BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF010M06

Length=524
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004241481.1|  PREDICTED: coiled-coil domain-containing pro...  94.0    7e-31   Solanum lycopersicum
ref|XP_006347381.1|  PREDICTED: coiled-coil domain-containing pro...  94.0    2e-30   Solanum tuberosum [potatoes]
gb|KDP45824.1|  hypothetical protein JCGZ_17431                       91.7    2e-29   Jatropha curcas
ref|XP_009777239.1|  PREDICTED: coiled-coil domain-containing pro...  85.1    8e-29   Nicotiana sylvestris
ref|XP_009608865.1|  PREDICTED: coiled-coil domain-containing pro...  85.1    1e-28   Nicotiana tomentosiformis
ref|XP_010687588.1|  PREDICTED: coiled-coil domain-containing pro...  86.3    3e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010322514.1|  PREDICTED: coiled-coil domain-containing pro...  95.5    7e-28   Solanum lycopersicum
ref|XP_010093549.1|  hypothetical protein L484_013982                 89.4    1e-27   Morus notabilis
gb|AFK47380.1|  unknown                                               86.3    2e-27   Lotus japonicus
ref|XP_010248821.1|  PREDICTED: coiled-coil domain-containing pro...  87.4    6e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010248829.1|  PREDICTED: coiled-coil domain-containing pro...  87.0    7e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010101177.1|  hypothetical protein L484_005414                 87.4    2e-26   Morus notabilis
ref|XP_002263858.1|  PREDICTED: coiled-coil domain-containing pro...  83.2    2e-26   Vitis vinifera
ref|XP_002305693.1|  hypothetical protein POPTR_0004s06590g           85.9    3e-26   Populus trichocarpa [western balsam poplar]
ref|XP_010102099.1|  ATP-dependent RNA helicase dhx8                  91.7    3e-26   
emb|CDP18672.1|  unnamed protein product                              83.6    7e-26   Coffea canephora [robusta coffee]
ref|XP_009355920.1|  PREDICTED: coiled-coil domain-containing pro...  84.7    8e-26   Pyrus x bretschneideri [bai li]
ref|XP_011035412.1|  PREDICTED: coiled-coil domain-containing pro...  84.7    9e-26   Populus euphratica
ref|XP_008375067.1|  PREDICTED: coiled-coil domain-containing pro...  84.3    1e-25   Malus domestica [apple tree]
ref|XP_008240328.1|  PREDICTED: coiled-coil domain-containing pro...  85.5    1e-25   Prunus mume [ume]
ref|XP_010069536.1|  PREDICTED: coiled-coil domain-containing pro...  82.8    3e-25   Eucalyptus grandis [rose gum]
gb|KGN64223.1|  hypothetical protein Csa_1G043260                     81.6    3e-25   Cucumis sativus [cucumbers]
ref|XP_008437152.1|  PREDICTED: coiled-coil domain-containing pro...  80.1    4e-25   Cucumis melo [Oriental melon]
ref|XP_011086938.1|  PREDICTED: coiled-coil domain-containing pro...  85.9    5e-25   Sesamum indicum [beniseed]
ref|XP_009355916.1|  PREDICTED: coiled-coil domain-containing pro...  85.1    6e-25   Pyrus x bretschneideri [bai li]
ref|XP_010546632.1|  PREDICTED: coiled-coil domain-containing pro...  83.6    6e-25   Tarenaya hassleriana [spider flower]
ref|XP_008375068.1|  PREDICTED: coiled-coil domain-containing pro...  84.7    8e-25   
ref|XP_004137537.1|  PREDICTED: coiled-coil domain-containing pro...  80.5    8e-25   Cucumis sativus [cucumbers]
ref|NP_566245.1|  uncharacterized protein                             75.9    2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004495490.1|  PREDICTED: coiled-coil domain-containing pro...  76.3    2e-24   Cicer arietinum [garbanzo]
gb|KJB60515.1|  hypothetical protein B456_009G312100                  82.4    3e-24   Gossypium raimondii
gb|KHG26990.1|  Coiled-coil domain-containing 12                      82.0    4e-24   Gossypium arboreum [tree cotton]
gb|EYU17804.1|  hypothetical protein MIMGU_mgv1a015162mg              80.5    5e-24   Erythranthe guttata [common monkey flower]
ref|NP_001236672.1|  uncharacterized protein LOC100527227             77.0    5e-24   Glycine max [soybeans]
ref|XP_010108874.1|  putative ATP-dependent RNA helicase DHX35        85.1    6e-24   
ref|XP_008393522.1|  PREDICTED: coiled-coil domain-containing pro...  79.3    7e-24   Malus domestica [apple tree]
ref|XP_008393521.1|  PREDICTED: coiled-coil domain-containing pro...  79.3    8e-24   Malus domestica [apple tree]
ref|XP_007009901.1|  Cwf18 isoform 1                                  79.3    9e-24   
gb|KDO55952.1|  hypothetical protein CISIN_1g031113mg                 79.3    1e-23   Citrus sinensis [apfelsine]
ref|XP_006441474.1|  hypothetical protein CICLE_v10022597mg           79.3    1e-23   Citrus clementina [clementine]
ref|XP_006478141.1|  PREDICTED: coiled-coil domain-containing pro...  79.3    1e-23   
ref|XP_002519582.1|  conserved hypothetical protein                   84.0    1e-23   
gb|KEH42882.1|  cwf18 pre-mRNA splicing factor                        73.6    2e-23   Medicago truncatula
ref|XP_002882392.1|  hypothetical protein ARALYDRAFT_477790           75.1    2e-23   
ref|XP_006408114.1|  hypothetical protein EUTSA_v10021722mg           80.9    2e-23   Eutrema salsugineum [saltwater cress]
gb|KJB60517.1|  hypothetical protein B456_009G312100                  83.6    2e-23   Gossypium raimondii
gb|KJB60516.1|  hypothetical protein B456_009G312100                  83.2    3e-23   Gossypium raimondii
gb|KFK23537.1|  hypothetical protein AALP_AAs63573U000100             77.0    5e-23   Arabis alpina [alpine rockcress]
emb|CDY27800.1|  BnaA05g32090D                                        73.6    6e-23   Brassica napus [oilseed rape]
ref|XP_010422930.1|  PREDICTED: coiled-coil domain-containing pro...  75.1    2e-22   Camelina sativa [gold-of-pleasure]
gb|KCW57911.1|  hypothetical protein EUGRSUZ_H00657                   81.6    2e-22   Eucalyptus grandis [rose gum]
emb|CDY41931.1|  BnaC05g46730D                                        71.6    2e-22   Brassica napus [oilseed rape]
ref|XP_009147281.1|  PREDICTED: coiled-coil domain-containing pro...  71.6    2e-22   Brassica rapa
gb|KCW57913.1|  hypothetical protein EUGRSUZ_H00657                   82.4    3e-22   Eucalyptus grandis [rose gum]
gb|ADE77638.1|  unknown                                               72.8    6e-22   Picea sitchensis
ref|XP_007208967.1|  hypothetical protein PRUPE_ppb020505mg           80.5    8e-22   
ref|NP_001238051.1|  uncharacterized protein LOC100306131             68.2    2e-21   
gb|KDO55954.1|  hypothetical protein CISIN_1g031113mg                 77.8    2e-21   Citrus sinensis [apfelsine]
ref|XP_010485909.1|  PREDICTED: coiled-coil domain-containing pro...  71.2    2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_006478142.1|  PREDICTED: coiled-coil domain-containing pro...  78.2    2e-21   Citrus sinensis [apfelsine]
ref|XP_010464015.1|  PREDICTED: coiled-coil domain-containing pro...  70.9    2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_004299453.1|  PREDICTED: coiled-coil domain-containing pro...  72.0    3e-21   Fragaria vesca subsp. vesca
ref|XP_006300259.1|  hypothetical protein CARUB_v10016498mg           73.2    9e-21   Capsella rubella
gb|KHN14750.1|  Coiled-coil domain-containing protein 12              65.1    2e-20   Glycine soja [wild soybean]
gb|EPS62441.1|  hypothetical protein M569_12350                       70.9    6e-20   Genlisea aurea
ref|XP_007161569.1|  hypothetical protein PHAVU_001G080600g           62.4    1e-19   Phaseolus vulgaris [French bean]
ref|XP_009134809.1|  PREDICTED: LOW QUALITY PROTEIN: coiled-coil ...  59.7    2e-18   Brassica rapa
ref|XP_006848659.1|  hypothetical protein AMTR_s00171p00065800        63.9    2e-18   Amborella trichopoda
ref|XP_006644463.1|  PREDICTED: coiled-coil domain-containing pro...  57.8    8e-17   Oryza brachyantha
gb|EMS53919.1|  hypothetical protein TRIUR3_06239                     57.4    1e-16   Triticum urartu
dbj|BAJ90654.1|  predicted protein                                    56.6    4e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006656528.1|  PREDICTED: coiled-coil domain-containing pro...  57.0    5e-16   Oryza brachyantha
gb|EMT31131.1|  hypothetical protein F775_07814                       55.1    1e-15   
ref|XP_003563215.1|  PREDICTED: coiled-coil domain-containing pro...  54.7    2e-15   Brachypodium distachyon [annual false brome]
ref|XP_004966558.1|  PREDICTED: coiled-coil domain-containing pro...  56.6    2e-15   Setaria italica
ref|XP_006372638.1|  hypothetical protein POPTR_0017s03480g           58.5    1e-14   
ref|XP_002437648.1|  hypothetical protein SORBIDRAFT_10g031190        57.8    1e-14   Sorghum bicolor [broomcorn]
ref|XP_007009902.1|  Cwf18 isoform 2                                  77.0    2e-14   
ref|XP_009396161.1|  PREDICTED: coiled-coil domain-containing pro...  77.8    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001141270.1|  hypothetical protein                             53.5    3e-14   Zea mays [maize]
ref|XP_010239286.1|  PREDICTED: coiled-coil domain-containing pro...  55.1    3e-14   Brachypodium distachyon [annual false brome]
ref|XP_002984337.1|  hypothetical protein SELMODRAFT_445863           58.2    4e-14   Selaginella moellendorffii
gb|ACJ86026.1|  unknown                                               75.1    1e-13   Medicago truncatula
ref|XP_002972762.1|  hypothetical protein SELMODRAFT_413348           58.2    2e-13   
ref|XP_001780929.1|  predicted protein                                55.5    6e-13   
ref|XP_010935583.1|  PREDICTED: coiled-coil domain-containing pro...  73.6    7e-13   Elaeis guineensis
ref|XP_008802780.1|  PREDICTED: coiled-coil domain-containing pro...  70.5    7e-12   Phoenix dactylifera
ref|XP_011461976.1|  PREDICTED: coiled-coil domain-containing pro...  46.2    3e-10   Fragaria vesca subsp. vesca
emb|CDX74154.1|  BnaA03g28930D                                        60.1    1e-08   
ref|XP_005647392.1|  hypothetical protein COCSUDRAFT_16114            53.9    7e-08   Coccomyxa subellipsoidea C-169
gb|EEC81357.1|  hypothetical protein OsI_24550                        57.8    2e-07   Oryza sativa Indica Group [Indian rice]
ref|NP_001058658.1|  Os06g0730800                                     57.8    2e-07   
gb|KIZ00598.1|  Coiled-coil domain-containing protein 12              44.3    2e-07   Monoraphidium neglectum
ref|XP_004365664.1|  hypothetical protein CAOG_00793                  42.4    2e-06   Capsaspora owczarzaki ATCC 30864
ref|XP_009067757.1|  PREDICTED: coiled-coil domain-containing pro...  45.8    8e-06   Acanthisitta chloris
ref|XP_004342218.1|  cwf18 pre-mRNA splicing factor protein           43.9    9e-06   Acanthamoeba castellanii str. Neff
ref|XP_008120605.1|  PREDICTED: coiled-coil domain-containing pro...  44.3    1e-05   Anolis carolinensis [Carolina anole]
ref|XP_006171088.1|  PREDICTED: coiled-coil domain-containing pro...  43.9    2e-05   
gb|ELV09682.1|  Coiled-coil domain-containing protein 12              43.9    2e-05   Tupaia chinensis
gb|KFU93677.1|  Coiled-coil domain-containing protein 12              46.2    3e-05   Chaetura pelagica
ref|XP_010020082.1|  PREDICTED: coiled-coil domain-containing pro...  45.8    3e-05   Nestor notabilis
ref|XP_010001356.1|  PREDICTED: coiled-coil domain-containing pro...  46.2    3e-05   Chaetura pelagica
ref|XP_009878822.1|  PREDICTED: coiled-coil domain-containing pro...  46.2    3e-05   Charadrius vociferus
ref|XP_003059754.1|  predicted protein                                40.8    3e-05   Micromonas pusilla CCMP1545
ref|XP_004704212.1|  PREDICTED: coiled-coil domain-containing pro...  44.3    4e-05   
ref|XP_004316573.1|  PREDICTED: coiled-coil domain-containing pro...  44.7    4e-05   
ref|XP_001521551.2|  PREDICTED: coiled-coil domain-containing pro...  45.4    5e-05   
ref|XP_005040505.1|  PREDICTED: coiled-coil domain-containing pro...  47.0    5e-05   Ficedula albicollis
ref|XP_004760838.1|  PREDICTED: coiled-coil domain-containing pro...  44.7    5e-05   Mustela putorius furo [black ferret]
gb|KFP75017.1|  Coiled-coil domain-containing protein 12              46.2    5e-05   Acanthisitta chloris
ref|XP_008921036.1|  PREDICTED: coiled-coil domain-containing pro...  45.8    5e-05   
ref|XP_009473636.1|  PREDICTED: coiled-coil domain-containing pro...  47.0    6e-05   Nipponia nippon
ref|XP_005600802.1|  PREDICTED: coiled-coil domain-containing pro...  44.3    6e-05   
ref|XP_005600801.1|  PREDICTED: coiled-coil domain-containing pro...  44.3    6e-05   
ref|XP_005144041.1|  PREDICTED: coiled-coil domain-containing pro...  46.2    6e-05   Melopsittacus undulatus
ref|XP_005023364.1|  PREDICTED: coiled-coil domain-containing pro...  45.1    6e-05   
ref|XP_005600803.1|  PREDICTED: coiled-coil domain-containing pro...  43.9    7e-05   Equus caballus [domestic horse]
ref|XP_011418659.1|  PREDICTED: coiled-coil domain-containing pro...  43.1    8e-05   Crassostrea gigas
ref|NP_001003589.1|  coiled-coil domain-containing protein 12         44.3    8e-05   Danio rerio [leopard danio]
ref|NP_001091259.1|  uncharacterized protein LOC100037064             45.1    8e-05   Xenopus laevis [clawed frog]
ref|XP_005532203.1|  PREDICTED: coiled-coil domain-containing pro...  45.8    9e-05   
ref|XP_003206961.1|  PREDICTED: coiled-coil domain-containing pro...  45.4    9e-05   Meleagris gallopavo [common turkey]
ref|XP_008641363.1|  PREDICTED: coiled-coil domain-containing pro...  46.6    9e-05   
ref|XP_010171939.1|  PREDICTED: coiled-coil domain-containing pro...  46.2    9e-05   Antrostomus carolinensis
ref|XP_005308836.1|  PREDICTED: coiled-coil domain-containing pro...  46.2    1e-04   Chrysemys picta bellii
ref|NP_001158518.1|  Coiled-coil domain-containing protein 12         45.8    1e-04   Oncorhynchus mykiss
ref|XP_010393056.1|  PREDICTED: coiled-coil domain-containing pro...  46.2    1e-04   Corvus cornix cornix
ref|XP_009705483.1|  PREDICTED: coiled-coil domain-containing pro...  46.2    1e-04   Cariama cristata
ref|XP_009279299.1|  PREDICTED: coiled-coil domain-containing pro...  46.2    1e-04   Aptenodytes forsteri
ref|XP_009638389.1|  PREDICTED: coiled-coil domain-containing pro...  46.2    1e-04   Egretta garzetta
ref|XP_009926465.1|  PREDICTED: coiled-coil domain-containing pro...  46.2    1e-04   Haliaeetus albicilla
ref|XP_004211306.1|  PREDICTED: coiled-coil domain-containing pro...  45.1    1e-04   
ref|XP_001422700.1|  predicted protein                                40.4    1e-04   Ostreococcus lucimarinus CCE9901
ref|NP_001106902.1|  coiled-coil domain containing 12                 45.1    1e-04   Xenopus laevis [clawed frog]
ref|XP_009573010.1|  PREDICTED: coiled-coil domain-containing pro...  46.2    1e-04   Fulmarus glacialis
ref|XP_007126145.1|  PREDICTED: coiled-coil domain-containing pro...  44.7    1e-04   
ref|XP_002912813.1|  PREDICTED: coiled-coil domain-containing pro...  44.7    1e-04   
gb|AAI29787.1|  LOC100037234 protein                                  45.1    1e-04   Xenopus laevis [clawed frog]
ref|XP_629550.1|  mRNA splicing factor, Cwf18 family protein          41.6    1e-04   Dictyostelium discoideum AX4
ref|XP_005223150.1|  PREDICTED: coiled-coil domain-containing pro...  43.9    2e-04   
gb|EPY89395.1|  coiled-coil domain-containing protein 12-like pro...  44.3    2e-04   Camelus ferus
ref|XP_006173541.1|  PREDICTED: coiled-coil domain-containing pro...  44.7    2e-04   
ref|XP_001833092.1|  hypothetical protein CC1G_01154                  48.9    2e-04   Coprinopsis cinerea okayama7#130
ref|XP_006928752.1|  PREDICTED: coiled-coil domain-containing pro...  44.7    2e-04   Felis catus [cat]
ref|XP_006200792.1|  PREDICTED: coiled-coil domain-containing pro...  44.7    2e-04   Vicugna pacos
ref|XP_541901.2|  PREDICTED: coiled-coil domain-containing protei...  44.7    2e-04   Canis lupus familiaris [dogs]
ref|XP_004676293.1|  PREDICTED: coiled-coil domain-containing pro...  44.7    2e-04   Condylura cristata
ref|XP_005669523.1|  PREDICTED: coiled-coil domain-containing pro...  44.7    2e-04   Sus scrofa [pigs]
ref|XP_005934857.1|  PREDICTED: coiled-coil domain-containing pro...  45.4    2e-04   Haplochromis burtoni
ref|XP_007470325.1|  PREDICTED: coiled-coil domain-containing pro...  45.1    2e-04   Lipotes vexillifer [baiji]
ref|XP_004283914.1|  PREDICTED: coiled-coil domain-containing pro...  45.1    2e-04   Orcinus orca [Orca]
ref|XP_007168907.1|  PREDICTED: coiled-coil domain-containing pro...  44.7    2e-04   Balaenoptera acutorostrata scammoni
ref|XP_007070347.1|  PREDICTED: coiled-coil domain-containing pro...  46.6    2e-04   
ref|XP_004399222.1|  PREDICTED: coiled-coil domain-containing pro...  44.7    2e-04   Odobenus rosmarus divergens
ref|XP_006914932.1|  PREDICTED: coiled-coil domain-containing pro...  44.7    2e-04   
ref|XP_004614568.1|  PREDICTED: coiled-coil domain-containing pro...  44.3    2e-04   Sorex araneus [Eurasian shrew]
ref|XP_005512181.1|  PREDICTED: coiled-coil domain-containing pro...  44.3    2e-04   Columba livia [carrier pigeon]
ref|XP_004419680.1|  PREDICTED: coiled-coil domain-containing pro...  44.7    2e-04   
gb|ELK24973.1|  Coiled-coil domain-containing protein 12              44.7    2e-04   Myotis davidii
ref|XP_005496692.1|  PREDICTED: uncharacterized protein LOC102063747  44.3    2e-04   
ref|XP_010133771.1|  PREDICTED: coiled-coil domain-containing pro...  45.1    2e-04   Buceros rhinoceros silvestris
ref|XP_005696078.1|  PREDICTED: coiled-coil domain-containing pro...  44.3    2e-04   Capra hircus [domestic goat]
ref|XP_009812719.1|  PREDICTED: coiled-coil domain-containing pro...  46.2    2e-04   Gavia stellata
ref|XP_009554414.1|  PREDICTED: coiled-coil domain-containing pro...  45.1    2e-04   Cuculus canorus
gb|KFO89314.1|  Coiled-coil domain-containing protein 12              45.1    2e-04   Buceros rhinoceros silvestris
ref|XP_009936630.1|  PREDICTED: coiled-coil domain-containing pro...  44.7    2e-04   Opisthocomus hoazin [hoatzin]
ref|XP_005804720.1|  PREDICTED: coiled-coil domain-containing pro...  43.9    2e-04   
ref|XP_008154223.1|  PREDICTED: coiled-coil domain-containing pro...  44.3    2e-04   Eptesicus fuscus
ref|XP_008321553.1|  PREDICTED: coiled-coil domain-containing pro...  43.5    2e-04   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005223151.2|  PREDICTED: coiled-coil domain-containing pro...  44.3    2e-04   
ref|XP_010860802.1|  PREDICTED: coiled-coil domain-containing pro...  43.9    2e-04   Bison bison bison
ref|NP_001069934.1|  coiled-coil domain-containing protein 12         44.3    2e-04   Bos taurus [bovine]
gb|EMC81123.1|  Coiled-coil domain-containing protein 12              43.9    2e-04   
ref|XP_007509692.1|  unknown protein                                  43.9    2e-04   Bathycoccus prasinos
ref|XP_010755218.1|  PREDICTED: coiled-coil domain-containing pro...  43.1    3e-04   
ref|XP_006129858.1|  PREDICTED: coiled-coil domain-containing pro...  45.8    3e-04   
ref|XP_006770487.1|  PREDICTED: coiled-coil domain-containing pro...  44.3    3e-04   
gb|EPB87798.1|  hypothetical protein HMPREF1544_05458                 46.2    3e-04   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_005428072.1|  PREDICTED: coiled-coil domain-containing pro...  44.3    3e-04   Geospiza fortis
ref|XP_006277376.1|  PREDICTED: coiled-coil domain-containing pro...  44.3    3e-04   
ref|XP_005867263.1|  PREDICTED: coiled-coil domain-containing pro...  44.3    3e-04   Myotis brandtii
gb|ACI66996.1|  Coiled-coil domain-containing protein 12              45.1    3e-04   Salmo salar
ref|XP_010281762.1|  PREDICTED: coiled-coil domain-containing pro...  47.0    3e-04   Phaethon lepturus
ref|NP_001134087.1|  Coiled-coil domain-containing protein 12         45.1    3e-04   Salmo salar
ref|XP_011221225.1|  PREDICTED: coiled-coil domain-containing pro...  43.1    3e-04   
gb|ACI66181.1|  Coiled-coil domain-containing protein 12              45.1    3e-04   Salmo salar
ref|XP_005955215.1|  PREDICTED: coiled-coil domain-containing pro...  44.3    3e-04   Pantholops hodgsonii [Tibetan antelope]
gb|ELK10175.1|  Coiled-coil domain-containing protein 12              44.3    3e-04   Pteropus alecto
ref|XP_007088492.1|  PREDICTED: coiled-coil domain-containing pro...  44.3    3e-04   Panthera tigris altaica
gb|EIE85714.1|  hypothetical protein RO3G_10424                       48.1    3e-04   Rhizopus delemar RA 99-880
ref|XP_010882732.1|  PREDICTED: coiled-coil domain-containing pro...  46.2    3e-04   Esox lucius
ref|XP_004077894.1|  PREDICTED: coiled-coil domain-containing pro...  43.5    3e-04   
ref|XP_007436316.1|  PREDICTED: coiled-coil domain-containing pro...  44.3    3e-04   
gb|EPQ08394.1|  Coiled-coil domain-containing protein 12              43.5    4e-04   Myotis brandtii
ref|XP_005229622.1|  PREDICTED: coiled-coil domain-containing pro...  44.7    4e-04   Falco peregrinus [peregrine]
ref|XP_010816234.1|  PREDICTED: coiled-coil domain-containing pro...  43.9    4e-04   
ref|XP_008490404.1|  PREDICTED: coiled-coil domain-containing pro...  45.8    4e-04   Calypte anna
gb|KFD48500.1|  hypothetical protein M513_10634                       44.3    4e-04   Trichuris suis
ref|XP_005696079.1|  PREDICTED: coiled-coil domain-containing pro...  43.9    4e-04   Capra hircus [domestic goat]
ref|XP_009084497.1|  PREDICTED: coiled-coil domain-containing pro...  43.9    4e-04   
ref|XP_005075048.1|  PREDICTED: coiled-coil domain-containing pro...  44.7    4e-04   Mesocricetus auratus [Syrian golden hamster]
ref|XP_008430786.1|  PREDICTED: coiled-coil domain-containing pro...  44.3    4e-04   Poecilia reticulata
ref|XP_005348055.1|  PREDICTED: coiled-coil domain-containing pro...  44.7    4e-04   
ref|NP_001006353.1|  coiled-coil domain-containing protein 12         45.4    4e-04   Gallus gallus [bantam]
gb|KFP61285.1|  Coiled-coil domain-containing protein 12              46.2    4e-04   Cariama cristata
gb|KFM08706.1|  Coiled-coil domain-containing protein 12              46.2    4e-04   Aptenodytes forsteri
gb|KFO12662.1|  Coiled-coil domain-containing protein 12              46.2    4e-04   Balearica regulorum gibbericeps
gb|KGL89593.1|  Coiled-coil domain-containing protein 12              46.2    5e-04   Charadrius vociferus
ref|XP_006770486.1|  PREDICTED: coiled-coil domain-containing pro...  43.5    5e-04   
ref|XP_003504302.1|  PREDICTED: coiled-coil domain-containing pro...  44.7    5e-04   Cricetulus griseus [Chinese hamsters]
ref|XP_009487206.1|  PREDICTED: coiled-coil domain-containing pro...  46.2    5e-04   Pelecanus crispus
gb|EOA98534.1|  Coiled-coil domain-containing protein 12              45.1    5e-04   Anas platyrhynchos [duck]
ref|XP_001697076.1|  hypothetical protein CHLREDRAFT_184951           42.0    5e-04   Chlamydomonas reinhardtii
gb|EHJ70025.1|  coiled-coil domain containing 12-like protein         43.9    5e-04   
ref|XP_010710593.1|  PREDICTED: coiled-coil domain-containing pro...  45.4    5e-04   Meleagris gallopavo [common turkey]
ref|XP_009979166.1|  PREDICTED: coiled-coil domain-containing pro...  46.6    5e-04   Tauraco erythrolophus
ref|XP_003762982.1|  PREDICTED: coiled-coil domain-containing pro...  43.9    5e-04   Sarcophilus harrisii
ref|XP_010304384.1|  PREDICTED: coiled-coil domain-containing pro...  46.2    6e-04   Balearica regulorum gibbericeps
dbj|GAM18895.1|  hypothetical protein SAMD00019534_020700             45.4    6e-04   Acytostelium subglobosum LB1
ref|XP_007534029.1|  PREDICTED: coiled-coil domain-containing pro...  44.7    6e-04   Erinaceus europaeus [common hedgehog]
ref|XP_006801430.1|  PREDICTED: coiled-coil domain-containing pro...  43.5    6e-04   Neolamprologus brichardi [lyretail cichlid]
ref|XP_003454446.1|  PREDICTED: coiled-coil domain-containing pro...  43.5    6e-04   
ref|XP_002109500.1|  hypothetical protein TRIADDRAFT_53602            36.2    6e-04   Trichoplax adhaerens
dbj|GAN07616.1|  coiled-coil domain-containing protein 12             44.7    6e-04   Mucor ambiguus
ref|XP_008970042.1|  PREDICTED: coiled-coil domain-containing pro...  42.7    6e-04   Pan paniscus [bonobo]
ref|XP_009906078.1|  PREDICTED: coiled-coil domain-containing pro...  45.1    6e-04   Picoides pubescens
emb|CDJ44745.1|  hypothetical protein, conserved                      39.7    7e-04   Eimeria tenella
ref|XP_009945692.1|  PREDICTED: coiled-coil domain-containing pro...  45.1    7e-04   Leptosomus discolor
ref|XP_005934856.1|  PREDICTED: coiled-coil domain-containing pro...  42.7    7e-04   
ref|XP_008283900.1|  PREDICTED: coiled-coil domain-containing pro...  43.5    7e-04   Stegastes partitus
ref|XP_010083497.1|  PREDICTED: coiled-coil domain-containing pro...  46.2    7e-04   Pterocles gutturalis
ref|XP_007632918.1|  PREDICTED: coiled-coil domain-containing pro...  44.3    7e-04   
ref|XP_009926464.1|  PREDICTED: coiled-coil domain-containing pro...  43.1    7e-04   Haliaeetus albicilla
ref|XP_009015858.1|  hypothetical protein HELRODRAFT_160665           42.7    7e-04   Helobdella robusta
ref|XP_009682438.1|  PREDICTED: coiled-coil domain-containing pro...  46.2    8e-04   Struthio camelus australis
ref|XP_006975600.1|  PREDICTED: coiled-coil domain-containing pro...  43.9    8e-04   
gb|KFO72623.1|  Coiled-coil domain-containing protein 12              45.1    8e-04   Cuculus canorus
ref|XP_001842700.1|  coiled-coil domain-containing protein 12         44.7    8e-04   Culex quinquefasciatus
ref|NP_001096533.1|  coiled-coil domain containing 12                 43.9    8e-04   Xenopus tropicalis [western clawed frog]
emb|CDI84055.1|  hypothetical protein, conserved                      38.5    0.001   Eimeria acervulina
ref|XP_010120764.1|  PREDICTED: coiled-coil domain-containing pro...  45.8    0.001   Chlamydotis macqueenii
ref|XP_007256563.1|  PREDICTED: coiled-coil domain-containing pro...  44.7    0.001   
gb|EHA98666.1|  Coiled-coil domain-containing protein 12              44.3    0.001   Heterocephalus glaber [naked mole rat]



>ref|XP_004241481.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Solanum lycopersicum]
Length=149

 Score = 94.0 bits (232),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 60/76 (79%), Gaps = 6/76 (8%)
 Frame = +3

Query  123  ETPDDDKDASQDQQENDEN-FQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQD  299
            +TPDDD   ++ ++E DEN  QMKFRNYLP DK LQEGK+ PPVLPKF+DP+A L PP++
Sbjct  31   QTPDDD--GNKTKEEEDENDVQMKFRNYLPHDKQLQEGKVTPPVLPKFEDPIATLPPPEE  88

Query  300  KKEKNEDPFLNIAPKK  347
            KK   EDPFLNI PKK
Sbjct  89   KK---EDPFLNIVPKK  101


 Score = 66.6 bits (161),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 1/48 (2%)
 Frame = +1

Query  340  PKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEE-KRRLAEDLGTNS  480
            PKKPNWDLRRDVQK+LDKLEKR++KAL QL EEEE KR++AE+  T +
Sbjct  99   PKKPNWDLRRDVQKKLDKLEKRTMKALTQLMEEEEKKRKIAEEEDTEN  146



>ref|XP_006347381.1| PREDICTED: coiled-coil domain-containing protein 12-like [Solanum 
tuberosum]
Length=149

 Score = 94.0 bits (232),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 61/75 (81%), Gaps = 4/75 (5%)
 Frame = +3

Query  123  ETPDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDK  302
            +TPDDD + + +++E++ + QMKFRNYLP DK LQEGK+ PPVLPKF+DP+A L PP++K
Sbjct  31   QTPDDDGNKT-NEEEDENDVQMKFRNYLPHDKQLQEGKVTPPVLPKFEDPIATLPPPEEK  89

Query  303  KEKNEDPFLNIAPKK  347
            K   EDPFLNI PKK
Sbjct  90   K---EDPFLNIVPKK  101


 Score = 64.7 bits (156),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 41/46 (89%), Gaps = 1/46 (2%)
 Frame = +1

Query  340  PKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEE-KRRLAEDLGT  474
            PKKPNWDLRRDVQK+L+KLEKR++KAL QL EEEE KR++AE+  T
Sbjct  99   PKKPNWDLRRDVQKKLEKLEKRTMKALTQLMEEEEKKRKIAEEEDT  144



>gb|KDP45824.1| hypothetical protein JCGZ_17431 [Jatropha curcas]
Length=149

 Score = 91.7 bits (226),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +3

Query  126  TPDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKK  305
            TPDDDK  ++++   D N  MKFRNY+PQ K LQE KLAPPVLPKF+DP+A   PP + K
Sbjct  31   TPDDDKTNNENETSADNNPSMKFRNYVPQAKELQEAKLAPPVLPKFEDPVAAAPPPSETK  90

Query  306  EKNEDPFLNIAPKK  347
               EDPFLNIAPKK
Sbjct  91   ---EDPFLNIAPKK  101


 Score = 64.3 bits (155),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 42/48 (88%), Gaps = 1/48 (2%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEK-RRLAEDLGT  474
            + PKKPNWDLRRDVQK+LDKLEKR+ KA+++L EE+EK ++L ED GT
Sbjct  97   IAPKKPNWDLRRDVQKKLDKLEKRTQKAIYKLMEEQEKQKQLDEDGGT  144



>ref|XP_009777239.1| PREDICTED: coiled-coil domain-containing protein 12 [Nicotiana 
sylvestris]
Length=157

 Score = 85.1 bits (209),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 47/56 (84%), Gaps = 3/56 (5%)
 Frame = +3

Query  180  FQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
             QMKFRNYLP DK LQEGK+APPVLPKF+DP+A L P ++KK   EDPFLNIAPKK
Sbjct  51   VQMKFRNYLPHDKQLQEGKVAPPVLPKFEDPIATLPPVEEKK---EDPFLNIAPKK  103


 Score = 68.6 bits (166),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 42/56 (75%), Gaps = 2/56 (4%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRR--LAEDLGTNS*DFKV  495
            + PKKPNWDLRRDVQK+LDKLEKR++KAL QL EEEEK+R    ED G    D  V
Sbjct  99   IAPKKPNWDLRRDVQKKLDKLEKRTMKALSQLMEEEEKKRKMAEEDAGNGGDDMDV  154



>ref|XP_009608865.1| PREDICTED: coiled-coil domain-containing protein 12 [Nicotiana 
tomentosiformis]
Length=158

 Score = 85.1 bits (209),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 47/56 (84%), Gaps = 3/56 (5%)
 Frame = +3

Query  180  FQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
             QMKFRNYLP DK LQEGK+APPVLPKF+DP+A L P ++KK   EDPFLNIAPKK
Sbjct  51   VQMKFRNYLPHDKQLQEGKVAPPVLPKFEDPIATLPPVEEKK---EDPFLNIAPKK  103


 Score = 68.6 bits (166),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 42/56 (75%), Gaps = 2/56 (4%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRR--LAEDLGTNS*DFKV  495
            + PKKPNWDLRRDVQK+LDKLEKR++KAL QL EEEEK+R    ED G    D  V
Sbjct  99   IAPKKPNWDLRRDVQKKLDKLEKRTMKALSQLMEEEEKKRKMAEEDAGNGGDDMDV  154



>ref|XP_010687588.1| PREDICTED: coiled-coil domain-containing protein 12 [Beta vulgaris 
subsp. vulgaris]
Length=153

 Score = 86.3 bits (212),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 56/82 (68%), Gaps = 11/82 (13%)
 Frame = +3

Query  123  ETPDDD----KDASQD---QQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMAN  281
            +TPDDD    K+ SQD       D N  +KFRNYLP DK LQEGKLA P LPKF+DP+A 
Sbjct  30   DTPDDDSSHPKNTSQDGDSANNGDSNLNLKFRNYLPHDKELQEGKLAAPNLPKFEDPIAT  89

Query  282  LTPPQDKKEKNEDPFLNIAPKK  347
              PP++K    EDPFLNIAPKK
Sbjct  90   APPPEEK----EDPFLNIAPKK  107


 Score = 65.1 bits (157),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLG  471
            + PKKPNWDLRRDVQK+LDKLEKR+ KALHQL  E EK+R  ED G
Sbjct  103  IAPKKPNWDLRRDVQKKLDKLEKRTQKALHQLMLEHEKQRQLEDGG  148



>ref|XP_010322514.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Solanum lycopersicum]
Length=159

 Score = 95.5 bits (236),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 60/76 (79%), Gaps = 6/76 (8%)
 Frame = +3

Query  123  ETPDDDKDASQDQQENDEN-FQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQD  299
            +TPDDD   ++ ++E DEN  QMKFRNYLP DK LQEGK+ PPVLPKF+DP+A L PP++
Sbjct  31   QTPDDD--GNKTKEEEDENDVQMKFRNYLPHDKQLQEGKVTPPVLPKFEDPIATLPPPEE  88

Query  300  KKEKNEDPFLNIAPKK  347
            KK   EDPFLNI PKK
Sbjct  89   KK---EDPFLNIVPKK  101


 Score = 55.1 bits (131),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +1

Query  340  PKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            PKKPNWDLRRDVQK+LDKLEKR++KAL QL
Sbjct  99   PKKPNWDLRRDVQKKLDKLEKRTMKALTQL  128



>ref|XP_010093549.1| hypothetical protein L484_013982 [Morus notabilis]
 gb|EXB54256.1| hypothetical protein L484_013982 [Morus notabilis]
Length=153

 Score = 89.4 bits (220),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 58/80 (73%), Gaps = 9/80 (11%)
 Frame = +3

Query  126  TPDDDKDASQDQQENDE------NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLT  287
            TPD+D    +D++ ND       N  MKFRNY+P D+HLQEGK+APPVLPKF+DP+A + 
Sbjct  31   TPDEDSVQVEDKKNNDNDSREETNPNMKFRNYVPHDEHLQEGKVAPPVLPKFEDPVAAMP  90

Query  288  PPQDKKEKNEDPFLNIAPKK  347
            PP    EK EDPF+NIAPKK
Sbjct  91   PPS---EKEEDPFVNIAPKK  107


 Score = 60.5 bits (145),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 40/45 (89%), Gaps = 1/45 (2%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRR-LAED  465
            + PKKPNWDLRRDVQK+ DKLE+R+ KA+++L EE+EK++ LAED
Sbjct  103  IAPKKPNWDLRRDVQKKFDKLERRTQKAIYKLMEEQEKQKELAED  147



>gb|AFK47380.1| unknown [Lotus japonicus]
Length=160

 Score = 86.3 bits (212),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 53/75 (71%), Gaps = 11/75 (15%)
 Frame = +3

Query  132  DDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTP---PQDK  302
            +DD+D S   QE  EN  MKFRNY+P DKHLQEGKLAP VLPKF+DP+A   P   PQ  
Sbjct  46   NDDRDESP--QEEQENLSMKFRNYVPHDKHLQEGKLAPAVLPKFEDPVAASAPEPHPQ--  101

Query  303  KEKNEDPFLNIAPKK  347
                EDPFLNIAPKK
Sbjct  102  ----EDPFLNIAPKK  112


 Score = 62.8 bits (151),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRR-LAEDLGTN  477
            + PKKPNWDLRRDVQK+LDKLEKR+ KAL+QL  E+EK++ LAE   TN
Sbjct  108  IAPKKPNWDLRRDVQKKLDKLEKRTQKALYQLMVEQEKQKELAEGDDTN  156



>ref|XP_010248821.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Nelumbo nucifera]
Length=162

 Score = 87.4 bits (215),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 54/76 (71%), Gaps = 5/76 (7%)
 Frame = +3

Query  126  TPDDDKDASQDQQENDEN--FQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQD  299
            T  +DK   +D  E +EN    MKFRNYLP DK LQEGKLAPPVLPKF+DP+A   PP  
Sbjct  44   TQKEDKPEEEDADETNENKTLNMKFRNYLPHDKQLQEGKLAPPVLPKFEDPVATEPPP--  101

Query  300  KKEKNEDPFLNIAPKK  347
              +K EDPF+NIAPKK
Sbjct  102  -SQKTEDPFVNIAPKK  116


 Score = 60.1 bits (144),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGT  474
            + PKKPNWDLRRDVQKRL+KLE+R+ KA+ QL EE+ +++ AE+ G 
Sbjct  112  IAPKKPNWDLRRDVQKRLEKLERRTQKAIFQLMEEDRQKQEAEENGA  158



>ref|XP_010248829.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Nelumbo nucifera]
Length=155

 Score = 87.0 bits (214),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 54/76 (71%), Gaps = 5/76 (7%)
 Frame = +3

Query  126  TPDDDKDASQDQQENDEN--FQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQD  299
            T  +DK   +D  E +EN    MKFRNYLP DK LQEGKLAPPVLPKF+DP+A   PP  
Sbjct  37   TQKEDKPEEEDADETNENKTLNMKFRNYLPHDKQLQEGKLAPPVLPKFEDPVATEPPP--  94

Query  300  KKEKNEDPFLNIAPKK  347
              +K EDPF+NIAPKK
Sbjct  95   -SQKTEDPFVNIAPKK  109


 Score = 60.1 bits (144),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGT  474
            + PKKPNWDLRRDVQKRL+KLE+R+ KA+ QL EE+ +++ AE+ G 
Sbjct  105  IAPKKPNWDLRRDVQKRLEKLERRTQKAIFQLMEEDRQKQEAEENGA  151



>ref|XP_010101177.1| hypothetical protein L484_005414 [Morus notabilis]
 gb|EXB87538.1| hypothetical protein L484_005414 [Morus notabilis]
Length=150

 Score = 87.4 bits (215),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 58/80 (73%), Gaps = 9/80 (11%)
 Frame = +3

Query  126  TPDDDKDASQDQQENDE------NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLT  287
            TPD+D    +D++ ND       N  MKFRNY+P D+HLQEGK+APPVLPKF+DP+A + 
Sbjct  31   TPDEDSVQVEDKKNNDNDSREETNPNMKFRNYVPHDEHLQEGKVAPPVLPKFEDPVAAMP  90

Query  288  PPQDKKEKNEDPFLNIAPKK  347
            PP  K+   EDPF+NIAPKK
Sbjct  91   PPSGKE---EDPFVNIAPKK  107


 Score = 58.2 bits (139),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRR-LAED  465
            + PKKPNWDLRRDVQK+ DKLE+R+ KA+++L E +EK++ LAED
Sbjct  103  IAPKKPNWDLRRDVQKKFDKLERRTQKAIYKLMEAQEKQKELAED  147



>ref|XP_002263858.1| PREDICTED: coiled-coil domain-containing protein 12 [Vitis vinifera]
 emb|CBI26410.3| unnamed protein product [Vitis vinifera]
Length=149

 Score = 83.2 bits (204),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 3/59 (5%)
 Frame = +3

Query  171  DENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            ++N  MKFRNYLP DK LQEGKLAPPVLPKF+DP+A   PP ++K   EDPF+NIAPKK
Sbjct  47   EDNPSMKFRNYLPHDKELQEGKLAPPVLPKFEDPVAAAPPPSEEK---EDPFVNIAPKK  102


 Score = 62.4 bits (150),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 42/52 (81%), Gaps = 1/52 (2%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEK-RRLAEDLGTNS*D  486
            + PKKPNWDLRRDVQK+LDKLE+R+ KA+ +L EE+EK  +LAED G  S D
Sbjct  98   IAPKKPNWDLRRDVQKKLDKLERRTQKAIFKLMEEQEKENQLAEDGGNVSED  149



>ref|XP_002305693.1| hypothetical protein POPTR_0004s06590g [Populus trichocarpa]
 gb|EEE86204.1| hypothetical protein POPTR_0004s06590g [Populus trichocarpa]
Length=154

 Score = 85.9 bits (211),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 46/57 (81%), Gaps = 3/57 (5%)
 Frame = +3

Query  177  NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            N  MKFRNY+PQDK LQEGKLAPPVLPKF+DP+A   PP    EK EDPFLNIAPKK
Sbjct  53   NPSMKFRNYVPQDKELQEGKLAPPVLPKFEDPVAAAPPPS---EKEEDPFLNIAPKK  106


 Score = 58.9 bits (141),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS  480
            + PKKPNWDLRRDVQ +LDKLE+R+ KA+++L EE+EK +   + G N 
Sbjct  102  IAPKKPNWDLRRDVQNKLDKLERRTQKAIYKLMEEQEKEKQLSENGGNG  150



>ref|XP_010102099.1| ATP-dependent RNA helicase dhx8 [Morus notabilis]
 gb|EXB92318.1| ATP-dependent RNA helicase dhx8 [Morus notabilis]
Length=941

 Score = 91.7 bits (226),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 58/80 (73%), Gaps = 9/80 (11%)
 Frame = +3

Query  126  TPDDDKDASQDQQENDE------NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLT  287
            TPD+D    +D++ ND       N  MKFRNY+P D+HLQEGK+APPV+PKF+DP+A + 
Sbjct  467  TPDEDSVQVEDKKNNDNDSREETNPNMKFRNYVPHDEHLQEGKVAPPVVPKFEDPVAAMP  526

Query  288  PPQDKKEKNEDPFLNIAPKK  347
            PP    EK EDPF+NIAPKK
Sbjct  527  PP---SEKEEDPFVNIAPKK  543


 Score = 53.1 bits (126),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEE  438
            + PKKPNWDLRRDVQK+ DKLE+R+ KA+++L +E
Sbjct  539  IAPKKPNWDLRRDVQKKFDKLERRTHKAIYKLMDE  573



>emb|CDP18672.1| unnamed protein product [Coffea canephora]
Length=174

 Score = 83.6 bits (205),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 46/57 (81%), Gaps = 3/57 (5%)
 Frame = +3

Query  177  NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            N  MKFRNYLP DK LQEG++APPVLPKF+DP+A   P Q+KK   EDPFLNIAPKK
Sbjct  75   NVNMKFRNYLPHDKQLQEGRVAPPVLPKFEDPVAEAPPCQEKK---EDPFLNIAPKK  128


 Score = 60.1 bits (144),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS*D  486
            + PKKPNWDL RDVQK+LDKLEKR+ KA+ QL  EEEKRR   + G +  D
Sbjct  124  IAPKKPNWDLWRDVQKKLDKLEKRTQKAMFQLMAEEEKRRRLSEEGADGED  174



>ref|XP_009355920.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Pyrus x bretschneideri]
Length=153

 Score = 84.7 bits (208),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 55/80 (69%), Gaps = 9/80 (11%)
 Frame = +3

Query  126  TPDDDKDASQDQ-QEN-----DENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLT  287
            TPD+D     D   EN     + N  MKFRNY+P DK LQEGKL PPVLPKF+DP+A + 
Sbjct  31   TPDEDSAQVHDNTNENNAISDETNTNMKFRNYVPHDKQLQEGKLVPPVLPKFEDPVAGVP  90

Query  288  PPQDKKEKNEDPFLNIAPKK  347
            PP +KK   EDPF+NIAPKK
Sbjct  91   PPSEKK---EDPFVNIAPKK  107


 Score = 58.9 bits (141),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS*D  486
            + PKKPNW+LRRDVQKRLDKLEKR+ KA+ +L EE+EK++  +  G N  D
Sbjct  103  IAPKKPNWELRRDVQKRLDKLEKRTQKAMLKLMEEQEKQKQLDGDGRNGED  153



>ref|XP_011035412.1| PREDICTED: coiled-coil domain-containing protein 12 [Populus 
euphratica]
Length=156

 Score = 84.7 bits (208),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 47/59 (80%), Gaps = 3/59 (5%)
 Frame = +3

Query  171  DENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            + N  MKFRNY+PQDK LQEGKLAPPVLPKF+DP+A   PP    +K EDPFLNIAPKK
Sbjct  53   ESNPSMKFRNYVPQDKELQEGKLAPPVLPKFEDPVAAAPPPS---QKEEDPFLNIAPKK  108


 Score = 58.9 bits (141),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS  480
            + PKKPNWDLRRDVQ +LDKLE+R+ KA+++L EE+EK +   + G N 
Sbjct  104  IAPKKPNWDLRRDVQNKLDKLERRTQKAIYKLMEEQEKEKQLSENGGNG  152



>ref|XP_008375067.1| PREDICTED: coiled-coil domain-containing protein 12-like isoform 
X1 [Malus domestica]
Length=153

 Score = 84.3 bits (207),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 54/80 (68%), Gaps = 9/80 (11%)
 Frame = +3

Query  126  TPDDDKDASQDQQ------ENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLT  287
            TPD+D     D         ++ N  MKFRNY+P DK LQEGKL PPVLPKF+DP+A + 
Sbjct  31   TPDEDSAQVHDNTNESNPISDETNTNMKFRNYVPHDKQLQEGKLVPPVLPKFEDPVAGVP  90

Query  288  PPQDKKEKNEDPFLNIAPKK  347
            PP +KK   EDPF+NIAPKK
Sbjct  91   PPSEKK---EDPFVNIAPKK  107


 Score = 58.9 bits (141),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS*D  486
            + PKKPNW+LRRDVQKRLDKLEKR+ KA+ +L EE+EK++  +  G N  D
Sbjct  103  IAPKKPNWELRRDVQKRLDKLEKRTQKAMLKLMEEQEKQKQLDGDGRNGED  153



>ref|XP_008240328.1| PREDICTED: coiled-coil domain-containing protein 12 [Prunus mume]
Length=151

 Score = 85.5 bits (210),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 55/77 (71%), Gaps = 6/77 (8%)
 Frame = +3

Query  126  TPDDDK---DASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQ  296
            TPD+D    D++ D+        MKFRNY+P DK LQEGKL PPVLPKF+DP+A + PP 
Sbjct  31   TPDEDSSLVDSNADEDNETSEETMKFRNYVPHDKKLQEGKLVPPVLPKFEDPVAAVPPPS  90

Query  297  DKKEKNEDPFLNIAPKK  347
            +KK   EDPF+NIAPKK
Sbjct  91   EKK---EDPFVNIAPKK  104


 Score = 57.4 bits (137),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTN  477
            + PKKPNW+LRRDVQK+LDKLE+R+ KA+ +L EE+EK++  ++ G N
Sbjct  100  IAPKKPNWELRRDVQKKLDKLERRTQKAMCKLMEEQEKQKQLDEDGRN  147



>ref|XP_010069536.1| PREDICTED: coiled-coil domain-containing protein 12 [Eucalyptus 
grandis]
 gb|KCW57912.1| hypothetical protein EUGRSUZ_H00657 [Eucalyptus grandis]
Length=162

 Score = 82.8 bits (203),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 4/59 (7%)
 Frame = +3

Query  171  DENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            +EN  MKFRNY+P DK LQEGK+APPVLPKF+DP+A   PP +KK    DPF+NIAPKK
Sbjct  60   EENPSMKFRNYVPHDKQLQEGKVAPPVLPKFEDPVATEPPPAEKK----DPFINIAPKK  114


 Score = 58.9 bits (141),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRR-LAEDLGTNS  480
            + PKKPNWDLRRDVQK+LDKLE+R+ KA++++ +E+EK++  AE+ G N 
Sbjct  110  IAPKKPNWDLRRDVQKKLDKLERRTQKAMYKIVQEQEKQKEKAEEDGENG  159



>gb|KGN64223.1| hypothetical protein Csa_1G043260 [Cucumis sativus]
Length=194

 Score = 81.6 bits (200),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 52/71 (73%), Gaps = 5/71 (7%)
 Frame = +3

Query  135  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKN  314
            +DK+    +  ++ N  MKFRNY+P DK LQEGKLAPPVLPKF+DP+ +  PPQ K    
Sbjct  81   EDKENGATEDSDETNLNMKFRNYVPHDKELQEGKLAPPVLPKFEDPVTS-EPPQLK----  135

Query  315  EDPFLNIAPKK  347
            EDPF+NIAPKK
Sbjct  136  EDPFVNIAPKK  146


 Score = 59.7 bits (143),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLA  459
            + PKKPNWDLRRDVQK+LDKLE+R+ KAL +L EE+EK++ A
Sbjct  142  IAPKKPNWDLRRDVQKKLDKLERRTQKALFKLMEEQEKQKQA  183



>ref|XP_008437152.1| PREDICTED: coiled-coil domain-containing protein 12 [Cucumis 
melo]
 ref|XP_008437160.1| PREDICTED: coiled-coil domain-containing protein 12 [Cucumis 
melo]
Length=153

 Score = 80.1 bits (196),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 50/71 (70%), Gaps = 5/71 (7%)
 Frame = +3

Query  135  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKN  314
            +DK+       ++ N  MKFRNY+P DK LQEGKLAPPVLPKF+DP+    PPQ K    
Sbjct  40   EDKENGATADTDETNLNMKFRNYVPHDKELQEGKLAPPVLPKFEDPVTT-EPPQQK----  94

Query  315  EDPFLNIAPKK  347
            EDPF+NIAPKK
Sbjct  95   EDPFVNIAPKK  105


 Score = 60.8 bits (146),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLA  459
            + PKKPNWDLRRDVQK+LDKLE+R+ KAL++L EE+EK++ A
Sbjct  101  IAPKKPNWDLRRDVQKKLDKLERRTQKALYKLMEEQEKQKQA  142



>ref|XP_011086938.1| PREDICTED: coiled-coil domain-containing protein 12 [Sesamum 
indicum]
Length=171

 Score = 85.9 bits (211),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 46/57 (81%), Gaps = 3/57 (5%)
 Frame = +3

Query  177  NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            N  MKFRNYLP DK LQEGKLAPPVLPKF+DP+    PP++KK   EDPFLNIAPKK
Sbjct  71   NVHMKFRNYLPHDKQLQEGKLAPPVLPKFEDPVLAAPPPEEKK---EDPFLNIAPKK  124


 Score = 55.1 bits (131),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRR  453
            + PKKPNWDLRRDVQKRLDKLE+R+ K++  L E EE RR
Sbjct  120  IAPKKPNWDLRRDVQKRLDKLERRTQKSMLILMEREEARR  159



>ref|XP_009355916.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009355917.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Pyrus x bretschneideri]
Length=154

 Score = 85.1 bits (209),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 55/80 (69%), Gaps = 9/80 (11%)
 Frame = +3

Query  126  TPDDDKDASQDQ-QEN-----DENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLT  287
            TPD+D     D   EN     + N  MKFRNY+P DK LQEGKL PPVLPKF+DP+A + 
Sbjct  31   TPDEDSAQVHDNTNENNAISDETNTNMKFRNYVPHDKQLQEGKLVPPVLPKFEDPVAGVP  90

Query  288  PPQDKKEKNEDPFLNIAPKK  347
            PP +KK   EDPF+NIAPKK
Sbjct  91   PPSEKK---EDPFVNIAPKK  107


 Score = 55.5 bits (132),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL-GEEEEKRRLAEDLGTNS*D  486
            + PKKPNW+LRRDVQKRLDKLEKR+ KA+ +L  EE+EK++  +  G N  D
Sbjct  103  IAPKKPNWELRRDVQKRLDKLEKRTQKAMLKLMAEEQEKQKQLDGDGRNGED  154



>ref|XP_010546632.1| PREDICTED: coiled-coil domain-containing protein 12 [Tarenaya 
hassleriana]
Length=144

 Score = 83.6 bits (205),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 53/71 (75%), Gaps = 3/71 (4%)
 Frame = +3

Query  135  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKN  314
            ++K+  +D    + N  MKFRNY+PQDKHLQEGKLAPP LPKF+DP+A+  P  +KK   
Sbjct  30   ENKENEEDDAGEESNPTMKFRNYVPQDKHLQEGKLAPPELPKFEDPVASTLPVAEKK---  86

Query  315  EDPFLNIAPKK  347
            EDP +NIAPKK
Sbjct  87   EDPLVNIAPKK  97


 Score = 57.0 bits (136),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEK  447
            + PKKPNWDLRRDVQK+LDKLE+R+ KA+ +L EE EK
Sbjct  93   IAPKKPNWDLRRDVQKKLDKLERRTQKAMFKLMEEAEK  130



>ref|XP_008375068.1| PREDICTED: coiled-coil domain-containing protein 12-like isoform 
X2 [Malus domestica]
Length=154

 Score = 84.7 bits (208),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 54/80 (68%), Gaps = 9/80 (11%)
 Frame = +3

Query  126  TPDDDKDASQDQQ------ENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLT  287
            TPD+D     D         ++ N  MKFRNY+P DK LQEGKL PPVLPKF+DP+A + 
Sbjct  31   TPDEDSAQVHDNTNESNPISDETNTNMKFRNYVPHDKQLQEGKLVPPVLPKFEDPVAGVP  90

Query  288  PPQDKKEKNEDPFLNIAPKK  347
            PP +KK   EDPF+NIAPKK
Sbjct  91   PPSEKK---EDPFVNIAPKK  107


 Score = 55.5 bits (132),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL-GEEEEKRRLAEDLGTNS*D  486
            + PKKPNW+LRRDVQKRLDKLEKR+ KA+ +L  EE+EK++  +  G N  D
Sbjct  103  IAPKKPNWELRRDVQKRLDKLEKRTQKAMLKLMAEEQEKQKQLDGDGRNGED  154



>ref|XP_004137537.1| PREDICTED: coiled-coil domain-containing protein 12-like [Cucumis 
sativus]
 ref|XP_004164500.1| PREDICTED: coiled-coil domain-containing protein 12-like [Cucumis 
sativus]
Length=153

 Score = 80.5 bits (197),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 52/71 (73%), Gaps = 5/71 (7%)
 Frame = +3

Query  135  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKN  314
            +DK+    +  ++ N  MKFRNY+P DK LQEGKLAPPVLPKF+DP+ +  PPQ K    
Sbjct  40   EDKENGATEDSDETNLNMKFRNYVPHDKELQEGKLAPPVLPKFEDPVTS-EPPQLK----  94

Query  315  EDPFLNIAPKK  347
            EDPF+NIAPKK
Sbjct  95   EDPFVNIAPKK  105


 Score = 59.7 bits (143),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLA  459
            + PKKPNWDLRRDVQK+LDKLE+R+ KAL +L EE+EK++ A
Sbjct  101  IAPKKPNWDLRRDVQKKLDKLERRTQKALFKLMEEQEKQKQA  142



>ref|NP_566245.1| uncharacterized protein  [Arabidopsis thaliana]
 gb|AAF27013.1|AC009177_3 unknown protein [Arabidopsis thaliana]
 gb|AAM62522.1| unknown [Arabidopsis thaliana]
 gb|AAO44023.1| At3g05070 [Arabidopsis thaliana]
 dbj|BAE99439.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE74182.1| uncharacterized protein AT3G05070 [Arabidopsis thaliana]
Length=144

 Score = 75.9 bits (185),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNED  320
            K+  +D+   ++   MKFRNY+PQ K LQ+GKLAPP LPKF+DP+  L P  +KK   ED
Sbjct  32   KEDGEDEAVEEDGPAMKFRNYVPQAKELQDGKLAPPELPKFEDPIVALPPAVEKK---ED  88

Query  321  PFLNIAPKK  347
            PF+NIAPKK
Sbjct  89   PFVNIAPKK  97


 Score = 62.8 bits (151),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEK-RRLAEDLGTN  477
            + PKKPNWDLRRDVQK+LDKLE+R+ KA+H+L EE+EK R +AE  G  
Sbjct  93   IAPKKPNWDLRRDVQKKLDKLERRTQKAMHKLMEEQEKEREMAEADGNT  141



>ref|XP_004495490.1| PREDICTED: coiled-coil domain-containing protein 12-like isoform 
X1 [Cicer arietinum]
 ref|XP_004495491.1| PREDICTED: coiled-coil domain-containing protein 12-like isoform 
X2 [Cicer arietinum]
Length=168

 Score = 76.3 bits (186),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 45/54 (83%), Gaps = 1/54 (2%)
 Frame = +3

Query  186  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            MKFRNY+P DKHLQEGKLAP VLPKF+DP++ +  P+ + +  EDPFLNIAPKK
Sbjct  68   MKFRNYVPHDKHLQEGKLAPAVLPKFEDPVS-VPEPEPETQPKEDPFLNIAPKK  120


 Score = 62.4 bits (150),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKR-RLAEDLGTNS  480
            + PKKPNWDLRRDVQK+LDKLEKR+ KAL+QL  E+EK+ +LAE   TN 
Sbjct  116  IAPKKPNWDLRRDVQKKLDKLEKRTQKALYQLMVEQEKQNQLAEGDDTNG  165



>gb|KJB60515.1| hypothetical protein B456_009G312100 [Gossypium raimondii]
Length=151

 Score = 82.4 bits (202),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 7/78 (9%)
 Frame = +3

Query  126  TPDDDKDASQDQQENDENFQ----MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPP  293
             PD+D   + + Q +D N +    MKFRNY+P DK LQEGK+APPVLPKF+DP+A   P 
Sbjct  31   APDEDSSQAAENQTDDTNEENNPSMKFRNYVPHDKQLQEGKVAPPVLPKFEDPVAAAPPA  90

Query  294  QDKKEKNEDPFLNIAPKK  347
             ++K   EDPF+NIAPKK
Sbjct  91   SEEK---EDPFVNIAPKK  105


 Score = 55.8 bits (133),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGT  474
            + PKKPNWDLRRDVQK+LDKLE+R+ KA+ +L E++E+ +  ++ G 
Sbjct  101  IAPKKPNWDLRRDVQKKLDKLERRTQKAIFKLMEQQEQEKQLDEGGN  147



>gb|KHG26990.1| Coiled-coil domain-containing 12 [Gossypium arboreum]
Length=151

 Score = 82.0 bits (201),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 7/78 (9%)
 Frame = +3

Query  126  TPDDDKDASQDQQENDENFQ----MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPP  293
             PD+D   + + Q +D N +    MKFRNY+P DK LQEGK+APPVLPKF+DP+A   P 
Sbjct  31   APDEDSSQASENQTDDTNEENNPSMKFRNYVPHDKQLQEGKVAPPVLPKFEDPVAAEPPA  90

Query  294  QDKKEKNEDPFLNIAPKK  347
             ++K   EDPF+NIAPKK
Sbjct  91   SEEK---EDPFVNIAPKK  105


 Score = 55.8 bits (133),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTN  477
            + PKKPNWDLRRDVQK+LDKLE+R+ KA+ +L E++E+ +  ++ G  
Sbjct  101  IAPKKPNWDLRRDVQKKLDKLERRTQKAIFKLMEQQEQEKQLDEGGNT  148



>gb|EYU17804.1| hypothetical protein MIMGU_mgv1a015162mg [Erythranthe guttata]
 gb|EYU17805.1| hypothetical protein MIMGU_mgv1a015162mg [Erythranthe guttata]
Length=166

 Score = 80.5 bits (197),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 43/56 (77%), Gaps = 2/56 (4%)
 Frame = +3

Query  180  FQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
              MKFRNYLP DK LQEGKLAPPVLPKF+DP   + PP D  E  EDPFLNIAPKK
Sbjct  66   VNMKFRNYLPHDKELQEGKLAPPVLPKFEDPAFAIPPPVD--ENKEDPFLNIAPKK  119


 Score = 57.0 bits (136),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAED  465
            + PKKPNWDLRRDVQKRLDKL++R+ KA+  L E+EE +R +E+
Sbjct  115  IAPKKPNWDLRRDVQKRLDKLDRRTQKAMLTLMEQEEAKRNSEE  158



>ref|NP_001236672.1| uncharacterized protein LOC100527227 [Glycine max]
 gb|ACU16280.1| unknown [Glycine max]
 gb|KHN05004.1| Coiled-coil domain-containing protein 12 [Glycine soja]
Length=152

 Score = 77.0 bits (188),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = +3

Query  183  QMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            +MKFRNY+P DK+LQEGKLAP VLPKF+DP+  + PP+   E  EDPFLNIAPKK
Sbjct  52   EMKFRNYVPHDKNLQEGKLAPAVLPKFEDPVDAVPPPE--PEAAEDPFLNIAPKK  104


 Score = 60.5 bits (145),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKR-RLAEDLGTN  477
            + PKKPNWDLRRDVQK+LDKLEKR+ KAL+QL  E+EK+ +L E   TN
Sbjct  100  IAPKKPNWDLRRDVQKKLDKLEKRTQKALYQLMVEQEKQNQLTEGDDTN  148



>ref|XP_010108874.1| putative ATP-dependent RNA helicase DHX35 [Morus notabilis]
 gb|EXC20514.1| putative ATP-dependent RNA helicase DHX35 [Morus notabilis]
Length=672

 Score = 85.1 bits (209),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 3/58 (5%)
 Frame = +3

Query  174  ENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            +N  MKFRNY+P D+HLQEGK+APPVLPKF+DP+A + PP    EK EDPF+NIAPKK
Sbjct  547  QNPNMKFRNYVPHDEHLQEGKVAPPVLPKFEDPVAAMPPPS---EKEEDPFVNIAPKK  601


 Score = 52.0 bits (123),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            + PKKPNWDLRRDVQK+ DKLE+R+ KA+++L
Sbjct  597  IAPKKPNWDLRRDVQKKFDKLERRTQKAIYKL  628



>ref|XP_008393522.1| PREDICTED: coiled-coil domain-containing protein 12-like isoform 
X2 [Malus domestica]
Length=154

 Score = 79.3 bits (194),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 54/80 (68%), Gaps = 9/80 (11%)
 Frame = +3

Query  126  TPDDDKDASQDQ-QEN-----DENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLT  287
            TPD+D   + D   EN     + N  MKFRNY+P DK LQ GKL PPVLPKF+DP+A + 
Sbjct  31   TPDEDSAQAHDNTNENNAISDEANANMKFRNYVPHDKQLQGGKLVPPVLPKFEDPVAAVP  90

Query  288  PPQDKKEKNEDPFLNIAPKK  347
            P  +KK   EDPF+NIAPKK
Sbjct  91   PLSEKK---EDPFVNIAPKK  107


 Score = 57.8 bits (138),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 41/52 (79%), Gaps = 1/52 (2%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL-GEEEEKRRLAEDLGTNS*D  486
            + PKKPNW+LRRDVQKRLDKLEKR+ KA+ +L GE+E++++L  D G    D
Sbjct  103  IAPKKPNWELRRDVQKRLDKLEKRTQKAMLKLMGEQEKQKQLDRDGGNGGED  154



>ref|XP_008393521.1| PREDICTED: coiled-coil domain-containing protein 12-like isoform 
X1 [Malus domestica]
Length=155

 Score = 79.3 bits (194),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 54/80 (68%), Gaps = 9/80 (11%)
 Frame = +3

Query  126  TPDDDKDASQDQ-QEN-----DENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLT  287
            TPD+D   + D   EN     + N  MKFRNY+P DK LQ GKL PPVLPKF+DP+A + 
Sbjct  31   TPDEDSAQAHDNTNENNAISDEANANMKFRNYVPHDKQLQGGKLVPPVLPKFEDPVAAVP  90

Query  288  PPQDKKEKNEDPFLNIAPKK  347
            P  +KK   EDPF+NIAPKK
Sbjct  91   PLSEKK---EDPFVNIAPKK  107


 Score = 57.4 bits (137),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 2/53 (4%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL--GEEEEKRRLAEDLGTNS*D  486
            + PKKPNW+LRRDVQKRLDKLEKR+ KA+ +L  GE+E++++L  D G    D
Sbjct  103  IAPKKPNWELRRDVQKRLDKLEKRTQKAMLKLMAGEQEKQKQLDRDGGNGGED  155



>ref|XP_007009901.1| Cwf18 isoform 1 [Theobroma cacao]
 gb|EOY18711.1| Cwf18 isoform 1 [Theobroma cacao]
Length=151

 Score = 79.3 bits (194),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 55/78 (71%), Gaps = 7/78 (9%)
 Frame = +3

Query  126  TPDDDK-DASQDQ-QENDE--NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPP  293
            TPD+D   A++D+  E DE  N  MKFRNY+P D  LQEGK+APPVLPKF+DP+    PP
Sbjct  31   TPDEDSAQAAEDKTNETDEENNRSMKFRNYVPHDIQLQEGKVAPPVLPKFEDPVEVAPPP  90

Query  294  QDKKEKNEDPFLNIAPKK  347
                E  EDPF+NIAPKK
Sbjct  91   ---SEDQEDPFVNIAPKK  105


 Score = 57.4 bits (137),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTN  477
            + PKKPNWDLRRDVQK+LDKLE+R+ KA++ L E++E+ +   + G N
Sbjct  101  IAPKKPNWDLRRDVQKKLDKLERRTQKAIYILMEQQEQEKQLAEGGNN  148



>gb|KDO55952.1| hypothetical protein CISIN_1g031113mg [Citrus sinensis]
Length=165

 Score = 79.3 bits (194),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 44/57 (77%), Gaps = 3/57 (5%)
 Frame = +3

Query  177  NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            N  MKFRNY+P DK LQEGK+ PP LPKF+DP+A   PPQ   EK EDPF+NIAPKK
Sbjct  64   NLSMKFRNYVPHDKQLQEGKVTPPELPKFEDPVA-AAPPQS--EKKEDPFVNIAPKK  117


 Score = 57.0 bits (136),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLA  459
            + PKKPNWDLRRDVQK+LDKLE+R+ KA+  L +++EK +L 
Sbjct  113  IAPKKPNWDLRRDVQKKLDKLERRTQKAMFTLMQQQEKEKLT  154



>ref|XP_006441474.1| hypothetical protein CICLE_v10022597mg [Citrus clementina]
 gb|ESR54714.1| hypothetical protein CICLE_v10022597mg [Citrus clementina]
Length=164

 Score = 79.3 bits (194),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 44/57 (77%), Gaps = 3/57 (5%)
 Frame = +3

Query  177  NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            N  MKFRNY+P DK LQEGK+ PP LPKF+DP+A   PPQ   EK EDPF+NIAPKK
Sbjct  63   NLSMKFRNYVPHDKQLQEGKVTPPELPKFEDPVA-AAPPQS--EKKEDPFVNIAPKK  116


 Score = 57.0 bits (136),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLA  459
            + PKKPNWDLRRDVQK+LDKLE+R+ KA+  L +++EK +L 
Sbjct  112  IAPKKPNWDLRRDVQKKLDKLERRTQKAMFTLMQQQEKEKLT  153



>ref|XP_006478141.1| PREDICTED: coiled-coil domain-containing protein 12-like isoform 
X1 [Citrus sinensis]
Length=165

 Score = 79.3 bits (194),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 44/57 (77%), Gaps = 3/57 (5%)
 Frame = +3

Query  177  NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            N  MKFRNY+P DK LQEGK+ PP LPKF+DP+A   PPQ   EK EDPF+NIAPKK
Sbjct  64   NLSMKFRNYVPHDKQLQEGKVTPPELPKFEDPVA-AAPPQS--EKKEDPFVNIAPKK  117


 Score = 56.6 bits (135),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLA  459
            + PKKPNWDLRRDVQK+LDKLE R+ KA+  L +++EK +L 
Sbjct  113  IAPKKPNWDLRRDVQKKLDKLESRTQKAMFTLMQQQEKEKLT  154



>ref|XP_002519582.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42793.1| conserved hypothetical protein [Ricinus communis]
Length=158

 Score = 84.0 bits (206),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 46/57 (81%), Gaps = 3/57 (5%)
 Frame = +3

Query  177  NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            N  MKFRNY+PQDK LQEGKLAP VLPKF+DP+A   PP +KK   EDPFLNIAPKK
Sbjct  64   NPSMKFRNYVPQDKELQEGKLAPAVLPKFEDPVAAAPPPSEKK---EDPFLNIAPKK  117


 Score = 52.0 bits (123),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            + PKKPNWDLRRDVQK+LDKLE+R+ KA+++L
Sbjct  113  IAPKKPNWDLRRDVQKKLDKLERRTQKAIYKL  144



>gb|KEH42882.1| cwf18 pre-mRNA splicing factor [Medicago truncatula]
Length=169

 Score = 73.6 bits (179),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 53/72 (74%), Gaps = 3/72 (4%)
 Frame = +3

Query  132  DDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEK  311
            DDD+   +   E +E   MKFRNY+P DK+LQEGKLAP VLPKF+DP   ++ P+ +++ 
Sbjct  53   DDDEQQEEKDGEGEEKLSMKFRNYVPHDKNLQEGKLAPAVLPKFEDP---VSVPEPEEKP  109

Query  312  NEDPFLNIAPKK  347
             EDPFLNIAPKK
Sbjct  110  KEDPFLNIAPKK  121


 Score = 62.4 bits (150),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKR-RLAEDLGTN  477
            + PKKPNWDLRRDVQK+LDKLEKR+ KAL+QL  E+EK+ +LAE   TN
Sbjct  117  IAPKKPNWDLRRDVQKKLDKLEKRTQKALYQLMVEQEKQNQLAEGDDTN  165



>ref|XP_002882392.1| hypothetical protein ARALYDRAFT_477790 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58651.1| hypothetical protein ARALYDRAFT_477790 [Arabidopsis lyrata subsp. 
lyrata]
Length=144

 Score = 75.1 bits (183),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNED  320
            K+  +D+   ++   MKFRNY+PQ K LQ+GKLAPP LPKF+DP+  L P  +KK   ED
Sbjct  32   KEDGEDEAVEEDGPAMKFRNYVPQAKELQDGKLAPPELPKFEDPILALPPAVEKK---ED  88

Query  321  PFLNIAPKK  347
            PF+NIAPKK
Sbjct  89   PFVNIAPKK  97


 Score = 60.5 bits (145),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS  480
            + PKKPNWDLRRDVQK+LDKLE+R+ KA+++L EE EK R   +   N+
Sbjct  93   IAPKKPNWDLRRDVQKKLDKLERRTQKAMYKLMEEHEKERETAEADGNT  141



>ref|XP_006408114.1| hypothetical protein EUTSA_v10021722mg [Eutrema salsugineum]
 gb|ESQ49567.1| hypothetical protein EUTSA_v10021722mg [Eutrema salsugineum]
Length=141

 Score = 80.9 bits (198),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 51/69 (74%), Gaps = 3/69 (4%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNED  320
            K+  QD    ++   MKFRNY+PQDK LQ+GK+APP LPKF+DP+A L P  +KK   ED
Sbjct  32   KEDGQDDAVEEDGPAMKFRNYVPQDKELQDGKVAPPELPKFEDPIAALAPAVEKK---ED  88

Query  321  PFLNIAPKK  347
            PF+NIAPKK
Sbjct  89   PFVNIAPKK  97


 Score = 55.1 bits (131),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 2/46 (4%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLG  471
            + PKKPNWDLRRDVQK+LDKLE+R+  A+ +L   +EKR +AE  G
Sbjct  93   IAPKKPNWDLRRDVQKKLDKLERRTQAAMSKLT--QEKREMAEADG  136



>gb|KJB60517.1| hypothetical protein B456_009G312100 [Gossypium raimondii]
Length=164

 Score = 83.6 bits (205),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 7/78 (9%)
 Frame = +3

Query  126  TPDDDKDASQDQQENDENFQ----MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPP  293
             PD+D   + + Q +D N +    MKFRNY+P DK LQEGK+APPVLPKF+DP+A   P 
Sbjct  31   APDEDSSQAAENQTDDTNEENNPSMKFRNYVPHDKQLQEGKVAPPVLPKFEDPVAAAPPA  90

Query  294  QDKKEKNEDPFLNIAPKK  347
             ++K   EDPF+NIAPKK
Sbjct  91   SEEK---EDPFVNIAPKK  105


 Score = 51.6 bits (122),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            + PKKPNWDLRRDVQK+LDKLE+R+ KA+ +L
Sbjct  101  IAPKKPNWDLRRDVQKKLDKLERRTQKAIFKL  132



>gb|KJB60516.1| hypothetical protein B456_009G312100 [Gossypium raimondii]
Length=165

 Score = 83.2 bits (204),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 7/78 (9%)
 Frame = +3

Query  126  TPDDDKDASQDQQENDENFQ----MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPP  293
             PD+D   + + Q +D N +    MKFRNY+P DK LQEGK+APPVLPKF+DP+A   P 
Sbjct  31   APDEDSSQAAENQTDDTNEENNPSMKFRNYVPHDKQLQEGKVAPPVLPKFEDPVAAAPPA  90

Query  294  QDKKEKNEDPFLNIAPKK  347
             ++K   EDPF+NIAPKK
Sbjct  91   SEEK---EDPFVNIAPKK  105


 Score = 51.2 bits (121),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            + PKKPNWDLRRDVQK+LDKLE+R+ KA+ +L
Sbjct  101  IAPKKPNWDLRRDVQKKLDKLERRTQKAIFKL  132



>gb|KFK23537.1| hypothetical protein AALP_AAs63573U000100 [Arabis alpina]
Length=156

 Score = 77.0 bits (188),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 3/76 (4%)
 Frame = +3

Query  120  HETPDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQD  299
             E  +  +D   D  E ++  +MKFRNY+PQ K LQ+GK+ PP LPKF+DP+A L P  +
Sbjct  37   QELSESKEDGEDDAVEQEDGPEMKFRNYVPQAKELQDGKVVPPELPKFEDPIAALPPVVE  96

Query  300  KKEKNEDPFLNIAPKK  347
            KK   EDPF+NIAPKK
Sbjct  97   KK---EDPFVNIAPKK  109


 Score = 57.4 bits (137),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEK-RRLAEDLGT  474
            + PKKPNWDLRRDVQK+LDKLE+++ KA+ +L EE EK R +AE  G 
Sbjct  105  IAPKKPNWDLRRDVQKKLDKLERKTQKAMFKLMEEHEKEREMAEADGN  152



>emb|CDY27800.1| BnaA05g32090D [Brassica napus]
Length=147

 Score = 73.6 bits (179),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 3/54 (6%)
 Frame = +3

Query  186  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            MKFRNY+PQ K LQ+ K+ PP LPKF+DP+A L P     EKNEDPF+NIAPKK
Sbjct  50   MKFRNYVPQAKELQDSKVVPPELPKFEDPVAALPPAV---EKNEDPFVNIAPKK  100


 Score = 60.1 bits (144),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRR  453
            + PKKPNWDLRRDVQK+LDKLE+R+ KA+++L EE EK R
Sbjct  96   IAPKKPNWDLRRDVQKKLDKLERRTQKAMYKLMEEHEKER  135



>ref|XP_010422930.1| PREDICTED: coiled-coil domain-containing protein 12-like [Camelina 
sativa]
Length=144

 Score = 75.1 bits (183),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 51/71 (72%), Gaps = 3/71 (4%)
 Frame = +3

Query  135  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKN  314
            D K+  +D+   ++   MKFRNY+PQ K LQ+GK+APP LP+F+DP+  L P  +KK   
Sbjct  30   DTKEDGEDEAVEEDGPAMKFRNYVPQAKELQDGKVAPPELPQFEDPIVALPPAVEKK---  86

Query  315  EDPFLNIAPKK  347
            EDPF+NIAPKK
Sbjct  87   EDPFVNIAPKK  97


 Score = 57.8 bits (138),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS  480
            + PKKPNWDLRRDVQK+LDKLE+R+ KA+++L  E EK R   +   N+
Sbjct  93   IAPKKPNWDLRRDVQKKLDKLERRTQKAMYKLMAEHEKEREITEADGNT  141



>gb|KCW57911.1| hypothetical protein EUGRSUZ_H00657 [Eucalyptus grandis]
Length=162

 Score = 81.6 bits (200),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 4/59 (7%)
 Frame = +3

Query  171  DENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            +EN  MKFRNY+P DK LQEGK+APPVLPKF+DP+A   PP +KK    DPF+NIAPKK
Sbjct  60   EENPSMKFRNYVPHDKQLQEGKVAPPVLPKFEDPVATEPPPAEKK----DPFINIAPKK  114


 Score = 50.8 bits (120),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALH  423
            + PKKPNWDLRRDVQK+LDKLE+R+ KA++
Sbjct  110  IAPKKPNWDLRRDVQKKLDKLERRTQKAMY  139



>emb|CDY41931.1| BnaC05g46730D [Brassica napus]
Length=147

 Score = 71.6 bits (174),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 3/54 (6%)
 Frame = +3

Query  186  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            MKFRNY+PQ K LQ+ K+ PP LPKF+DP+A L P  +KK   EDPF+NIAPKK
Sbjct  50   MKFRNYVPQAKELQDSKVVPPELPKFEDPVAALPPAVEKK---EDPFVNIAPKK  100


 Score = 60.8 bits (146),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS  480
            + PKKPNWDLRRDVQK+LDKLE+R+ KA+++L EE EK R   +   N+
Sbjct  96   IAPKKPNWDLRRDVQKKLDKLERRTQKAMYKLMEEHEKERETAETDDNA  144



>ref|XP_009147281.1| PREDICTED: coiled-coil domain-containing protein 12 [Brassica 
rapa]
Length=147

 Score = 71.6 bits (174),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 3/54 (6%)
 Frame = +3

Query  186  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            MKFRNY+PQ K LQ+ K+ PP LPKF+DP+A L P  +KK   EDPF+NIAPKK
Sbjct  50   MKFRNYVPQAKELQDSKVVPPELPKFEDPVAALPPAVEKK---EDPFVNIAPKK  100


 Score = 60.1 bits (144),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRR  453
            + PKKPNWDLRRDVQK+LDKLE+R+ KA+++L EE EK R
Sbjct  96   IAPKKPNWDLRRDVQKKLDKLERRTQKAMYKLMEEHEKER  135



>gb|KCW57913.1| hypothetical protein EUGRSUZ_H00657 [Eucalyptus grandis]
Length=147

 Score = 82.4 bits (202),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 4/59 (7%)
 Frame = +3

Query  171  DENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            +EN  MKFRNY+P DK LQEGK+APPVLPKF+DP+A   PP +KK    DPF+NIAPKK
Sbjct  60   EENPSMKFRNYVPHDKQLQEGKVAPPVLPKFEDPVATEPPPAEKK----DPFINIAPKK  114


 Score = 49.3 bits (116),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKAL  420
            + PKKPNWDLRRDVQK+LDKLE+R+ KA+
Sbjct  110  IAPKKPNWDLRRDVQKKLDKLERRTQKAI  138



>gb|ADE77638.1| unknown [Picea sitchensis]
Length=151

 Score = 72.8 bits (177),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 3/63 (5%)
 Frame = +3

Query  159  QQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIA  338
            ++E DE   MKFRNYLP+DKHLQ+ ++APP +PKFDDP+A  T P       EDP ++IA
Sbjct  40   EEEQDEKQDMKFRNYLPRDKHLQQNRVAPPTIPKFDDPVA--TAP-SATNGTEDPIISIA  96

Query  339  PKK  347
            PKK
Sbjct  97   PKK  99


 Score = 57.8 bits (138),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRR  453
            + PKKPNWDLRRDVQK+LDKLE+R+ +A+ +L  EEE+RR
Sbjct  95   IAPKKPNWDLRRDVQKKLDKLERRTQRAIIELMHEEERRR  134



>ref|XP_007208967.1| hypothetical protein PRUPE_ppb020505mg, partial [Prunus persica]
 gb|EMJ10166.1| hypothetical protein PRUPE_ppb020505mg, partial [Prunus persica]
Length=232

 Score = 80.5 bits (197),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 44/54 (81%), Gaps = 3/54 (6%)
 Frame = +3

Query  186  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            MKFRNY+P DK LQEGKL PPVLPKF+DP+A +  P +KK   EDPF+NIAPKK
Sbjct  109  MKFRNYVPHDKKLQEGKLVPPVLPKFEDPVAAVPSPSEKK---EDPFVNIAPKK  159


 Score = 49.7 bits (117),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            + PKKPNW+LRRDVQK+LDKLE+R+ KA+ +L
Sbjct  155  IAPKKPNWELRRDVQKKLDKLERRTQKAMCKL  186



>ref|NP_001238051.1| uncharacterized protein LOC100306131 [Glycine max]
 gb|ACU14163.1| unknown [Glycine max]
Length=152

 Score = 68.2 bits (165),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 54/73 (74%), Gaps = 4/73 (5%)
 Frame = +3

Query  129  PDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKE  308
            P+ +KD   D +E+ E  +MKFRNY+P DK+LQEGKLAP VLPKF+DP+ ++     K E
Sbjct  36   PNGNKD--DDNEEDQEPQEMKFRNYVPHDKNLQEGKLAPAVLPKFEDPVDDVP--PPKPE  91

Query  309  KNEDPFLNIAPKK  347
              EDPFLNIAPKK
Sbjct  92   AKEDPFLNIAPKK  104


 Score = 60.8 bits (146),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKR-RLAEDLGTNS  480
            + PKKPNWDLRRDVQK+LDKLEKR+ KAL+QL  E+EK+ +L E   TN 
Sbjct  100  IAPKKPNWDLRRDVQKKLDKLEKRTQKALYQLMVEQEKQNQLTEGDDTNG  149



>gb|KDO55954.1| hypothetical protein CISIN_1g031113mg [Citrus sinensis]
Length=148

 Score = 77.8 bits (190),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 44/57 (77%), Gaps = 3/57 (5%)
 Frame = +3

Query  177  NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            N  MKFRNY+P DK LQEGK+ PP LPKF+DP+A   PPQ   EK EDPF+NIAPKK
Sbjct  64   NLSMKFRNYVPHDKQLQEGKVTPPELPKFEDPVA-AAPPQS--EKKEDPFVNIAPKK  117


 Score = 50.8 bits (120),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            + PKKPNWDLRRDVQK+LDKLE+R+ KA+  L
Sbjct  113  IAPKKPNWDLRRDVQKKLDKLERRTQKAMFTL  144



>ref|XP_010485909.1| PREDICTED: coiled-coil domain-containing protein 12-like [Camelina 
sativa]
Length=144

 Score = 71.2 bits (173),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 3/54 (6%)
 Frame = +3

Query  186  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            MKFRNY+PQ K LQ+GKLAPP LP+F+DP+  L    +KK   EDPF+NIAPKK
Sbjct  47   MKFRNYVPQAKELQDGKLAPPELPQFEDPIVALPAAVEKK---EDPFVNIAPKK  97


 Score = 57.8 bits (138),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS  480
            + PKKPNWDLRRDVQK+LDKLE+R+ KA+++L  E EK R   +   N+
Sbjct  93   IAPKKPNWDLRRDVQKKLDKLERRTQKAMYKLMAEHEKEREITEADGNT  141



>ref|XP_006478142.1| PREDICTED: coiled-coil domain-containing protein 12-like isoform 
X2 [Citrus sinensis]
Length=148

 Score = 78.2 bits (191),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 44/57 (77%), Gaps = 3/57 (5%)
 Frame = +3

Query  177  NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            N  MKFRNY+P DK LQEGK+ PP LPKF+DP+A   PPQ   EK EDPF+NIAPKK
Sbjct  64   NLSMKFRNYVPHDKQLQEGKVTPPELPKFEDPVA-AAPPQS--EKKEDPFVNIAPKK  117


 Score = 50.4 bits (119),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            + PKKPNWDLRRDVQK+LDKLE R+ KA+  L
Sbjct  113  IAPKKPNWDLRRDVQKKLDKLESRTQKAMFTL  144



>ref|XP_010464015.1| PREDICTED: coiled-coil domain-containing protein 12-like [Camelina 
sativa]
 ref|XP_010464016.1| PREDICTED: coiled-coil domain-containing protein 12-like [Camelina 
sativa]
Length=144

 Score = 70.9 bits (172),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 3/69 (4%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNED  320
            K+  +D+   ++   MKFRNY+PQ K LQ+GK+APP LP+F+DP+  L    +KK   ED
Sbjct  32   KEDGEDEAVEEDGPAMKFRNYVPQAKELQDGKVAPPELPQFEDPIVALPAAVEKK---ED  88

Query  321  PFLNIAPKK  347
            PF+NIAPKK
Sbjct  89   PFVNIAPKK  97


 Score = 57.8 bits (138),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS  480
            + PKKPNWDLRRDVQK+LDKLE+R+ KA+++L  E EK R   +   N+
Sbjct  93   IAPKKPNWDLRRDVQKKLDKLERRTQKAMYKLMAEHEKEREITEADGNT  141



>ref|XP_004299453.1| PREDICTED: coiled-coil domain-containing protein 12 [Fragaria 
vesca subsp. vesca]
Length=162

 Score = 72.0 bits (175),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 49/75 (65%), Gaps = 11/75 (15%)
 Frame = +3

Query  123  ETPDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDK  302
            E PD+D D      EN  N  MKFRNY+P DK LQE KL PP   KF++P+A + PP   
Sbjct  53   EAPDNDVD------ENSTN--MKFRNYVPHDKKLQEAKLEPPKPSKFEEPVAAVAPPS--  102

Query  303  KEKNEDPFLNIAPKK  347
             EK EDPF+NIAPKK
Sbjct  103  -EKTEDPFVNIAPKK  116


 Score = 55.8 bits (133),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS  480
            + PKKPNW+LRRDVQK+LDKLE+R+ KA+ +L E+E++++L E+ G N 
Sbjct  112  IAPKKPNWELRRDVQKKLDKLERRTQKAMCKLMEQEKQKQLEEE-GING  159



>ref|XP_006300259.1| hypothetical protein CARUB_v10016498mg [Capsella rubella]
 gb|EOA33157.1| hypothetical protein CARUB_v10016498mg [Capsella rubella]
Length=145

 Score = 73.2 bits (178),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 3/54 (6%)
 Frame = +3

Query  186  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            MKFRNY+PQ K LQ+GK+APP LPKF+DP+  L P  +KK   EDPF+NIAPKK
Sbjct  47   MKFRNYVPQAKELQDGKVAPPELPKFEDPIVALPPAVEKK---EDPFVNIAPKK  97


 Score = 53.1 bits (126),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            + PKKPNWDLRRDVQK+LDKLE+R+ KA+++L
Sbjct  93   IAPKKPNWDLRRDVQKKLDKLERRTQKAMYKL  124



>gb|KHN14750.1| Coiled-coil domain-containing protein 12 [Glycine soja]
Length=152

 Score = 65.1 bits (157),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 54/73 (74%), Gaps = 4/73 (5%)
 Frame = +3

Query  129  PDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKE  308
            P+ +KD   D +E+ E  +MKFRNY+P DK+LQEGKLAP VLPKF+DP+ ++     + E
Sbjct  36   PNGNKD--DDNEEDQEPQEMKFRNYVPHDKNLQEGKLAPAVLPKFEDPVDDVP--PPEPE  91

Query  309  KNEDPFLNIAPKK  347
              EDPFLNIAPKK
Sbjct  92   AKEDPFLNIAPKK  104


 Score = 60.5 bits (145),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKR-RLAEDLGTNS  480
            + PKKPNWDLRRDVQK+LDKLEKR+ KAL+QL  E+EK+ +L E   TN 
Sbjct  100  IAPKKPNWDLRRDVQKKLDKLEKRTQKALYQLMVEQEKQNQLTEGDDTNG  149



>gb|EPS62441.1| hypothetical protein M569_12350, partial [Genlisea aurea]
Length=131

 Score = 70.9 bits (172),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +3

Query  138  DKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNE  317
            D++++    +   +  M+FRNY+P DK LQEGKL P VLPKF+DP      P   +E  E
Sbjct  34   DENSTNGNADGLPDINMRFRNYIPHDKQLQEGKLVPHVLPKFEDPPQLAAAPASSEETKE  93

Query  318  DPFLNIAPKK  347
            DPFL IAPKK
Sbjct  94   DPFLRIAPKK  103


 Score = 53.1 bits (126),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            + PKKPNWDLRRDVQKR+DKL++R+ KALH+L
Sbjct  99   IAPKKPNWDLRRDVQKRIDKLDRRTQKALHKL  130



>ref|XP_007161569.1| hypothetical protein PHAVU_001G080600g [Phaseolus vulgaris]
 gb|ESW33563.1| hypothetical protein PHAVU_001G080600g [Phaseolus vulgaris]
Length=147

 Score = 62.4 bits (150),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 41/54 (76%), Gaps = 3/54 (6%)
 Frame = +3

Query  186  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            MKFRNY+P DK+LQEGKLAP VLPKF+DP+        + +  EDPFLNIAPKK
Sbjct  49   MKFRNYVPHDKNLQEGKLAPAVLPKFEDPVDVPP---PEPQVQEDPFLNIAPKK  99


 Score = 60.5 bits (145),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEK-RRLAEDLGTN  477
            + PKKPNWDLRRDVQK+ DKLEKR+ KAL+QL  E+EK ++L E   TN
Sbjct  95   IAPKKPNWDLRRDVQKKFDKLEKRTQKALYQLMVEQEKQKQLTEGDDTN  143



>ref|XP_009134809.1| PREDICTED: LOW QUALITY PROTEIN: coiled-coil domain-containing 
protein 12-like [Brassica rapa]
Length=140

 Score = 59.7 bits (143),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 10/54 (19%)
 Frame = +3

Query  186  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            MKFRNY+PQDK LQ+G        KF+DP+A L P  +KK   EDPF+NIAPKK
Sbjct  50   MKFRNYVPQDKELQDGX-------KFEDPVAALPPAVEKK---EDPFVNIAPKK  93


 Score = 59.7 bits (143),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRR  453
            + PKKPNWDLRRDVQK+LDKLE+R+ KA+++L EE EK R
Sbjct  89   IAPKKPNWDLRRDVQKKLDKLERRTQKAMYKLMEEHEKER  128



>ref|XP_006848659.1| hypothetical protein AMTR_s00171p00065800 [Amborella trichopoda]
 gb|ERN10240.1| hypothetical protein AMTR_s00171p00065800 [Amborella trichopoda]
Length=156

 Score = 63.9 bits (154),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 3/54 (6%)
 Frame = +3

Query  186  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            MKFRNYLP DKHLQE KLAPP  PKF+DP+A   P     EK EDPF+NIAPKK
Sbjct  57   MKFRNYLPHDKHLQESKLAPPPPPKFEDPVAPEPPVS---EKPEDPFVNIAPKK  107


 Score = 55.1 bits (131),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLA  459
            + PKKPNWDL+RDVQ +L KLEKR+ KA+ +L +E++K RLA
Sbjct  103  IAPKKPNWDLQRDVQSKLKKLEKRTQKAMFELMQEQDKERLA  144



>ref|XP_006644463.1| PREDICTED: coiled-coil domain-containing protein 12-like [Oryza 
brachyantha]
Length=175

 Score = 57.8 bits (138),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 6/73 (8%)
 Frame = +3

Query  126  TPDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKK  305
            TP +D +   D   +D+   MKFRNYLP D+ L+ GKLAP  LP F+DP++  T    + 
Sbjct  62   TPSEDSNKVND---DDDIPAMKFRNYLPHDEQLRGGKLAPVSLPNFEDPISAETA---EP  115

Query  306  EKNEDPFLNIAPK  344
            ++ EDPF NIAPK
Sbjct  116  KQLEDPFGNIAPK  128


 Score = 55.5 bits (132),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS*D  486
            + PK PNWDL+RDVQKR+DKLEKR+ KAL ++  E+++ + A + G+++ D
Sbjct  125  IAPKNPNWDLKRDVQKRIDKLEKRTQKALAEIAVEQQREKEALEEGSDAQD  175



>gb|EMS53919.1| hypothetical protein TRIUR3_06239 [Triticum urartu]
Length=170

 Score = 57.4 bits (137),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 9/76 (12%)
 Frame = +3

Query  120  HETPDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPM-ANLTPPQ  296
            H +P  + D ++D  E      +KFRNYLP D+ L+ GK+AP  LPKF+DP+ A+   P+
Sbjct  55   HVSPTKESDEAEDNGE----VPLKFRNYLPHDERLRGGKVAPLSLPKFEDPITADAAEPK  110

Query  297  DKKEKNEDPFLNIAPK  344
                + E+PF NIAPK
Sbjct  111  ----QLENPFGNIAPK  122


 Score = 55.5 bits (132),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS  480
            + PK PNWDL+RDVQKR+DKLEKR+ KAL ++  E++K + A + G+++
Sbjct  119  IAPKNPNWDLKRDVQKRIDKLEKRTQKALAEIALEQQKEKEALEEGSDA  167



>dbj|BAJ90654.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=184

 Score = 56.6 bits (135),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 7/65 (11%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKN--EDPFL  329
            D+ E++    +KFRNYLP D+ L+ GK+AP  LPKF+DP+A      D  E    E+PF 
Sbjct  77   DEAEDNGEVPLKFRNYLPHDERLRGGKVAPLSLPKFEDPIA-----ADAAEPKQLENPFG  131

Query  330  NIAPK  344
            NIAPK
Sbjct  132  NIAPK  136


 Score = 54.3 bits (129),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS  480
            + PK PNWDL+RDVQKR+DKLEKR+ K+L ++  E++K + A + G+++
Sbjct  133  IAPKNPNWDLKRDVQKRIDKLEKRTQKSLAEIALEQQKEKEALEEGSDA  181



>ref|XP_006656528.1| PREDICTED: coiled-coil domain-containing protein 12-like [Oryza 
brachyantha]
Length=177

 Score = 57.0 bits (136),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 3/53 (6%)
 Frame = +3

Query  186  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPK  344
            MKFRNYLP D+ L+ GKLAP  LP F+DP++  T    + ++ EDPF NIAPK
Sbjct  81   MKFRNYLPHDEQLRGGKLAPVSLPNFEDPISAETA---EPKQLEDPFGNIAPK  130


 Score = 53.5 bits (127),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS*D  486
            + PK PNWDL+RDVQKR+DKLEKR+ KAL ++ + +++ + A + G+++ D
Sbjct  127  IAPKNPNWDLKRDVQKRIDKLEKRTQKALAEIADIQQREKEALEEGSDAQD  177



>gb|EMT31131.1| hypothetical protein F775_07814 [Aegilops tauschii]
Length=149

 Score = 55.1 bits (131),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (69%), Gaps = 5/64 (8%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPM-ANLTPPQDKKEKNEDPFLN  332
            D+ E++    +KFRNYLP D+ L+ GK+AP  LPKF+DP+ A+   P+    + E+PF N
Sbjct  42   DEVEDNGEVPLKFRNYLPHDERLRGGKVAPLSLPKFEDPIAADAAEPK----QLENPFGN  97

Query  333  IAPK  344
            IAPK
Sbjct  98   IAPK  101


 Score = 54.3 bits (129),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS  480
            + PK PNWDL+RDVQKR+DKLEKR+ KAL ++  +++K + A + G+++
Sbjct  98   IAPKNPNWDLKRDVQKRIDKLEKRTQKALAEIALDQQKEKEALEEGSDA  146



>ref|XP_003563215.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Brachypodium distachyon]
Length=182

 Score = 54.7 bits (130),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (69%), Gaps = 5/64 (8%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPM-ANLTPPQDKKEKNEDPFLN  332
            D+ E++    +KFRNYLP D+ L+ GK+AP  LPKF+DP+ A+   P+    + E+PF N
Sbjct  77   DELEDNGEIPLKFRNYLPHDERLRGGKVAPLSLPKFEDPIAADAAEPK----QLENPFGN  132

Query  333  IAPK  344
            IAPK
Sbjct  133  IAPK  136


 Score = 54.3 bits (129),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS  480
            + PK PNWDL+RDVQKR+DKLEKR  KAL ++  E++K + A + G+++
Sbjct  133  IAPKNPNWDLKRDVQKRVDKLEKRMQKALAEIALEQQKEKEALEEGSDA  181



>ref|XP_004966558.1| PREDICTED: coiled-coil domain-containing protein 12-like [Setaria 
italica]
Length=176

 Score = 56.6 bits (135),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 5/54 (9%)
 Frame = +3

Query  186  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPM-ANLTPPQDKKEKNEDPFLNIAPK  344
            MKFRNYLP D+ L+ GKLAP  LPKF+DP+ A    P+    + E+PF NIAPK
Sbjct  83   MKFRNYLPHDEQLRGGKLAPVSLPKFEDPISAEAAEPK----QVENPFGNIAPK  132


 Score = 52.4 bits (124),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLA  459
            + PK PNWDL+RDVQKR+DKLEKR+ KAL ++  E+++ + A
Sbjct  129  IAPKNPNWDLKRDVQKRIDKLEKRTQKALAEIALEQQREKEA  170



>ref|XP_006372638.1| hypothetical protein POPTR_0017s03480g [Populus trichocarpa]
 gb|ERP50435.1| hypothetical protein POPTR_0017s03480g [Populus trichocarpa]
Length=78

 Score = 58.5 bits (140),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTN  477
            + PKKPNWDLRRDVQK+ DKLE+R+LKA+ +L EE+EK +   + G N
Sbjct  27   IAPKKPNWDLRRDVQKKHDKLERRTLKAICKLMEEQEKEKQVVENGGN  74


 Score = 47.8 bits (112),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 28/54 (52%), Gaps = 23/54 (43%)
 Frame = +3

Query  186  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            MKFRNY+PQDK   EGKLAPP                       DPFLNIAPKK
Sbjct  1    MKFRNYVPQDKEFHEGKLAPP-----------------------DPFLNIAPKK  31



>ref|XP_002437648.1| hypothetical protein SORBIDRAFT_10g031190 [Sorghum bicolor]
 gb|EER89015.1| hypothetical protein SORBIDRAFT_10g031190 [Sorghum bicolor]
Length=178

 Score = 57.8 bits (138),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 3/53 (6%)
 Frame = +3

Query  186  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPK  344
            MKFRNYLP D+ L+ GKLAP  LPKF+DP++  T    + ++ E+PF NIAPK
Sbjct  85   MKFRNYLPHDEQLRGGKLAPVSLPKFEDPISAETA---EPKEVENPFGNIAPK  134


 Score = 48.1 bits (113),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLA  459
            + PK PNWDL+R VQKR+DKLE+R+ KAL ++  E+++ + A
Sbjct  131  IAPKNPNWDLKRHVQKRIDKLERRTQKALAEIALEQQREKEA  172



>ref|XP_007009902.1| Cwf18 isoform 2, partial [Theobroma cacao]
 gb|EOY18712.1| Cwf18 isoform 2, partial [Theobroma cacao]
Length=145

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 5/78 (6%)
 Frame = +3

Query  126  TPDDDK-DASQDQ-QENDE--NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPP  293
            TPD+D   A++D+  E DE  N  MKFRNY+P D  LQEGK+APPVLPKF+DP+  + PP
Sbjct  31   TPDEDSAQAAEDKTNETDEENNRSMKFRNYVPHDIQLQEGKVAPPVLPKFEDPV-EVAPP  89

Query  294  QDKKEKNEDPFLNIAPKK  347
              + ++  DPF+NIAPKK
Sbjct  90   PSEDQEVLDPFVNIAPKK  107


 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +1

Query  292  PKTKRRKMRIPS*ILPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRR  453
            P ++ +++  P   + PKKPNWDLRRDVQK+LDKLE+R+ KA++ L E++E+ +
Sbjct  89   PPSEDQEVLDPFVNIAPKKPNWDLRRDVQKKLDKLERRTQKAIYILMEQQEQEK  142



>ref|XP_009396161.1| PREDICTED: coiled-coil domain-containing protein 12 [Musa acuminata 
subsp. malaccensis]
Length=205

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 54/78 (69%), Gaps = 7/78 (9%)
 Frame = +3

Query  123  ETPDDD--KDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANL-TPP  293
            +TPD++  K  S+ +   DE   MKFRNYLP DK LQEGK+AP  LPKF+DP+A    PP
Sbjct  85   DTPDEEAAKHDSKTEDSEDEMPSMKFRNYLPHDKQLQEGKVAPATLPKFEDPVAAAPLPP  144

Query  294  QDKKEKNEDPFLNIAPKK  347
                EK EDPFLNIAPKK
Sbjct  145  ----EKIEDPFLNIAPKK  158


 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +1

Query  310  KMRIPS*ILPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDL  468
            K+  P   + PKKPNWDLRRDVQK+LDKLE+R+ KAL++L +E+EK   A D+
Sbjct  146  KIEDPFLNIAPKKPNWDLRRDVQKKLDKLERRTQKALYKLMQEQEKETEAMDI  198



>ref|NP_001141270.1| hypothetical protein [Zea mays]
 gb|ACF85922.1| unknown [Zea mays]
 gb|AFW69647.1| hypothetical protein ZEAMMB73_159078 [Zea mays]
Length=178

 Score = 53.5 bits (127),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 3/53 (6%)
 Frame = +3

Query  186  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPK  344
            MKFRNYLP D+ L+ GKLAP  LPKF+DP++  T    + ++ E+ F NIAPK
Sbjct  85   MKFRNYLPHDEQLRGGKLAPVSLPKFEDPISAETA---EPKEVENLFGNIAPK  134


 Score = 50.8 bits (120),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLA  459
            + PK PNWDL+RDVQKR+DKLE+R+ KAL ++  E+++ + A
Sbjct  131  IAPKNPNWDLKRDVQKRIDKLERRTQKALAEIALEQQREKEA  172



>ref|XP_010239286.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Brachypodium distachyon]
Length=189

 Score = 55.1 bits (131),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (69%), Gaps = 5/64 (8%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPM-ANLTPPQDKKEKNEDPFLN  332
            D+ E++    +KFRNYLP D+ L+ GK+AP  LPKF+DP+ A+   P+    + E+PF N
Sbjct  77   DELEDNGEIPLKFRNYLPHDERLRGGKVAPLSLPKFEDPIAADAAEPK----QLENPFGN  132

Query  333  IAPK  344
            IAPK
Sbjct  133  IAPK  136


 Score = 49.3 bits (116),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEE  438
            + PK PNWDL+RDVQKR+DKLEKR  KAL ++  E
Sbjct  133  IAPKNPNWDLKRDVQKRVDKLEKRMQKALAEIACE  167



>ref|XP_002984337.1| hypothetical protein SELMODRAFT_445863 [Selaginella moellendorffii]
 gb|EFJ14387.1| hypothetical protein SELMODRAFT_445863 [Selaginella moellendorffii]
Length=153

 Score = 58.2 bits (139),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 47/79 (59%), Gaps = 13/79 (16%)
 Frame = +3

Query  138  DKDASQDQQEND-ENFQ--------MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTP  290
            D D  Q+   N  EN Q        ++FRNYLP+D+ LQ+ K  PPVLPKF+DP+A  T 
Sbjct  36   DGDGEQEVDANGKENLQEEKADLPPIRFRNYLPRDEELQKLKREPPVLPKFEDPVAVPTD  95

Query  291  PQDKKEKNEDPFLNIAPKK  347
              +     EDP L+IAPKK
Sbjct  96   TSNA----EDPMLSIAPKK  110


 Score = 46.2 bits (108),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 34/44 (77%), Gaps = 2/44 (5%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL--GEEEEKRRLA  459
            + PKK NWDLRRD  K+L+KLEKR+ +A+ +L  GE+E +++L 
Sbjct  106  IAPKKANWDLRRDATKKLEKLEKRTTRAIIELMAGEKENRKKLG  149



>gb|ACJ86026.1| unknown [Medicago truncatula]
Length=169

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 53/72 (74%), Gaps = 3/72 (4%)
 Frame = +3

Query  132  DDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEK  311
            DDD+   +   E +E   MKFRNY+P DK+LQEGKLAP VLPKF+DP   ++ P+ K++ 
Sbjct  53   DDDEQREEKDGEGEEKLSMKFRNYVPHDKNLQEGKLAPAVLPKFEDP---VSVPEPKEKP  109

Query  312  NEDPFLNIAPKK  347
             EDPFLNIAPKK
Sbjct  110  KEDPFLNIAPKK  121


 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = +1

Query  292  PKTKRRKMRIPS*ILPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKR-RLAEDL  468
            P+ K +    P   + PKKPNWDLRRDVQK+LDKLEKR+ KAL+QL  E+EK+ +LAE  
Sbjct  103  PEPKEKPKEDPFLNIAPKKPNWDLRRDVQKKLDKLEKRTQKALYQLMVEQEKQNQLAEGD  162

Query  469  GTNS  480
             TN 
Sbjct  163  DTNG  166



>ref|XP_002972762.1| hypothetical protein SELMODRAFT_413348 [Selaginella moellendorffii]
 gb|EFJ25983.1| hypothetical protein SELMODRAFT_413348 [Selaginella moellendorffii]
Length=142

 Score = 58.2 bits (139),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 47/79 (59%), Gaps = 13/79 (16%)
 Frame = +3

Query  138  DKDASQDQQEND-ENFQ--------MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTP  290
            D D  Q+   N  EN Q        ++FRNYLP+D+ LQ+ K  PPVLPKF+DP+A  T 
Sbjct  36   DGDGEQEVDANGKENLQEEKADLPPIRFRNYLPRDEELQKLKREPPVLPKFEDPVAVPTD  95

Query  291  PQDKKEKNEDPFLNIAPKK  347
              +     EDP L+IAPKK
Sbjct  96   TSNA----EDPMLSIAPKK  110


 Score = 43.1 bits (100),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            + PKK NWDLRRD  K+L+KLEKR+ +A+ +L
Sbjct  106  IAPKKANWDLRRDATKKLEKLEKRTTRAIIEL  137



>ref|XP_001780929.1| predicted protein [Physcomitrella patens]
 gb|EDQ54267.1| predicted protein, partial [Physcomitrella patens]
Length=81

 Score = 55.5 bits (132),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 3/54 (6%)
 Frame = +3

Query  186  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            +KFRNY P+D  LQ+ K APPV+PKF+DP+A   P Q      EDP ++IAPKK
Sbjct  1    IKFRNYFPRDSDLQKAKHAPPVIPKFEDPVAT-DPLQ--VAGGEDPIVSIAPKK  51


 Score = 45.1 bits (105),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            + PKKPNWDLRRDV K+L+KLE+R+ +A+ +L
Sbjct  47   IAPKKPNWDLRRDVAKKLEKLERRTHRAIVEL  78



>ref|XP_010935583.1| PREDICTED: coiled-coil domain-containing protein 12 [Elaeis guineensis]
 ref|XP_010935584.1| PREDICTED: coiled-coil domain-containing protein 12 [Elaeis guineensis]
Length=209

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 3/54 (6%)
 Frame = +3

Query  186  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            MKFRNYLP DK LQEGK+AP VLPKF+DP+A +       EK EDPF+NIAPKK
Sbjct  112  MKFRNYLPHDKQLQEGKVAPAVLPKFEDPVAAVP---SAPEKIEDPFVNIAPKK  162


 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  310  KMRIPS*ILPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEE  441
            K+  P   + PKKPNWDLRRDVQK+LDKLE+R+ KA++QL +E+
Sbjct  150  KIEDPFVNIAPKKPNWDLRRDVQKKLDKLERRTQKAIYQLMQEQ  193



>ref|XP_008802780.1| PREDICTED: coiled-coil domain-containing protein 12 [Phoenix 
dactylifera]
Length=209

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 50/68 (74%), Gaps = 5/68 (7%)
 Frame = +3

Query  150  SQDQQENDENF--QMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDP  323
            ++D +EN+E+    MKFRNYLP DK LQEGKL P VLPKF+DP A + P     EK EDP
Sbjct  98   AEDSEENEEDKMPNMKFRNYLPHDKQLQEGKLTPAVLPKFEDPAAAVPP---PPEKIEDP  154

Query  324  FLNIAPKK  347
            F+NIAPKK
Sbjct  155  FVNIAPKK  162


 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  310  KMRIPS*ILPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEE  441
            K+  P   + PKKPNWDLRRDVQK+LDKLE+R+ KA++QL +E+
Sbjct  150  KIEDPFVNIAPKKPNWDLRRDVQKKLDKLERRTQKAIYQLMQEQ  193



>ref|XP_011461976.1| PREDICTED: coiled-coil domain-containing protein 12-like [Fragaria 
vesca subsp. vesca]
Length=147

 Score = 46.2 bits (108),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEE  441
            L P+ P+++L+RDVQKRLDKLE+R+LKAL ++ E+E
Sbjct  108  LVPRPPHFELQRDVQKRLDKLERRTLKALCKIMEQE  143


 Score = 45.1 bits (105),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 34/59 (58%), Gaps = 5/59 (8%)
 Frame = +3

Query  177  NFQMKFRNYLPQDKHL---QEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPK  344
            N  +KFRNY P+DK L   QEGKL      KFDDP+  + P     EK +D F ++ P+
Sbjct  55   NTSVKFRNYFPRDKKLIKEQEGKLESGPTSKFDDPIGAVVP--SPLEKKKDSFKDLVPR  111



>emb|CDX74154.1| BnaA03g28930D [Brassica napus]
Length=115

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRR  453
            + PKKPNWDLRRDVQK+LDKLE+R+ KA+++L EE EK R
Sbjct  64   IAPKKPNWDLRRDVQKKLDKLERRTQKAMYKLMEEHEKER  103



>ref|XP_005647392.1| hypothetical protein COCSUDRAFT_16114 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22848.1| hypothetical protein COCSUDRAFT_16114 [Coccomyxa subellipsoidea 
C-169]
Length=131

 Score = 53.9 bits (128),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  340  PKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLG  471
            PKK NWDLRRDV+K+L KLE+R+ +AL QL +E+++ +LA+D G
Sbjct  85   PKKANWDLRRDVEKKLAKLERRTQRALVQLMQEQQREQLAQDGG  128


 Score = 28.9 bits (63),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 15/54 (28%), Positives = 27/54 (50%), Gaps = 5/54 (9%)
 Frame = +3

Query  186  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            +KFRNY  +D  ++   +     P++ +P+     P+    +  D  LN+ PKK
Sbjct  39   LKFRNYAVKDNRIEHQTIEAAQAPEYQEPV-----PEPSIVQEGDVLLNVVPKK  87



>gb|EEC81357.1| hypothetical protein OsI_24550 [Oryza sativa Indica Group]
Length=182

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 5/68 (7%)
 Frame = +3

Query  144  DASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPM-ANLTPPQDKKEKNED  320
            D S++ Q + +   MKFRNYLP D+ L+ GK+AP  LPKF+DP+ A  T P+    + E+
Sbjct  71   DESEEVQNDGDMPAMKFRNYLPHDEQLRGGKVAPVSLPKFEDPISAETTEPK----QVEN  126

Query  321  PFLNIAPK  344
            PF NIAPK
Sbjct  127  PFGNIAPK  134


 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  298  TKRRKMRIPS*ILPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTN  477
            T+ +++  P   + PK PNWDL+RDVQKR+DKLEKR+ KAL ++  E++K + A   G++
Sbjct  119  TEPKQVENPFGNIAPKNPNWDLKRDVQKRMDKLEKRTQKALAEIALEQQKEKEALGEGSD  178

Query  478  S  480
            +
Sbjct  179  A  179



>ref|NP_001058658.1| Os06g0730800 [Oryza sativa Japonica Group]
 dbj|BAD62127.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD62486.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20572.1| Os06g0730800 [Oryza sativa Japonica Group]
 dbj|BAG92558.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66403.1| hypothetical protein OsJ_22745 [Oryza sativa Japonica Group]
Length=182

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 5/68 (7%)
 Frame = +3

Query  144  DASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPM-ANLTPPQDKKEKNED  320
            D S++ Q + +   MKFRNYLP D+ L+ GK+AP  LPKF+DP+ A  T P+    + E+
Sbjct  71   DESEEVQNDGDMPAMKFRNYLPHDEQLRGGKVAPVSLPKFEDPISAETTEPK----QVEN  126

Query  321  PFLNIAPK  344
            PF NIAPK
Sbjct  127  PFGNIAPK  134


 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  298  TKRRKMRIPS*ILPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTN  477
            T+ +++  P   + PK PNWDL+RDVQKR+DKLEKR+ KAL ++  E++K + A   G++
Sbjct  119  TEPKQVENPFGNIAPKNPNWDLKRDVQKRMDKLEKRTQKALAEIALEQQKEKEALGEGSD  178

Query  478  S  480
            +
Sbjct  179  A  179



>gb|KIZ00598.1| Coiled-coil domain-containing protein 12 [Monoraphidium neglectum]
Length=141

 Score = 44.3 bits (103),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            + PKK NWDL+R+VQ +LDKLE+R+L+AL ++
Sbjct  93   VAPKKANWDLKREVQPKLDKLERRTLRALVEI  124


 Score = 37.4 bits (85),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 40/64 (63%), Gaps = 4/64 (6%)
 Frame = +3

Query  159  QQENDENFQMKFRNYLPQD-KHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNI  335
            +Q+  E   +KFRNY+ +D KH++  ++AP  +PK ++P+     P+D  E  E+   ++
Sbjct  37   EQQEPEKPVLKFRNYVVKDSKHIEHEQVAPAQVPKAEEPVVEQR-PEDAGE--EELLASV  93

Query  336  APKK  347
            APKK
Sbjct  94   APKK  97



>ref|XP_004365664.1| hypothetical protein CAOG_00793 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE89293.1| hypothetical protein CAOG_000793 [Capsaspora owczarzaki ATCC 
30864]
Length=197

 Score = 42.4 bits (98),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+K NWDL+RDV K+L+KLE+R+ +A+ +L
Sbjct  146  LAPRKQNWDLKRDVTKKLEKLERRTNRAIAEL  177


 Score = 35.8 bits (81),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 38/70 (54%), Gaps = 2/70 (3%)
 Frame = +3

Query  138  DKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNE  317
            D+ ++ D   ND +  ++FRNY P D  L   ++  P LP+ +  +A +    D +  + 
Sbjct  83   DESSAMDDGSNDADTTLRFRNYTPNDAKLANAQIEHPDLPEPEKDVAEIAKA-DARIHDI  141

Query  318  DPFLNIAPKK  347
            D  +N+AP+K
Sbjct  142  D-LVNLAPRK  150



>ref|XP_009067757.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Acanthisitta chloris]
Length=133

 Score = 45.8 bits (107),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  75   LAPRKPDWDLKRDVSKKLEKLEKRTQRAIAELIRERLKGQEEE---LAAAVGS  124


 Score = 30.0 bits (66),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +3

Query  153  QDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLP  257
            QD++E  ++ ++K RNY P+D+ L++ KL PP  P
Sbjct  14   QDEEEPIKHKEIKLRNYEPEDEELKKRKL-PPAKP  47



>ref|XP_004342218.1| cwf18 pre-mRNA splicing factor protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR20108.1| cwf18 pre-mRNA splicing factor protein [Acanthamoeba castellanii 
str. Neff]
Length=184

 Score = 43.9 bits (102),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKAL  420
            L PKKPNWDL+RD++++LD LEKR+ +A+
Sbjct  122  LAPKKPNWDLKRDIERKLDALEKRTQRAI  150


 Score = 31.6 bits (70),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 2/55 (4%)
 Frame = +3

Query  183  QMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            ++KFRNY+P+D  L+E ++ P  LP     + N      +  + ED  L +APKK
Sbjct  74   RLKFRNYVPRDNLLRELRIEPAPLPSMVGEI-NRKLIMMEGRRGED-LLALAPKK  126



>ref|XP_008120605.1| PREDICTED: coiled-coil domain-containing protein 12 [Anolis carolinensis]
Length=195

 Score = 44.3 bits (103),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  137  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  168


 Score = 30.8 bits (68),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 24/34 (71%), Gaps = 1/34 (3%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLP  257
            +++E  ++ ++K RNY P+D+ L+ G++ PP  P
Sbjct  77   EEEEAPKHKELKLRNYTPEDEELK-GRIVPPAKP  109



>ref|XP_006171088.1| PREDICTED: coiled-coil domain-containing protein 86 isoform X3 
[Tupaia chinensis]
Length=158

 Score = 43.9 bits (102),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 30.8 bits (68),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   ++QQE +++ +++ RNY+P+D+ L+  ++  A PV
Sbjct  42   KQLREEQQEGEKHRELRLRNYVPEDEDLKRRRVPQAKPV  80



>gb|ELV09682.1| Coiled-coil domain-containing protein 12 [Tupaia chinensis]
Length=184

 Score = 43.9 bits (102),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 30.4 bits (67),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   ++QQE +++ +++ RNY+P+D+ L+  ++  A PV
Sbjct  42   KQLREEQQEGEKHRELRLRNYVPEDEDLKRRRVPQAKPV  80



>gb|KFU93677.1| Coiled-coil domain-containing protein 12, partial [Chaetura pelagica]
Length=135

 Score = 46.2 bits (108),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  77   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  126


 Score = 28.1 bits (61),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 24/34 (71%), Gaps = 1/34 (3%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLP  257
            D++E  ++ ++K RNY P+D+ L++ K+ PP  P
Sbjct  17   DEEETVKHKELKLRNYDPEDEELKKRKV-PPAKP  49



>ref|XP_010020082.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Nestor notabilis]
Length=134

 Score = 45.8 bits (107),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  76   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  125


 Score = 28.5 bits (62),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 24/34 (71%), Gaps = 1/34 (3%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLP  257
            D++E  ++ ++K RNY P+D+ L++ K+ PP  P
Sbjct  16   DEEETVKHKELKLRNYDPEDEELKKRKM-PPAKP  48



>ref|XP_010001356.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Chaetura pelagica]
Length=134

 Score = 46.2 bits (108),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  76   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  125


 Score = 28.1 bits (61),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 24/34 (71%), Gaps = 1/34 (3%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLP  257
            D++E  ++ ++K RNY P+D+ L++ K+ PP  P
Sbjct  16   DEEETVKHKELKLRNYDPEDEELKKRKV-PPAKP  48



>ref|XP_009878822.1| PREDICTED: coiled-coil domain-containing protein 12 [Charadrius 
vociferus]
Length=164

 Score = 46.2 bits (108),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  106  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  155


 Score = 27.7 bits (60),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 36/68 (53%), Gaps = 7/68 (10%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKL----APPVLPKFDDPMANLTPPQDKKEKNEDP  323
            D++E  ++ ++K RNY P+D+ L++ K+      PV  K  D +    P    +E +   
Sbjct  46   DEEETAKHKELKLRNYEPEDEELKKRKVPQAKPAPVEDKVKDQLEAAKPEPIIEEVD---  102

Query  324  FLNIAPKK  347
              N+AP+K
Sbjct  103  LANLAPRK  110



>ref|XP_003059754.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55706.1| predicted protein [Micromonas pusilla CCMP1545]
Length=148

 Score = 40.8 bits (94),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  340  PKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRR  453
            P+K N DLRRDV ++++KLE+R+ +A+  L +EEE+RR
Sbjct  103  PQKLNADLRRDVAQKMEKLERRTQRAMLVLMQEEEERR  140


 Score = 33.5 bits (75),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +3

Query  186  MKFRNYLPQDKHLQEGKLA  242
            +KFRNY+P+D+ LQEG +A
Sbjct  51   LKFRNYMPRDEELQEGVMA  69



>ref|XP_004704212.1| PREDICTED: coiled-coil domain-containing protein 12 [Echinops 
telfairi]
Length=153

 Score = 44.3 bits (103),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  94   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  125


 Score = 29.6 bits (65),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 14/38 (37%), Positives = 24/38 (63%), Gaps = 3/38 (8%)
 Frame = +3

Query  183  QMKFRNYLPQDKHLQEGKLAPPVLP--KFDDPMANLTP  290
            +++ RNY+P+D+ L+  ++ PP  P    D  +ANL P
Sbjct  60   ELRLRNYVPEDEDLKRRRV-PPAKPVAGRDTDLANLAP  96



>ref|XP_004316573.1| PREDICTED: coiled-coil domain-containing protein 12 [Tursiops 
truncatus]
Length=167

 Score = 44.7 bits (104),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 28.9 bits (63),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 28/39 (72%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            KD  + ++E +++ +++ RNY+P+D+ L++ ++  A P+
Sbjct  42   KDLRRGEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPI  80



>ref|XP_001521551.2| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Ornithorhynchus anatinus]
Length=177

 Score = 45.4 bits (106),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+LDKLEKR+ +A+ +L
Sbjct  119  LAPRKPDWDLKRDVAKKLDKLEKRTQRAIAEL  150


 Score = 27.7 bits (60),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  153  QDQQENDENFQMKFRNYLPQDKHLQEGKL  239
            +++ E + + ++K RNY+PQD+ L++ K+
Sbjct  58   EEEGEPERHRELKLRNYVPQDEELKKRKV  86



>ref|XP_005040505.1| PREDICTED: coiled-coil domain-containing protein 12 [Ficedula 
albicollis]
Length=268

 Score = 47.0 bits (110),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  210  LAPRKPDWDLKRDVSKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  259


 Score = 26.2 bits (56),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 23/34 (68%), Gaps = 1/34 (3%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLP  257
            +++E  ++ ++K RNY P+D  L++ KL PP  P
Sbjct  150  EEEEPVKHREIKLRNYDPEDAELKKRKL-PPAKP  182



>ref|XP_004760838.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Mustela putorius furo]
 ref|XP_004760839.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Mustela putorius furo]
 ref|XP_004814162.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Mustela putorius furo]
 ref|XP_004814163.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Mustela putorius furo]
Length=166

 Score = 44.7 bits (104),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 28.5 bits (62),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 26/39 (67%), Gaps = 1/39 (3%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLP  257
            K   + ++E +++ +++ RNY+P+D+ L+  ++ PP  P
Sbjct  42   KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRV-PPAKP  79



>gb|KFP75017.1| Coiled-coil domain-containing protein 12, partial [Acanthisitta 
chloris]
Length=111

 Score = 46.2 bits (108),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  53   LAPRKPDWDLKRDVSKKLEKLEKRTQRAIAELIRERLKGQEEE---LAAAVGS  102


 Score = 26.9 bits (58),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
 Frame = +3

Query  183  QMKFRNYLPQDKHLQEGKLAPPVLP  257
            ++K RNY P+D+ L++ KL PP  P
Sbjct  2    EIKLRNYEPEDEELKKRKL-PPAKP  25



>ref|XP_008921036.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Manacus vitellinus]
Length=175

 Score = 45.8 bits (107),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  117  LAPRKPDWDLKRDVSKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  166


 Score = 27.3 bits (59),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (67%), Gaps = 4/33 (12%)
 Frame = +3

Query  159  QQENDE----NFQMKFRNYLPQDKHLQEGKLAP  245
            +QE DE    + ++K RNY P+D+ L++ KL P
Sbjct  54   RQEEDEEPVKHKEIKLRNYEPEDEELKKRKLPP  86



>ref|XP_009473636.1| PREDICTED: coiled-coil domain-containing protein 12 [Nipponia 
nippon]
Length=182

 Score = 47.0 bits (110),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  124  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  173


 Score = 25.8 bits (55),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 10/28 (36%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKL  239
            D++E  ++ ++K RNY P+D+ L++ K+
Sbjct  64   DEEETVKHKELKLRNYEPEDEELKKRKV  91



>ref|XP_005600802.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Equus caballus]
 ref|XP_008518536.1| PREDICTED: coiled-coil domain-containing protein 12 [Equus przewalskii]
Length=252

 Score = 44.3 bits (103),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  193  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  224


 Score = 28.9 bits (63),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 26/39 (67%), Gaps = 1/39 (3%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLP  257
            K   + ++E +++ +++ RNY+P+D+ L+  ++ PP  P
Sbjct  128  KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRV-PPAKP  165



>ref|XP_005600801.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Equus caballus]
Length=262

 Score = 44.3 bits (103),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  203  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  234


 Score = 28.9 bits (63),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 26/39 (67%), Gaps = 1/39 (3%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLP  257
            K   + ++E +++ +++ RNY+P+D+ L+  ++ PP  P
Sbjct  138  KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRV-PPAKP  175



>ref|XP_005144041.1| PREDICTED: coiled-coil domain-containing protein 12 [Melopsittacus 
undulatus]
Length=214

 Score = 46.2 bits (108),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  156  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  205


 Score = 26.9 bits (58),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 19/26 (73%), Gaps = 1/26 (4%)
 Frame = +3

Query  180  FQMKFRNYLPQDKHLQEGKLAPPVLP  257
            +++K RNY P+D+ L++ K+ PP  P
Sbjct  104  WELKLRNYDPEDEELKKRKM-PPAKP  128



>ref|XP_005023364.1| PREDICTED: coiled-coil domain-containing protein 12 [Anas platyrhynchos]
Length=139

 Score = 45.1 bits (105),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KL+KR+ +A+ +L      G+EEE   LA  +G+
Sbjct  81   LAPRKPDWDLKRDVAKKLEKLDKRTQRAIAELIRERLKGQEEE---LASAVGS  130


 Score = 27.7 bits (60),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 23/34 (68%), Gaps = 1/34 (3%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLP  257
            D++E   + ++K RNY P+D+ L++ K+ PP  P
Sbjct  21   DEEETVRHKEIKLRNYDPEDEELKKRKV-PPAKP  53



>ref|XP_005600803.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X3 
[Equus caballus]
Length=207

 Score = 43.9 bits (102),  Expect(2) = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  148  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  179


 Score = 28.5 bits (62),  Expect(2) = 7e-05, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 26/39 (67%), Gaps = 1/39 (3%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLP  257
            K   + ++E +++ +++ RNY+P+D+ L+  ++ PP  P
Sbjct  83   KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRV-PPAKP  120



>ref|XP_011418659.1| PREDICTED: coiled-coil domain-containing protein 12-like [Crassostrea 
gigas]
 gb|EKC22753.1| Coiled-coil domain-containing protein 12 [Crassostrea gigas]
Length=155

 Score = 43.1 bits (100),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLE+R+ +A+ +L
Sbjct  92   LAPRKPDWDLKRDVAKKLEKLERRTQRAIAEL  123


 Score = 29.6 bits (65),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (56%), Gaps = 3/54 (6%)
 Frame = +3

Query  192  FRNYLPQDKHLQEGKLAPPVLPK--FDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            FR+Y P+D+ LQE KL P V P    D   ++L    ++    E   +N+AP+K
Sbjct  44   FRSYKPKDESLQESKL-PQVKPSDVTDKIKSHLEAATEEMSIEEVDLINLAPRK  96



>ref|NP_001003589.1| coiled-coil domain-containing protein 12 [Danio rerio]
 gb|AAH78268.1| Coiled-coil domain containing 12 [Danio rerio]
Length=163

 Score = 44.3 bits (103),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 6/43 (14%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE  444
            L P+KP+WDL+RDV K+L+KLE+R+ KA+ +L      G EEE
Sbjct  105  LAPRKPDWDLKRDVAKKLEKLERRTQKAIAELIRERLKGSEEE  147


 Score = 28.1 bits (61),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 0/30 (0%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQE  230
            K A +D +  D + ++K RNY P+D  L+E
Sbjct  40   KRALEDTETEDRHRELKLRNYTPEDVELKE  69



>ref|NP_001091259.1| uncharacterized protein LOC100037064 [Xenopus laevis]
 gb|AAI28981.1| LOC100037064 protein [Xenopus laevis]
Length=157

 Score = 45.1 bits (105),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 6/43 (14%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE  444
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE
Sbjct  99   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE  141


 Score = 27.3 bits (59),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 23/32 (72%), Gaps = 2/32 (6%)
 Frame = +3

Query  162  QENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            +E +++ ++K RNY PQD+ L+E ++  A P+
Sbjct  41   EEEEQHRELKLRNYTPQDEVLKERQVPQAKPI  72



>ref|XP_005532203.1| PREDICTED: coiled-coil domain-containing protein 12 [Pseudopodoces 
humilis]
Length=191

 Score = 45.8 bits (107),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  133  LAPRKPDWDLKRDVSKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  182


 Score = 26.6 bits (57),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 24/34 (71%), Gaps = 1/34 (3%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLP  257
            +++E  ++ ++K RNY P+D+ L++ KL PP  P
Sbjct  73   EEEEPVKHREIKLRNYDPEDEELKKRKL-PPAKP  105



>ref|XP_003206961.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Meleagris gallopavo]
Length=175

 Score = 45.4 bits (106),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+++KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  117  LAPRKPDWDLKRDVAKKMEKLEKRTQRAIAELIRERLKGQEEE---LAAAVGS  166


 Score = 26.9 bits (58),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 23/34 (68%), Gaps = 1/34 (3%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLP  257
            +++EN  + ++  RNY P+D+ L++ KL PP  P
Sbjct  57   EEEENVRHREIILRNYDPEDEELKKRKL-PPAKP  89



>ref|XP_008641363.1| PREDICTED: coiled-coil domain-containing protein 12 [Corvus brachyrhynchos]
Length=163

 Score = 46.6 bits (109),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  105  LAPRKPDWDLKRDVSKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  154


 Score = 25.8 bits (55),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +3

Query  183  QMKFRNYLPQDKHLQEGKLAP  245
            ++K RNY P+D+ L++ KL P
Sbjct  54   EIKLRNYDPEDEELKKRKLPP  74



>ref|XP_010171939.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Caprimulgus carolinensis]
Length=110

 Score = 46.2 bits (108),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  52   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  101


 Score = 26.2 bits (56),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (51%), Gaps = 11/61 (18%)
 Frame = +3

Query  183  QMKFRNYLPQDKHLQEGKL----APPVLPKFDDPM--ANLTPPQDKKEKNEDPFLNIAPK  344
            ++K RNY P+D+ L++ K+      PV  K  D +  A L P  D     E    N+AP+
Sbjct  1    ELKLRNYEPEDEELKKRKMPKAKPAPVEDKVKDQLEAAKLEPIID-----EVDLANLAPR  55

Query  345  K  347
            K
Sbjct  56   K  56



>ref|XP_005308836.1| PREDICTED: coiled-coil domain-containing protein 12 [Chrysemys 
picta bellii]
 ref|XP_005308837.1| PREDICTED: coiled-coil domain-containing protein 12 [Chrysemys 
picta bellii]
Length=179

 Score = 46.2 bits (108),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  121  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLRGQEEE---LASAVGS  170


 Score = 25.8 bits (55),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 25/36 (69%), Gaps = 7/36 (19%)
 Frame = +3

Query  132  DDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL  239
            DD++DA++       + ++K RNY+P+D+ L++ K+
Sbjct  60   DDEEDAAK-------HKELKLRNYVPEDEDLKKRKV  88



>ref|NP_001158518.1| Coiled-coil domain-containing protein 12 [Oncorhynchus mykiss]
 gb|ACO07622.1| Coiled-coil domain-containing protein 12 [Oncorhynchus mykiss]
Length=165

 Score = 45.8 bits (107),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 6/55 (11%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGTNS  480
            L P+KP+WDL+RDV K+L+KLE+R+ KA+ +L      G EEE   +   +G  +
Sbjct  106  LAPRKPDWDLKRDVAKKLEKLERRTQKAIAELIRDRLKGSEEELAGVVGAIGVTA  160


 Score = 26.2 bits (56),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 29/43 (67%), Gaps = 2/43 (5%)
 Frame = +3

Query  129  PDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            PD  +D ++++ E + + ++K RNY P+D+ L+E ++  A PV
Sbjct  37   PDRKRDRAEEEAEEERHRELKLRNYTPEDEELKERQVPKAKPV  79



>ref|XP_010393056.1| PREDICTED: coiled-coil domain-containing protein 12 [Corvus cornix 
cornix]
Length=139

 Score = 46.2 bits (108),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  81   LAPRKPDWDLKRDVSKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  130


 Score = 25.8 bits (55),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +3

Query  183  QMKFRNYLPQDKHLQEGKLAP  245
            ++K RNY P+D+ L++ KL P
Sbjct  30   EIKLRNYDPEDEELKKRKLPP  50



>ref|XP_009705483.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Cariama cristata]
Length=134

 Score = 46.2 bits (108),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  76   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  125


 Score = 25.8 bits (55),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 10/28 (36%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKL  239
            D++E  ++ ++K RNY P+D+ L++ K+
Sbjct  16   DEEETVKHKELKLRNYEPEDEELKKRKV  43



>ref|XP_009279299.1| PREDICTED: coiled-coil domain-containing protein 12 [Aptenodytes 
forsteri]
 ref|XP_009331541.1| PREDICTED: coiled-coil domain-containing protein 12 [Pygoscelis 
adeliae]
Length=135

 Score = 46.2 bits (108),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  77   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  126


 Score = 25.8 bits (55),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 10/28 (36%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKL  239
            D++E  ++ ++K RNY P+D+ L++ K+
Sbjct  17   DEEETVKHKELKLRNYEPEDEELKKRKV  44



>ref|XP_009638389.1| PREDICTED: coiled-coil domain-containing protein 12 [Egretta 
garzetta]
Length=139

 Score = 46.2 bits (108),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  81   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  130


 Score = 25.8 bits (55),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 10/28 (36%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKL  239
            D++E  ++ ++K RNY P+D+ L++ K+
Sbjct  21   DEEETVKHKELKLRNYEPEDEELKKRKV  48



>ref|XP_009926465.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Haliaeetus albicilla]
 ref|XP_010560173.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Haliaeetus leucocephalus]
Length=135

 Score = 46.2 bits (108),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  77   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  126


 Score = 25.8 bits (55),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 10/28 (36%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKL  239
            D++E  ++ ++K RNY P+D+ L++ K+
Sbjct  17   DEEETVKHKELKLRNYEPEDEELKKRKV  44



>ref|XP_004211306.1| PREDICTED: coiled-coil domain-containing protein 12-like, partial 
[Hydra vulgaris]
Length=102

 Score = 45.1 bits (105),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  331  ILPPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEE  438
             L P+KP+WDL+RDV  R+DKLEKR+ KA+ +L  E
Sbjct  64   TLAPRKPDWDLKRDVTNRMDKLEKRTQKAIVELIRE  99


 Score = 26.6 bits (57),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = +3

Query  186  MKFRNYLPQDKHLQEGKL  239
            +KFRNY PQD  L+E K+
Sbjct  15   IKFRNYTPQDPLLKEKKI  32



>ref|XP_001422700.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP01017.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=126

 Score = 40.4 bits (93),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +1

Query  331  ILPPKKPNWDLRRDVQKRLDKLEKRSLKAL  420
            ++ P++ NWDL+RDV+ RL+KLE+R+ +AL
Sbjct  81   MVAPRRANWDLKRDVEARLEKLERRTRRAL  110


 Score = 31.2 bits (69),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 13/42 (31%), Positives = 19/42 (45%), Gaps = 0/42 (0%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFD  266
            + A    +E     ++ FRNY+P+D  L   KL     P  D
Sbjct  13   RAADATSREGRATREIAFRNYVPRDGALAAAKLPATTAPALD  54



>ref|NP_001106902.1| coiled-coil domain containing 12 [Xenopus laevis]
 gb|AAI57392.1| LOC100037234 protein [Xenopus laevis]
Length=157

 Score = 45.1 bits (105),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 6/43 (14%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE  444
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE
Sbjct  99   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE  141


 Score = 26.6 bits (57),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 22/32 (69%), Gaps = 2/32 (6%)
 Frame = +3

Query  162  QENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            +E +++ ++K RNY PQD  L+E ++  A P+
Sbjct  41   EEQEQHRELKLRNYTPQDDVLKERQVPQAKPI  72



>ref|XP_009573010.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Fulmarus glacialis]
Length=134

 Score = 46.2 bits (108),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  76   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  125


 Score = 25.8 bits (55),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 10/28 (36%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKL  239
            D++E  ++ ++K RNY P+D+ L++ K+
Sbjct  16   DEEETVKHKELKLRNYEPEDEELKKRKV  43



>ref|XP_007126145.1| PREDICTED: coiled-coil domain-containing protein 12 [Physeter 
catodon]
Length=167

 Score = 44.7 bits (104),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 26.9 bits (58),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   + ++E +++ +++ RNY+P+D+ L++ ++  A PV
Sbjct  42   KQLREGEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPV  80



>ref|XP_002912813.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Ailuropoda melanoleuca]
 gb|EFB19184.1| hypothetical protein PANDA_000626 [Ailuropoda melanoleuca]
Length=166

 Score = 44.7 bits (104),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 26.9 bits (58),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 25/33 (76%), Gaps = 2/33 (6%)
 Frame = +3

Query  159  QQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            ++E++++ +++ RNY+P+D+ L+  ++  A PV
Sbjct  48   EEESEKHRELRLRNYVPEDEDLKRRRVPQAKPV  80



>gb|AAI29787.1| LOC100037234 protein [Xenopus laevis]
Length=156

 Score = 45.1 bits (105),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 6/43 (14%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE  444
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE
Sbjct  98   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE  140


 Score = 26.6 bits (57),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 22/32 (69%), Gaps = 2/32 (6%)
 Frame = +3

Query  162  QENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            +E +++ ++K RNY PQD  L+E ++  A P+
Sbjct  40   EEEEQHRELKLRNYTPQDDVLKERQVPQAKPI  71



>ref|XP_629550.1| mRNA splicing factor, Cwf18 family protein [Dictyostelium discoideum 
AX4]
 gb|EAL61127.1| mRNA splicing factor, Cwf18 family protein [Dictyostelium discoideum 
AX4]
Length=325

 Score = 41.6 bits (96),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
              PKK NWDL+RD  K+L KLEK++ KA++QL
Sbjct  266  FVPKKVNWDLKRDCSKKLLKLEKQTEKAIYQL  297


 Score = 30.0 bits (66),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 41/75 (55%), Gaps = 7/75 (9%)
 Frame = +3

Query  132  DDDKDASQDQQENDENFQ--MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMAN-LTPPQDK  302
            +D+K   +   EN++N    +KFRNY+P+D+   + ++   V+P    P+A  L      
Sbjct  200  NDEKKEIEMDNENEKNSHTGLKFRNYIPKDQTFLKYRIEKAVVP----PIAQELMSRLKV  255

Query  303  KEKNEDPFLNIAPKK  347
             E+N+D  ++  PKK
Sbjct  256  LEENQDIQISFVPKK  270



>ref|XP_005223150.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Bos taurus]
Length=270

 Score = 43.9 bits (102),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  209  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  240


 Score = 27.3 bits (59),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 11/41 (27%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = +3

Query  135  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            + K   + ++E +++ +++ RNY+P+D+ L++ ++  A PV
Sbjct  142  NTKQLREGEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPV  182



>gb|EPY89395.1| coiled-coil domain-containing protein 12-like protein [Camelus 
ferus]
Length=221

 Score = 44.3 bits (103),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  162  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  193


 Score = 26.9 bits (58),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 26/39 (67%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   + ++E +++ +++ RNY+P+D+ L+  ++  A PV
Sbjct  97   KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPV  135



>ref|XP_006173541.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Camelus ferus]
 ref|XP_006173542.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Camelus ferus]
 ref|XP_010958315.1| PREDICTED: coiled-coil domain-containing protein 12 [Camelus 
bactrianus]
 ref|XP_010995515.1| PREDICTED: coiled-coil domain-containing protein 12 [Camelus 
dromedarius]
 ref|XP_010995521.1| PREDICTED: coiled-coil domain-containing protein 12 [Camelus 
dromedarius]
 ref|XP_010995528.1| PREDICTED: coiled-coil domain-containing protein 12 [Camelus 
dromedarius]
Length=166

 Score = 44.7 bits (104),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 26.9 bits (58),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 26/39 (67%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   + ++E +++ +++ RNY+P+D+ L+  ++  A PV
Sbjct  42   KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPV  80



>ref|XP_001833092.1| hypothetical protein CC1G_01154 [Coprinopsis cinerea okayama7#130]
 gb|EAU88781.1| hypothetical protein CC1G_01154 [Coprinopsis cinerea okayama7#130]
Length=157

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 47/86 (55%), Gaps = 13/86 (15%)
 Frame = +1

Query  208  LKTSTFRRVNLPLQYYPSSMTLWQT*LHPKTK------------RRKMRIPS*ILPPKKP  351
            +KT  F  V+  L+ Y   + +  T +  K K            RR+  +    + PK+P
Sbjct  36   IKTRNFDPVSRTLKKYDGDVEMEDT-VEKKVKGLAEQIIAEDEARRQQELDIFNIAPKRP  94

Query  352  NWDLRRDVQKRLDKLEKRSLKALHQL  429
            NWDL+RD++K+L KLE+R+ +A+H L
Sbjct  95   NWDLKRDMEKKLAKLERRTQEAIHTL  120



>ref|XP_006928752.1| PREDICTED: coiled-coil domain-containing protein 12 [Felis catus]
 ref|XP_007088491.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Panthera tigris altaica]
Length=166

 Score = 44.7 bits (104),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 26.6 bits (57),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 26/39 (67%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   + ++E +++ +++ RNY+P+D+ L+  ++  A PV
Sbjct  42   KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPV  80



>ref|XP_006200792.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Vicugna pacos]
 ref|XP_006200793.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Vicugna pacos]
Length=166

 Score = 44.7 bits (104),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 26.9 bits (58),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 26/39 (67%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   + ++E +++ +++ RNY+P+D+ L+  ++  A PV
Sbjct  42   KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPV  80



>ref|XP_541901.2| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Canis lupus familiaris]
 ref|XP_006737340.1| PREDICTED: coiled-coil domain-containing protein 12 [Leptonychotes 
weddellii]
 ref|XP_008702082.1| PREDICTED: coiled-coil domain-containing protein 12 [Ursus maritimus]
Length=166

 Score = 44.7 bits (104),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 26.6 bits (57),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 26/39 (67%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   + ++E +++ +++ RNY+P+D+ L+  ++  A PV
Sbjct  42   KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPV  80



>ref|XP_004676293.1| PREDICTED: coiled-coil domain-containing protein 12 [Condylura 
cristata]
Length=166

 Score = 44.7 bits (104),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 26.6 bits (57),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 26/39 (67%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   + ++E +++ +++ RNY+P+D+ L+  ++  A PV
Sbjct  42   KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPV  80



>ref|XP_005669523.1| PREDICTED: coiled-coil domain-containing protein 12 [Sus scrofa]
Length=165

 Score = 44.7 bits (104),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 26.9 bits (58),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 26/39 (67%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   + ++E +++ +++ RNY+P+D+ L+  ++  A PV
Sbjct  42   KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPV  80



>ref|XP_005934857.1| PREDICTED: coiled-coil domain-containing protein 12-like isoform 
X2 [Haplochromis burtoni]
Length=163

 Score = 45.4 bits (106),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 37/53 (70%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLE+R+ +A+ +L      G EEE   LAE +G 
Sbjct  105  LAPRKPDWDLKRDVAKKLEKLERRTQRAIAELIRDRLRGHEEE---LAEAVGA  154


 Score = 26.2 bits (56),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 10/32 (31%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = +3

Query  135  DDKDASQDQQENDENFQMKFRNYLPQDKHLQE  230
            + K A+ ++   +++ ++K RNY P+D+ L+E
Sbjct  38   ESKKATLEEATQEKHRELKLRNYAPEDEELKE  69



>ref|XP_007470325.1| PREDICTED: coiled-coil domain-containing protein 12 [Lipotes 
vexillifer]
Length=172

 Score = 45.1 bits (105),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  112  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  143


 Score = 26.6 bits (57),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 10/39 (26%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   + ++E +++ +++ RNY+P+D+ L++ ++  A P+
Sbjct  47   KQLREGEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPI  85



>ref|XP_004283914.1| PREDICTED: coiled-coil domain-containing protein 12 [Orcinus 
orca]
Length=172

 Score = 45.1 bits (105),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  112  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  143


 Score = 26.6 bits (57),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 10/39 (26%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   + ++E +++ +++ RNY+P+D+ L++ ++  A P+
Sbjct  47   KQLREGEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPI  85



>ref|XP_007168907.1| PREDICTED: coiled-coil domain-containing protein 12 [Balaenoptera 
acutorostrata scammoni]
Length=172

 Score = 44.7 bits (104),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  112  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  143


 Score = 26.6 bits (57),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 26/39 (67%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   + ++E +++ +++ RNY+P+D+ L+  ++  A PV
Sbjct  47   KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPV  85



>ref|XP_007070347.1| PREDICTED: coiled-coil domain-containing protein 12-like [Chelonia 
mydas]
Length=139

 Score = 46.6 bits (109),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  81   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLRGQEEE---LASAVGS  130


 Score = 25.0 bits (53),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 8/19 (42%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +3

Query  183  QMKFRNYLPQDKHLQEGKL  239
            ++K RNY+P+D+ L++ K+
Sbjct  30   ELKLRNYIPEDEDLKKRKV  48



>ref|XP_004399222.1| PREDICTED: coiled-coil domain-containing protein 12 [Odobenus 
rosmarus divergens]
Length=166

 Score = 44.7 bits (104),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 26.6 bits (57),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 24/33 (73%), Gaps = 2/33 (6%)
 Frame = +3

Query  159  QQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            ++E +++ +++ RNY+P+D+ L+  ++  A PV
Sbjct  48   EEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPV  80



>ref|XP_006914932.1| PREDICTED: coiled-coil domain-containing protein 12 [Pteropus 
alecto]
Length=166

 Score = 44.7 bits (104),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 26.6 bits (57),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 24/33 (73%), Gaps = 2/33 (6%)
 Frame = +3

Query  159  QQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            ++E +++ +++ RNY+P+D+ L+  ++  A PV
Sbjct  48   EEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPV  80



>ref|XP_004614568.1| PREDICTED: coiled-coil domain-containing protein 12 [Sorex araneus]
Length=166

 Score = 44.3 bits (103),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 26.9 bits (58),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 25/33 (76%), Gaps = 2/33 (6%)
 Frame = +3

Query  159  QQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            ++E +++ +++ RNY+P+D+ L++ ++  A PV
Sbjct  48   EEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPV  80



>ref|XP_005512181.1| PREDICTED: coiled-coil domain-containing protein 12 [Columba 
livia]
Length=174

 Score = 44.3 bits (103),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  116  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  147


 Score = 26.9 bits (58),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 24/34 (71%), Gaps = 2/34 (6%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            D++E  ++ ++K RNY P+D+ L++ K+  A PV
Sbjct  56   DEEETVKHKELKLRNYEPEDEELKKRKMPKAKPV  89



>ref|XP_004419680.1| PREDICTED: coiled-coil domain-containing protein 12 [Ceratotherium 
simum simum]
Length=166

 Score = 44.7 bits (104),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 26.6 bits (57),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 26/39 (67%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   + ++E +++ +++ RNY+P+D+ L+  ++  A PV
Sbjct  42   KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPV  80



>gb|ELK24973.1| Coiled-coil domain-containing protein 12 [Myotis davidii]
Length=166

 Score = 44.7 bits (104),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 26.6 bits (57),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 26/39 (67%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   + ++E +++ +++ RNY+P+D+ L+  ++  A PV
Sbjct  42   KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPV  80



>ref|XP_005496692.1| PREDICTED: uncharacterized protein LOC102063747 [Zonotrichia 
albicollis]
Length=224

 Score = 44.3 bits (103),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  175  LAPRKPDWDLKRDVSKKLEKLEKRTQRAIAEL  206


 Score = 26.9 bits (58),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = +3

Query  171  DENFQMKFRNYLPQDKHLQEGKLAP  245
            ++  ++K RNY P+D+ L++ KL P
Sbjct  120  NQGMEIKLRNYDPEDEELKKRKLPP  144



>ref|XP_010133771.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Buceros rhinoceros silvestris]
Length=134

 Score = 45.1 bits (105),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 6/43 (14%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE  444
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE
Sbjct  76   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE  118


 Score = 26.2 bits (56),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 10/28 (36%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKL  239
            D++E  ++ ++K RNY P+D+ L++ K+
Sbjct  16   DEEETVKHRELKLRNYEPEDEELKKRKV  43



>ref|XP_005696078.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Capra hircus]
Length=168

 Score = 44.3 bits (103),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 26.9 bits (58),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   + ++E +++ +++ RNY+P+D+ L++ ++  A PV
Sbjct  42   KQLREGEEEGEKHRELRLRNYIPEDEDLKKRRVPQAKPV  80



>ref|XP_009812719.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Gavia stellata]
Length=134

 Score = 46.2 bits (108),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  76   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  125


 Score = 25.0 bits (53),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 10/28 (36%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKL  239
            D++E  ++ ++K RNY P+D+ L++ K+
Sbjct  16   DEEEAVKHKELKLRNYEPEDEELKKRKV  43



>ref|XP_009554414.1| PREDICTED: coiled-coil domain-containing protein 12 [Cuculus 
canorus]
Length=144

 Score = 45.1 bits (105),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 6/43 (14%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE  444
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE
Sbjct  86   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLRGQEEE  128


 Score = 25.8 bits (55),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 38/70 (54%), Gaps = 11/70 (16%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPM--ANLTPPQDKKEKNE  317
            D++E  ++ ++K RNY P+D+ L++ K+  A P  V  K  + +  A L P  D     E
Sbjct  26   DEEETVKHKELKLRNYEPEDEELKKRKVPQAKPASVEEKVKEQLEAAKLEPIID-----E  80

Query  318  DPFLNIAPKK  347
                N+AP+K
Sbjct  81   VDLTNLAPRK  90



>gb|KFO89314.1| Coiled-coil domain-containing protein 12, partial [Buceros rhinoceros 
silvestris]
Length=130

 Score = 45.1 bits (105),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 6/43 (14%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE  444
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE
Sbjct  77   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE  119


 Score = 26.2 bits (56),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 10/28 (36%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKL  239
            D++E  ++ ++K RNY P+D+ L++ K+
Sbjct  17   DEEETVKHRELKLRNYEPEDEELKKRKV  44



>ref|XP_009936630.1| PREDICTED: coiled-coil domain-containing protein 12 [Opisthocomus 
hoazin]
Length=148

 Score = 44.7 bits (104),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  90   LAPRKPDWDLKRDVSKKLEKLEKRTQRAIAEL  121


 Score = 26.6 bits (57),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 37/65 (57%), Gaps = 1/65 (2%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMAN-LTPPQDKKEKNEDPFLN  332
            D++E  ++ +++ RNY P+D+ L++ K+    L   +D + + L   + +   +E    N
Sbjct  30   DEEETVKHKELRLRNYEPEDEELKKRKVPQARLASVEDTVKDQLEAAKPEPIIDEVDLAN  89

Query  333  IAPKK  347
            +AP+K
Sbjct  90   LAPRK  94



>ref|XP_005804720.1| PREDICTED: coiled-coil domain-containing protein 12-like [Xiphophorus 
maculatus]
Length=177

 Score = 43.9 bits (102),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (68%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLE+R+ +A+ +L      G EEE   LA  +G 
Sbjct  119  LAPRKPDWDLKRDVAKKLEKLERRTQRAIAELIRDRLRGSEEE---LAAAVGA  168


 Score = 26.9 bits (58),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 13/40 (33%), Positives = 26/40 (65%), Gaps = 3/40 (8%)
 Frame = +3

Query  120  HETPDDD---KDASQDQQENDENFQMKFRNYLPQDKHLQE  230
            HE  D++   K A+ ++   +++ ++K RNY P+D+ L+E
Sbjct  44   HEQEDEEPESKKATLEETPEEKHRELKLRNYTPEDEELKE  83



>ref|XP_008154223.1| PREDICTED: coiled-coil domain-containing protein 12 [Eptesicus 
fuscus]
Length=166

 Score = 44.3 bits (103),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 26.6 bits (57),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 26/39 (67%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   + ++E +++ +++ RNY+P+D+ L+  ++  A PV
Sbjct  42   KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPV  80



>ref|XP_008321553.1| PREDICTED: coiled-coil domain-containing protein 12 [Cynoglossus 
semilaevis]
Length=163

 Score = 43.5 bits (101),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 32/43 (74%), Gaps = 6/43 (14%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE  444
            L P+KP+WDL+RDV K+L+KLE+R+ +A+ +L      G EEE
Sbjct  105  LAPRKPDWDLKRDVAKKLEKLERRTQRAIAELIRDRLRGSEEE  147


 Score = 27.3 bits (59),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 7/75 (9%)
 Frame = +3

Query  135  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDK  302
            + K AS ++     + ++K RNY P+D+ L+E ++  A P  V  K  D +  + P    
Sbjct  38   ESKKASLEEASEGRHRELKLRNYTPEDEELKERQVPKAKPASVEDKVKDQLEAVNPEPII  97

Query  303  KEKNEDPFLNIAPKK  347
            +E +     N+AP+K
Sbjct  98   EEVD---LANLAPRK  109



>ref|XP_005223151.2| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Bos taurus]
Length=169

 Score = 44.3 bits (103),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  108  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  139


 Score = 26.6 bits (57),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   + ++E +++ +++ RNY+P+D+ L++ ++  A PV
Sbjct  43   KQLREGEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPV  81



>ref|XP_010860802.1| PREDICTED: coiled-coil domain-containing protein 12 [Bison bison 
bison]
Length=178

 Score = 43.9 bits (102),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 26.9 bits (58),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   + ++E +++ +++ RNY+P+D+ L++ ++  A PV
Sbjct  42   KQLREGEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPV  80



>ref|NP_001069934.1| coiled-coil domain-containing protein 12 [Bos taurus]
 ref|XP_004018552.1| PREDICTED: coiled-coil domain-containing protein 12 [Ovis aries]
 ref|XP_005910803.1| PREDICTED: coiled-coil domain-containing protein 12 [Bos mutus]
 ref|XP_006065279.1| PREDICTED: coiled-coil domain-containing protein 12 [Bubalus 
bubalis]
 gb|AAI18454.1| Coiled-coil domain containing 12 [Bos taurus]
 tpg|DAA16848.1| TPA: coiled-coil domain containing 12 [Bos taurus]
 gb|ELR45268.1| Coiled-coil domain-containing protein 12 [Bos mutus]
Length=168

 Score = 44.3 bits (103),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 26.6 bits (57),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   + ++E +++ +++ RNY+P+D+ L++ ++  A PV
Sbjct  42   KQLREGEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPV  80



>gb|EMC81123.1| Coiled-coil domain-containing protein 12, partial [Columba livia]
Length=135

 Score = 43.9 bits (102),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  77   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  108


 Score = 26.9 bits (58),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 24/34 (71%), Gaps = 2/34 (6%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            D++E  ++ ++K RNY P+D+ L++ K+  A PV
Sbjct  17   DEEETVKHKELKLRNYEPEDEELKKRKMPKAKPV  50



>ref|XP_007509692.1| unknown protein [Bathycoccus prasinos]
 emb|CCO18807.1| unknown protein [Bathycoccus prasinos]
Length=143

 Score = 43.9 bits (102),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  343  KKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRR  453
            KK NWDL+RDV ++ +KLE+R+++A+ +L  EEE++R
Sbjct  105  KKQNWDLKRDVARKTEKLERRTIRAIAELAREEEEKR  141


 Score = 26.9 bits (58),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (52%), Gaps = 10/54 (19%)
 Frame = +3

Query  168  NDE--NFQMKFRNYLPQD-KHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNED  320
            NDE  N  +K RNY+P+D   L+   +   +LP       N   P+ K++K E+
Sbjct  43   NDEETNVTIKLRNYVPKDISALKSTSVGVQILP-------NAVAPEFKRKKEEE  89



>ref|XP_010755218.1| PREDICTED: coiled-coil domain-containing protein 12 [Larimichthys 
crocea]
Length=162

 Score = 43.1 bits (100),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLE+R+ +A+ +L
Sbjct  104  LAPRKPDWDLKRDVAKKLEKLERRTQRAIAEL  135


 Score = 27.7 bits (60),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 11/30 (37%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQE  230
            K AS ++  ++ + ++K RNY P+D+ L+E
Sbjct  39   KKASLEETSHERHRELKLRNYTPEDEELKE  68



>ref|XP_006129858.1| PREDICTED: coiled-coil domain-containing protein 12 [Pelodiscus 
sinensis]
Length=160

 Score = 45.8 bits (107),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  102  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLRGQEEE---LASAVGS  151


 Score = 24.6 bits (52),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 8/21 (38%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +3

Query  177  NFQMKFRNYLPQDKHLQEGKL  239
            + ++K RNY+P+D+ L++ K+
Sbjct  49   SRELKLRNYVPEDEELKKRKV  69



>ref|XP_006770487.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Myotis davidii]
Length=211

 Score = 44.3 bits (103),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  152  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  183


 Score = 26.6 bits (57),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 26/39 (67%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   + ++E +++ +++ RNY+P+D+ L+  ++  A PV
Sbjct  87   KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPV  125



>gb|EPB87798.1| hypothetical protein HMPREF1544_05458 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=159

 Score = 46.2 bits (108),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L PKKPNWDL+RDV+K+L++L++R+ +A++++
Sbjct  93   LAPKKPNWDLKRDVEKKLERLDRRTQRAIYEI  124


 Score = 24.6 bits (52),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 39/76 (51%), Gaps = 8/76 (11%)
 Frame = +3

Query  144  DASQDQQENDENFQ-MKFRNYLPQDKHLQEG-KLAPP------VLPKFDDPMANLTPPQD  299
            +A+Q+ + +DE  + +KFR+Y P D+ LQ+   +A P      +  +  D          
Sbjct  22   NAAQNDRTSDEAEKALKFRSYTPNDEKLQQHVDIAKPTDIGNTLETETKDFTKEALAQAA  81

Query  300  KKEKNEDPFLNIAPKK  347
            +K+K E    N+APKK
Sbjct  82   EKQKEEVDLFNLAPKK  97



>ref|XP_005428072.1| PREDICTED: coiled-coil domain-containing protein 12 [Geospiza 
fortis]
Length=138

 Score = 44.3 bits (103),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  80   LAPRKPDWDLKRDVSKKLEKLEKRTQRAIAEL  111


 Score = 26.6 bits (57),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 24/34 (71%), Gaps = 1/34 (3%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLP  257
            +++E  ++ ++K RNY P+D+ L++ KL PP  P
Sbjct  20   EEEEPVKHREIKLRNYDPEDEELKKRKL-PPAKP  52



>ref|XP_006277376.1| PREDICTED: coiled-coil domain-containing protein 12 [Alligator 
mississippiensis]
Length=177

 Score = 44.3 bits (103),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  119  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  150


 Score = 26.6 bits (57),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 14/43 (33%), Positives = 27/43 (63%), Gaps = 5/43 (12%)
 Frame = +3

Query  126  TPDDDKDASQDQQENDE-----NFQMKFRNYLPQDKHLQEGKL  239
            T D  + AS+  +E+DE     + +++ RNY P+D+ L++ K+
Sbjct  44   TKDSGEPASKQLREDDEESAVKHMELRLRNYNPEDEELKKRKV  86



>ref|XP_005867263.1| PREDICTED: coiled-coil domain-containing protein 12 [Myotis brandtii]
Length=211

 Score = 44.3 bits (103),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  152  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  183


 Score = 26.6 bits (57),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 26/39 (67%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   + ++E +++ +++ RNY+P+D+ L+  ++  A PV
Sbjct  87   KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPV  125



>gb|ACI66996.1| Coiled-coil domain-containing protein 12 [Salmo salar]
 gb|ACI68802.1| Coiled-coil domain-containing protein 12 [Salmo salar]
 gb|ACI69732.1| Coiled-coil domain-containing protein 12 [Salmo salar]
Length=165

 Score = 45.1 bits (105),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 6/43 (14%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE  444
            L P+KP+WDL+RDV K+L+KLE+R+ KA+ +L      G EEE
Sbjct  106  LAPRKPDWDLKRDVAKKLEKLERRTQKAIAELIRDRLKGSEEE  148


 Score = 25.8 bits (55),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/77 (30%), Positives = 42/77 (55%), Gaps = 7/77 (9%)
 Frame = +3

Query  129  PDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQ  296
            PD  +D ++++ E + + ++K RNY P+D+ L+E ++  A P  V  K  D +    P  
Sbjct  37   PDRKRDRAEEEAEEERHRELKLRNYTPEDEELKERQVPKAKPASVEEKVKDQLDAAKPES  96

Query  297  DKKEKNEDPFLNIAPKK  347
              +E +     N+AP+K
Sbjct  97   VIEEVD---LANLAPRK  110



>ref|XP_010281762.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Phaethon lepturus]
Length=219

 Score = 47.0 bits (110),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  161  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  210


 Score = 23.9 bits (50),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 8/19 (42%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +3

Query  183  QMKFRNYLPQDKHLQEGKL  239
            ++K RNY P+D+ L++ K+
Sbjct  110  ELKLRNYEPEDEELKKRKV  128



>ref|NP_001134087.1| Coiled-coil domain-containing protein 12 [Salmo salar]
 gb|ACI66188.1| Coiled-coil domain-containing protein 12 [Salmo salar]
Length=165

 Score = 45.1 bits (105),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 6/43 (14%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE  444
            L P+KP+WDL+RDV K+L+KLE+R+ KA+ +L      G EEE
Sbjct  106  LAPRKPDWDLKRDVAKKLEKLERRTQKAIAELIRDRLKGSEEE  148


 Score = 25.8 bits (55),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/77 (30%), Positives = 42/77 (55%), Gaps = 7/77 (9%)
 Frame = +3

Query  129  PDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQ  296
            PD  +D ++++ E + + ++K RNY P+D+ L+E ++  A P  V  K  D +    P  
Sbjct  37   PDRKRDRAEEEAEEERHRELKLRNYTPEDEELKERQVPKAKPASVEEKVKDQLDAAKPES  96

Query  297  DKKEKNEDPFLNIAPKK  347
              +E +     N+AP+K
Sbjct  97   VIEEVD---LANLAPRK  110



>ref|XP_011221225.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Ailuropoda melanoleuca]
Length=212

 Score = 43.1 bits (100),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  153  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  184


 Score = 27.3 bits (59),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   + ++E++++ +++ RNY+P+D+ L+  ++  A PV
Sbjct  88   KQLREGEEESEKHRELRLRNYVPEDEDLKRRRVPQAKPV  126



>gb|ACI66181.1| Coiled-coil domain-containing protein 12 [Salmo salar]
Length=165

 Score = 45.1 bits (105),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 6/43 (14%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE  444
            L P+KP+WDL+RDV K+L+KLE+R+ KA+ +L      G EEE
Sbjct  106  LAPRKPDWDLKRDVAKKLEKLERRTQKAIAELIRDRLKGSEEE  148


 Score = 25.8 bits (55),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/77 (30%), Positives = 42/77 (55%), Gaps = 7/77 (9%)
 Frame = +3

Query  129  PDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQ  296
            PD  +D ++++ E + + ++K RNY P+D+ L+E ++  A P  V  K  D +    P  
Sbjct  37   PDRKRDRAEEEAEEERHRELKLRNYTPEDEELKERQVPKAKPASVEEKVKDQLDAAKPGS  96

Query  297  DKKEKNEDPFLNIAPKK  347
              +E +     N+AP+K
Sbjct  97   VIEEVD---LANLAPRK  110



>ref|XP_005955215.1| PREDICTED: coiled-coil domain-containing protein 12 [Pantholops 
hodgsonii]
Length=168

 Score = 44.3 bits (103),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 26.2 bits (56),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 25/33 (76%), Gaps = 2/33 (6%)
 Frame = +3

Query  159  QQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            ++E +++ +++ RNY+P+D+ L++ ++  A PV
Sbjct  48   EEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPV  80



>gb|ELK10175.1| Coiled-coil domain-containing protein 12 [Pteropus alecto]
Length=148

 Score = 44.3 bits (103),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  89   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  120


 Score = 26.6 bits (57),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 24/33 (73%), Gaps = 2/33 (6%)
 Frame = +3

Query  159  QQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            ++E +++ +++ RNY+P+D+ L+  ++  A PV
Sbjct  30   EEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPV  62



>ref|XP_007088492.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Panthera tigris altaica]
Length=138

 Score = 44.3 bits (103),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  79   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  110


 Score = 26.6 bits (57),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 24/33 (73%), Gaps = 2/33 (6%)
 Frame = +3

Query  159  QQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            ++E +++ +++ RNY+P+D+ L+  ++  A PV
Sbjct  20   EEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPV  52



>gb|EIE85714.1| hypothetical protein RO3G_10424 [Rhizopus delemar RA 99-880]
Length=156

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L PKKPNWDL+RDV+K+L +L+KR+ KA++++
Sbjct  94   LAPKKPNWDLKRDVEKKLQRLDKRTQKAIYEI  125



>ref|XP_010882732.1| PREDICTED: coiled-coil domain-containing protein 12 [Esox lucius]
Length=165

 Score = 46.2 bits (108),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 6/55 (11%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGTNS  480
            L P+KP+WDL+RDV K+L+KLE+R+ KA+ +L      G EEE   +   +G ++
Sbjct  106  LAPRKPDWDLKRDVAKKLEKLERRTQKAIAELIRDRLKGSEEELAGVVGAIGVSA  160


 Score = 24.6 bits (52),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +3

Query  129  PDDDKDASQDQQENDENFQMKFRNYLPQDKHLQ  227
            PD  KD ++++ E + + ++K RNY P+D+ L+
Sbjct  37   PDCKKDRAEEEAEEERHRELKLRNYTPEDEELR  69



>ref|XP_004077894.1| PREDICTED: coiled-coil domain-containing protein 12 [Oryzias 
latipes]
Length=163

 Score = 43.5 bits (101),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 32/43 (74%), Gaps = 6/43 (14%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE  444
            L P+KP+WDL+RDV K+L+KLE+R+ +A+ +L      G EEE
Sbjct  105  LAPRKPDWDLKRDVAKKLEKLERRTQRAIAELIRDRLRGSEEE  147


 Score = 26.9 bits (58),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 24/39 (62%), Gaps = 3/39 (8%)
 Frame = +3

Query  120  HETPD---DDKDASQDQQENDENFQMKFRNYLPQDKHLQ  227
            HE  D   ++K A+ ++   D++ ++K RNY P+D  L+
Sbjct  30   HEQEDGEPENKKAALEETAEDKHRELKLRNYTPEDDELK  68



>ref|XP_007436316.1| PREDICTED: coiled-coil domain-containing protein 12 [Python bivittatus]
Length=167

 Score = 44.3 bits (103),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  109  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  140


 Score = 26.2 bits (56),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
 Frame = +3

Query  183  QMKFRNYLPQDKHLQEGKLAPPVLP  257
            ++K RNY+P+D+ L+E ++ P   P
Sbjct  58   ELKLRNYVPEDEELKE-RVVPKAKP  81



>gb|EPQ08394.1| Coiled-coil domain-containing protein 12 [Myotis brandtii]
Length=166

 Score = 43.5 bits (101),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 26.6 bits (57),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 26/39 (67%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   + ++E +++ +++ RNY+P+D+ L+  ++  A PV
Sbjct  42   KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPV  80



>ref|XP_005229622.1| PREDICTED: coiled-coil domain-containing protein 12 [Falco peregrinus]
 ref|XP_005442463.1| PREDICTED: coiled-coil domain-containing protein 12 [Falco cherrug]
Length=137

 Score = 44.7 bits (104),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EE+   LA  +G+
Sbjct  79   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEED---LASAVGS  128


 Score = 25.8 bits (55),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 10/28 (36%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKL  239
            D++E  ++ ++K RNY P+D+ L++ K+
Sbjct  19   DEEETVKHKELKLRNYEPEDEELKKRKV  46



>ref|XP_010816234.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X3 
[Bos taurus]
Length=164

 Score = 43.9 bits (102),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  103  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  134


 Score = 26.2 bits (56),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   + ++E +++ +++ RNY+P+D+ L++ ++  A PV
Sbjct  38   KQLREGEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPV  76



>ref|XP_008490404.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Calypte anna]
Length=134

 Score = 45.8 bits (107),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  76   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  125


 Score = 24.6 bits (52),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 10/28 (36%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKL  239
            D++E  ++ ++K RNY P+D+ L++ K+
Sbjct  16   DEEEPIKHKELKLRNYEPEDEELKKRKV  43



>gb|KFD48500.1| hypothetical protein M513_10634 [Trichuris suis]
Length=163

 Score = 44.3 bits (103),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L PKK +WDL+RD QK+LDKLE+R+ KA+ +L
Sbjct  99   LAPKKVDWDLKRDAQKKLDKLERRTQKAIIEL  130


 Score = 26.2 bits (56),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/83 (29%), Positives = 36/83 (43%), Gaps = 7/83 (8%)
 Frame = +3

Query  120  HETPDDDKDASQDQQENDE------NFQMKFRNYLPQDKHLQEGKL-APPVLPKFDDPMA  278
            H+  + D   SQ  +++ E      N  +KFRNY P D  L    +   P L   D+   
Sbjct  21   HQNDNTDSAESQTAKDDSERSNAVSNAVLKFRNYKPLDSELARFSVDLSPALDIADELRE  80

Query  279  NLTPPQDKKEKNEDPFLNIAPKK  347
             L   +  +E  E    ++APKK
Sbjct  81   VLEEAKKFQEVEEIDLASLAPKK  103



>ref|XP_005696079.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Capra hircus]
Length=143

 Score = 43.9 bits (102),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  82   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  113


 Score = 26.6 bits (57),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   + ++E +++ +++ RNY+P+D+ L++ ++  A PV
Sbjct  17   KQLREGEEEGEKHRELRLRNYIPEDEDLKKRRVPQAKPV  55



>ref|XP_009084497.1| PREDICTED: coiled-coil domain-containing protein 12 [Serinus 
canaria]
Length=167

 Score = 43.9 bits (102),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  109  LAPRKPDWDLKRDVSKKLEKLEKRTQRAIAEL  140


 Score = 26.2 bits (56),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 24/34 (71%), Gaps = 1/34 (3%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLP  257
            +++E  ++ ++K RNY P+D+ L++ KL PP  P
Sbjct  49   EEEEPVKHREIKLRNYDPEDEELKKRKL-PPAKP  81



>ref|XP_005075048.1| PREDICTED: coiled-coil domain-containing protein 12 [Mesocricetus 
auratus]
Length=166

 Score = 44.7 bits (104),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 25.4 bits (54),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 26/39 (67%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   ++++E+ ++  ++ RNY+P+D+ L+  ++  A PV
Sbjct  42   KQLREEEEEDGKHRGLRLRNYVPEDEDLKRRRVPQAKPV  80



>ref|XP_008430786.1| PREDICTED: coiled-coil domain-containing protein 12 [Poecilia 
reticulata]
Length=202

 Score = 44.3 bits (103),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (68%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLE+R+ +A+ +L      G EEE   LA  +G 
Sbjct  144  LAPRKPDWDLKRDVAKKLEKLERRTQRAIAELIRDRLRGSEEE---LAAAVGA  193


 Score = 25.8 bits (55),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 42/79 (53%), Gaps = 8/79 (10%)
 Frame = +3

Query  123  ETPDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTP  290
            E P+  K A ++  E +++ ++K RNY P+D+ L+E ++  A P  V  K  D +    P
Sbjct  74   EEPESKKAALEETLE-EKHRELKLRNYTPEDEELKERQVPKAKPASVEDKVKDQLEAANP  132

Query  291  PQDKKEKNEDPFLNIAPKK  347
                +E +     N+AP+K
Sbjct  133  EPIIEEVD---LANLAPRK  148



>ref|XP_005348055.1| PREDICTED: coiled-coil domain-containing protein 12 [Microtus 
ochrogaster]
Length=166

 Score = 44.7 bits (104),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 25.4 bits (54),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 26/39 (67%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   ++++E+ ++  ++ RNY+P+D+ L+  ++  A PV
Sbjct  42   KQLREEEEEDGKHRGLRLRNYVPEDEDLKRRRVPQAKPV  80



>ref|NP_001006353.1| coiled-coil domain-containing protein 12 [Gallus gallus]
 emb|CAG31909.1| hypothetical protein RCJMB04_13h18 [Gallus gallus]
Length=175

 Score = 45.4 bits (106),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+++KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  117  LAPRKPDWDLKRDVAKKMEKLEKRTQRAIAELIRERLKGQEEE---LAAAVGS  166


 Score = 24.6 bits (52),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 22/34 (65%), Gaps = 1/34 (3%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLP  257
            +++E   + ++  RNY P+D+ L++ KL PP  P
Sbjct  57   EEEETVRHRELILRNYDPEDEELKKRKL-PPAKP  89



>gb|KFP61285.1| Coiled-coil domain-containing protein 12, partial [Cariama cristata]
 gb|KFV12292.1| Coiled-coil domain-containing protein 12, partial [Tauraco erythrolophus]
Length=111

 Score = 46.2 bits (108),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  53   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  102


 Score = 23.9 bits (50),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 8/19 (42%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +3

Query  183  QMKFRNYLPQDKHLQEGKL  239
            ++K RNY P+D+ L++ K+
Sbjct  2    ELKLRNYEPEDEELKKRKV  20



>gb|KFM08706.1| Coiled-coil domain-containing protein 12, partial [Aptenodytes 
forsteri]
 gb|KFP17041.1| Coiled-coil domain-containing protein 12, partial [Egretta garzetta]
 gb|KFP54079.1| Coiled-coil domain-containing protein 12, partial [Cathartes 
aura]
 gb|KFQ64380.1| Coiled-coil domain-containing protein 12, partial [Pelecanus 
crispus]
 gb|KFQ71939.1| Coiled-coil domain-containing protein 12, partial [Phaethon lepturus]
 gb|KFQ77282.1| Coiled-coil domain-containing protein 12, partial [Phoenicopterus 
ruber ruber]
 gb|KFV55386.1| Coiled-coil domain-containing protein 12, partial [Gavia stellata]
 gb|KFW73643.1| Coiled-coil domain-containing protein 12, partial [Pygoscelis 
adeliae]
Length=111

 Score = 46.2 bits (108),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  53   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  102


 Score = 23.9 bits (50),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 8/19 (42%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +3

Query  183  QMKFRNYLPQDKHLQEGKL  239
            ++K RNY P+D+ L++ K+
Sbjct  2    ELKLRNYEPEDEELKKRKV  20



>gb|KFO12662.1| Coiled-coil domain-containing protein 12, partial [Balearica 
regulorum gibbericeps]
Length=111

 Score = 46.2 bits (108),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  53   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  102


 Score = 23.9 bits (50),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 8/19 (42%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +3

Query  183  QMKFRNYLPQDKHLQEGKL  239
            ++K RNY P+D+ L++ K+
Sbjct  2    ELKLRNYEPEDEELKKRKV  20



>gb|KGL89593.1| Coiled-coil domain-containing protein 12, partial [Charadrius 
vociferus]
Length=111

 Score = 46.2 bits (108),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  53   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  102


 Score = 23.9 bits (50),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 13/40 (33%), Positives = 21/40 (53%), Gaps = 10/40 (25%)
 Frame = +3

Query  183  QMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDK  302
            ++K RNY P+D+ L++ K+          P A   P +DK
Sbjct  2    ELKLRNYEPEDEELKKRKV----------PQAKPAPVEDK  31



>ref|XP_006770486.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Myotis davidii]
Length=260

 Score = 43.5 bits (101),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  201  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  232


 Score = 26.2 bits (56),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 26/39 (67%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   + ++E +++ +++ RNY+P+D+ L+  ++  A PV
Sbjct  136  KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPV  174



>ref|XP_003504302.1| PREDICTED: coiled-coil domain-containing protein 12 [Cricetulus 
griseus]
 gb|EGV92162.1| Coiled-coil domain-containing protein 12 [Cricetulus griseus]
Length=166

 Score = 44.7 bits (104),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 25.4 bits (54),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 26/39 (67%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   ++++E+ ++  ++ RNY+P+D+ L+  ++  A PV
Sbjct  42   KQLREEEEEDGKHRGLRLRNYVPEDEDLKRRRVPQAKPV  80



>ref|XP_009487206.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Pelecanus crispus]
 ref|XP_009869852.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Apaloderma vittatum]
Length=110

 Score = 46.2 bits (108),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  52   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  101


 Score = 23.9 bits (50),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 8/19 (42%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +3

Query  183  QMKFRNYLPQDKHLQEGKL  239
            ++K RNY P+D+ L++ K+
Sbjct  1    ELKLRNYEPEDEELKKRKV  19



>gb|EOA98534.1| Coiled-coil domain-containing protein 12 [Anas platyrhynchos]
Length=157

 Score = 45.1 bits (105),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KL+KR+ +A+ +L      G+EEE   LA  +G+
Sbjct  99   LAPRKPDWDLKRDVAKKLEKLDKRTQRAIAELIRERLKGQEEE---LASAVGS  148


 Score = 25.0 bits (53),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
 Frame = +3

Query  183  QMKFRNYLPQDKHLQEGKLAPPVLP  257
            ++K RNY P+D+ L++ K+ PP  P
Sbjct  48   EIKLRNYDPEDEELKKRKV-PPAKP  71



>ref|XP_001697076.1| hypothetical protein CHLREDRAFT_184951 [Chlamydomonas reinhardtii]
 gb|EDP00768.1| hypothetical protein CHLREDRAFT_184951 [Chlamydomonas reinhardtii]
Length=134

 Score = 42.0 bits (97),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKAL  420
            + PKK NWDL+RDVQ +LDKLE+R+ +A+
Sbjct  86   IAPKKANWDLKRDVQPKLDKLERRTQRAM  114


 Score = 28.1 bits (61),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 4/55 (7%)
 Frame = +3

Query  186  MKFRNYLPQD-KHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            +KFRNY  QD K +   ++     PKF+ P  + T P+D  +  E+  +NIAPKK
Sbjct  39   LKFRNYAVQDTKRIDYEQVEAAQPPKFEAPKVD-TKPEDLPQ--EELLVNIAPKK  90



>gb|EHJ70025.1| coiled-coil domain containing 12-like protein [Danaus plexippus]
Length=153

 Score = 43.9 bits (102),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLE+R+ KA+ +L
Sbjct  94   LAPRKPDWDLKRDVAKKLEKLERRTQKAIAEL  125


 Score = 26.2 bits (56),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 11/17 (65%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +3

Query  189  KFRNYLPQDKHLQEGKL  239
            KFR+Y PQD++LQ+ KL
Sbjct  45   KFRSYKPQDENLQKEKL  61



>ref|XP_010710593.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Meleagris gallopavo]
Length=166

 Score = 45.4 bits (106),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+++KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  108  LAPRKPDWDLKRDVAKKMEKLEKRTQRAIAELIRERLKGQEEE---LAAAVGS  157


 Score = 24.3 bits (51),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 16/56 (29%), Positives = 30/56 (54%), Gaps = 1/56 (2%)
 Frame = +3

Query  183  QMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMAN-LTPPQDKKEKNEDPFLNIAPKK  347
            ++  RNY P+D+ L++ KL P      +D + + L   + +   +E    N+AP+K
Sbjct  57   EIILRNYDPEDEELKKRKLPPAKPASVEDKVKDQLEAAKPETIIDEVDLTNLAPRK  112



>ref|XP_009979166.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Tauraco erythrolophus]
Length=176

 Score = 46.6 bits (109),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  118  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  167


 Score = 23.5 bits (49),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 8/19 (42%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +3

Query  183  QMKFRNYLPQDKHLQEGKL  239
            ++K RNY P+D+ L++ K+
Sbjct  67   ELKLRNYEPEDEELKKRKV  85



>ref|XP_003762982.1| PREDICTED: coiled-coil domain-containing protein 12-like [Sarcophilus 
harrisii]
Length=160

 Score = 43.9 bits (102),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  106  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  137


 Score = 25.8 bits (55),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 8/29 (28%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  153  QDQQENDENFQMKFRNYLPQDKHLQEGKL  239
            ++++  +++ ++K RNY+P+D+ L++ K+
Sbjct  45   KEEEGGEKHRELKLRNYVPEDEELKKRKV  73



>ref|XP_010304384.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Balearica regulorum gibbericeps]
Length=134

 Score = 46.2 bits (108),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  76   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  125


 Score = 23.5 bits (49),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 8/19 (42%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +3

Query  183  QMKFRNYLPQDKHLQEGKL  239
            ++K RNY P+D+ L++ K+
Sbjct  25   ELKLRNYEPEDEELKKRKV  43



>dbj|GAM18895.1| hypothetical protein SAMD00019534_020700 [Acytostelium subglobosum 
LB1]
Length=381

 Score = 45.4 bits (106),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+K NWDL+RDV+K+L+KLEKR+ +A+++L
Sbjct  324  LMPRKANWDLKRDVEKKLNKLEKRTNRAIYEL  355


 Score = 23.9 bits (50),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 11/30 (37%), Positives = 18/30 (60%), Gaps = 4/30 (13%)
 Frame = +3

Query  186  MKFRNYLPQDKHLQEGKL----APPVLPKF  263
            +KFRNY P++  L + +L     PPV+ + 
Sbjct  275  LKFRNYAPREATLVKYRLPKSKVPPVVEEI  304



>ref|XP_007534029.1| PREDICTED: coiled-coil domain-containing protein 12 [Erinaceus 
europaeus]
Length=166

 Score = 44.7 bits (104),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 25.0 bits (53),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 24/39 (62%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   + ++E  +  +++ RNY+P+D+ L+  ++  A PV
Sbjct  42   KQLREGEEEGSQPRELRLRNYVPEDEDLKRRRVPQAKPV  80



>ref|XP_006801430.1| PREDICTED: coiled-coil domain-containing protein 12-like [Neolamprologus 
brichardi]
Length=163

 Score = 43.5 bits (101),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLE+R+ +A+ +L
Sbjct  105  LAPRKPDWDLKRDVAKKLEKLERRTQRAIAEL  136


 Score = 26.2 bits (56),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 10/32 (31%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = +3

Query  135  DDKDASQDQQENDENFQMKFRNYLPQDKHLQE  230
            + K A+ ++   +++ ++K RNY P+D+ L+E
Sbjct  38   ESKKATLEEATQEKHRELKLRNYAPEDEELKE  69



>ref|XP_003454446.1| PREDICTED: coiled-coil domain-containing protein 12-like [Oreochromis 
niloticus]
 ref|XP_004541492.1| PREDICTED: coiled-coil domain-containing protein 12-like [Maylandia 
zebra]
 ref|XP_005738568.1| PREDICTED: coiled-coil domain-containing protein 12-like [Pundamilia 
nyererei]
Length=163

 Score = 43.5 bits (101),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 32/43 (74%), Gaps = 6/43 (14%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE  444
            L P+KP+WDL+RDV K+L+KLE+R+ +A+ +L      G EEE
Sbjct  105  LAPRKPDWDLKRDVAKKLEKLERRTQRAIAELIRDRLRGHEEE  147


 Score = 26.2 bits (56),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 10/32 (31%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = +3

Query  135  DDKDASQDQQENDENFQMKFRNYLPQDKHLQE  230
            + K A+ ++   +++ ++K RNY P+D+ L+E
Sbjct  38   ESKKATLEEATQEKHRELKLRNYAPEDEELKE  69



>ref|XP_002109500.1| hypothetical protein TRIADDRAFT_53602 [Trichoplax adhaerens]
 gb|EDV27666.1| hypothetical protein TRIADDRAFT_53602 [Trichoplax adhaerens]
Length=162

 Score = 36.2 bits (82),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 31/56 (55%), Gaps = 1/56 (2%)
 Frame = +3

Query  183  QMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDP-FLNIAPKK  347
            ++KFRNYLPQD  L++ K+  P  P   + +  +    +   K E    +N+AP+K
Sbjct  52   RVKFRNYLPQDDSLKDQKMEKPSAPTAQEDVEEILSSTNANTKYEGVDLVNLAPRK  107


 Score = 33.1 bits (74),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKAL  420
            L P+KP+WDL+R ++ ++ KLE+++ +++
Sbjct  103  LAPRKPDWDLKRTIEDKMQKLERKTQRSI  131



>dbj|GAN07616.1| coiled-coil domain-containing protein 12 [Mucor ambiguus]
Length=159

 Score = 44.7 bits (104),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L PKKPNWDL+RDV+K+L++L++++ +A++++
Sbjct  93   LAPKKPNWDLKRDVEKKLERLDRKTQRAIYEI  124


 Score = 24.6 bits (52),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 7/61 (11%)
 Frame = +3

Query  186  MKFRNYLPQDKHLQEG-KLAPP------VLPKFDDPMANLTPPQDKKEKNEDPFLNIAPK  344
            +KFR+Y P D+ LQ+  ++A P      +  +  D          +K+K E    N+APK
Sbjct  37   LKFRSYTPNDEKLQQHVEIAQPTDIGNTLETETKDFTKEALAQAAEKQKEEVDLFNLAPK  96

Query  345  K  347
            K
Sbjct  97   K  97



>ref|XP_008970042.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X3 
[Pan paniscus]
Length=179

 Score = 42.7 bits (99),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KL+KR+ +A+ +L
Sbjct  120  LAPRKPDWDLKRDVAKKLEKLKKRTQRAIAEL  151


 Score = 26.6 bits (57),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 10/35 (29%), Positives = 26/35 (74%), Gaps = 2/35 (6%)
 Frame = +3

Query  153  QDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            +++ E +++ +++ RNY+P+D+ L++ ++  A PV
Sbjct  59   EEEGEGEKHRELRLRNYVPEDEDLKKRRVPQAKPV  93



>ref|XP_009906078.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Picoides pubescens]
Length=146

 Score = 45.1 bits (105),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 6/43 (14%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE  444
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE
Sbjct  88   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE  130


 Score = 24.6 bits (52),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 11/37 (30%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +3

Query  129  PDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL  239
            P+  K    +++E+ ++ ++K RNY P+D+ L++ K+
Sbjct  19   PESKKLREDEEEESIKHKEIKLRNYDPEDEELKKRKV  55



>emb|CDJ44745.1| hypothetical protein, conserved [Eimeria tenella]
Length=162

 Score = 39.7 bits (91),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = +1

Query  340  PKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEE-EKRRLAEDLGTN  477
            P++PNWDL+RDV++++  L +R+ KA+ QL  E+ E+ + A++L + 
Sbjct  71   PRRPNWDLKRDVERKITILSRRTDKAIVQLIREKIEQNKKAKELAST  117


 Score = 30.0 bits (66),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 29/55 (53%), Gaps = 0/55 (0%)
 Frame = +3

Query  183  QMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            +++FRNY+P+D  L++  L  P + + +  +A       +  K ED    + P++
Sbjct  19   EIRFRNYVPKDPKLRQFCLPRPSVEELEKQIAKEAQEAVQAAKEEDILSQVVPRR  73



>ref|XP_009945692.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Leptosomus discolor]
Length=98

 Score = 45.1 bits (105),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 6/43 (14%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE  444
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE
Sbjct  52   LAPRKPDWDLKRDVSKKLEKLEKRTQRAIAELIRERLKGQEEE  94


 Score = 24.3 bits (51),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 11/61 (18%)
 Frame = +3

Query  183  QMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPM--ANLTPPQDKKEKNEDPFLNIAPK  344
            ++K RNY P+D+ L++ K+  A P  V  K  D +  A L P  D     E    N+AP+
Sbjct  1    ELKLRNYEPEDEELKKRKVPQAKPASVEDKVKDQLEAAKLEPIID-----EVDLANLAPR  55

Query  345  K  347
            K
Sbjct  56   K  56



>ref|XP_005934856.1| PREDICTED: coiled-coil domain-containing protein 12-like isoform 
X1 [Haplochromis burtoni]
Length=167

 Score = 42.7 bits (99),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLE+R+ +A+ +L
Sbjct  105  LAPRKPDWDLKRDVAKKLEKLERRTQRAIAEL  136


 Score = 26.6 bits (57),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 10/35 (29%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +3

Query  135  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL  239
            + K A+ ++   +++ ++K RNY P+D+ L+E ++
Sbjct  38   ESKKATLEEATQEKHRELKLRNYAPEDEELKERQV  72



>ref|XP_008283900.1| PREDICTED: coiled-coil domain-containing protein 12 [Stegastes 
partitus]
Length=191

 Score = 43.5 bits (101),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 32/43 (74%), Gaps = 6/43 (14%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE  444
            L P+KP+WDL+RDV K+L+KLE+R+ +A+ +L      G EEE
Sbjct  133  LAPRKPDWDLKRDVAKKLEKLERRTQRAIAELIRDRLRGSEEE  175


 Score = 25.8 bits (55),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 7/75 (9%)
 Frame = +3

Query  135  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDK  302
            ++K A+ ++    ++ ++K RNY P+D+ L+E ++  A P  V  K  D +    P    
Sbjct  66   ENKKATLEETTEQKHRELKLRNYTPEDEELKERQVPKAKPASVEDKVKDQLEAANPEPII  125

Query  303  KEKNEDPFLNIAPKK  347
            +E +     N+AP+K
Sbjct  126  EEVD---LANLAPRK  137



>ref|XP_010083497.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Pterocles gutturalis]
Length=110

 Score = 46.2 bits (108),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  52   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  101


 Score = 23.5 bits (49),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 8/19 (42%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +3

Query  183  QMKFRNYLPQDKHLQEGKL  239
            ++K RNY P+D+ L++ K+
Sbjct  1    ELKLRNYDPEDEELKKRKV  19



>ref|XP_007632918.1| PREDICTED: coiled-coil domain-containing protein 12 [Cricetulus 
griseus]
Length=166

 Score = 44.3 bits (103),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138


 Score = 25.0 bits (53),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 26/39 (67%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   ++++E+ ++  ++ RNY+P+D+ L+  ++  A PV
Sbjct  42   KQLREEEEEDGKHRGLRLRNYVPEDEDLKRRRVPQAKPV  80



>ref|XP_009926464.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Haliaeetus albicilla]
 ref|XP_010560164.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Haliaeetus leucocephalus]
Length=163

 Score = 43.1 bits (100),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  77   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  108


 Score = 26.2 bits (56),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 10/28 (36%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  156  DQQENDENFQMKFRNYLPQDKHLQEGKL  239
            D++E  ++ ++K RNY P+D+ L++ K+
Sbjct  17   DEEETVKHKELKLRNYEPEDEELKKRKV  44



>ref|XP_009015858.1| hypothetical protein HELRODRAFT_160665 [Helobdella robusta]
 gb|ESO06490.1| hypothetical protein HELRODRAFT_160665 [Helobdella robusta]
Length=152

 Score = 42.7 bits (99),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLE+R+ +A+ +L
Sbjct  98   LAPRKPDWDLKRDVAKKLEKLERRTQRAMGEL  129


 Score = 26.2 bits (56),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 27/53 (51%), Gaps = 1/53 (2%)
 Frame = +3

Query  192  FRNYLPQDKHLQEGKLAPPVLPKFDDPMAN-LTPPQDKKEKNEDPFLNIAPKK  347
            FR+Y P D+ L+EG L P    +  + + + L   Q      E   LN+AP+K
Sbjct  50   FRSYQPTDEKLKEGVLEPAKPLEIKEQVKDQLIDAQQTNIVEEVDLLNLAPRK  102



>ref|XP_009682438.1| PREDICTED: coiled-coil domain-containing protein 12 [Struthio 
camelus australis]
Length=190

 Score = 46.2 bits (108),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  474
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  132  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  181


 Score = 23.1 bits (48),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 8/19 (42%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +3

Query  183  QMKFRNYLPQDKHLQEGKL  239
            ++K RNY P+D+ L++ K+
Sbjct  81   ELKLRNYEPEDEELKKRKV  99



>ref|XP_006975600.1| PREDICTED: coiled-coil domain-containing protein 12 [Peromyscus 
maniculatus bairdii]
Length=143

 Score = 43.9 bits (102),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  84   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  115


 Score = 25.0 bits (53),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 26/39 (67%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            K   ++++E+ ++  ++ RNY+P+D+ L+  ++  A PV
Sbjct  19   KQLREEEEEDGKHRGLRLRNYVPEDEDLKRRRVPQAKPV  57



>gb|KFO72623.1| Coiled-coil domain-containing protein 12, partial [Cuculus canorus]
Length=111

 Score = 45.1 bits (105),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 40/58 (69%), Gaps = 9/58 (16%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE---KRRLAEDLGTNS  480
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE     R A+  G++S
Sbjct  53   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLRGQEEELASAVRSAKQEGSDS  110


 Score = 24.3 bits (51),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 11/61 (18%)
 Frame = +3

Query  183  QMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPM--ANLTPPQDKKEKNEDPFLNIAPK  344
            ++K RNY P+D+ L++ K+  A P  V  K  + +  A L P  D     E    N+AP+
Sbjct  2    ELKLRNYEPEDEELKKRKVPQAKPASVEEKVKEQLEAAKLEPIID-----EVDLTNLAPR  56

Query  345  K  347
            K
Sbjct  57   K  57



>ref|XP_001842700.1| coiled-coil domain-containing protein 12 [Culex quinquefasciatus]
 gb|EDS27402.1| coiled-coil domain-containing protein 12 [Culex quinquefasciatus]
Length=155

 Score = 44.7 bits (104),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLE+R+ KA+ +L
Sbjct  93   LAPRKPDWDLKRDVSKKLEKLERRTQKAIAEL  124


 Score = 24.3 bits (51),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 22/53 (42%), Gaps = 22/53 (42%)
 Frame = +3

Query  192  FRNYLPQDKHLQEGKL--------------------APPVLPKFDDPMANLTP  290
            FRNY P+ + +QE  L                    AP V+ + D  +ANL P
Sbjct  45   FRNYRPESEEIQESALEEVQPTDVEREISSQLELMRAPIVIEEID--IANLAP  95



>ref|NP_001096533.1| coiled-coil domain containing 12 [Xenopus (Silurana) tropicalis]
 gb|AAI35876.1| LOC100125177 protein [Xenopus (Silurana) tropicalis]
Length=157

 Score = 43.9 bits (102),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  99   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  130


 Score = 25.0 bits (53),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 21/32 (66%), Gaps = 2/32 (6%)
 Frame = +3

Query  162  QENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            +E + + ++K RNY PQD  L+E ++  A P+
Sbjct  41   EEEEPHRELKLRNYTPQDDDLKERQVPQAKPI  72



>emb|CDI84055.1| hypothetical protein, conserved [Eimeria acervulina]
Length=159

 Score = 38.5 bits (88),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            + P++PNWDL+RDV++++  L +R+ KA+ QL
Sbjct  66   VVPRRPNWDLKRDVERKIAILSRRTDKAIIQL  97


 Score = 30.4 bits (67),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 29/53 (55%), Gaps = 0/53 (0%)
 Frame = +3

Query  189  KFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  347
            +FRNY+P+D+ L++  L  P + + +  +A       +  K+ED    + P++
Sbjct  18   RFRNYVPKDRKLRQFCLPRPSIDELEKQIALEAESAVQAAKDEDILSQVVPRR  70



>ref|XP_010120764.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Chlamydotis macqueenii]
Length=83

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 6/43 (14%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE  444
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE
Sbjct  25   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE  67



>ref|XP_007256563.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Astyanax mexicanus]
 ref|XP_007256564.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Astyanax mexicanus]
Length=162

 Score = 44.7 bits (104),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ KA+ +L
Sbjct  105  LAPRKPDWDLKRDVAKKLEKLEKRTQKAIAEL  136


 Score = 24.3 bits (51),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 0/32 (0%)
 Frame = +3

Query  135  DDKDASQDQQENDENFQMKFRNYLPQDKHLQE  230
            D K A  + +    +  +K RNY P+D+ L+E
Sbjct  38   DSKRALDETEAEQRHRDLKLRNYTPEDEELKE  69



>gb|EHA98666.1| Coiled-coil domain-containing protein 12 [Heterocephalus glaber]
Length=255

 Score = 44.3 bits (103),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  334  LPPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  429
            L P+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  196  LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  227


 Score = 24.6 bits (52),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 22/33 (67%), Gaps = 2/33 (6%)
 Frame = +3

Query  159  QQENDENFQMKFRNYLPQDKHLQEGKL--APPV  251
            + E+  + +++ RNY+P+D+ L+  ++  A PV
Sbjct  137  RAESCRDEELRLRNYVPEDEDLKRRRVPQAKPV  169



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564104274800