BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF010M17

Length=575
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009628969.1|  PREDICTED: LOW QUALITY PROTEIN: GATA transcr...    184   3e-53   
ref|XP_006345791.1|  PREDICTED: GATA transcription factor 8-like ...    176   4e-50   Solanum tuberosum [potatoes]
ref|XP_004239665.1|  PREDICTED: GATA transcription factor 8-like ...    176   4e-50   Solanum lycopersicum
ref|XP_004239666.1|  PREDICTED: GATA transcription factor 8-like ...    175   8e-50   Solanum lycopersicum
ref|XP_004239667.2|  PREDICTED: GATA transcription factor 8-like ...    176   2e-49   Solanum lycopersicum
emb|CDO99748.1|  unnamed protein product                                174   2e-49   Coffea canephora [robusta coffee]
ref|XP_009598426.1|  PREDICTED: GATA transcription factor 8-like        171   4e-48   Nicotiana tomentosiformis
dbj|BAC98495.1|  AG-motif binding protein-5                             171   4e-48   Nicotiana tabacum [American tobacco]
dbj|BAC98491.1|  AG-motif binding protein-1                             171   4e-48   Nicotiana tabacum [American tobacco]
ref|XP_009760862.1|  PREDICTED: GATA transcription factor 8-like        170   7e-48   Nicotiana sylvestris
ref|XP_006350222.1|  PREDICTED: GATA transcription factor 8-like ...    167   1e-46   Solanum tuberosum [potatoes]
ref|XP_009605437.1|  PREDICTED: GATA transcription factor 8-like        166   2e-46   Nicotiana tomentosiformis
ref|XP_009802378.1|  PREDICTED: GATA transcription factor 8-like        166   2e-46   Nicotiana sylvestris
ref|XP_011076972.1|  PREDICTED: GATA transcription factor 8-like        163   3e-45   Sesamum indicum [beniseed]
ref|XP_004236632.1|  PREDICTED: GATA transcription factor 8             161   3e-44   Solanum lycopersicum
ref|XP_011084325.1|  PREDICTED: GATA transcription factor 8             145   2e-38   Sesamum indicum [beniseed]
emb|CBI31452.3|  unnamed protein product                                140   4e-38   Vitis vinifera
ref|XP_002273502.1|  PREDICTED: GATA transcription factor 8-like        141   1e-36   Vitis vinifera
gb|EYU39843.1|  hypothetical protein MIMGU_mgv1a010405mg                125   6e-31   Erythranthe guttata [common monkey flower]
ref|XP_006436435.1|  hypothetical protein CICLE_v10032018mg             116   2e-27   
gb|KDO44680.1|  hypothetical protein CISIN_1g016706mg                   116   2e-27   Citrus sinensis [apfelsine]
gb|EYU39605.1|  hypothetical protein MIMGU_mgv1a011769mg                110   7e-26   Erythranthe guttata [common monkey flower]
ref|XP_007009854.1|  Plant-specific GATA-type zinc finger transcr...    110   2e-25   
ref|XP_007009853.1|  Plant-specific GATA-type zinc finger transcr...    109   8e-25   
ref|XP_004142426.1|  PREDICTED: GATA transcription factor 9-like        107   5e-24   Cucumis sativus [cucumbers]
ref|XP_008446884.1|  PREDICTED: GATA transcription factor 8             105   2e-23   Cucumis melo [Oriental melon]
gb|KDP44375.1|  hypothetical protein JCGZ_20055                         105   2e-23   Jatropha curcas
ref|XP_006606248.1|  PREDICTED: GATA transcription factor 8-like ...    104   3e-23   Glycine max [soybeans]
ref|XP_003556234.1|  PREDICTED: GATA transcription factor 8-like ...    103   5e-23   Glycine max [soybeans]
ref|XP_002534043.1|  GATA transcription factor, putative                102   2e-22   Ricinus communis
emb|CDP19135.1|  unnamed protein product                              97.4    2e-22   Coffea canephora [robusta coffee]
ref|XP_007143712.1|  hypothetical protein PHAVU_007G095300g             102   3e-22   Phaseolus vulgaris [French bean]
ref|XP_010092608.1|  GATA transcription factor 9                        100   1e-21   Morus notabilis
ref|XP_003536350.1|  PREDICTED: GATA transcription factor 8-like ...  99.0    3e-21   
ref|XP_011041012.1|  PREDICTED: GATA transcription factor 8-like      96.7    2e-20   Populus euphratica
gb|KHN17141.1|  GATA transcription factor 9                           95.9    4e-20   Glycine soja [wild soybean]
gb|KJB73559.1|  hypothetical protein B456_011G238800                  95.9    4e-20   Gossypium raimondii
ref|XP_010683872.1|  PREDICTED: GATA transcription factor 8           94.4    1e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010032183.1|  PREDICTED: GATA transcription factor 8-like ...  94.4    1e-19   Eucalyptus grandis [rose gum]
ref|XP_002311088.1|  zinc finger family protein                       93.6    2e-19   Populus trichocarpa [western balsam poplar]
ref|XP_007218229.1|  hypothetical protein PRUPE_ppa007936mg           93.2    3e-19   Prunus persica
ref|XP_004496271.1|  PREDICTED: GATA transcription factor 8-like ...  91.7    1e-18   Cicer arietinum [garbanzo]
ref|XP_006378769.1|  hypothetical protein POPTR_0010s23010g           91.3    1e-18   
ref|XP_011031733.1|  PREDICTED: GATA transcription factor 8-like      91.3    2e-18   Populus euphratica
gb|KHG18876.1|  GATA transcription factor 8 -like protein             90.9    2e-18   Gossypium arboreum [tree cotton]
dbj|BAP90356.1|  GATA type zinc finger domain                         89.0    1e-17   Populus nigra [black poplar]
ref|XP_003548072.1|  PREDICTED: GATA transcription factor 8-like ...  87.8    2e-17   Glycine max [soybeans]
ref|XP_006574762.1|  PREDICTED: GATA transcription factor 8-like ...  87.8    2e-17   Glycine max [soybeans]
ref|XP_007151876.1|  hypothetical protein PHAVU_004G083100g           87.8    2e-17   Phaseolus vulgaris [French bean]
ref|XP_008233316.1|  PREDICTED: GATA transcription factor 8           87.0    4e-17   Prunus mume [ume]
ref|XP_003519961.2|  PREDICTED: GATA transcription factor 8-like ...  87.8    5e-17   Glycine max [soybeans]
ref|XP_010067308.1|  PREDICTED: GATA transcription factor 8-like      86.3    7e-17   Eucalyptus grandis [rose gum]
ref|XP_008347480.1|  PREDICTED: GATA transcription factor 8-like      85.5    2e-16   
ref|XP_010264666.1|  PREDICTED: GATA transcription factor 8-like      85.1    2e-16   Nelumbo nucifera [Indian lotus]
ref|XP_008367332.1|  PREDICTED: GATA transcription factor 8-like      85.1    2e-16   Malus domestica [apple tree]
ref|XP_009344766.1|  PREDICTED: GATA transcription factor 8-like      85.1    2e-16   Pyrus x bretschneideri [bai li]
ref|XP_009345388.1|  PREDICTED: GATA transcription factor 8-like      85.1    2e-16   Pyrus x bretschneideri [bai li]
gb|EPS57112.1|  hypothetical protein M569_17713                       80.5    6e-16   Genlisea aurea
ref|XP_010253699.1|  PREDICTED: GATA transcription factor 8-like      82.4    1e-15   Nelumbo nucifera [Indian lotus]
ref|XP_009770305.1|  PREDICTED: GATA transcription factor 8-like      81.6    2e-15   Nicotiana sylvestris
gb|KJB60582.1|  hypothetical protein B456_009G313700                  80.9    5e-15   Gossypium raimondii
gb|KHG25368.1|  GATA transcription factor 8 -like protein             76.3    3e-13   Gossypium arboreum [tree cotton]
ref|XP_010555821.1|  PREDICTED: GATA transcription factor 8           73.2    4e-12   Tarenaya hassleriana [spider flower]
ref|XP_010554544.1|  PREDICTED: GATA transcription factor 8-like      72.4    6e-12   Tarenaya hassleriana [spider flower]
gb|ACJ02090.1|  AG-motif binding protein                              70.9    3e-11   Garcinia mangostana [mangosteen]
ref|XP_004307386.1|  PREDICTED: GATA transcription factor 8           70.5    3e-11   Fragaria vesca subsp. vesca
emb|CDY67017.1|  BnaCnng53150D                                        63.2    1e-08   Brassica napus [oilseed rape]
dbj|BAH20385.1|  AT3G54810                                            63.2    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010427201.1|  PREDICTED: GATA transcription factor 8-like ...  62.8    1e-08   Camelina sativa [gold-of-pleasure]
ref|NP_191041.1|  GATA transcription factor 8                         61.2    5e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876270.1|  BME3/BME3-ZF                                     61.2    5e-08   
emb|CDX73447.1|  BnaC08g25560D                                        60.5    9e-08   
ref|XP_010427202.1|  PREDICTED: GATA transcription factor 8-like ...  60.5    9e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010504307.1|  PREDICTED: GATA transcription factor 8           60.5    9e-08   Camelina sativa [gold-of-pleasure]
ref|XP_009116158.1|  PREDICTED: GATA transcription factor 8           58.9    3e-07   Brassica rapa
emb|CDY02894.1|  BnaC04g25920D                                        58.5    4e-07   
emb|CDX78264.1|  BnaA09g34590D                                        58.5    4e-07   
ref|XP_006403533.1|  hypothetical protein EUTSA_v10010544mg           57.8    7e-07   Eutrema salsugineum [saltwater cress]
ref|XP_006291493.1|  hypothetical protein CARUB_v10017647mg           57.8    8e-07   Capsella rubella
ref|XP_004149904.1|  PREDICTED: GATA transcription factor 4-like      56.6    2e-06   Cucumis sativus [cucumbers]
ref|XP_006591215.1|  PREDICTED: VHS domain-containing protein At3...  54.3    7e-06   
ref|XP_006591214.1|  PREDICTED: VHS domain-containing protein At3...  53.5    2e-05   
emb|CDY07522.1|  BnaC06g15420D                                        53.9    2e-05   Brassica napus [oilseed rape]
ref|XP_010516023.1|  PREDICTED: GATA transcription factor 8-like      53.5    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010032187.1|  PREDICTED: GATA transcription factor 8-like ...  52.0    6e-05   Eucalyptus grandis [rose gum]
ref|XP_009103933.1|  PREDICTED: GATA transcription factor 8-like      52.0    7e-05   Brassica rapa
emb|CDX67609.1|  BnaA07g16490D                                        51.2    1e-04   



>ref|XP_009628969.1| PREDICTED: LOW QUALITY PROTEIN: GATA transcription factor 8-like 
[Nicotiana tomentosiformis]
Length=320

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 133/165 (81%), Gaps = 5/165 (3%)
 Frame = +3

Query  78   MDSNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIWDEPLPDSDPIFsaah  257
            M SNFVDEIDCGSFFD IDDLI+FP ENECGG+ S DC  FPSIWD+PLPDSDP+FS ++
Sbjct  1    MGSNFVDEIDCGSFFDQIDDLIEFPSENECGGLSSTDCKEFPSIWDQPLPDSDPLFSGSY  60

Query  258  shsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAAs  437
            ++S SDLSAELSVPYEDIVQLEWLS FVE+SFS  GLTLGKEN P+N K  S  KFQ++ 
Sbjct  61   NNSPSDLSAELSVPYEDIVQLEWLSTFVEDSFSGRGLTLGKENAPIN-KETSHSKFQSS-  118

Query  438  spisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRP  572
               S +    SSSSSS+SSCSGGK  PLSP  RG QRARSKRPRP
Sbjct  119  ---SPVSVLESSSSSSSSSCSGGKTFPLSPCHRGPQRARSKRPRP  160



>ref|XP_006345791.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006345792.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006345793.1| PREDICTED: GATA transcription factor 8-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006345794.1| PREDICTED: GATA transcription factor 8-like isoform X4 [Solanum 
tuberosum]
Length=328

 Score =   176 bits (446),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 129/166 (78%), Gaps = 3/166 (2%)
 Frame = +3

Query  78   MDSNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIWDEPLPDSDPIFsaah  257
            M SN VDEIDCGSFFDHIDDLIDFP ENE  G+ S DC +FPSIW++PLPDSD +FS +H
Sbjct  1    MGSNVVDEIDCGSFFDHIDDLIDFPLENENVGLSSTDCKDFPSIWNDPLPDSDSLFSGSH  60

Query  258  shsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAAs  437
             +SASDLSAELSVPYEDIVQLEWLS FVE+SFS GGLTLGKEN P+  +P S  KFQ + 
Sbjct  61   RNSASDLSAELSVPYEDIVQLEWLSTFVEDSFSGGGLTLGKENIPVEKEPLSQGKFQTS-  119

Query  438  spisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
                V    SSSSSSS+ S SG K +PLSP  RG QRAR+KRPRP 
Sbjct  120  --SPVSVLESSSSSSSSFSSSGEKTLPLSPCHRGPQRARTKRPRPT  163



>ref|XP_004239665.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Solanum 
lycopersicum]
Length=341

 Score =   176 bits (446),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 130/167 (78%), Gaps = 3/167 (2%)
 Frame = +3

Query  75   SMDSNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIWDEPLPDSDPIFsaa  254
            +M SN VDEIDCGSFFDHIDDLIDFP E+E  G+ S DC +FPSIW++PLPDSD +FS +
Sbjct  14   TMGSNVVDEIDCGSFFDHIDDLIDFPLESENVGLSSTDCKDFPSIWNDPLPDSDSLFSGS  73

Query  255  hshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAA  434
            H +SASDLSAELSVPYEDIVQLEWLS FVE+SFS GGLTLGKEN P+  +P S  KFQ +
Sbjct  74   HRNSASDLSAELSVPYEDIVQLEWLSTFVEDSFSGGGLTLGKENIPVEKEPSSQGKFQTS  133

Query  435  sspisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
                 V    SSSSSSS+ S SG K +PLSP  RG QRAR+KRPRP 
Sbjct  134  ---SPVSVLESSSSSSSSFSSSGEKTLPLSPCHRGPQRARTKRPRPT  177



>ref|XP_004239666.1| PREDICTED: GATA transcription factor 8-like isoform X3 [Solanum 
lycopersicum]
 ref|XP_010321318.1| PREDICTED: GATA transcription factor 8-like isoform X3 [Solanum 
lycopersicum]
 ref|XP_010321319.1| PREDICTED: GATA transcription factor 8-like isoform X3 [Solanum 
lycopersicum]
Length=327

 Score =   175 bits (444),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 129/166 (78%), Gaps = 3/166 (2%)
 Frame = +3

Query  78   MDSNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIWDEPLPDSDPIFsaah  257
            M SN VDEIDCGSFFDHIDDLIDFP E+E  G+ S DC +FPSIW++PLPDSD +FS +H
Sbjct  1    MGSNVVDEIDCGSFFDHIDDLIDFPLESENVGLSSTDCKDFPSIWNDPLPDSDSLFSGSH  60

Query  258  shsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAAs  437
             +SASDLSAELSVPYEDIVQLEWLS FVE+SFS GGLTLGKEN P+  +P S  KFQ + 
Sbjct  61   RNSASDLSAELSVPYEDIVQLEWLSTFVEDSFSGGGLTLGKENIPVEKEPSSQGKFQTS-  119

Query  438  spisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
                V    SSSSSSS+ S SG K +PLSP  RG QRAR+KRPRP 
Sbjct  120  --SPVSVLESSSSSSSSFSSSGEKTLPLSPCHRGPQRARTKRPRPT  163



>ref|XP_004239667.2| PREDICTED: GATA transcription factor 8-like isoform X1 [Solanum 
lycopersicum]
Length=410

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 130/167 (78%), Gaps = 3/167 (2%)
 Frame = +3

Query  75   SMDSNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIWDEPLPDSDPIFsaa  254
            +M SN VDEIDCGSFFDHIDDLIDFP E+E  G+ S DC +FPSIW++PLPDSD +FS +
Sbjct  83   TMGSNVVDEIDCGSFFDHIDDLIDFPLESENVGLSSTDCKDFPSIWNDPLPDSDSLFSGS  142

Query  255  hshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAA  434
            H +SASDLSAELSVPYEDIVQLEWLS FVE+SFS GGLTLGKEN P+  +P S  KFQ +
Sbjct  143  HRNSASDLSAELSVPYEDIVQLEWLSTFVEDSFSGGGLTLGKENIPVEKEPSSQGKFQTS  202

Query  435  sspisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
                 V    SSSSSSS+ S SG K +PLSP  RG QRAR+KRPRP 
Sbjct  203  ---SPVSVLESSSSSSSSFSSSGEKTLPLSPCHRGPQRARTKRPRPT  246



>emb|CDO99748.1| unnamed protein product [Coffea canephora]
Length=341

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 132/168 (79%), Gaps = 7/168 (4%)
 Frame = +3

Query  78   MDSNFVDEIDCGSFFDHIDDLIDFPPENECGG--VGSGDCANFPSIWDEPLPDSDPIFsa  251
            M  NFVDEIDCGSFFDHIDDLI+FPPENECG   VGSGDC NFPS+WDE LPD+D +F+ 
Sbjct  1    MGPNFVDEIDCGSFFDHIDDLIEFPPENECGNGLVGSGDCKNFPSLWDEALPDTDTLFTG  60

Query  252  ahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQA  431
              S+SASDLSAELSVPYEDIVQLEWLS FVE+SFS GG+TL K+N  +N K     +FQ 
Sbjct  61   NTSNSASDLSAELSVPYEDIVQLEWLSTFVEDSFSGGGMTLSKDNSSVN-KDNPCNQFQT  119

Query  432  AsspisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
            +    S +    SSSSSS+SSCSGGK +PLSP+ RG QRARSKRPRP 
Sbjct  120  S----SPVSVLESSSSSSSSSCSGGKTIPLSPNHRGPQRARSKRPRPA  163



>ref|XP_009598426.1| PREDICTED: GATA transcription factor 8-like [Nicotiana tomentosiformis]
 ref|XP_009598427.1| PREDICTED: GATA transcription factor 8-like [Nicotiana tomentosiformis]
Length=343

 Score =   171 bits (433),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 131/167 (78%), Gaps = 6/167 (4%)
 Frame = +3

Query  78   MDSNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIWDEPLPDSDPIFsaah  257
            M SN VDEIDCGSFFDHIDDLI+FP ENE  G+ S DC +FP+IW++PLPDSD +FS +H
Sbjct  1    MGSNLVDEIDCGSFFDHIDDLIEFPLENEGAGLSSTDCKDFPTIWNDPLPDSDSLFSGSH  60

Query  258  shsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAAs  437
             +SASD SAELSVPYEDIVQLEWLSAFVE+SFS GGLTLGK+N+PLN K  S+ KFQ + 
Sbjct  61   RNSASDFSAELSVPYEDIVQLEWLSAFVEDSFSGGGLTLGKDNFPLN-KETSEAKFQTS-  118

Query  438  spisvlesssssssssnsscsGGKAMPL-SPSQRGAQRARSKRPRPV  575
               S +    SSSS S+SSCS  K +PL SP  RG QRARSKRPRP 
Sbjct  119  ---SPVSVLESSSSCSSSSCSVEKTVPLSSPCHRGPQRARSKRPRPA  162



>dbj|BAC98495.1| AG-motif binding protein-5 [Nicotiana tabacum]
Length=342

 Score =   171 bits (433),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 128/167 (77%), Gaps = 6/167 (4%)
 Frame = +3

Query  78   MDSNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIWDEPLPDSDPIFsaah  257
            M SN VDEIDCGSFFDHIDDLIDFP ENE  G+ S DC +FPSIW++PLPDSD +FS +H
Sbjct  1    MGSNLVDEIDCGSFFDHIDDLIDFPLENESAGLSSTDCKDFPSIWNDPLPDSDSLFSGSH  60

Query  258  shsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAAs  437
             +SASD SAELSVPYEDIVQLEWLS FVE+SFS GGLTLGKEN+PL  K  S+ KFQ +S
Sbjct  61   RNSASDFSAELSVPYEDIVQLEWLSTFVEDSFSGGGLTLGKENFPLY-KETSEAKFQTSS  119

Query  438  spisvlesssssssssnsscsGGKAMPL-SPSQRGAQRARSKRPRPV  575
                +  SSSSSSSS +      K +PL SP  RG QRARSKRPRP 
Sbjct  120  PVSVLESSSSSSSSSCSVE----KTVPLSSPCHRGPQRARSKRPRPA  162



>dbj|BAC98491.1| AG-motif binding protein-1 [Nicotiana tabacum]
Length=343

 Score =   171 bits (433),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 130/167 (78%), Gaps = 6/167 (4%)
 Frame = +3

Query  78   MDSNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIWDEPLPDSDPIFsaah  257
            M SN VDEIDCGSFFDHIDDLI+FP ENE  G+ S DC +FP+IW++PLPDSD +FS +H
Sbjct  1    MGSNLVDEIDCGSFFDHIDDLIEFPLENEGAGLSSTDCKDFPTIWNDPLPDSDSLFSGSH  60

Query  258  shsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAAs  437
             +SASD SAELSVPYEDIVQLEWLSAFVE+SFS GGLTLGK+N+PLN K  S+ KFQ +S
Sbjct  61   RNSASDFSAELSVPYEDIVQLEWLSAFVEDSFSGGGLTLGKDNFPLN-KETSEAKFQTSS  119

Query  438  spisvlesssssssssnsscsGGKAMPL-SPSQRGAQRARSKRPRPV  575
                +  SSSSSSSS +      K +PL SP  RG QRARSKRPRP 
Sbjct  120  PVSVLESSSSSSSSSCSVE----KTVPLSSPCHRGPQRARSKRPRPA  162



>ref|XP_009760862.1| PREDICTED: GATA transcription factor 8-like [Nicotiana sylvestris]
 ref|XP_009760863.1| PREDICTED: GATA transcription factor 8-like [Nicotiana sylvestris]
Length=332

 Score =   170 bits (431),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 129/166 (78%), Gaps = 8/166 (5%)
 Frame = +3

Query  78   MDSNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIWDEPLPDSDPIFsaah  257
            M SN VDEIDCGSFFD IDDLI+FP ENECGG  S DC  FPSIWD+P   SDP+FS ++
Sbjct  1    MGSNMVDEIDCGSFFDQIDDLIEFPSENECGGFSSTDCKEFPSIWDQP---SDPLFSGSY  57

Query  258  shsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAAs  437
            ++S SDLSAELSVPYEDIVQLEWLS FVE+SFS GGLTLGKEN P+N K  S  KFQ++ 
Sbjct  58   NNSPSDLSAELSVPYEDIVQLEWLSTFVEDSFSAGGLTLGKENAPIN-KETSHSKFQSS-  115

Query  438  spisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
               S +    SS SSS+SSCSGGK +PLSP  RG QRARSKRPRP 
Sbjct  116  ---SPVSVLESSGSSSSSSCSGGKTIPLSPCHRGPQRARSKRPRPA  158



>ref|XP_006350222.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006350223.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Solanum 
tuberosum]
Length=344

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 131/166 (79%), Gaps = 1/166 (1%)
 Frame = +3

Query  78   MDSNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIWDEPLPDSDPIFsaah  257
            M S+FVDEIDC SFFDH++DLI+F PENECGG+ + DC +FPSIW++PLPDSDP+FS ++
Sbjct  1    MGSDFVDEIDCSSFFDHMEDLIEFSPENECGGLDAVDCKDFPSIWNDPLPDSDPLFSGSY  60

Query  258  shsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAAs  437
            S+SASD SAELSVPYEDIVQLEWLS FVE+SFS GGLTLGKE+  +  K  SD KF  +S
Sbjct  61   SNSASDFSAELSVPYEDIVQLEWLSTFVEDSFSCGGLTLGKEHCSVK-KESSDSKFLTSS  119

Query  438  spisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
                +  SSSSSSSS++SS  G    PLSP  RG QRAR+KRPRP 
Sbjct  120  PVSVLESSSSSSSSSTSSSGPGKTLPPLSPCTRGPQRARTKRPRPT  165



>ref|XP_009605437.1| PREDICTED: GATA transcription factor 8-like [Nicotiana tomentosiformis]
Length=339

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 123/166 (74%), Gaps = 5/166 (3%)
 Frame = +3

Query  78   MDSNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIWDEPLPDSDPIFsaah  257
            M SN VDEIDC SFFDHIDDL++F PENECG + S DC NFPSI ++PLPDS P+F ++H
Sbjct  1    MASNLVDEIDCASFFDHIDDLVEFSPENECGDLDSTDCKNFPSICNDPLPDSGPLFFSSH  60

Query  258  shsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAAs  437
             +S SD SAEL VPYEDIVQLEWLS FVE+SFS GGLT+GKE++P+N +P   K   ++ 
Sbjct  61   RNSPSDFSAELLVPYEDIVQLEWLSTFVEDSFSCGGLTMGKEHFPVNKEPSHSKFLSSS-  119

Query  438  spisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
                 +    SSSSSS+SS +G    PLSP  RG QRARSKRPRP 
Sbjct  120  ----PVSVLESSSSSSSSSGAGKTTPPLSPCHRGTQRARSKRPRPA  161



>ref|XP_009802378.1| PREDICTED: GATA transcription factor 8-like [Nicotiana sylvestris]
 ref|XP_009802379.1| PREDICTED: GATA transcription factor 8-like [Nicotiana sylvestris]
Length=338

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 123/166 (74%), Gaps = 5/166 (3%)
 Frame = +3

Query  78   MDSNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIWDEPLPDSDPIFsaah  257
            M S+ VDEIDC SFFDH+DDLI+F PENECG + S DC NFPSI +EPLPDSDP+F ++H
Sbjct  1    MGSSLVDEIDCASFFDHMDDLIEFSPENECGDLDSTDCKNFPSICNEPLPDSDPLFFSSH  60

Query  258  shsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAAs  437
             +S SD S+EL VPYEDIVQLEWLS FVE+SFS GGLT+GKE++P+N +P  +K   ++ 
Sbjct  61   RNSPSDFSSELLVPYEDIVQLEWLSTFVEDSFSCGGLTMGKEHFPVNKEPSHNKFLSSSP  120

Query  438  spisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
              +    SSSSSSS +  +       PLSP  RG QRARSKRPRP 
Sbjct  121  VSVLESSSSSSSSSGAVKTTP-----PLSPCHRGTQRARSKRPRPA  161



>ref|XP_011076972.1| PREDICTED: GATA transcription factor 8-like [Sesamum indicum]
 ref|XP_011076974.1| PREDICTED: GATA transcription factor 8-like [Sesamum indicum]
Length=328

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 128/168 (76%), Gaps = 10/168 (6%)
 Frame = +3

Query  78   MDSNFVDEIDCGSFFDHIDDLIDFPPENECGG---VGSGDCANFPSIWDEPLPDSDPIFs  248
            M+SNFVDEIDCGSFFD +DDLI+FPP+N+CG    + SGDC +F ++W++ LPD+DP FS
Sbjct  1    MESNFVDEIDCGSFFDQMDDLIEFPPDNDCGDGNLISSGDCEDFTNMWNDALPDADPFFS  60

Query  249  aahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQ  428
             +H   ASDLSAELSVPYEDIVQLEWLS FVE+SFS GGLT+GKEN  ++ +  S   F+
Sbjct  61   GSHVDCASDLSAELSVPYEDIVQLEWLSTFVEDSFSGGGLTIGKENLSIDVE-SSRNPFR  119

Query  429  AAsspisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRP  572
             +         S   SSSS+SSCSGGK MPLSPS RG QRARSKRPRP
Sbjct  120  TS------SPVSVLESSSSSSSCSGGKTMPLSPSHRGTQRARSKRPRP  161



>ref|XP_004236632.1| PREDICTED: GATA transcription factor 8 [Solanum lycopersicum]
 ref|XP_010319208.1| PREDICTED: GATA transcription factor 8 [Solanum lycopersicum]
Length=337

 Score =   161 bits (407),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = +3

Query  78   MDSNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIWDEPLPDSDPIFsaah  257
            M S+FVDEIDC SFFDH++DLI+F PEN CGGV + DC +FPSIW++PLPDSDP FS ++
Sbjct  1    MGSDFVDEIDCSSFFDHMEDLIEFSPENVCGGVDAVDCNDFPSIWNDPLPDSDPFFSGSY  60

Query  258  shsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAAs  437
            S+SASD SAELSVP EDIVQLEWLS FVE+SFS GGLTLGKE+  +  K  SD KF  +S
Sbjct  61   SNSASDFSAELSVPLEDIVQLEWLSTFVEDSFSCGGLTLGKEHCSVK-KESSDSKFLTSS  119

Query  438  spisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
                +  SSSSSSSS++SS  G    PLSP  RG QRAR+KRPRP 
Sbjct  120  PVSVLESSSSSSSSSTSSSGPGKTLPPLSPCPRGPQRARTKRPRPT  165



>ref|XP_011084325.1| PREDICTED: GATA transcription factor 8 [Sesamum indicum]
Length=333

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 128/172 (74%), Gaps = 12/172 (7%)
 Frame = +3

Query  78   MDSNFVDEIDCGSFFDHIDDLIDFPPENECGG-----VGSGDCANFPSIWDEPLPDSDPI  242
            M  NF+DEIDCG+FFD IDDLI+FPPENE GG     V S D   F S+W++ LP+SDP 
Sbjct  1    MGPNFMDEIDCGNFFDQIDDLIEFPPENESGGGGGNLVSSVDSKAFSSMWNDALPESDPF  60

Query  243  FsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPE-SDK  419
            FS +H +S+SDLSAELSVPYEDIVQLEWLS F+E+SFS  G+T+GKEN  L P+ E SD 
Sbjct  61   FSGSHGNSSSDLSAELSVPYEDIVQLEWLSTFMEDSFSGQGMTVGKEN--LCPEMEPSDN  118

Query  420  KFQAAsspisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
            +FQ +S    +  SSSSS+SSS+      KAMPLSPS RG QRARSKRPRP 
Sbjct  119  QFQTSSPISVLESSSSSSTSSSSE----AKAMPLSPSHRGPQRARSKRPRPA  166



>emb|CBI31452.3| unnamed protein product [Vitis vinifera]
Length=185

 Score =   140 bits (354),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 115/166 (69%), Gaps = 11/166 (7%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIW---DEPLPDSDPIFsaah  257
            NF+DEIDCGSFFDHIDDL++FPPE+  GG+  GDC +FPSIW    +PLP  D +FS  +
Sbjct  5    NFMDEIDCGSFFDHIDDLLEFPPEDVSGGLMGGDCNSFPSIWTNASDPLPGPDSVFSGPN  64

Query  258  shsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAAs  437
            S+S SDLSAELSVPYEDIVQLEWLS FVE+SFS G + L KE+  +  K     +FQ +S
Sbjct  65   SNSNSDLSAELSVPYEDIVQLEWLSNFVEDSFSGGSIGLNKEDGSI-VKDSPHHQFQTSS  123

Query  438  spisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
                +  SSS S           K +PLSP+ RGAQRARSKRPRP 
Sbjct  124  PVSVLESSSSCSGGGG-------KTIPLSPNHRGAQRARSKRPRPA  162



>ref|XP_002273502.1| PREDICTED: GATA transcription factor 8-like [Vitis vinifera]
Length=340

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 115/166 (69%), Gaps = 11/166 (7%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIW---DEPLPDSDPIFsaah  257
            NF+DEIDCGSFFDHIDDL++FPPE+  GG+  GDC +FPSIW    +PLP  D +FS  +
Sbjct  5    NFMDEIDCGSFFDHIDDLLEFPPEDVSGGLMGGDCNSFPSIWTNASDPLPGPDSVFSGPN  64

Query  258  shsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAAs  437
            S+S SDLSAELSVPYEDIVQLEWLS FVE+SFS G + L KE+  +  K     +FQ +S
Sbjct  65   SNSNSDLSAELSVPYEDIVQLEWLSNFVEDSFSGGSIGLNKEDGSIV-KDSPHHQFQTSS  123

Query  438  spisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
                +  SSS S           K +PLSP+ RGAQRARSKRPRP 
Sbjct  124  PVSVLESSSSCSGGGG-------KTIPLSPNHRGAQRARSKRPRPA  162



>gb|EYU39843.1| hypothetical protein MIMGU_mgv1a010405mg [Erythranthe guttata]
Length=313

 Score =   125 bits (314),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 120/173 (69%), Gaps = 15/173 (9%)
 Frame = +3

Query  78   MDSNFVDEIDCGSFFDHIDDLIDFPPENE-CGG--VGSGDCANFPSIW-DEPLPDSDPIF  245
            M+ NF+DEIDCG+FFD IDDLI+FPP+NE  GG  V S    +FPS+W D+ LP+SD +F
Sbjct  1    MEPNFMDEIDCGNFFDQIDDLIEFPPDNEDVGGIFVNSDSSKDFPSMWNDDALPESDHLF  60

Query  246  saahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTL-GKEN---YPLNPKPES  413
                +++ASDLSAELSVPYEDIVQLEWLS FVE+SFS GG+T+  KEN   +   P   +
Sbjct  61   ---SANAASDLSAELSVPYEDIVQLEWLSTFVEDSFSGGGMTIAAKENLREHKNEPTSHT  117

Query  414  DKKFQAAsspisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRP  572
              +FQ +    S +    S+SSSS+++  G     L P+ RG QRARSKRPRP
Sbjct  118  TYQFQTS----SPVSVLESTSSSSSTTSVGQTTAHLPPTHRGPQRARSKRPRP  166



>ref|XP_006436435.1| hypothetical protein CICLE_v10032018mg [Citrus clementina]
 ref|XP_006436436.1| hypothetical protein CICLE_v10032018mg [Citrus clementina]
 ref|XP_006436437.1| hypothetical protein CICLE_v10032018mg [Citrus clementina]
 ref|XP_006485699.1| PREDICTED: GATA transcription factor 8-like [Citrus sinensis]
 gb|ESR49675.1| hypothetical protein CICLE_v10032018mg [Citrus clementina]
 gb|ESR49676.1| hypothetical protein CICLE_v10032018mg [Citrus clementina]
 gb|ESR49677.1| hypothetical protein CICLE_v10032018mg [Citrus clementina]
Length=341

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 108/168 (64%), Gaps = 14/168 (8%)
 Frame = +3

Query  84   SNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIW---DEPLPDSDPIFsaa  254
            +NF+DEIDCGSFFDHIDDL+DFP E+   G+ + D  +FPSIW    + LP SD +F   
Sbjct  4    TNFMDEIDCGSFFDHIDDLLDFPNEDVEAGLPNADSNSFPSIWPTQSDSLPGSDSVF---  60

Query  255  hshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGK-ENYPLNPKPESDKKFQA  431
             S+S++DLS +LSVPYEDIVQLEWLS FVE+SFS G LT+ K E+  +     S  +FQ 
Sbjct  61   -SNSSTDLSTQLSVPYEDIVQLEWLSNFVEDSFSGGSLTMSKQESSTITKDDSSHNQFQT  119

Query  432  AsspisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
            +S    +  SSS S   +      G     +P +RG  RARSKRPRP 
Sbjct  120  SSPVSVLESSSSCSGEKTVL----GSPETTAPGRRG--RARSKRPRPA  161



>gb|KDO44680.1| hypothetical protein CISIN_1g016706mg [Citrus sinensis]
 gb|KDO44681.1| hypothetical protein CISIN_1g016706mg [Citrus sinensis]
Length=384

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 109/170 (64%), Gaps = 14/170 (8%)
 Frame = +3

Query  78   MDSNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIW---DEPLPDSDPIFs  248
            + +NF+DEIDCGSFFDHIDDL+DFP E+   G+ + D  +FPSIW    + LP SD +F 
Sbjct  2    IGTNFMDEIDCGSFFDHIDDLLDFPNEDVEAGLPNADSNSFPSIWPTQSDSLPGSDSVF-  60

Query  249  aahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGK-ENYPLNPKPESDKKF  425
               S+S++DLS +LSVPYEDIVQLEWLS FVE+SFS G LT+ K E+  +     S  +F
Sbjct  61   ---SNSSTDLSTQLSVPYEDIVQLEWLSNFVEDSFSGGSLTMSKQESSTITKDDSSHNQF  117

Query  426  QAAsspisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
            Q +S    +  SSS S   +      G     +P +RG  RARSKRPRP 
Sbjct  118  QTSSPVSVLESSSSCSGEKTVL----GSPETTAPGRRG--RARSKRPRPA  161



>gb|EYU39605.1| hypothetical protein MIMGU_mgv1a011769mg [Erythranthe guttata]
 gb|EYU39606.1| hypothetical protein MIMGU_mgv1a011769mg [Erythranthe guttata]
 gb|EYU39607.1| hypothetical protein MIMGU_mgv1a011769mg [Erythranthe guttata]
 gb|EYU39608.1| hypothetical protein MIMGU_mgv1a011769mg [Erythranthe guttata]
Length=271

 Score =   110 bits (276),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 110/171 (64%), Gaps = 21/171 (12%)
 Frame = +3

Query  78   MDSNFVDEIDCGSFFDHIDDLIDFPPENECGG-----VGSGDCANFPSIWDEPLPDSDPI  242
            M  NF+DEIDCG+FFD IDDLI+FPP+NECG      + S    +FP+ W+  LPD DP+
Sbjct  1    MGPNFMDEIDCGNFFDQIDDLIEFPPDNECGEDSNLVISSDVRKDFPA-WNNDLPDCDPL  59

Query  243  FsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKK  422
            FS +H  SASDLSAELSVPYEDIVQLEWLS F+E+SFS   +T+GK+N  +        +
Sbjct  60   FSGSHVSSASDLSAELSVPYEDIVQLEWLSNFMEDSFSCKDMTIGKQNSSV-----PHNQ  114

Query  423  FQAAsspisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
            FQ +          S  S   +SS S   +  LSP+ RG QRARSKR RP 
Sbjct  115  FQTS----------SPVSVLESSSSSNSTSSSLSPTHRGPQRARSKRARPA  155



>ref|XP_007009854.1| Plant-specific GATA-type zinc finger transcription factor family 
protein isoform 2 [Theobroma cacao]
 gb|EOY18664.1| Plant-specific GATA-type zinc finger transcription factor family 
protein isoform 2 [Theobroma cacao]
Length=341

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 109/176 (62%), Gaps = 26/176 (15%)
 Frame = +3

Query  84   SNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCA----NFPSIW---DEPLPDSDPI  242
            +NF+DEIDCGSFFDHIDDL+DFP E+   G+ + D A     FPSIW    E LP SD +
Sbjct  5    TNFIDEIDCGSFFDHIDDLLDFPNEDVEAGLSASDSAVNASAFPSIWTTHSESLPGSDSV  64

Query  243  FsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKK  422
            F    ++SASDLSAELSVPYEDIVQLEWLS FV++S     LT+ KE      K  S  +
Sbjct  65   F---SNNSASDLSAELSVPYEDIVQLEWLSNFVDDSQCGASLTIKKEESSSITKDSSQHQ  121

Query  423  FQAAsspisvlesssssssssnsscsGGKAMPLSPS-----QRGAQRARSKRPRPV  575
            FQ +         S  S   S+SSCSG K +P SP      +RG  RARSKRPRP 
Sbjct  122  FQTS---------SPVSVLESSSSCSGEKTLPRSPETAAPGRRG--RARSKRPRPT  166



>ref|XP_007009853.1| Plant-specific GATA-type zinc finger transcription factor family 
protein isoform 1 [Theobroma cacao]
 gb|EOY18663.1| Plant-specific GATA-type zinc finger transcription factor family 
protein isoform 1 [Theobroma cacao]
Length=414

 Score =   109 bits (272),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 109/176 (62%), Gaps = 26/176 (15%)
 Frame = +3

Query  84   SNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCA----NFPSIW---DEPLPDSDPI  242
            +NF+DEIDCGSFFDHIDDL+DFP E+   G+ + D A     FPSIW    E LP SD +
Sbjct  78   TNFIDEIDCGSFFDHIDDLLDFPNEDVEAGLSASDSAVNASAFPSIWTTHSESLPGSDSV  137

Query  243  FsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKK  422
            F    ++SASDLSAELSVPYEDIVQLEWLS FV++S     LT+ KE      K  S  +
Sbjct  138  F---SNNSASDLSAELSVPYEDIVQLEWLSNFVDDSQCGASLTIKKEESSSITKDSSQHQ  194

Query  423  FQAAsspisvlesssssssssnsscsGGKAMPLSPS-----QRGAQRARSKRPRPV  575
            FQ +         S  S   S+SSCSG K +P SP      +RG  RARSKRPRP 
Sbjct  195  FQTS---------SPVSVLESSSSCSGEKTLPRSPETAAPGRRG--RARSKRPRPT  239



>ref|XP_004142426.1| PREDICTED: GATA transcription factor 9-like [Cucumis sativus]
 ref|XP_004166767.1| PREDICTED: GATA transcription factor 9-like [Cucumis sativus]
 gb|KGN52268.1| hypothetical protein Csa_5G622830 [Cucumis sativus]
Length=355

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 109/173 (63%), Gaps = 14/173 (8%)
 Frame = +3

Query  78   MDSNFVDEIDCGSFFDHIDDLIDFPPENECGGV---GSGDCAN-FPSIW---DEPLPDSD  236
            + +NFVDEIDCGSFFDHIDDL+DFP E+   G+     GD AN FP+IW    E LP SD
Sbjct  2    IGNNFVDEIDCGSFFDHIDDLLDFPVEDVDAGLPPAKGGDSANSFPTIWPTHSESLPGSD  61

Query  237  PIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESD  416
             +F    ++S SDLSAELSVPYEDIVQL+WL+ FVE+SF   GLT+ KE   +     ++
Sbjct  62   SVF---SANSNSDLSAELSVPYEDIVQLDWLANFVEDSFCGEGLTMNKEE--VKDLTHNN  116

Query  417  KKFQAAsspisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
             +FQ +S    +  SSS SS  +    S    +     QRG  RARSKRPRP 
Sbjct  117  NQFQTSSPVSVLESSSSCSSDKTLQPRSPEPTVATPGQQRG--RARSKRPRPA  167



>ref|XP_008446884.1| PREDICTED: GATA transcription factor 8 [Cucumis melo]
Length=353

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 107/173 (62%), Gaps = 16/173 (9%)
 Frame = +3

Query  78   MDSNFVDEIDCGSFFDHIDDLIDFPPENECGGV---GSGDCAN-FPSIW---DEPLPDSD  236
            + +NFVDEIDCGSFFD IDDL+DFP E+   G+     GD  N FP+IW    E LP SD
Sbjct  2    IGNNFVDEIDCGSFFDQIDDLLDFPVEDVDTGLPPAKGGDSTNSFPTIWPTHSESLPGSD  61

Query  237  PIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESD  416
             +F    ++S SDLSAELSVPYEDIVQL+WL+ FVE+SF  G LT+ KE     PK  + 
Sbjct  62   SVF---SANSNSDLSAELSVPYEDIVQLDWLANFVEDSFCGGSLTMNKE----EPKDLTH  114

Query  417  KKFQAAsspisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
             +FQ +S    +  SSS SS  +    S    +     QRG  RARSKRPRP 
Sbjct  115  NQFQTSSPVSVLESSSSCSSDKTLQPRSPEPTVATPGQQRG--RARSKRPRPA  165



>gb|KDP44375.1| hypothetical protein JCGZ_20055 [Jatropha curcas]
Length=357

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 113/186 (61%), Gaps = 36/186 (19%)
 Frame = +3

Query  84   SNFVDEIDCGSFFDHIDDLIDFP--------PENECGGVGSGDCA--NFPSIW---DEPL  224
            +NF+DEIDCGSFFDHIDDL+DFP        P ++C  + +   A  +FPSIW    + L
Sbjct  5    ANFMDEIDCGSFFDHIDDLLDFPTDDIDDCLPGSDCATINNNGIAGNSFPSIWSTQSDSL  64

Query  225  PDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENY----P  392
            P SD +F    ++SASDLSAELSVPYEDIVQLEWLS FVE+SFS G LT+   +      
Sbjct  65   PGSDSVF---SNNSASDLSAELSVPYEDIVQLEWLSNFVEDSFSGGSLTINNSSKNKEGS  121

Query  393  LNPKPESDKKFQAAsspisvlesssssssssnsscsGGKAMPLSPS-----QRGAQRARS  557
             +   +S ++FQ +         S  S   S+SSCSG K  P SP      +RG  RARS
Sbjct  122  TSINKDSSRQFQTS---------SPVSVLESSSSCSGEKTAPRSPEIIASGRRG--RARS  170

Query  558  KRPRPV  575
            KRPRP 
Sbjct  171  KRPRPA  176



>ref|XP_006606248.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Glycine 
max]
Length=357

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 105/186 (56%), Gaps = 24/186 (13%)
 Frame = +3

Query  60   SFVGSSMDSNFVDEIDCGSFFDHIDDLIDFPPENECGGVGS-------GDCANFPSIW--  212
            S V   +  NF+DEIDCGSFFDHIDDL+DFP E+  GG  +       G+C +  SIW  
Sbjct  5    SIVEKMVGPNFMDEIDCGSFFDHIDDLLDFPVEDVDGGAATLPSVAAAGNCNSLASIWPA  64

Query  213  -DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENY  389
              +  P SD +F     ++ASDLSAELSVPYEDIVQLEWLS FVE+SF  G LT+ K   
Sbjct  65   ESDSFPTSDSVF---SGNTASDLSAELSVPYEDIVQLEWLSNFVEDSFCGGSLTMNKVEE  121

Query  390  PLNPKPESDKKFQAAsspisvlesssssssssnsscsGGKAMPLSPSQ----RGAQRARS  557
            P     E     Q          SS  S   S+SSCSGGK  PLS  +        R RS
Sbjct  122  PSCTTKEDSVNTQ-------FHTSSPVSVLESSSSCSGGKTFPLSSPEIYIPVPCGRTRS  174

Query  558  KRPRPV  575
            KRPRP 
Sbjct  175  KRPRPA  180



>ref|XP_003556234.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Glycine 
max]
Length=348

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 102/177 (58%), Gaps = 24/177 (14%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGGVGS-------GDCANFPSIW---DEPLPDSD  236
            NF+DEIDCGSFFDHIDDL+DFP E+  GG  +       G+C +  SIW    +  P SD
Sbjct  5    NFMDEIDCGSFFDHIDDLLDFPVEDVDGGAATLPSVAAAGNCNSLASIWPAESDSFPTSD  64

Query  237  PIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESD  416
             +F     ++ASDLSAELSVPYEDIVQLEWLS FVE+SF  G LT+ K   P     E  
Sbjct  65   SVF---SGNTASDLSAELSVPYEDIVQLEWLSNFVEDSFCGGSLTMNKVEEPSCTTKEDS  121

Query  417  KKFQAAsspisvlesssssssssnsscsGGKAMPLSPSQ----RGAQRARSKRPRPV  575
               Q          SS  S   S+SSCSGGK  PLS  +        R RSKRPRP 
Sbjct  122  VNTQ-------FHTSSPVSVLESSSSCSGGKTFPLSSPEIYIPVPCGRTRSKRPRPA  171



>ref|XP_002534043.1| GATA transcription factor, putative [Ricinus communis]
 gb|EEF28339.1| GATA transcription factor, putative [Ricinus communis]
Length=359

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 112/182 (62%), Gaps = 29/182 (16%)
 Frame = +3

Query  84   SNFVDEIDCGSFFDHIDDLIDFP--------PENECGGVGSGDCANFPSIW---DEPLPD  230
            +NF+DEIDCGSFFDHIDDL+DFP        P+       +G+  +FPSIW    + LP 
Sbjct  5    TNFIDEIDCGSFFDHIDDLLDFPTDDIDSCLPDCTNAVNVNGNVNSFPSIWSTQSDSLPG  64

Query  231  SDPIFsaahshsasd-lsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGK-ENYPLNPK  404
            S  +FS+  +++++  LSAELSVPYEDIVQLEWLS FVE+SFS G LT+ K E+  +N  
Sbjct  65   SHSVFSSNTNNNSASDLSAELSVPYEDIVQLEWLSNFVEDSFSGGSLTMNKEESTSINKD  124

Query  405  PESDKKFQAAsspisvlesssssssssnsscsGGKAMPLSPS-----QRGAQRARSKRPR  569
                 +FQ +         S  S   S+SSCSG K +P SP      +RG  RARSKRPR
Sbjct  125  SSHHHQFQTS---------SPVSVLESSSSCSGEKTVPRSPEIIASGRRG--RARSKRPR  173

Query  570  PV  575
            P 
Sbjct  174  PA  175



>emb|CDP19135.1| unnamed protein product [Coffea canephora]
Length=93

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 50/58 (86%), Gaps = 2/58 (3%)
 Frame = +3

Query  78   MDSNFVDEIDCGSFFDHIDDLIDFPPENECGG--VGSGDCANFPSIWDEPLPDSDPIF  245
            M  NFVDEIDCGSFFDHIDDLI+FPPENECG   VGSGDC NFPS+WDE LPD+D +F
Sbjct  1    MGPNFVDEIDCGSFFDHIDDLIEFPPENECGNGLVGSGDCKNFPSLWDEALPDTDTLF  58



>ref|XP_007143712.1| hypothetical protein PHAVU_007G095300g [Phaseolus vulgaris]
 gb|ESW15706.1| hypothetical protein PHAVU_007G095300g [Phaseolus vulgaris]
Length=354

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 103/181 (57%), Gaps = 27/181 (15%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGG---------VGSGDCANFPSIW---DEPLPD  230
            NF+DEIDCGSFFDHIDDL+DFP E+  GG           +G+C +  SIW    +  P 
Sbjct  5    NFMDEIDCGSFFDHIDDLLDFPVEDVDGGAPTLPSVAAAAAGNCNSLASIWPAGSDSFPG  64

Query  231  SDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPE  410
            SD +F     +SASDLSAELSVPYEDIVQLEWLS FVE+SF  G LT+ K + P     +
Sbjct  65   SDSVF---SGNSASDLSAELSVPYEDIVQLEWLSNFVEDSFCGGSLTMKKVDEPSCTTTK  121

Query  411  SDKKFQAAsspisvlesssssssssnsscsGGKAMPLSPSQRGAQ------RARSKRPRP  572
             D              SS  S   S+SSCSGGK +P  P            RARSKRPRP
Sbjct  122  EDSVHN------QFHTSSPVSVLESSSSCSGGKTVPAPPRSPEVYIPVPCGRARSKRPRP  175

Query  573  V  575
             
Sbjct  176  A  176



>ref|XP_010092608.1| GATA transcription factor 9 [Morus notabilis]
 gb|EXB51749.1| GATA transcription factor 9 [Morus notabilis]
Length=351

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 100/176 (57%), Gaps = 27/176 (15%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDL-IDFPPENECGGVGSGDCAN-FPSIWD----EPLPDSDPIFs  248
            NF+DEIDCGSFFDHIDDL +DF  ++   G+G    AN F SIW     E LP SD +FS
Sbjct  5    NFMDEIDCGSFFDHIDDLLVDFSGDDVDTGLGPKPEANPFTSIWSTTQSESLPSSDSVFS  64

Query  249  aahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKE--NYPLNPKPESDKK  422
               +   S   +   VPYEDIVQLEWLS FVE+SFS G L + KE  +  LN K  S  +
Sbjct  65   GKSASDLSAELS---VPYEDIVQLEWLSNFVEDSFSGGSLAINKEQDSSSLN-KESSHHQ  120

Query  423  FQAAsspisvlesssssssssnsscsGGKAMPLSPS-----QRGAQRARSKRPRPV  575
            FQ +        S  S   SS+S   G K  P SP      +RG  RARSKRPRP 
Sbjct  121  FQTS--------SPVSVLESSSSCSGGEKNAPCSPETVNPGRRG--RARSKRPRPA  166



>ref|XP_003536350.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Glycine 
max]
 ref|XP_006589425.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Glycine 
max]
 ref|XP_006589426.1| PREDICTED: GATA transcription factor 8-like isoform X3 [Glycine 
max]
Length=347

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 103/176 (59%), Gaps = 23/176 (13%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGG------VGSGDCANFPSIW---DEPLPDSDP  239
            NF+DEIDCGSFFDHIDDL+DFP E+  GG      V +G+  +  SIW    +  P SD 
Sbjct  5    NFMDEIDCGSFFDHIDDLLDFPVEDVDGGAATLPSVSAGNSNSLASIWPSESDSFPASDS  64

Query  240  IFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDK  419
            +F     +SASDLSAELSVPYEDIVQLEWLS FVE+SF  G LT+ K   P     E   
Sbjct  65   VF---SGNSASDLSAELSVPYEDIVQLEWLSNFVEDSFCGGSLTMNKVEEPSCTTKEDSV  121

Query  420  KFQAAsspisvlesssssssssnsscsGGKAM-PLSPSQR---GAQRARSKRPRPV  575
              Q          SS  S   S+SSCSGGK + P SP         RARSKRPRP 
Sbjct  122  NTQ-------FHTSSPVSVLESSSSCSGGKTLPPRSPEIYIPVPCGRARSKRPRPA  170



>ref|XP_011041012.1| PREDICTED: GATA transcription factor 8-like [Populus euphratica]
 ref|XP_011041013.1| PREDICTED: GATA transcription factor 8-like [Populus euphratica]
Length=355

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 101/187 (54%), Gaps = 34/187 (18%)
 Frame = +3

Query  72   SSMDSNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCAN-------------FPSIW  212
            ++  S F+DEIDCGSFFDHIDDL+DFP ++   G+  G   N             FP IW
Sbjct  5    TNTSSGFMDEIDCGSFFDHIDDLLDFPSDDVDAGLPDGTTTNNHASCFIGNDDNSFPGIW  64

Query  213  ---DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKE  383
                E LP S           ASDLSAELSVPYEDIVQLEWLS FVE+SFS G LT+ KE
Sbjct  65   STQSESLPGS-----------ASDLSAELSVPYEDIVQLEWLSNFVEDSFSGGSLTMKKE  113

Query  384  NYPLNPKPESDKKFQAAsspisvlesssssssssnsscsGGKAMPLSPSQRGA---QRAR  554
                  K   DKK  A         SS  S   S+S CSG K  P SP    +    RAR
Sbjct  114  ESAFVDK--KDKKDSAP--HPQFQTSSPVSVLESSSYCSGEKNAPRSPEVVASGKCGRAR  169

Query  555  SKRPRPV  575
            SKRPRP 
Sbjct  170  SKRPRPA  176



>gb|KHN17141.1| GATA transcription factor 9 [Glycine soja]
Length=339

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 99/170 (58%), Gaps = 19/170 (11%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIW---DEPLPDSDPIFsaah  257
            NF+DEIDCGSFFDHIDDL+DFP       V +G+  +  SIW    +  P SD +F    
Sbjct  5    NFMDEIDCGSFFDHIDDLLDFPA--TLPSVSAGNSNSLASIWPSESDSFPASDSVF---S  59

Query  258  shsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAAs  437
             +SASDLSAELSVPYEDIVQLEWLS FVE+SF  G LT+ K   P     E     Q   
Sbjct  60   GNSASDLSAELSVPYEDIVQLEWLSNFVEDSFCGGSLTMNKVEEPSCTTKEDSVNTQ---  116

Query  438  spisvlesssssssssnsscsGGKAM-PLSPSQR---GAQRARSKRPRPV  575
                   SS  S   S+SSCSGGK + P SP         RARSKRPRP 
Sbjct  117  ----FHTSSPVSVLESSSSCSGGKTLPPRSPEIYIPVPCGRARSKRPRPA  162



>gb|KJB73559.1| hypothetical protein B456_011G238800 [Gossypium raimondii]
 gb|KJB73560.1| hypothetical protein B456_011G238800 [Gossypium raimondii]
 gb|KJB73561.1| hypothetical protein B456_011G238800 [Gossypium raimondii]
Length=337

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 96/173 (55%), Gaps = 20/173 (12%)
 Frame = +3

Query  84   SNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGD----CANFPSIWD---EPLPDSDPI  242
            +NF+DEIDCGSFFDHIDDL+DFP E+   G  + D     A FPSIW    E  P SD +
Sbjct  5    TNFIDEIDCGSFFDHIDDLLDFPNEDVEAGFSAPDSAVNAAAFPSIWTAHPESFPGSDSV  64

Query  243  FsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKK  422
            FS   +   S   +   VPYEDIVQLEWLS FVE+S     LT+ K+      +P S+ K
Sbjct  65   FSNNSASDLSAELS---VPYEDIVQLEWLSNFVEDSNCGASLTIKKQ------EPNSNNK  115

Query  423  FQAAsspisvle--sssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
               +       +  +SS  S   +SS   G+    +P + G  RARSKRPRP 
Sbjct  116  DSPSHHDHDHHQFQTSSPVSVLESSSSYSGEKPVAAPGKCG--RARSKRPRPA  166



>ref|XP_010683872.1| PREDICTED: GATA transcription factor 8 [Beta vulgaris subsp. 
vulgaris]
Length=310

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 106/171 (62%), Gaps = 24/171 (14%)
 Frame = +3

Query  84   SNFVDEIDCGSFFDHIDDLIDFPPEN-ECG----GVGSGDCAN-FPSI-WDEPLPDSDPI  242
            +  ++EIDCG+FFD IDDL++FP ++ E G    GVG     N FP + W E    + P+
Sbjct  4    TKLMEEIDCGNFFDQIDDLLEFPNDDVEKGLIDNGVGVEHQYNDFPPVFWSE----NSPV  59

Query  243  FsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKK  422
            FSAA+S+SASDLSAELSVPYEDIVQLEWLS FVE+SF+ GGLTL K     + K     +
Sbjct  60   FSAANSNSASDLSAELSVPYEDIVQLEWLSTFVEDSFAGGGLTLEKSQCTSSSKDSPRNQ  119

Query  423  FQAAsspisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
            FQ +S    +  SS+ S          GK +P S      +RARSKRPRP 
Sbjct  120  FQTSSPISVLESSSACSR---------GKTLPAS----HEKRARSKRPRPA  157



>ref|XP_010032183.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010032184.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010032185.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010032186.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW51583.1| hypothetical protein EUGRSUZ_J01083 [Eucalyptus grandis]
 gb|KCW51584.1| hypothetical protein EUGRSUZ_J01083 [Eucalyptus grandis]
 gb|KCW51585.1| hypothetical protein EUGRSUZ_J01083 [Eucalyptus grandis]
Length=350

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 67/103 (65%), Gaps = 9/103 (9%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIWD---EPLPDSDPIFsaah  257
            NF+DEIDCGSFFD   D +DFP E+   G+  G   + PSIW    EPLP SD +FS   
Sbjct  5    NFIDEIDCGSFFD---DFLDFPSEDIEAGLPVGKPDSLPSIWSAQPEPLPGSDAVFSGNS  61

Query  258  shsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKEN  386
            S S S   +   VPYEDIVQLEWLS FVEESFS G LT+ KE 
Sbjct  62   SSSLSAELS---VPYEDIVQLEWLSTFVEESFSGGSLTMSKEQ  101



>ref|XP_002311088.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE88455.1| zinc finger family protein [Populus trichocarpa]
Length=354

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 103/189 (54%), Gaps = 39/189 (21%)
 Frame = +3

Query  72   SSMDSNFVDEIDCGSFFDHIDDLIDFPPE-------------NECGGVGSGDCANFPSIW  212
            ++  SNF+DEIDCGSFF+HIDDL++FP +             N      + D  +FP IW
Sbjct  5    TNTTSNFMDEIDCGSFFEHIDDLLEFPSDDVDATLPDCTTTNNHTSCFMNNDDNSFPGIW  64

Query  213  D---EPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKE  383
                + LP S           ASDLSAELSVPYEDIVQLEWLS FVE+SFS G LT+ KE
Sbjct  65   STQSDSLPGS-----------ASDLSAELSVPYEDIVQLEWLSNFVEDSFSGGSLTMKKE  113

Query  384  NYPLNPKPESDKKFQAAsspisvlesssssssssnsscsGGKAMPLSPS-----QRGAQR  548
               +    ES    Q          SS  S   S+SSCSG K  P SP      +RG  R
Sbjct  114  ESTIVNNKESPPHHQ-----YQFQTSSPVSVLESSSSCSGEKTAPRSPEVGASGKRG--R  166

Query  549  ARSKRPRPV  575
            ARSKRPRP 
Sbjct  167  ARSKRPRPA  175



>ref|XP_007218229.1| hypothetical protein PRUPE_ppa007936mg [Prunus persica]
 gb|EMJ19428.1| hypothetical protein PRUPE_ppa007936mg [Prunus persica]
Length=351

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 107/171 (63%), Gaps = 17/171 (10%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGGVGSG-DC--ANFPSIWDE-----PLPDSDPI  242
            NF+DEIDCGSFFD IDDL+DFP ++   G+G   DC  A   S+W       P P+ D +
Sbjct  5    NFIDEIDCGSFFDTIDDLLDFPNDDVESGLGPAPDCNAAFNNSLWPNQSGSLPAPN-DAV  63

Query  243  FsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKK  422
            F  +  +SASDLSAELSVP EDIVQLEWLS FVE+SFS G LT+ K +  +N K  S ++
Sbjct  64   F--SAGNSASDLSAELSVPIEDIVQLEWLSNFVEDSFSGGSLTINKPDSFIN-KDTSHRQ  120

Query  423  FQAAsspisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
            FQ +S    +  SSS S   +     G  A   +P +RG  RARSKRPRP 
Sbjct  121  FQTSSPISVLDSSSSCSGDKNVPQSPGPVA---APGKRG--RARSKRPRPA  166



>ref|XP_004496271.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Cicer 
arietinum]
 ref|XP_004496272.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Cicer 
arietinum]
Length=345

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 97/178 (54%), Gaps = 29/178 (16%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGGVGS-------GDCANFPSIW---DEPLPDSD  236
            NF+DE+DCGSFFD IDDL+DFP ++      S       G+C +  SIW       P SD
Sbjct  5    NFMDELDCGSFFDQIDDLLDFPVDDVDTANASLPSVASAGNCNSLASIWPSESHSFPASD  64

Query  237  PIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGK-ENYPLNPKPES  413
             +FS   +   S   +   VPYEDIVQLEWLS FVE+SFS+G LT+ K E  P +   + 
Sbjct  65   SVFSGNSASDLSAELS---VPYEDIVQLEWLSNFVEDSFSEGSLTMKKIEQQPSSCATKE  121

Query  414  D---KKFQAAsspisvlesssssssssnsscsGGKAMPLS-PSQRGAQRARSKRPRPV  575
            D    +FQ +         S  S   S+SS SGGK   +  P   G  RAR+KRPRP 
Sbjct  122  DSVHNQFQTS---------SPVSVLESSSSSSGGKTTGIYIPVPCG--RARTKRPRPA  168



>ref|XP_006378769.1| hypothetical protein POPTR_0010s23010g [Populus trichocarpa]
 ref|XP_002316371.2| zinc finger family protein [Populus trichocarpa]
 gb|ERP56566.1| hypothetical protein POPTR_0010s23010g [Populus trichocarpa]
 gb|EEF02542.2| zinc finger family protein [Populus trichocarpa]
Length=352

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 101/187 (54%), Gaps = 37/187 (20%)
 Frame = +3

Query  72   SSMDSNFVDEIDCGSFFDHIDDLIDFPPEN------ECGGVGS-------GDCANFPSIW  212
            ++  S F+DEIDCGSFFDHIDDL+DFP ++      +C    +        D  +FP IW
Sbjct  5    TNTSSGFMDEIDCGSFFDHIDDLLDFPSDDVDASLPDCTTTNNHASCFIDNDDNSFPGIW  64

Query  213  D---EPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKE  383
                + LP S           ASDLSAELSVPYEDIVQLEWLS FVE+SFS G LT+ KE
Sbjct  65   STQSDSLPGS-----------ASDLSAELSVPYEDIVQLEWLSNFVEDSFSGGSLTMKKE  113

Query  384  NYPLNPKPESDKKFQAAsspisvlesssssssssnsscsGGKAMPLSP---SQRGAQRAR  554
                  K +S    Q          SS  S   S+S CSG K  P SP   +     RAR
Sbjct  114  ESASVDKKDSTPHHQ-------FQTSSPVSVLESSSDCSGEKNAPRSPEIVASGKCGRAR  166

Query  555  SKRPRPV  575
            SKRPRP 
Sbjct  167  SKRPRPA  173



>ref|XP_011031733.1| PREDICTED: GATA transcription factor 8-like [Populus euphratica]
Length=358

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 104/190 (55%), Gaps = 41/190 (22%)
 Frame = +3

Query  72   SSMDSNFVDEIDCGSFFDHIDDLIDFPPE-------------NECGGVGSGDCANFPSIW  212
            ++  SNF+DEIDCGSFF+HIDDL++FP +             N      + D  +FP IW
Sbjct  5    TNTTSNFMDEIDCGSFFEHIDDLLEFPSDDVDATLPDCTTTNNHTSCFVNNDDNSFPGIW  64

Query  213  DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYP  392
                    P  S +   SASDLSAELSVPYEDIVQLEWLS FVE+SFS G LT+ KE   
Sbjct  65   --------PTQSDSLPGSASDLSAELSVPYEDIVQLEWLSNFVEDSFSGGSLTMKKEEST  116

Query  393  L----NPKPESDKKFQAAsspisvlesssssssssnsscsGGKAMPLSPS-----QRGAQ  545
            +    +  P    +FQ +         S  S   S+SSCSG K  P SP      +RG  
Sbjct  117  IVNNKDSPPHHQYQFQTS---------SPVSVLESSSSCSGEKTAPRSPEVGASGKRG--  165

Query  546  RARSKRPRPV  575
            R RSKRPRP 
Sbjct  166  RPRSKRPRPA  175



>gb|KHG18876.1| GATA transcription factor 8 -like protein [Gossypium arboreum]
Length=337

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 96/173 (55%), Gaps = 20/173 (12%)
 Frame = +3

Query  84   SNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCAN----FPSIW---DEPLPDSDPI  242
            +NF+DEIDCGSFFDHIDDL+DFP E+   G  + D A     FPSIW    E  P SD +
Sbjct  5    TNFIDEIDCGSFFDHIDDLLDFPNEDVEAGFSAADSAINAAAFPSIWTAHSESFPGSDSV  64

Query  243  FsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKK  422
            FS   +   S   +   VPYEDIVQLEWLS FVE+S     LT+ K+      +P S+ K
Sbjct  65   FSNNSASDLSAELS---VPYEDIVQLEWLSNFVEDSNCGASLTIKKQ------EPNSNNK  115

Query  423  FQAAsspisvle--sssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
               +       +  +SS  S   +SS   G+    +P + G  RARSKRPRP 
Sbjct  116  DSPSHHDHDHHQFQTSSPVSVLESSSSYSGEKPVAAPGKCG--RARSKRPRPA  166



>dbj|BAP90356.1| GATA type zinc finger domain [Populus nigra]
Length=352

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 100/187 (53%), Gaps = 37/187 (20%)
 Frame = +3

Query  72   SSMDSNFVDEIDCGSFFDHIDDLIDFPPEN------ECGGVGS-------GDCANFPSIW  212
            ++  S F+DEI CGSFFDHIDDL+DFP ++      +C    +        D  +FP IW
Sbjct  5    TNTSSGFMDEIGCGSFFDHIDDLLDFPSDDVDASLPDCTTTNNHASCFIDNDDNSFPGIW  64

Query  213  D---EPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKE  383
                + LP S           ASDLSAELSVPYEDIVQLEWLS FVE+SFS G LT+ KE
Sbjct  65   STQSDSLPGS-----------ASDLSAELSVPYEDIVQLEWLSNFVEDSFSGGSLTMKKE  113

Query  384  NYPLNPKPESDKKFQAAsspisvlesssssssssnsscsGGKAMPLSPSQRGA---QRAR  554
                  K +S    Q          SS  S   S+S CSG K  P SP    +    RAR
Sbjct  114  ESASVDKKDSTPHHQ-------FQTSSPVSVLESSSDCSGEKNAPRSPEVVASGKCGRAR  166

Query  555  SKRPRPV  575
            SKRPRP 
Sbjct  167  SKRPRPA  173



>ref|XP_003548072.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Glycine 
max]
 ref|XP_006599443.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Glycine 
max]
Length=333

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 90/170 (53%), Gaps = 14/170 (8%)
 Frame = +3

Query  78   MDSNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCA----NFPSIWDEPLPDSDPIF  245
            M  NF+D+IDCG+FFDHIDDL++FP +       +        NF S   + LP +D +F
Sbjct  1    MIGNFIDDIDCGNFFDHIDDLLEFPDDAAAADTSAAAPVPPPANFWSAESDSLPATDTVF  60

Query  246  saahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKF  425
            S       S   +   VPYEDI+QLEWLS FVE+SFS G +T+ KE     P+  + K+ 
Sbjct  61   SDNSVTDLSAELS---VPYEDIMQLEWLSNFVEDSFSGGSMTMKKE----EPQCTTTKED  113

Query  426  QAAsspisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
             A +   +    S   SSS  S    G  + +S       RARSKRPRP 
Sbjct  114  IAPAQFQTASPVSVLESSSFCSGEKAGTEINIS---VPCGRARSKRPRPA  160



>ref|XP_006574762.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Glycine 
max]
 ref|XP_006574763.1| PREDICTED: GATA transcription factor 8-like isoform X3 [Glycine 
max]
Length=333

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 71/105 (68%), Gaps = 6/105 (6%)
 Frame = +3

Query  78   MDSNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIWDEPLPDSDPIFsaah  257
            M  NF+D+IDCGSFFDHIDDL++FP +N          ANF S   + LP S  +F    
Sbjct  1    MIGNFIDDIDCGSFFDHIDDLLEFPDDN---AAPVAPPANFWSAESDSLPASYTVF---S  54

Query  258  shsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYP  392
             +S +DLSAELSV Y+DIVQLEWLS FVE+SFS G +T+ KE  P
Sbjct  55   DNSVTDLSAELSVSYDDIVQLEWLSNFVEDSFSGGSITMKKEEEP  99



>ref|XP_007151876.1| hypothetical protein PHAVU_004G083100g [Phaseolus vulgaris]
 gb|ESW23870.1| hypothetical protein PHAVU_004G083100g [Phaseolus vulgaris]
Length=336

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 93/176 (53%), Gaps = 23/176 (13%)
 Frame = +3

Query  78   MDSNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCA------NFPSIWDEPLPDSDP  239
            M  NF+D+IDCGSFFD IDDL++FP E E   + +   A      NF S   +    ++ 
Sbjct  1    MIGNFIDDIDCGSFFDQIDDLLEFPAE-ETAAIDTTAVAPLAPPTNFWSAESDSFHAANA  59

Query  240  IFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPE-SD  416
            +FS       S   +   VPYEDIVQLEWLS FVE+SFS G LT+ +E      K + + 
Sbjct  60   VFSGNTVPDLSTELS---VPYEDIVQLEWLSNFVEDSFSGGSLTMQQEQPQCTNKEDITH  116

Query  417  KKFQAAsspisvlesssssssssnsscsGGKAMPLSPSQ---RGAQRARSKRPRPV  575
             +FQ A         S  S   S+S CSG KA+P SP         RARSKR RP 
Sbjct  117  AQFQTA---------SPVSVLESSSFCSGEKAVPRSPEIFIPVPCGRARSKRARPT  163



>ref|XP_008233316.1| PREDICTED: GATA transcription factor 8 [Prunus mume]
 ref|XP_008233317.1| PREDICTED: GATA transcription factor 8 [Prunus mume]
Length=351

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 105/171 (61%), Gaps = 17/171 (10%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGGVG-SGDC--ANFPSIWDE-----PLPDSDPI  242
            NF+DEIDCGSFFD IDDL+DFP ++   G+G + DC  A   S+W       P P+ D +
Sbjct  5    NFIDEIDCGSFFDTIDDLLDFPNDDVESGLGPASDCNAAFNNSLWPNQSGSLPAPN-DAV  63

Query  243  FsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKK  422
            F  +  +SASDLSAELSVP EDIVQLEWLS FVE+SFS G LT+ K +  +N K  S  +
Sbjct  64   F--SAGNSASDLSAELSVPIEDIVQLEWLSNFVEDSFSGGSLTINKPDSFIN-KDTSHHQ  120

Query  423  FQAAsspisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
            FQ +S    +  SSS S   +     G  A   +P +RG  RARSKR  P 
Sbjct  121  FQTSSPISVLDSSSSCSGDKNVPQSPGPIA---APGKRG--RARSKRLSPA  166



>ref|XP_003519961.2| PREDICTED: GATA transcription factor 8-like isoform X1 [Glycine 
max]
Length=416

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 71/105 (68%), Gaps = 6/105 (6%)
 Frame = +3

Query  78   MDSNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIWDEPLPDSDPIFsaah  257
            M  NF+D+IDCGSFFDHIDDL++FP +N          ANF S   + LP S  +F    
Sbjct  84   MIGNFIDDIDCGSFFDHIDDLLEFPDDN---AAPVAPPANFWSAESDSLPASYTVF---S  137

Query  258  shsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYP  392
             +S +DLSAELSV Y+DIVQLEWLS FVE+SFS G +T+ KE  P
Sbjct  138  DNSVTDLSAELSVSYDDIVQLEWLSNFVEDSFSGGSITMKKEEEP  182



>ref|XP_010067308.1| PREDICTED: GATA transcription factor 8-like [Eucalyptus grandis]
 gb|KCW65417.1| hypothetical protein EUGRSUZ_G02840 [Eucalyptus grandis]
Length=333

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 99/169 (59%), Gaps = 17/169 (10%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIW-DEP--LPDSDP-IFsaa  254
            N ++EIDCGSFFD IDDL+DFP ++   G+   D  +FPS W D+P  LP S   + S  
Sbjct  5    NIMEEIDCGSFFDQIDDLLDFPSDDVEAGLPPIDHDSFPSFWSDQPQSLPGSGSGVGSVF  64

Query  255  hshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAA  434
             +H  SDLSA LSVPYEDIVQ+EWLS  +++SFS   LT+  ++ P   +P S  +FQ +
Sbjct  65   EAHPGSDLSAHLSVPYEDIVQMEWLSNLMDDSFSSDPLTINDQD-PSKAQPVSHAQFQTS  123

Query  435  sspisvlesssssssssnsscsGGKAMPLSPSQRGAQ---RARSKRPRP  572
            S    +  SSS +           KA P SP         RARSKRPRP
Sbjct  124  SPISVLDSSSSCTDE---------KAAPRSPEAINLARCGRARSKRPRP  163



>ref|XP_008347480.1| PREDICTED: GATA transcription factor 8-like [Malus domestica]
Length=351

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 90/171 (53%), Gaps = 17/171 (10%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGGVGSG-DCA---NFPSIW----DEPLPDSDPI  242
            +F+D+IDCGS FD IDDL+DFP ++    +G   DC    N  S+W        P ++ +
Sbjct  5    SFIDDIDCGSLFDTIDDLLDFPTDDVESALGPAPDCNAAFNSSSLWPSQSXSLQPPNEAV  64

Query  243  FsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKK  422
            FS   +   S       VP EDIVQLEWLS F E+SFS G LT+ K +        S ++
Sbjct  65   FSGNSASDLSAELD---VPIEDIVQLEWLSNFCEDSFSGGSLTINKPDNSFVNNESSHRQ  121

Query  423  FQAAsspisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
            FQ +S    +  SSS S         G    P+ P +RG  RARSKRPRP 
Sbjct  122  FQTSSPISVLDSSSSCSVEKXVPQSPG----PVVPGKRG--RARSKRPRPA  166



>ref|XP_010264666.1| PREDICTED: GATA transcription factor 8-like [Nelumbo nucifera]
Length=333

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 93/162 (57%), Gaps = 19/162 (12%)
 Frame = +3

Query  108  CGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIWDEPLPDS-----DPIFsaahshsas  272
            CG FFD IDDL+DFP     G V  GDC  F   W  P PD+     + +FS  +  S S
Sbjct  12   CGDFFDQIDDLLDFPTGEMEGEVIGGDCNAF---WTAPPPDTLMGGPNAVFSGNNDSSRS  68

Query  273  dlsaelsVPYEDIVQLEWLSAFVEESFSDG-GLTLGKENYPLNPKPESDKKFQAAsspis  449
            +L+ ELSVPYEDI QLEWLS FVE+SFS G  +T+ K++   +   ++  +FQ +S    
Sbjct  69   ELANELSVPYEDIAQLEWLSNFVEDSFSAGSSITIDKDS---STNDQNSYQFQTSSPVSV  125

Query  450  vlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
            +  SSSSS S         + MPLSP      RARSKRPRP 
Sbjct  126  LESSSSSSGSGG-------RTMPLSPETIVPGRARSKRPRPA  160



>ref|XP_008367332.1| PREDICTED: GATA transcription factor 8-like [Malus domestica]
Length=351

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 91/171 (53%), Gaps = 17/171 (10%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPP---ENECGGVGSGDCA-NFPSIW----DEPLPDSDPI  242
            N++D+IDCGS FD IDDL+DFP    E+  G   + D A N  S+W        P +D +
Sbjct  5    NYIDDIDCGSLFDTIDDLLDFPTDDVESALGPAPNCDAAFNSSSLWPGHSGSLQPPNDAV  64

Query  243  FsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKK  422
            FS   +   S       VP EDIVQLEWLS F E+SFS G LT+ K +     +  S ++
Sbjct  65   FSCNSASDLSAELD---VPIEDIVQLEWLSNFCEDSFSGGSLTINKPDISFINREPSHQQ  121

Query  423  FQAAsspisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
            FQ +S    +  SSS S   +     G     + P +RG  RARSKRPRP 
Sbjct  122  FQTSSPISVLDSSSSCSVEKNVPQSPGA----VVPGKRG--RARSKRPRPA  166



>ref|XP_009344766.1| PREDICTED: GATA transcription factor 8-like [Pyrus x bretschneideri]
Length=354

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 91/171 (53%), Gaps = 17/171 (10%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPP---ENECGGVGSGDCA-NFPSIWDEP----LPDSDPI  242
            N++D+IDCGS FD IDDL+DFP    E+  G V   + A N  S+W        P +D +
Sbjct  8    NYIDDIDCGSLFDTIDDLLDFPTDDVESVLGPVPDCNAAINSSSLWPSHSGSLQPPNDAV  67

Query  243  FsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKK  422
            FS   +   S       VP EDIVQLEWLS F E+SFS G LT+ K +     K  S ++
Sbjct  68   FSCNSASDLSAELD---VPIEDIVQLEWLSNFCEDSFSGGSLTINKPDSSFINKESSHQQ  124

Query  423  FQAAsspisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
            FQ +S    +  SSS S   +     G     + P +RG  RARSKRPRP 
Sbjct  125  FQTSSPISVLDSSSSCSVEKNVPQSPGT----VVPGKRG--RARSKRPRPA  169



>ref|XP_009345388.1| PREDICTED: GATA transcription factor 8-like [Pyrus x bretschneideri]
Length=351

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 93/174 (53%), Gaps = 17/174 (10%)
 Frame = +3

Query  78   MDSNFVDEIDCGSFFDHIDDLIDFPPENECGGVG-SGDC-------ANFPSIWDEPLPDS  233
            M  +F+D+IDCGS FD IDDL+DFP ++    +G + DC       + +PS      P +
Sbjct  2    MGPSFIDDIDCGSLFDTIDDLLDFPTDDVESALGPTPDCDAAFNSSSPWPSQSGSLQPPN  61

Query  234  DPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPES  413
            + +FS   +   S       VP EDIVQLEWLS F E+SFS G LT+ K + P      S
Sbjct  62   EAVFSGNSASDLSAELD---VPIEDIVQLEWLSNFCEDSFSGGSLTINKPDNPFVNNESS  118

Query  414  DKKFQAAsspisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
             ++FQ +S    +  SSS S   +     G     + P +RG  RARSKRPRP 
Sbjct  119  HQQFQTSSPISVLDSSSSCSVEKNVPQSPGQ----VVPGKRG--RARSKRPRPA  166



>gb|EPS57112.1| hypothetical protein M569_17713, partial [Genlisea aurea]
Length=101

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 70/101 (69%), Gaps = 5/101 (5%)
 Frame = +3

Query  78   MDSNFVDEIDCGSFFDHIDDLIDFPPENECGG----VGSGDCANFPSIWDEPLPDSD-PI  242
            M  + VDE++CG+ FD IDDLI FP E+EC G     GS + +  P+IW++ + DSD  +
Sbjct  1    MGPSLVDEMECGNLFDQIDDLIKFPVEDECAGGGFLAGSVNSSEIPAIWNDAVDDSDGGL  60

Query  243  FsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGG  365
            F+AA +  +  L A+LS+P ED+ QLEWLS+FVE+SFS  G
Sbjct  61   FAAAAAPHSDGLFADLSIPDEDVAQLEWLSSFVEDSFSTKG  101



>ref|XP_010253699.1| PREDICTED: GATA transcription factor 8-like [Nelumbo nucifera]
Length=334

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 92/162 (57%), Gaps = 19/162 (12%)
 Frame = +3

Query  108  CGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIWDEPLPDS-----DPIFsaahshsas  272
            CG FFD IDDL+DF  E+   G G     N+ + W    PD+     D +FS     S+S
Sbjct  12   CGDFFDQIDDLLDFSTEDIEAGAGE----NYITSWTTVPPDTMIGAPDSVFSGYSDRSSS  67

Query  273  dlsaelsVPYEDIVQLEWLSAFVEESFSDG-GLTLGKENYPLNPKPESDKKFQAAsspis  449
            +L+ ELSVPYE+I QLEWLS FVE+SFS G  +TL K+++  + K     +FQ +     
Sbjct  68   ELATELSVPYEEIAQLEWLSNFVEDSFSAGSSVTLDKDSFN-DHKNNDSHRFQTS-----  121

Query  450  vlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
               S  S   SS+S   GG+ MPLSP      RARSKRPRP 
Sbjct  122  ---SPVSVLESSSSCSGGGRTMPLSPETVVPGRARSKRPRPA  160



>ref|XP_009770305.1| PREDICTED: GATA transcription factor 8-like, partial [Nicotiana 
sylvestris]
Length=272

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 66/93 (71%), Gaps = 6/93 (6%)
 Frame = +3

Query  300  YEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAAsspisvlesssssss  479
            YEDIVQLEWLS FVE+SFS GGLTLGKEN+PL  K  S+ KFQ +S    +  SSSSSSS
Sbjct  5    YEDIVQLEWLSTFVEDSFSGGGLTLGKENFPLY-KETSEAKFQTSSPVSVLESSSSSSSS  63

Query  480  ssnsscsGGKAMPL-SPSQRGAQRARSKRPRPV  575
            S +      K +PL SP  RG QRARSKRPRP 
Sbjct  64   SCSVE----KTVPLSSPCHRGPQRARSKRPRPA  92



>gb|KJB60582.1| hypothetical protein B456_009G313700 [Gossypium raimondii]
 gb|KJB60583.1| hypothetical protein B456_009G313700 [Gossypium raimondii]
Length=337

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 92/172 (53%), Gaps = 28/172 (16%)
 Frame = +3

Query  84   SNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSG--DCANFPSIWD---EPLPDSDPIFs  248
            ++F+DEIDCGSFFD   DLIDFP E+      +   + A FPSIW    E LP SD +F 
Sbjct  5    TDFIDEIDCGSFFD---DLIDFPNEDVEAYESTAVINAAAFPSIWTTQPESLPLSDSVFL  61

Query  249  aahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQ  428
               +   S       VPYEDIVQLEW+S FVE++     LT  KE+   +    S+ +FQ
Sbjct  62   NNSASELSTELF---VPYEDIVQLEWMSKFVEDTQCGASLTTKKEDSS-SISEGSNHQFQ  117

Query  429  AAsspisvlesssssssssnsscsGGKAMPLSPS-----QRGAQRARSKRPR  569
                       S  S   S+SSCSG K +P SP      +RG  R RSKRPR
Sbjct  118  TC---------SPVSVLESSSSCSGMKPLPRSPETSAPGKRG--RPRSKRPR  158



>gb|KHG25368.1| GATA transcription factor 8 -like protein [Gossypium arboreum]
Length=339

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 62/110 (56%), Gaps = 19/110 (17%)
 Frame = +3

Query  84   SNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGD------CANFPSIWD---EPLPDSD  236
            ++F+DEIDCGSFFD   DLIDFP     G V + D       A FPSIW    E LP SD
Sbjct  5    TDFIDEIDCGSFFD---DLIDFPN----GDVEAYDSTAVINAAAFPSIWTTQPESLPFSD  57

Query  237  PIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKEN  386
             +F    +   S       VPYEDIVQLEW+S FVE++     LT  KE+
Sbjct  58   SVFLNNSASELSTELF---VPYEDIVQLEWMSKFVEDTQCGASLTKKKED  104



>ref|XP_010555821.1| PREDICTED: GATA transcription factor 8 [Tarenaya hassleriana]
Length=331

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 63/94 (67%), Gaps = 6/94 (6%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIWD---EPLPDSDPIFsaah  257
            +F DE+DCG+FFD++DDLI+FP E+   G G GD   FPSIW    E  P SD +F    
Sbjct  5    SFGDEMDCGNFFDNMDDLINFPNEDIGLGFGIGDNDEFPSIWSAQPESWPGSDLMF---S  61

Query  258  shsasdlsaelsVPYEDIVQLEWLSAFVEESFSD  359
            S + S+ S EL VP+E+IVQLE  S  V+ESF++
Sbjct  62   SKNNSETSTELYVPFENIVQLEQPSGLVDESFTN  95



>ref|XP_010554544.1| PREDICTED: GATA transcription factor 8-like [Tarenaya hassleriana]
Length=317

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 61/94 (65%), Gaps = 6/94 (6%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIWD---EPLPDSDPIFsaah  257
            +F DE+DCG+FFD++DDLIDFP E+   G G GD   FPSIW    E  P SD +F    
Sbjct  5    SFADEMDCGNFFDNMDDLIDFPNEDIGLGFGMGDNDVFPSIWSAQPESWPGSDQLF---S  61

Query  258  shsasdlsaelsVPYEDIVQLEWLSAFVEESFSD  359
            S + SD   EL VP+ +IVQLE  S FV++S SD
Sbjct  62   SKNNSDSPTELYVPFANIVQLEQPSGFVDDSCSD  95



>gb|ACJ02090.1| AG-motif binding protein [Garcinia mangostana]
Length=335

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 92/176 (52%), Gaps = 28/176 (16%)
 Frame = +3

Query  84   SNFVDEIDCGSFFDHIDDLIDFP-----------PENECGGVGSGDCANFPSIWDEPLPD  230
            +N ++E DCG+F D    LIDFP            +N   GV      ++  +   P P+
Sbjct  4    ANLMEETDCGNFLD----LIDFPSDDVLIDNDTFTDNNVVGVDQ----SYDVVEGFPFPN  55

Query  231  SDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENY-PLNPKP  407
                 +   S + +DLSAELSVPYEDIVQLEWLS FVE+SFS G LT+ KE+Y  +N K 
Sbjct  56   DVWSSAHCQSLANADLSAELSVPYEDIVQLEWLSNFVEDSFSGGSLTMKKEDYSSINNKD  115

Query  408  ESDKKFQAAsspisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
             S ++F  +S    +  SSS S            + P SP      RARSKRPRP 
Sbjct  116  SSPRQFHTSSPVSVLESSSSCSGEK--------TSSPPSPGSARCGRARSKRPRPA  163



>ref|XP_004307386.1| PREDICTED: GATA transcription factor 8 [Fragaria vesca subsp. 
vesca]
Length=344

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 93/172 (54%), Gaps = 21/172 (12%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGGVGSG-DCANFPSIWDEPLPDSDPIFsaahsh  263
            +FVDEIDCGSFFD+IDDL+    E+    +G   DC +  S+W      +        + 
Sbjct  5    SFVDEIDCGSFFDNIDDLM----EDVDSVLGPAPDCNSAFSLWPAASSAAAAPLPPPDAA  60

Query  264  sasdl-----saelsVPYEDIVQLEWLSAFVEES-FSDGGLTLGK--ENYPLNPKPESDK  419
              S       S+EL VPYE++V LEWLS FVE S +S G LT+ K  E+Y L  K  S +
Sbjct  61   VFSGNGDSDFSSELPVPYEEMVHLEWLSNFVENSEYSGGDLTMNKQQESYSLVNKESSHQ  120

Query  420  KFQAAsspisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
            +FQ +S    +  SSS S   +    S      ++P +RG  RARSKRPRP 
Sbjct  121  QFQTSSPISVLDSSSSCSGEKNVLEGS------IAPGRRG--RARSKRPRPA  164



>emb|CDY67017.1| BnaCnng53150D [Brassica napus]
Length=333

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 60/92 (65%), Gaps = 7/92 (8%)
 Frame = +3

Query  90   FVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIW----DEPLPDSDPIFsaah  257
            F +++DCG+FFD++DDL+DFP  +   G G GD  +FP+IW    D     SDP+F    
Sbjct  6    FAEDLDCGNFFDNMDDLLDFPGGDIDVGFGIGDSDSFPNIWTTHQDTWPAASDPLF---A  62

Query  258  shsasdlsaelsVPYEDIVQLEWLSAFVEESF  353
            S++ SD S EL VP+EDIV++E    FVEES 
Sbjct  63   SNTNSDSSPELYVPFEDIVKVERPKCFVEESL  94



>dbj|BAH20385.1| AT3G54810 [Arabidopsis thaliana]
Length=322

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 64/94 (68%), Gaps = 7/94 (7%)
 Frame = +3

Query  84   SNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIW----DEPLPDSDPIFsa  251
            ++F +++DCG+FFD++DDL+DFP  +   G G GD  +FP+IW    D     SDP+F  
Sbjct  4    TSFPEDLDCGNFFDNMDDLMDFPGGDIDVGFGIGDSDSFPTIWTTHHDTWPAASDPLF--  61

Query  252  ahshsasdlsaelsVPYEDIVQLEWLSAFVEESF  353
              S++ SD S EL VP+EDIV++E   +FVEE+F
Sbjct  62   -SSNTNSDSSPELYVPFEDIVKVERPPSFVEETF  94



>ref|XP_010427201.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Camelina 
sativa]
Length=326

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 64/93 (69%), Gaps = 5/93 (5%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIWDEPL----PDSDPIFsaa  254
            +F +++DCG+FFD++DDL+DFP  +   G G GD  +FP+IW  P       SDP+F ++
Sbjct  5    SFPEDLDCGNFFDNMDDLMDFPGGDIDVGFGIGDSDSFPTIWTSPQDTWPAASDPLF-SS  63

Query  255  hshsasdlsaelsVPYEDIVQLEWLSAFVEESF  353
            ++ + SD S EL VP+EDIV+++   +FVEES 
Sbjct  64   NTTTNSDSSPELYVPFEDIVKVDRPPSFVEESL  96



>ref|NP_191041.1| GATA transcription factor 8 [Arabidopsis thaliana]
 ref|NP_850704.1| GATA transcription factor 8 [Arabidopsis thaliana]
 sp|Q9SV30.1|GATA8_ARATH RecName: Full=GATA transcription factor 8 [Arabidopsis thaliana]
 gb|AAL06560.1|AF412107_1 AT3g54810/F28P10_210 [Arabidopsis thaliana]
 emb|CAB41103.1| putative protein [Arabidopsis thaliana]
 gb|AAL77730.1| AT3g54810/F28P10_210 [Arabidopsis thaliana]
 dbj|BAH20168.1| AT3G54810 [Arabidopsis thaliana]
 gb|AEE79293.1| GATA transcription factor 8 [Arabidopsis thaliana]
 gb|AEE79294.1| GATA transcription factor 8 [Arabidopsis thaliana]
Length=322

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 63/94 (67%), Gaps = 7/94 (7%)
 Frame = +3

Query  84   SNFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIW----DEPLPDSDPIFsa  251
            ++F +++DCG+FFD++DDL+DFP  +   G G GD  +FP+IW    D     SDP+F  
Sbjct  4    TSFPEDLDCGNFFDNMDDLMDFPGGDIDVGFGIGDSDSFPTIWTTHHDTWPAASDPLF--  61

Query  252  ahshsasdlsaelsVPYEDIVQLEWLSAFVEESF  353
              S++ SD S EL VP+EDIV++E   +FVEE+ 
Sbjct  62   -SSNTNSDSSPELYVPFEDIVKVERPPSFVEETL  94



>ref|XP_002876270.1| BME3/BME3-ZF [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52529.1| BME3/BME3-ZF [Arabidopsis lyrata subsp. lyrata]
Length=319

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 61/93 (66%), Gaps = 7/93 (8%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIW----DEPLPDSDPIFsaa  254
            +F +++DCG+FFD++DDL+DFP  +   G G GD  +FP+IW    D     SDP+F   
Sbjct  5    SFPEDLDCGNFFDNMDDLMDFPGGDIDVGFGIGDSDSFPTIWTTHHDTWPAASDPLF---  61

Query  255  hshsasdlsaelsVPYEDIVQLEWLSAFVEESF  353
             S++ SD S EL VP+EDIV++E    FVEES 
Sbjct  62   SSNTNSDSSPELYVPFEDIVKVERPPTFVEESL  94



>emb|CDX73447.1| BnaC08g25560D [Brassica napus]
Length=323

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 61/92 (66%), Gaps = 7/92 (8%)
 Frame = +3

Query  90   FVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIW----DEPLPDSDPIFsaah  257
            F ++IDCG+FFD++DD++DFP  +   G   GD  +FP+IW    D     SDP+F    
Sbjct  6    FPEDIDCGNFFDNMDDILDFPGCDMDVGFSIGDSDSFPNIWTNHQDTWPAASDPLF---S  62

Query  258  shsasdlsaelsVPYEDIVQLEWLSAFVEESF  353
            S++ SD S EL VP+EDIV++E  ++FVEES 
Sbjct  63   SNTNSDSSPELYVPFEDIVKVERPASFVEESL  94



>ref|XP_010427202.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Camelina 
sativa]
Length=326

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 64/93 (69%), Gaps = 5/93 (5%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIW----DEPLPDSDPIFsaa  254
            +F +++DCG+FFD++DDL+DFP  +   G G GD  +FP+IW    D     SDP+F ++
Sbjct  5    SFPEDLDCGNFFDNMDDLMDFPGGDIDVGFGIGDSDSFPTIWTSHQDTWPAASDPLF-SS  63

Query  255  hshsasdlsaelsVPYEDIVQLEWLSAFVEESF  353
            ++ + SD S EL VP+EDIV+++   +FVEES 
Sbjct  64   NTTTNSDSSPELYVPFEDIVKVDRPPSFVEESL  96



>ref|XP_010504307.1| PREDICTED: GATA transcription factor 8 [Camelina sativa]
 ref|XP_010504308.1| PREDICTED: GATA transcription factor 8 [Camelina sativa]
Length=326

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 64/93 (69%), Gaps = 5/93 (5%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIW----DEPLPDSDPIFsaa  254
            +F +++DCG+FFD++DDL+DFP  +   G G GD  +FP+IW    D     SDP+F ++
Sbjct  5    SFPEDLDCGNFFDNMDDLMDFPGGDIDVGFGIGDSDSFPTIWTSHQDTWPAASDPLF-SS  63

Query  255  hshsasdlsaelsVPYEDIVQLEWLSAFVEESF  353
            ++ + SD S EL VP+EDIV+++   +FVEES 
Sbjct  64   NTTTNSDSSPELYVPFEDIVKVDRPPSFVEESL  96



>ref|XP_009116158.1| PREDICTED: GATA transcription factor 8 [Brassica rapa]
Length=324

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 61/93 (66%), Gaps = 7/93 (8%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIW----DEPLPDSDPIFsaa  254
            +F ++IDCG+FFD++DD++DFP  +   G   GD   FP+IW    D     SDP+F   
Sbjct  5    SFPEDIDCGNFFDNMDDILDFPGCDMDVGFNIGDSDPFPNIWTNHQDTWPAASDPLF---  61

Query  255  hshsasdlsaelsVPYEDIVQLEWLSAFVEESF  353
             S++ SD S EL VP+EDIV++E  ++FVEES 
Sbjct  62   SSNTNSDSSPELYVPFEDIVKVERPASFVEESL  94



>emb|CDY02894.1| BnaC04g25920D [Brassica napus]
Length=333

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 61/93 (66%), Gaps = 7/93 (8%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIW----DEPLPDSDPIFsaa  254
            +F +++DCG+FFD++DDL+DFP  +   G   GD  +FP+IW    D     S+P+F   
Sbjct  5    SFPEDLDCGNFFDNMDDLLDFPGGDIDVGFSIGDSDSFPNIWTTHHDTWPAASEPVF---  61

Query  255  hshsasdlsaelsVPYEDIVQLEWLSAFVEESF  353
             S++ SD S EL VP+EDIV++E   +FVEES 
Sbjct  62   ASNTNSDSSPELYVPFEDIVKVERPQSFVEESL  94



>emb|CDX78264.1| BnaA09g34590D [Brassica napus]
Length=324

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 61/93 (66%), Gaps = 7/93 (8%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIW----DEPLPDSDPIFsaa  254
            +F ++IDCG+FFD++DD++DFP  +   G   GD  +FP+IW    D     SDP+F   
Sbjct  5    SFPEDIDCGNFFDNMDDILDFPGCDMDVGFNIGDSDSFPNIWTNHQDTWPAASDPLF---  61

Query  255  hshsasdlsaelsVPYEDIVQLEWLSAFVEESF  353
             S++ SD S EL VP+EDIV++E  ++FV ES 
Sbjct  62   SSNTNSDSSPELYVPFEDIVKVERPASFVSESL  94



>ref|XP_006403533.1| hypothetical protein EUTSA_v10010544mg [Eutrema salsugineum]
 dbj|BAJ34547.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ44986.1| hypothetical protein EUTSA_v10010544mg [Eutrema salsugineum]
Length=325

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 61/92 (66%), Gaps = 7/92 (8%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIW----DEPLPDSDPIFsaa  254
            +F +++DCG+FFD++DDLIDFP  +   G   GD  +FP+IW    D     SDP+F   
Sbjct  5    SFPEDLDCGNFFDNMDDLIDFPGGDIDVGFDIGDSDSFPNIWTTHHDTWPTASDPLF---  61

Query  255  hshsasdlsaelsVPYEDIVQLEWLSAFVEES  350
             S++ SD S EL VP+EDIV++E   +FVEES
Sbjct  62   SSNTNSDSSTELYVPFEDIVKVERPPSFVEES  93



>ref|XP_006291493.1| hypothetical protein CARUB_v10017647mg [Capsella rubella]
 gb|EOA24391.1| hypothetical protein CARUB_v10017647mg [Capsella rubella]
Length=323

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 61/93 (66%), Gaps = 7/93 (8%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIW----DEPLPDSDPIFsaa  254
            +F +++DCG+FFD++DD++DFP  +   G G GD   FP+IW    D     SDP+F   
Sbjct  5    SFPEDLDCGNFFDNMDDIMDFPGGDIDVGFGIGDSDAFPTIWTTQHDTWPAASDPLF---  61

Query  255  hshsasdlsaelsVPYEDIVQLEWLSAFVEESF  353
             S++ S+ S EL VP+EDIV+++   +FVEES 
Sbjct  62   SSNTNSNSSTELYVPFEDIVKVDRPQSFVEESL  94



>ref|XP_004149904.1| PREDICTED: GATA transcription factor 4-like [Cucumis sativus]
 ref|XP_004158598.1| PREDICTED: GATA transcription factor 4-like [Cucumis sativus]
 gb|KGN47830.1| hypothetical protein Csa_6G405920 [Cucumis sativus]
Length=327

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 87/176 (49%), Gaps = 38/176 (22%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDL-------IDFPPENECGGVGSGDCANFPSIWDEPL------P  227
            N  +EIDCG+FFD+I+DL       +DF          + + A FP IW E        P
Sbjct  5    NIAEEIDCGNFFDNIEDLLEDLDHDVDF----------NTNSAAFPPIWSEHSDSLPSDP  54

Query  228  DSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKP  407
              DP+  + ++   S LS +L VPY+D  Q+EWLS FV++SFS G  TL      L+P  
Sbjct  55   VVDPVLFSVNTAPDSALSPDLCVPYDD--QMEWLSNFVDDSFS-GAETLTINASNLSPP-  110

Query  408  ESDKKFQAAsspisvlesssssssssnsscsGGKAMPLSPSQRGAQRARSKRPRPV  575
                +F  +        S  S   SS+SS S  +  PLS       RARSKRPRP 
Sbjct  111  ---SQFHIS--------SPVSVLDSSSSSSSSDEKKPLSTKDGRRGRARSKRPRPT  155



>ref|XP_006591215.1| PREDICTED: VHS domain-containing protein At3g16270-like isoform 
X2 [Glycine max]
 ref|XP_006591216.1| PREDICTED: VHS domain-containing protein At3g16270-like isoform 
X3 [Glycine max]
Length=238

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 5/41 (12%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSI  209
            NF+DEIDCGSFFDHIDDL+DFP ++  GG      A  PS+
Sbjct  5    NFMDEIDCGSFFDHIDDLLDFPVKDVDGG-----AATLPSV  40



>ref|XP_006591214.1| PREDICTED: VHS domain-containing protein At3g16270-like isoform 
X1 [Glycine max]
Length=270

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 5/41 (12%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSI  209
            NF+DEIDCGSFFDHIDDL+DFP ++  GG      A  PS+
Sbjct  5    NFMDEIDCGSFFDHIDDLLDFPVKDVDGG-----AATLPSV  40



>emb|CDY07522.1| BnaC06g15420D [Brassica napus]
Length=324

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 62/90 (69%), Gaps = 5/90 (6%)
 Frame = +3

Query  90   FVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIW----DEPLPDSDPIFsaah  257
            F +++DCG+FFD++DD++DFP  +   G   G+  +FP+IW    D   P SDP+F +++
Sbjct  7    FPEDLDCGNFFDNMDDILDFPGGDIDVGFDIGESDSFPNIWTTHHDTWPPASDPLF-SSN  65

Query  258  shsasdlsaelsVPYEDIVQLEWLSAFVEE  347
            +++ SD S EL VP+EDIV++E   + +E+
Sbjct  66   TNTNSDSSPELYVPFEDIVKVERPPSLIEK  95



>ref|XP_010516023.1| PREDICTED: GATA transcription factor 8-like [Camelina sativa]
Length=324

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 58/83 (70%), Gaps = 5/83 (6%)
 Frame = +3

Query  87   NFVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIW----DEPLPDSDPIFsaa  254
            +F +++DCG+FFD++DDL+DFP  +   G G GD  +FP+IW    D     SDP+F ++
Sbjct  5    SFPEDLDCGNFFDNMDDLMDFPGGDIDVGFGIGDSDSFPTIWTSHQDTWPAASDPLF-SS  63

Query  255  hshsasdlsaelsVPYEDIVQLE  323
            ++ + SD S EL VP+EDIV+++
Sbjct  64   NTTTNSDSSPELYVPFEDIVKVD  86



>ref|XP_010032187.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Eucalyptus 
grandis]
Length=310

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +3

Query  300  YEDIVQLEWLSAFVEESFSDGGLTLGKE  383
            YEDIVQLEWLS FVEESFS G LT+ KE
Sbjct  33   YEDIVQLEWLSTFVEESFSGGSLTMSKE  60



>ref|XP_009103933.1| PREDICTED: GATA transcription factor 8-like [Brassica rapa]
Length=313

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 61/90 (68%), Gaps = 5/90 (6%)
 Frame = +3

Query  90   FVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIW----DEPLPDSDPIFsaah  257
            F +++DCG+FFD++DD++DFP  +   G   G+  +FP+IW    D     SDP+F A++
Sbjct  7    FPEDLDCGNFFDNMDDILDFPGGDIDVGFDIGESDSFPNIWTTHHDTWHAASDPLF-ASN  65

Query  258  shsasdlsaelsVPYEDIVQLEWLSAFVEE  347
            +++ SD S EL VP+EDIV++E   + VE+
Sbjct  66   TNTNSDSSPELYVPFEDIVKVERPPSLVEK  95



>emb|CDX67609.1| BnaA07g16490D [Brassica napus]
Length=315

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 61/90 (68%), Gaps = 5/90 (6%)
 Frame = +3

Query  90   FVDEIDCGSFFDHIDDLIDFPPENECGGVGSGDCANFPSIW----DEPLPDSDPIFsaah  257
            F +++DCG+FFD++DD++DFP  +   G   G+  +FP+IW    D     SDP+F +++
Sbjct  7    FPEDLDCGNFFDNMDDILDFPGGDIDVGFDIGESDSFPNIWTTHHDTWPAASDPLF-SSN  65

Query  258  shsasdlsaelsVPYEDIVQLEWLSAFVEE  347
            +++ SD S EL VP+EDIV++E   + VE+
Sbjct  66   TNTNSDSSPELYVPFEDIVKVERPPSLVEK  95



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750