGN--------INCKS  63

Query  184  YYNTYCEQEQWA--WTCALCGTLNGLPSQ--AIARYSLPDSCPENMSSFIDLELPLEGSE  351
              N YCE +  +  WTC +C T N LP     + + +LP         +I        S 
Sbjct  64   VLNPYCEIDVRSNTWTCPICQTRNILPQHYANLTQETLPLELTNTTVEYI-------TSV  116

Query  352  EMQARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDV  516
             +Q  P++   VD  + EE L+ +K +++ +L  L   +L GL T+ + I L+D+
Sbjct  117  PVQVPPIFFFVVDTTAEEENLQALKESIVTSLSLLPSNALVGLITYDNVIQLHDL  171



>ref|XP_001580499.1| hypothetical protein [Trichomonas vaginalis G3]
 gb|EAY19513.1| hypothetical protein TVAG_136440 [Trichomonas vaginalis G3]
Length=553

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 3/55 (5%)
 Frame = +1

Query  94   TPFAA---KDENGNPPVYGSDGHLLPRCENCWAYYNTYCEQEQWAWTCALCGTLN  249
            TP +A     EN N P        +PRC  C  Y + +C++++ +WTCALCGT N
Sbjct  21   TPISAIISPAENTNIPTIDLTYEQIPRCRKCNGYISNFCKRDESSWTCALCGTKN  75



>gb|EFA82261.1| hypothetical protein PPL_04684 [Polysphondylium pallidum PN500]
Length=662

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 41/149 (28%), Positives = 63/149 (42%), Gaps = 30/149 (20%)
 Frame = +1

Query  157  LPRCENCWAYYNTYCEQE-QWAWTCALCGTLNGLPSQAIAR--YSLPDSCPENMSSFIDL  327
            + RC+ C+AY N Y  +E    + C LC T N L +       YS PD  PE   + + L
Sbjct  61   IDRCKKCFAYVNPYIVREPNNTYKCVLCDTTNKLETDRYLNLAYSHPDQVPELQYNNLVL  120

Query  328  ELPL---------------------------EGSEEMQARPVYVAAVDLASSEEFLELVK  426
            E  +                           E  +E    P+Y+A VD + SE+ +  + 
Sbjct  121  EDIIDNNNNNSNDNNSDVGVIDQQLLQLQQLEEYKEFANNPIYIAVVDHSGSEDQINTIH  180

Query  427  SallaaleglgpgslFGLATFSHKIGLYD  513
              L A +  L    LFG+  +S KIG+++
Sbjct  181  DGLEALVHALPDNCLFGMIIYSQKIGIFN  209



>ref|XP_454166.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 sp|Q6CPH3.1|SEC23_KLULA RecName: Full=Protein transport protein SEC23 [Kluyveromyces 
lactis NRRL Y-1140]
 emb|CAG99253.1| KLLA0E04885p [Kluyveromyces lactis]
Length=760

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 77/175 (44%), Gaps = 23/175 (13%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENG----NPPVYGSDGHLLPRCENCWA  183
            VR S N FP          +P G   TP   +++      NP V G+         NC +
Sbjct  12   VRFSWNVFPASRTDANKNVVPVGCLYTPLKEREDLAVAGYNPVVCGN--------INCKS  63

Query  184  YYNTYCEQEQWA--WTCALCGTLNGLPSQ--AIARYSLPDSCPENMSSFIDLELPLEGSE  351
              N YCE +  +  WTC +C T N LP     + + +LP         +I        S 
Sbjct  64   VLNPYCEIDVRSNTWTCPICKTRNILPQHYANMTQETLPLELTNTTVEYI-------TSV  116

Query  352  EMQARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDV  516
             +Q  P++   VD  + EE L+ +K +++ +L  L   +L GL T+ + I L+D+
Sbjct  117  PVQVPPIFFFIVDTTAEEENLQALKESIITSLSLLPANALVGLITYDNVIQLHDL  171



>ref|XP_003680499.1| hypothetical protein TDEL_0C03990 [Torulaspora delbrueckii]
 emb|CCE91288.1| hypothetical protein TDEL_0C03990 [Torulaspora delbrueckii]
Length=906

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 39/85 (46%), Gaps = 3/85 (4%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYNT  195
            +R ++N  P     L+ + LP  + + P+    ++ NPP    DG L+ RC  C +Y N 
Sbjct  173  IRCTLNAVPKSNSLLKKSKLPLALVIRPYQHLQDDINPPPLNEDG-LVVRCRRCRSYMNP  231

Query  196  YCE--QEQWAWTCALCGTLNGLPSQ  264
            +     +   W C  C   N +P Q
Sbjct  232  FVNFTDQGRRWRCNFCRLANDVPMQ  256



>emb|CCK71056.1| hypothetical protein KNAG_0F03920 [Kazachstania naganishii CBS 
8797]
Length=769

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 82/177 (46%), Gaps = 19/177 (11%)
 Frame = +1

Query  13   AVRASVNRFPGDPDALEVAGLPWGVTLTPFAA-KDENGNPPVYGSDGH-LLPRCENCWAY  186
             VR S N FP          +P G   TP    +DENG   +  +  + ++     C A 
Sbjct  11   GVRFSWNVFPSTRTDANKNVIPVGCVYTPLKEFEDENGESQLNLAQYNPVVCSGPQCKAI  70

Query  187  YNTYC--EQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEEM-  357
             N YC  +    +WTC +C + N LP+Q        +   ENM     LEL +   E + 
Sbjct  71   LNPYCAIDPRSNSWTCPICNSRNHLPTQ------YANMTQENMP----LELQMTTVEYIT  120

Query  358  ----QARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDV  516
                Q  P++   +D+ S +E L+ +K +++ +L  L P +L GL T+ + + L+D+
Sbjct  121  NKPVQIPPIFFFVIDITSEQENLDALKESIITSLSVLPPNALIGLITYGNVVQLHDL  177



>emb|CEG70265.1| hypothetical protein RMATCC62417_06195 [Rhizopus microsporus]
Length=910

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 40/144 (28%), Positives = 68/144 (47%), Gaps = 17/144 (12%)
 Frame = +1

Query  1    NCA-MAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPV----YGSDGHLLPR  165
            NC+   +R++++R P   +  + + LP G+ + P A K++    PV    +G DG +  R
Sbjct  248  NCSPRFMRSTMDRIPFSKELADKSKLPLGLVIQPLA-KNKPEEVPVQVVDHGPDGPI--R  304

Query  166  CENCWAYYNTYCEQEQWA--WTCALCGTLNGLPSQAIARYSL------PDSCPENMSSFI  321
            C  C AY N +C+       + C +C  LN +PS   A   +       +  PE     +
Sbjct  305  CSRCRAYINPWCQFTHGGSRFECNVCAHLNEVPSWYFANIDMSGRRIDANERPELRYGTV  364

Query  322  DLELPLEGSEEMQARPV-YVAAVD  390
            + E+P E     +  P+ YV A+D
Sbjct  365  EFEVPKEYYSTRRPAPLTYVFAID  388



>gb|KJB41726.1| hypothetical protein B456_007G117000 [Gossypium raimondii]
 gb|KJB41727.1| hypothetical protein B456_007G117000 [Gossypium raimondii]
 gb|KJB41728.1| hypothetical protein B456_007G117000 [Gossypium raimondii]
Length=875

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 73/165 (44%), Gaps = 26/165 (16%)
 Frame = +1

Query  64   VAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYNTYCEQ--EQWAWTCALC  237
            V  L +GV ++P   +D +  P V   D H   RC +C AY N Y         W C +C
Sbjct  170  VPSLGFGVLVSP--GRDTSPGPQVIQRDPH---RCHDCGAYSNLYSNILIGSGQWQCVIC  224

Query  238  GTLNGLPSQAIARYSLPDSCPENMSSFIDLELPL-EGSEEMQARPVYVAAVDLASS----  402
            G LNG   + IA         E + +F +L  PL +  +    RP +V   D  +S    
Sbjct  225  GNLNGSEGEYIALSK------EELRNFPELSSPLVDFIQTGNKRPSFVPVTDSRTSAPVV  278

Query  403  --------EEFLELVKSallaaleglgpgslFGLATFSHKIGLYD  513
                    E+ L+ ++S+L A ++ L P +  G+  +   + +YD
Sbjct  279  LVIDECLDEQHLQYLQSSLHAFVDSLPPTTRIGIILYGRAVSVYD  323



>emb|CBK24810.2| unnamed protein product [Blastocystis hominis]
Length=763

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 78/179 (44%), Gaps = 25/179 (14%)
 Frame = +1

Query  13   AVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLP----RCE--N  174
             +R + N +PG         +P     +P   K   G PP        LP    RC   N
Sbjct  16   GIRFTFNTWPGTRMEATKCVIPMACLYSPL--KTIYGMPPA-------LPYQPVRCRQPN  66

Query  175  CWAYYNTYCEQEQWA--WTCALCGTLNGLP---SQAIARYSLPDSCPENMSSFIDLELPL  339
            C AY N YC+ +  A  WTC  CG  N  P   +Q I   SLP    E M S+  +E  +
Sbjct  67   CGAYLNPYCQIDFRAKLWTCPFCGQRNHFPPEYAQGINETSLPY---EVMPSYTTVEYEI  123

Query  340  EGSEEMQARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDV  516
            +G + +   PV++  +D     + L  +K AL   L  L   +L G+ +F   + ++++
Sbjct  124  QGRQSIP--PVFLIVIDTTVDAKELNSLKDALQQNLAYLPDNALVGVISFGTHVEVHEL  180



>ref|XP_009164005.1| hypothetical protein T265_01675 [Opisthorchis viverrini]
 gb|KER32243.1| hypothetical protein T265_01675 [Opisthorchis viverrini]
Length=1262

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 61/139 (44%), Gaps = 7/139 (5%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLP-RCENCWAYYN  192
            +R+S+   P   D ++  G+P+ +T++PFA+   +  P V    G   P RC  C AY N
Sbjct  260  IRSSLYAIPTTSDLMKTVGIPFTLTISPFASLHADDQPIVVSDMGEQGPVRCMRCRAYMN  319

Query  193  TYCE--QEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEEMQAR  366
             +         + C+LCG +  +P    A     D       ++   EL L GS E+ A 
Sbjct  320  PFASFIDGGRRFQCSLCGGVTEVPVNYFAHL---DHTGRRTDTYHRPELCL-GSYELTAT  375

Query  367  PVYVAAVDLASSEEFLELV  423
              Y    +L     FL L+
Sbjct  376  AEYCKNNELPLPPAFLFLL  394



>ref|XP_455249.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 sp|Q6CLE0.1|SEC24_KLULA RecName: Full=Protein transport protein SEC24 [Kluyveromyces 
lactis NRRL Y-1140]
 emb|CAG97957.1| KLLA0F03729p [Kluyveromyces lactis]
Length=924

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 51/116 (44%), Gaps = 4/116 (3%)
 Frame = +1

Query  1    NCAMAVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCW  180
            NC+  +R ++N  P +   L+ + LP  + + P+  K  +   PV  S+  ++ RC  C 
Sbjct  190  NCSDHLRCTLNAVPKNNSLLKKSKLPLAMVIRPYT-KLTDSECPVPTSEDGVVVRCRRCR  248

Query  181  AYYNTYCE--QEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLE  342
            AY N + +  +    W C  C   N  P QAI         PE   S +D   P E
Sbjct  249  AYLNPFVQVIENGLRWRCNFCNLANNFP-QAIDMNGNRYERPEFNHSVVDFVAPKE  303



>ref|XP_001326967.1| Sec23/Sec24 trunk domain containing protein [Trichomonas vaginalis 
G3]
 gb|EAY14744.1| Sec23/Sec24 trunk domain containing protein [Trichomonas vaginalis 
G3]
Length=745

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 72/174 (41%), Gaps = 17/174 (10%)
 Frame = +1

Query  13   AVRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLP----RCENCW  180
             +R S    P +        +P G   TP           + G D  +L      C NC 
Sbjct  11   GIRISTYALPTNQQDCASMAVPSGCIYTPLKK--------IEGRDMDILNYPPVECPNCH  62

Query  181  AYYNTY--CEQEQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEE  354
            +  N Y   + ++  W C LC +LN LP QA    +      E +  +  +E  L   + 
Sbjct  63   SILNPYAVVDYQKHTWVCPLCNSLNPLP-QAYHAMTETQQAAEIIKDYTTVEYLLR--DN  119

Query  355  MQARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDV  516
            M  RP++V  VDL S  +  + +K+ LL  +  L   +L GL TF   + L ++
Sbjct  120  MPERPIFVFVVDLCSVNKEHDYLKNILLQTISSLPSNALVGLITFGTNVYLKEL  173



>gb|KDN38703.1| putative SEC24-COPII coated vesicle component [Tilletiaria anomala 
UBC 951]
Length=1053

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 61/138 (44%), Gaps = 16/138 (12%)
 Frame = +1

Query  19   RASVNRFPGDPDALEVAGLPWGVTLTPF-AAKDENGNPPVYGSDGHLLPRCENCWAYYNT  195
            R ++N  P     L+   LP+G+ LTP+ + ++++G+ PV      ++ RC  C  Y N 
Sbjct  306  RCTLNAVPTTSALLQKTRLPFGLILTPYRSVREQDGDEPVPVVTDTVIARCRRCRTYINP  365

Query  196  YCEQEQWA--WTCALCGTLNGLP---------SQAIARYSLPDSCPENMSSFIDLELPLE  342
            Y +  +    W C +C   N +P         +Q   R+      PE   S ++   P E
Sbjct  366  YVQFIEGGNRWKCCMCNISNEVPQLFDWDQENNQPADRWKR----PELNHSVVEFIAPRE  421

Query  343  GSEEMQARPVYVAAVDLA  396
                    PVYV  +D++
Sbjct  422  YMVRPPQPPVYVFLIDVS  439



>gb|EFO62780.1| Sec24-like protein [Giardia lamblia P15]
Length=572

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 43/96 (45%), Gaps = 11/96 (11%)
 Frame = +1

Query  7    AMAVRA-SVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLP-------  162
            +MAV + S+N  P     L   G+P  + ++P A+ D   N  V G     +P       
Sbjct  51   SMAVLSCSLNTIPRSEGVLRKLGIPIALGVSPLASLD---NLHVVGLQSSSIPLITAPPI  107

Query  163  RCENCWAYYNTYCEQEQWAWTCALCGTLNGLPSQAI  270
            RC+ C  Y N Y      +WTC LC  +N  PS  I
Sbjct  108  RCQRCRGYMNPYNILLNESWTCVLCSRVNSYPSNRI  143



>ref|XP_007051293.1| Sec23/Sec24 protein transport family protein isoform 2 [Theobroma 
cacao]
 gb|EOX95450.1| Sec23/Sec24 protein transport family protein isoform 2 [Theobroma 
cacao]
Length=881

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 73/165 (44%), Gaps = 26/165 (16%)
 Frame = +1

Query  64   VAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYNTYCE--QEQWAWTCALC  237
            V  L +GV ++P   ++ +  P V   D H   RC NC AY N YC        W C +C
Sbjct  170  VPSLGFGVLVSP--GRETSPGPQVIQRDPH---RCHNCGAYSNFYCNILIGSGQWQCVIC  224

Query  238  GTLNGLPSQAIARYSLPDSCPENMSSFIDLELPL-EGSEEMQARPVYVAAVDLASS----  402
              LNG   + I       S  E++ +F +L  PL +  +    RP +V   D  +S    
Sbjct  225  RNLNGSEGEYIT------SSKEDLCNFPELSSPLVDFIQTGNKRPSFVPVTDSRTSAPIV  278

Query  403  --------EEFLELVKSallaaleglgpgslFGLATFSHKIGLYD  513
                    E  L+ ++S+L A +E + P +  G+  +   + +YD
Sbjct  279  LVIDECLDEPHLQHLQSSLHAFVESVLPTTRIGIILYGRTVSVYD  323



>ref|XP_001276901.1| Sec23/Sec24 trunk domain containing protein [Trichomonas vaginalis 
G3]
 gb|EAY23653.1| Sec23/Sec24 trunk domain containing protein [Trichomonas vaginalis 
G3]
Length=673

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 36/136 (26%), Positives = 63/136 (46%), Gaps = 13/136 (10%)
 Frame = +1

Query  19   RASVNRFPGDPDALEVAGLPWGVTLTPFAAK-DENGNPPVYGSDGHLLPRCENCWAYYNT  195
            R ++  FP   D    +G+P G+T+ P   + +E G+     S  ++L +C  C +++N+
Sbjct  36   RPTIKTFPRSTDLYIKSGIPLGITIEPAKVQVEEVGDL----SQSNIL-KCNRCGSFFNS  90

Query  196  YCEQ-EQWAWTCALCGTLNGLPSQAIARYSLPDSCPENMSSFIDLELPLEGSEEMQARPV  372
            +C       W C +C   N L S  +    +    PE  S  +DL  P   +EE    P 
Sbjct  91   WCRLINDKTWVCPVCNHENILVSADV----VLSQRPEKKSQVVDLLAPPLYAEESTRHPT  146

Query  373  YVAAVDLASSEEFLEL  420
            ++   D+  S+E + L
Sbjct  147  FLFMFDV--SQESISL  160



>emb|CDS06613.1| hypothetical protein LRAMOSA09141 [Absidia idahoensis var. thermophila]
Length=996

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 35/138 (25%), Positives = 62/138 (45%), Gaps = 10/138 (7%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLP-RCENCWAYYN  192
            +RA+V++ P   D  +++ LP G+ + P A + +   P      G   P RC  C AY N
Sbjct  269  MRATVDKIPYSKDLADLSKLPLGLVIQPLAKQKKEEVPLQVVDHGEEGPVRCNRCRAYIN  328

Query  193  TYCEQEQWA--WTCALCGTLNGLPSQAIARYSL------PDSCPENMSSFIDLELPLEGS  348
             +C   Q    + C +C  +N +PS   A   +       D  PE     ++  +P E +
Sbjct  329  PWCTFTQGGSRFICNICSHVNEVPSWYFANVDMSGRRVDADQRPELRYGSVEFAVPAEYN  388

Query  349  EEMQARPV-YVAAVDLAS  399
                   + Y+ A+D+++
Sbjct  389  STRSPTALNYIFALDVSA  406



>ref|XP_007051294.1| Sec23/Sec24 protein transport family protein isoform 3 [Theobroma 
cacao]
 gb|EOX95451.1| Sec23/Sec24 protein transport family protein isoform 3 [Theobroma 
cacao]
Length=817

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 73/165 (44%), Gaps = 26/165 (16%)
 Frame = +1

Query  64   VAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYNTYCE--QEQWAWTCALC  237
            V  L +GV ++P   ++ +  P V   D H   RC NC AY N YC        W C +C
Sbjct  170  VPSLGFGVLVSP--GRETSPGPQVIQRDPH---RCHNCGAYSNFYCNILIGSGQWQCVIC  224

Query  238  GTLNGLPSQAIARYSLPDSCPENMSSFIDLELPL-EGSEEMQARPVYVAAVDLASS----  402
              LNG   + I       S  E++ +F +L  PL +  +    RP +V   D  +S    
Sbjct  225  RNLNGSEGEYIT------SSKEDLCNFPELSSPLVDFIQTGNKRPSFVPVTDSRTSAPIV  278

Query  403  --------EEFLELVKSallaaleglgpgslFGLATFSHKIGLYD  513
                    E  L+ ++S+L A +E + P +  G+  +   + +YD
Sbjct  279  LVIDECLDEPHLQHLQSSLHAFVESVLPTTRIGIILYGRTVSVYD  323



>ref|XP_007051295.1| Sec23/Sec24 protein transport family protein isoform 4 [Theobroma 
cacao]
 gb|EOX95452.1| Sec23/Sec24 protein transport family protein isoform 4 [Theobroma 
cacao]
Length=711

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 73/165 (44%), Gaps = 26/165 (16%)
 Frame = +1

Query  64   VAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYNTYCE--QEQWAWTCALC  237
            V  L +GV ++P   ++ +  P V   D H   RC NC AY N YC        W C +C
Sbjct  170  VPSLGFGVLVSP--GRETSPGPQVIQRDPH---RCHNCGAYSNFYCNILIGSGQWQCVIC  224

Query  238  GTLNGLPSQAIARYSLPDSCPENMSSFIDLELPL-EGSEEMQARPVYVAAVDLASS----  402
              LNG   + I       S  E++ +F +L  PL +  +    RP +V   D  +S    
Sbjct  225  RNLNGSEGEYIT------SSKEDLCNFPELSSPLVDFIQTGNKRPSFVPVTDSRTSAPIV  278

Query  403  --------EEFLELVKSallaaleglgpgslFGLATFSHKIGLYD  513
                    E  L+ ++S+L A +E + P +  G+  +   + +YD
Sbjct  279  LVIDECLDEPHLQHLQSSLHAFVESVLPTTRIGIILYGRTVSVYD  323



>gb|EIJ94381.1| hypothetical protein NEPG_01049 [Nematocida parisii ERTm1]
Length=728

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 33/119 (28%), Positives = 52/119 (44%), Gaps = 17/119 (14%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYNT  195
            +R+S+   P D D  E+ GLP  +   PF   +E+   P Y +D   L +C+ C ++   
Sbjct  90   IRSSMYTVPADEDLFELIGLPLLIVAQPF---NESVAIPEYRTD--YLHKCKECGSFPTV  144

Query  196  Y------CEQEQWAWTCALCGTLNGLP------SQAIARYSLPDSCPENMSSFIDLELP  336
                    ++  + + C +CGT N LP       +    Y   DSC  N S +    LP
Sbjct  145  SDDLFRGQQESTYQFKCVMCGTTNDLPYDCPLLREPTVEYICEDSCISNRSWYSSDNLP  203



>ref|XP_007051292.1| Sec23/Sec24 protein transport family protein isoform 1 [Theobroma 
cacao]
 gb|EOX95449.1| Sec23/Sec24 protein transport family protein isoform 1 [Theobroma 
cacao]
Length=875

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 73/165 (44%), Gaps = 26/165 (16%)
 Frame = +1

Query  64   VAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYNTYCE--QEQWAWTCALC  237
            V  L +GV ++P   ++ +  P V   D H   RC NC AY N YC        W C +C
Sbjct  170  VPSLGFGVLVSP--GRETSPGPQVIQRDPH---RCHNCGAYSNFYCNILIGSGQWQCVIC  224

Query  238  GTLNGLPSQAIARYSLPDSCPENMSSFIDLELPL-EGSEEMQARPVYVAAVDLASS----  402
              LNG   + I       S  E++ +F +L  PL +  +    RP +V   D  +S    
Sbjct  225  RNLNGSEGEYIT------SSKEDLCNFPELSSPLVDFIQTGNKRPSFVPVTDSRTSAPIV  278

Query  403  --------EEFLELVKSallaaleglgpgslFGLATFSHKIGLYD  513
                    E  L+ ++S+L A +E + P +  G+  +   + +YD
Sbjct  279  LVIDECLDEPHLQHLQSSLHAFVESVLPTTRIGIILYGRTVSVYD  323



>ref|XP_001609240.1| Sec 24 protein transport protein [Babesia bovis T2Bo]
 gb|EDO05672.1| Sec 24 protein transport protein, putative [Babesia bovis]
Length=835

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 43/181 (24%), Positives = 73/181 (40%), Gaps = 13/181 (7%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFA-AKDENGNPPVYGSDGHLLPRCENCWAYYN  192
            +R++V   P      +   +P  V L P A   D +   P   ++   + RC+ C  Y N
Sbjct  131  IRSTVGVLPSSVKLQQKTNIPLAVVLRPMAPLSDSDPEIPFVNTNSETISRCKRCRTYIN  190

Query  193  TYC--EQEQWAWTCALCGTLNGLPSQ--AIARYSLPDSCP--------ENMSSFIDLELP  336
             +   +  +  WTC +CG  N LP++   I    + DS P        E M+S   +   
Sbjct  191  PFITLDGSRRYWTCNICGVSNELPNRYSDIPSIGMDDSVPVELRKGLIEYMASADYMARS  250

Query  337  LEGSEEMQARPVYVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYDV  516
             +    M    V V+AV+    E   + +   +       GP +L G+ TF   + +Y +
Sbjct  251  PQAPTIMFVIDVSVSAVNSGMLEVVCQTISDLIKTRELPGGPRTLVGIMTFDTSVHIYQM  310

Query  517  Q  519
             
Sbjct  311  N  311



>ref|XP_004030860.1| hypothetical protein IMG5_151710, partial [Ichthyophthirius multifiliis]
 gb|EGR29624.1| hypothetical protein IMG5_151710 [Ichthyophthirius multifiliis]
Length=857

 Score = 48.5 bits (114),  Expect = 0.001, Method: Composition-based stats.
 Identities = 27/88 (31%), Positives = 40/88 (45%), Gaps = 2/88 (2%)
 Frame = +1

Query  16   VRASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENCWAYYNT  195
            +R S+  F  DP+ ++  G+P G  +TPFA  +EN            + RC  C  Y N 
Sbjct  311  IRPSIYSFATDPNLIQQTGIPQGCIITPFAETEENVQIIDCSQPNTCMLRCSRCHGYINP  370

Query  196  YCEQEQWAWT--CALCGTLNGLPSQAIA  273
            Y    +   T  C LC   N +P++  A
Sbjct  371  YFIFTEGGNTAICNLCKQTNKVPNEYFA  398



>gb|EHJ70415.1| hypothetical protein KGM_15898 [Danaus plexippus]
Length=1348

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 53/121 (44%), Gaps = 12/121 (10%)
 Frame = +1

Query  1    NCAMAV-RASVNRFPGDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCENC  177
            NC+  + R +VNR P     L+ + LP G+ + PF  KD N  P +  +    + RC  C
Sbjct  644  NCSPEIFRCTVNRIPETNSLLQKSRLPLGILIHPF--KDLNHLPVIQCTT---IVRCRAC  698

Query  178  WAYYNTYCE-QEQWAWTCALCGTLNGLPSQ-----AIARYSLPDSCPENMSSFIDLELPL  339
              Y N +    +   W C LC  +N LP +         Y  P   PE  S+ I+   P 
Sbjct  699  RTYINPFVHFVDSKRWKCNLCYRVNELPEEFQYDPVSKSYGDPSRRPEVKSATIEFIAPS  758

Query  340  E  342
            E
Sbjct  759  E  759



>ref|XP_459434.1| DEHA2E02332p [Debaryomyces hansenii CBS767]
 sp|Q6BQT6.1|SEC23_DEBHA RecName: Full=Protein transport protein SEC23 [Debaryomyces hansenii 
CBS767]
 emb|CAG87648.1| DEHA2E02332p [Debaryomyces hansenii CBS767]
Length=746

 Score = 48.5 bits (114),  Expect = 0.001, Method: Composition-based stats.
 Identities = 54/181 (30%), Positives = 82/181 (45%), Gaps = 32/181 (18%)
 Frame = +1

Query  13   AVRASVNRFP---GDPDALEVAGLPWGVTLTPFAAKDENGNPPVYGSDGHLLPRCEN--C  177
             VR + N FP    D + L V   P G   TP   +++    P+   D H    C N  C
Sbjct  11   GVRFAWNTFPCTKADANKLVV---PTGALYTPLKFRED---LPIAEYDPHC---CLNTHC  61

Query  178  WAYYNTYCEQE-QWAWTCALCGTLNGLPS--QAIARYSLPDSCPENMSSFIDLELPLEGS  348
             +  N YC+ +   +W C +CG  N LPS  Q I+  +LP     N S+           
Sbjct  62   RSILNPYCQIDPTGSWICPICGNRNPLPSHYQGISNENLPLELNPNSSTI----------  111

Query  349  EEMQARPV-----YVAAVDLASSEEFLELVKSallaaleglgpgslFGLATFSHKIGLYD  513
            E + ARPV     +   +DL   E+ L+ +K  L+ +L  L P +L GL T+   + ++D
Sbjct  112  EYITARPVANPPIFFFVIDLCQDEDNLKALKETLVVSLSLLPPNALIGLITYGTMVQVHD  171

Query  514  V  516
            +
Sbjct  172  L  172



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566636427000