BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF010L11

Length=422
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006344398.1|  PREDICTED: pantothenate kinase 2-like isofor...    129   2e-31   Solanum tuberosum [potatoes]
ref|XP_010243065.1|  PREDICTED: pantothenate kinase 2 isoform X2        128   3e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010243061.1|  PREDICTED: pantothenate kinase 2 isoform X1        128   4e-31   Nelumbo nucifera [Indian lotus]
ref|XP_004236210.1|  PREDICTED: pantothenate kinase 2                   127   7e-31   
emb|CDP12422.1|  unnamed protein product                                124   7e-30   Coffea canephora [robusta coffee]
ref|XP_009793996.1|  PREDICTED: pantothenate kinase 2 isoform X1        124   8e-30   Nicotiana sylvestris
ref|XP_009600890.1|  PREDICTED: pantothenate kinase 2                   123   2e-29   
ref|XP_009793998.1|  PREDICTED: pantothenate kinase 2 isoform X2        123   2e-29   Nicotiana sylvestris
ref|XP_007210380.1|  hypothetical protein PRUPE_ppa001094mg             123   2e-29   Prunus persica
ref|XP_010678776.1|  PREDICTED: pantothenate kinase 2                   122   3e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002511391.1|  Pantothenate kinase, putative                      122   3e-29   
ref|XP_011071870.1|  PREDICTED: pantothenate kinase 2                   122   5e-29   Sesamum indicum [beniseed]
ref|XP_009363012.1|  PREDICTED: pantothenate kinase 2                   122   7e-29   Pyrus x bretschneideri [bai li]
ref|XP_006439829.1|  hypothetical protein CICLE_v10018751mg             120   1e-28   
ref|XP_006439830.1|  hypothetical protein CICLE_v10018751mg             120   2e-28   Citrus clementina [clementine]
gb|KDP31092.1|  hypothetical protein JCGZ_11468                         120   2e-28   Jatropha curcas
ref|XP_008356598.1|  PREDICTED: pantothenate kinase 2-like              120   2e-28   
ref|XP_008795923.1|  PREDICTED: pantothenate kinase 2-like isofor...    119   4e-28   Phoenix dactylifera
ref|XP_008795922.1|  PREDICTED: pantothenate kinase 2-like isofor...    119   4e-28   
gb|EYU42581.1|  hypothetical protein MIMGU_mgv1a001050mg                119   4e-28   Erythranthe guttata [common monkey flower]
ref|XP_008393114.1|  PREDICTED: pantothenate kinase 2-like              114   6e-28   
gb|KDO69623.1|  hypothetical protein CISIN_1g042742mg                   118   1e-27   Citrus sinensis [apfelsine]
ref|XP_004152477.1|  PREDICTED: pantothenate kinase 2-like              118   2e-27   Cucumis sativus [cucumbers]
ref|XP_008239770.1|  PREDICTED: pantothenate kinase 2                   118   2e-27   Prunus mume [ume]
ref|XP_008438456.1|  PREDICTED: pantothenate kinase 2                   117   2e-27   Cucumis melo [Oriental melon]
gb|KJB53155.1|  hypothetical protein B456_008G295400                    116   5e-27   Gossypium raimondii
gb|EPS64631.1|  hypothetical protein M569_10149                         115   6e-27   Genlisea aurea
ref|XP_010940068.1|  PREDICTED: pantothenate kinase 2-like isofor...    116   6e-27   Elaeis guineensis
gb|KJB39191.1|  hypothetical protein B456_007G001600                    115   6e-27   Gossypium raimondii
gb|KJB53156.1|  hypothetical protein B456_008G295400                    116   6e-27   Gossypium raimondii
ref|XP_010940070.1|  PREDICTED: pantothenate kinase 2-like isofor...    116   6e-27   Elaeis guineensis
ref|XP_007138072.1|  hypothetical protein PHAVU_009G178200g             116   7e-27   Phaseolus vulgaris [French bean]
ref|XP_002279079.1|  PREDICTED: pantothenate kinase 2                   116   7e-27   Vitis vinifera
gb|KHG28314.1|  hypothetical protein F383_13494                         116   7e-27   Gossypium arboreum [tree cotton]
emb|CBI15019.3|  unnamed protein product                                116   8e-27   Vitis vinifera
ref|XP_004298946.1|  PREDICTED: pantothenate kinase 2                   115   9e-27   Fragaria vesca subsp. vesca
gb|KJB39190.1|  hypothetical protein B456_007G001600                    115   9e-27   Gossypium raimondii
ref|XP_008393029.1|  PREDICTED: pantothenate kinase 2                   115   1e-26   
ref|XP_011001529.1|  PREDICTED: pantothenate kinase 2-like              114   2e-26   Populus euphratica
ref|XP_002318651.1|  hypothetical protein POPTR_0012s08310g             114   2e-26   
ref|XP_010037560.1|  PREDICTED: pantothenate kinase 2                   114   3e-26   Eucalyptus grandis [rose gum]
gb|KCW49278.1|  hypothetical protein EUGRSUZ_K02840                     114   3e-26   Eucalyptus grandis [rose gum]
gb|KCW49280.1|  hypothetical protein EUGRSUZ_K02840                     114   3e-26   Eucalyptus grandis [rose gum]
ref|XP_007036235.1|  Pantothenate kinase 2 isoform 2                    114   3e-26   
ref|XP_007036234.1|  Pantothenate kinase 2 isoform 1                    114   4e-26   
ref|XP_010447427.1|  PREDICTED: pantothenate kinase 2 isoform X1        113   6e-26   Camelina sativa [gold-of-pleasure]
emb|CDX75226.1|  BnaA01g04760D                                          112   1e-25   
ref|XP_009126332.1|  PREDICTED: pantothenate kinase 2                   112   1e-25   Brassica rapa
ref|XP_011028555.1|  PREDICTED: pantothenate kinase 2-like              112   2e-25   Populus euphratica
ref|XP_010437940.1|  PREDICTED: pantothenate kinase 2-like              111   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010432761.1|  PREDICTED: pantothenate kinase 2-like              111   3e-25   Camelina sativa [gold-of-pleasure]
gb|KJB53157.1|  hypothetical protein B456_008G295400                    110   5e-25   Gossypium raimondii
pir||T05410  hypothetical protein F10M6.180 - Arabidopsis thaliana      110   8e-25
ref|NP_001031768.1|  pantothenate kinase 2                              110   9e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003601259.1|  Pantothenate kinase                                110   9e-25   Medicago truncatula
ref|NP_194945.3|  pantothenate kinase 2                                 110   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010101220.1|  Pantothenate kinase 2                              110   1e-24   Morus notabilis
ref|XP_002867254.1|  ATPANK2                                            109   1e-24   
emb|CDX68824.1|  BnaC01g06290D                                          109   1e-24   
ref|XP_006412505.1|  hypothetical protein EUTSA_v10024357mg             109   1e-24   Eutrema salsugineum [saltwater cress]
gb|AAM20690.1|  putative protein                                        109   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003542534.2|  PREDICTED: pantothenate kinase 2-like isofor...    108   4e-24   
gb|KHN48232.1|  Pantothenate kinase 2                                   108   4e-24   Glycine soja [wild soybean]
ref|XP_006594169.1|  PREDICTED: pantothenate kinase 2-like isofor...    108   4e-24   
gb|KHN19302.1|  Pantothenate kinase 2                                   106   5e-24   Glycine soja [wild soybean]
ref|XP_009108890.1|  PREDICTED: pantothenate kinase 2                   107   5e-24   Brassica rapa
ref|XP_010534230.1|  PREDICTED: pantothenate kinase 2                   108   5e-24   Tarenaya hassleriana [spider flower]
ref|XP_006840740.1|  hypothetical protein AMTR_s00096p00130150          107   7e-24   
ref|XP_006282554.1|  hypothetical protein CARUB_v10004099mg             107   1e-23   Capsella rubella
ref|XP_003528148.1|  PREDICTED: pantothenate kinase 2-like              106   2e-23   Glycine max [soybeans]
ref|XP_006579568.1|  PREDICTED: pantothenate kinase 2-like              102   2e-23   
gb|KHN34316.1|  Pantothenate kinase 2                                   102   3e-23   Glycine soja [wild soybean]
ref|XP_004501924.1|  PREDICTED: pantothenate kinase 2-like isofor...    105   3e-23   Cicer arietinum [garbanzo]
ref|XP_010936708.1|  PREDICTED: pantothenate kinase 2-like              105   4e-23   Elaeis guineensis
ref|XP_008782481.1|  PREDICTED: pantothenate kinase 2-like              105   4e-23   
ref|XP_003576771.1|  PREDICTED: pantothenate kinase 2                   105   5e-23   Brachypodium distachyon [annual false brome]
gb|KFK29830.1|  hypothetical protein AALP_AA7G184400                    104   6e-23   Arabis alpina [alpine rockcress]
gb|EMT07573.1|  Pantothenate kinase 2                                   103   2e-22   
ref|XP_006840737.1|  hypothetical protein AMTR_s00096p00126400          102   2e-22   
gb|EEC84941.1|  hypothetical protein OsI_32156                          102   4e-22   Oryza sativa Indica Group [Indian rice]
sp|Q0J035.2|PANK2_ORYSJ  RecName: Full=Pantothenate kinase 2; Alt...    102   4e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004957459.1|  PREDICTED: pantothenate kinase 2-like              101   8e-22   Setaria italica
ref|XP_002460569.1|  hypothetical protein SORBIDRAFT_02g030920          101   8e-22   Sorghum bicolor [broomcorn]
tpg|DAA62461.1|  TPA: hypothetical protein ZEAMMB73_754388            99.0    2e-21   
ref|XP_008652990.1|  PREDICTED: pantothenate kinase 2                 99.4    6e-21   
ref|XP_006660887.1|  PREDICTED: pantothenate kinase 2-like            99.0    8e-21   
ref|XP_009403915.1|  PREDICTED: pantothenate kinase 2                 98.6    9e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007155432.1|  hypothetical protein PHAVU_003G200700g           95.5    1e-19   Phaseolus vulgaris [French bean]
gb|KHN18454.1|  Pantothenate kinase 2                                 95.5    1e-19   Glycine soja [wild soybean]
ref|XP_006600640.1|  PREDICTED: pantothenate kinase 2-like isofor...  95.5    1e-19   Glycine max [soybeans]
ref|XP_006600639.1|  PREDICTED: pantothenate kinase 2-like isofor...  95.5    1e-19   Glycine max [soybeans]
ref|XP_006477543.1|  PREDICTED: pantothenate kinase 2-like            92.4    1e-18   
gb|EMS60500.1|  Pantothenate kinase 2                                 91.7    2e-18   Triticum urartu
gb|EEE70109.1|  hypothetical protein OsJ_30119                        90.9    4e-18   Oryza sativa Japonica Group [Japonica rice]
gb|ACN39905.1|  unknown                                               90.9    5e-18   Picea sitchensis
ref|XP_006374525.1|  hypothetical protein POPTR_0015s08840g           79.7    2e-15   
ref|XP_001768633.1|  predicted protein                                74.7    4e-14   
ref|XP_001757682.1|  predicted protein                                78.6    7e-14   
ref|XP_008789287.1|  PREDICTED: pantothenate kinase 1-like            61.6    3e-08   Phoenix dactylifera
ref|XP_010932472.1|  PREDICTED: pantothenate kinase 1 isoform X2      59.7    1e-07   
ref|XP_010932471.1|  PREDICTED: pantothenate kinase 1 isoform X1      59.7    1e-07   Elaeis guineensis
ref|XP_009419129.1|  PREDICTED: pantothenate kinase 1-like            55.8    3e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_005849803.1|  hypothetical protein CHLNCDRAFT_34679            49.7    3e-04   Chlorella variabilis
gb|AFW85383.1|  hypothetical protein ZEAMMB73_434998                  48.9    3e-04   
ref|NP_001147318.1|  LOC100280926                                     49.3    4e-04   Zea mays [maize]
gb|KDD75300.1|  fumble                                                48.5    4e-04   Helicosporidium sp. ATCC 50920
ref|XP_009621068.1|  PREDICTED: pantothenate kinase 1                 48.5    5e-04   Nicotiana tomentosiformis
ref|XP_635721.1|  pantothenate kinase                                 48.5    5e-04   Dictyostelium discoideum AX4
ref|XP_002507494.1|  pantothenate kinase                              48.5    6e-04   Micromonas commoda
ref|XP_005649526.1|  fumble-domain-containing protein                 48.1    7e-04   Coccomyxa subellipsoidea C-169
ref|XP_002951581.1|  hypothetical protein VOLCADRAFT_61514            48.1    8e-04   Volvox carteri f. nagariensis
ref|XP_004964926.1|  PREDICTED: pantothenate kinase 2-like isofor...  48.1    9e-04   Setaria italica
ref|XP_003287654.1|  hypothetical protein DICPUDRAFT_54979            47.8    0.001   Dictyostelium purpureum



>ref|XP_006344398.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Solanum tuberosum]
 ref|XP_006344399.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Solanum tuberosum]
 ref|XP_006344400.1| PREDICTED: pantothenate kinase 2-like isoform X3 [Solanum tuberosum]
Length=901

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 83/114 (73%), Gaps = 4/114 (4%)
 Frame = +2

Query  89   MAGVTTGDLPDLGIDDKNEKDNIAVLKRGGVEKEKEISP---MHRSTSRPQLDLXGAAIQ  259
            MA  TT +   + IDD NE+    + ++  VEK+    P   +HRS+SRPQLD+ GAAIQ
Sbjct  1    MASPTTKNHSHIEIDDINEESQ-QITEKDIVEKDMAPLPGSSIHRSSSRPQLDVSGAAIQ  59

Query  260  GNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKRKRKVKE  421
            GNFE KDP I LPNQ+DDISHLALDIGGSLIKL YFS H  RQV+D RKRKVKE
Sbjct  60   GNFEEKDPAILLPNQTDDISHLALDIGGSLIKLIYFSRHADRQVDDGRKRKVKE  113



>ref|XP_010243065.1| PREDICTED: pantothenate kinase 2 isoform X2 [Nelumbo nucifera]
Length=805

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 78/98 (80%), Gaps = 3/98 (3%)
 Frame = +2

Query  131  DDKNEKDNIAVLKRGGVEKEK-EISPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQS  307
            +DKN++D     K+GG E      +P+HRS+SRPQLDL GAAIQGNFE +DPTI LPNQS
Sbjct  23   NDKNKEDEEE--KQGGREMAPPAANPIHRSSSRPQLDLSGAAIQGNFEERDPTILLPNQS  80

Query  308  DDISHLALDIGGSLIKLXYFSXHEGRQVEDKRKRKVKE  421
            DDISHL+LDIGGSLIKL YFS HE R V+DKRKR +KE
Sbjct  81   DDISHLSLDIGGSLIKLVYFSRHEDRSVDDKRKRSLKE  118



>ref|XP_010243061.1| PREDICTED: pantothenate kinase 2 isoform X1 [Nelumbo nucifera]
 ref|XP_010243063.1| PREDICTED: pantothenate kinase 2 isoform X1 [Nelumbo nucifera]
 ref|XP_010243064.1| PREDICTED: pantothenate kinase 2 isoform X1 [Nelumbo nucifera]
Length=908

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 78/98 (80%), Gaps = 3/98 (3%)
 Frame = +2

Query  131  DDKNEKDNIAVLKRGGVEKEK-EISPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQS  307
            +DKN++D     K+GG E      +P+HRS+SRPQLDL GAAIQGNFE +DPTI LPNQS
Sbjct  23   NDKNKEDEEE--KQGGREMAPPAANPIHRSSSRPQLDLSGAAIQGNFEERDPTILLPNQS  80

Query  308  DDISHLALDIGGSLIKLXYFSXHEGRQVEDKRKRKVKE  421
            DDISHL+LDIGGSLIKL YFS HE R V+DKRKR +KE
Sbjct  81   DDISHLSLDIGGSLIKLVYFSRHEDRSVDDKRKRSLKE  118



>ref|XP_004236210.1| PREDICTED: pantothenate kinase 2 [Solanum lycopersicum]
 ref|XP_010318982.1| PREDICTED: pantothenate kinase 2 [Solanum lycopersicum]
Length=901

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 82/114 (72%), Gaps = 4/114 (4%)
 Frame = +2

Query  89   MAGVTTGDLPDLGIDDKNEKDNIAVLKRGGVEKEKEISP---MHRSTSRPQLDLXGAAIQ  259
            MA  TT D   + ID  NE+    + ++  VEK+    P   +HRS+SRPQLD+ GAAIQ
Sbjct  1    MASSTTKDHSHIEIDGINEESQ-QMTEKDIVEKDMAPLPGSSIHRSSSRPQLDVSGAAIQ  59

Query  260  GNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKRKRKVKE  421
            GNFE KDP I LPNQ+DDISHLALDIGGSLIKL YFS H  RQV+D RKRKVKE
Sbjct  60   GNFEEKDPAILLPNQTDDISHLALDIGGSLIKLIYFSRHADRQVDDGRKRKVKE  113



>emb|CDP12422.1| unnamed protein product [Coffea canephora]
Length=804

 Score =   124 bits (312),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 56/74 (76%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  200  SPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHE  379
            +P+HRS+SRPQLD+ GAAIQGNFE +DPTI LPNQSDDISHLALDIGGSLIKL YFS HE
Sbjct  7    NPIHRSSSRPQLDVSGAAIQGNFEERDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE  66

Query  380  GRQVEDKRKRKVKE  421
             R V D+ K+ +KE
Sbjct  67   DRPVNDRIKKTIKE  80



>ref|XP_009793996.1| PREDICTED: pantothenate kinase 2 isoform X1 [Nicotiana sylvestris]
Length=932

 Score =   124 bits (312),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 92/124 (74%), Gaps = 15/124 (12%)
 Frame = +2

Query  86   VMAGVTTGD-LPDLGIDDKNEK-----DNIAVLKRGGVEKEKEISPM------HRSTSRP  229
            +MA  TT D  P +GID  NE+     +   VL++GG   EK+++P+      HRS+SRP
Sbjct  24   IMASPTTEDHSPHIGIDCINEETQQISEKDIVLEKGG---EKDMAPLPGSSSIHRSSSRP  80

Query  230  QLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKRKR  409
            QLD+ GAAIQGNFE KDPTI LPNQSDDISHLALDIGGSLIKL YFS H  RQV+D+RKR
Sbjct  81   QLDVSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHADRQVDDRRKR  140

Query  410  KVKE  421
            KVKE
Sbjct  141  KVKE  144



>ref|XP_009600890.1| PREDICTED: pantothenate kinase 2 [Nicotiana tomentosiformis]
 ref|XP_009600891.1| PREDICTED: pantothenate kinase 2 [Nicotiana tomentosiformis]
Length=908

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 91/123 (74%), Gaps = 15/123 (12%)
 Frame = +2

Query  89   MAGVTTGDLP-DLGIDDKNEK-----DNIAVLKRGGVEKEKEISPM------HRSTSRPQ  232
            MA  TT D P  +GID  NE+     +   VL++GG   EK+++P+      HRS+SRPQ
Sbjct  1    MASPTTEDHPPHIGIDGINEETQQISEKDIVLEKGG---EKDMAPLPGSSSIHRSSSRPQ  57

Query  233  LDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKRKRK  412
            LD+ GAAIQGNFE KDPTI LPNQSDDISHLALDIGGSLIKL YFS H  RQV+D+RKRK
Sbjct  58   LDVSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHADRQVDDRRKRK  117

Query  413  VKE  421
            VKE
Sbjct  118  VKE  120



>ref|XP_009793998.1| PREDICTED: pantothenate kinase 2 isoform X2 [Nicotiana sylvestris]
Length=908

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 91/123 (74%), Gaps = 15/123 (12%)
 Frame = +2

Query  89   MAGVTTGD-LPDLGIDDKNEK-----DNIAVLKRGGVEKEKEISPM------HRSTSRPQ  232
            MA  TT D  P +GID  NE+     +   VL++GG   EK+++P+      HRS+SRPQ
Sbjct  1    MASPTTEDHSPHIGIDCINEETQQISEKDIVLEKGG---EKDMAPLPGSSSIHRSSSRPQ  57

Query  233  LDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKRKRK  412
            LD+ GAAIQGNFE KDPTI LPNQSDDISHLALDIGGSLIKL YFS H  RQV+D+RKRK
Sbjct  58   LDVSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHADRQVDDRRKRK  117

Query  413  VKE  421
            VKE
Sbjct  118  VKE  120



>ref|XP_007210380.1| hypothetical protein PRUPE_ppa001094mg [Prunus persica]
 gb|EMJ11579.1| hypothetical protein PRUPE_ppa001094mg [Prunus persica]
Length=910

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 83/114 (73%), Gaps = 12/114 (11%)
 Frame = +2

Query  116  PDLGIDD------KNEKDNIAVLKRGGV-EKEKEI-----SPMHRSTSRPQLDLXGAAIQ  259
            P LGI+D      +NEK N  V+K   V + E+++     S +HRS SRPQLDL  AAIQ
Sbjct  8    PVLGINDIKEREEENEKGNTQVVKTEEVGQSERDMASATGSSIHRSGSRPQLDLSKAAIQ  67

Query  260  GNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKRKRKVKE  421
            GNFE +DPTI LPNQSDD+SHLALDIGGSLIKL YFS HE + ++DKRK+ +KE
Sbjct  68   GNFEERDPTILLPNQSDDLSHLALDIGGSLIKLVYFSRHEDQSIDDKRKKTLKE  121



>ref|XP_010678776.1| PREDICTED: pantothenate kinase 2 [Beta vulgaris subsp. vulgaris]
Length=899

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +2

Query  206  MHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGR  385
            +HRS SRPQLD+ GAAIQGNFE +DPTI LPNQSDDISHLALDIGGSLIKL YFS HE R
Sbjct  39   IHRSGSRPQLDVSGAAIQGNFEERDPTILLPNQSDDISHLALDIGGSLIKLAYFSRHEDR  98

Query  386  QVEDKRKRKVKE  421
             VEDKRKR +K+
Sbjct  99   SVEDKRKRSIKQ  110



>ref|XP_002511391.1| Pantothenate kinase, putative [Ricinus communis]
 gb|EEF51993.1| Pantothenate kinase, putative [Ricinus communis]
Length=907

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 78/111 (70%), Gaps = 9/111 (8%)
 Frame = +2

Query  116  PDLGIDDKNEKDNIAV----LKRGGVEKEKEISP-----MHRSTSRPQLDLXGAAIQGNF  268
            P LGIDD  E    A     L+  G + ++E+SP     +HRS SRPQLDL  AAIQGN 
Sbjct  8    PVLGIDDIIETSEDAEVRDKLREEGGQSDREMSPATGNSIHRSGSRPQLDLSKAAIQGNS  67

Query  269  EXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKRKRKVKE  421
            E +DPTI LPNQSDDISHLALDIGGSLIKL YFS HE R + DKRK+ VKE
Sbjct  68   EERDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEDRSINDKRKKTVKE  118



>ref|XP_011071870.1| PREDICTED: pantothenate kinase 2 [Sesamum indicum]
 ref|XP_011071871.1| PREDICTED: pantothenate kinase 2 [Sesamum indicum]
Length=922

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 68/82 (83%), Gaps = 5/82 (6%)
 Frame = +2

Query  188  EKEISP-----MHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLI  352
            EK++SP     MHRS+SRPQLDL GAAIQGNFE KDPTI LPNQSDDISHLALDIGGSLI
Sbjct  50   EKDMSPVAGNSMHRSSSRPQLDLSGAAIQGNFEEKDPTILLPNQSDDISHLALDIGGSLI  109

Query  353  KLXYFSXHEGRQVEDKRKRKVK  418
            KL YFS HE + V D+R++ +K
Sbjct  110  KLVYFSRHENQPVNDRRRKIIK  131



>ref|XP_009363012.1| PREDICTED: pantothenate kinase 2 [Pyrus x bretschneideri]
 ref|XP_009363013.1| PREDICTED: pantothenate kinase 2 [Pyrus x bretschneideri]
 ref|XP_009363015.1| PREDICTED: pantothenate kinase 2 [Pyrus x bretschneideri]
Length=915

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 87/126 (69%), Gaps = 15/126 (12%)
 Frame = +2

Query  89   MAGVTTGDLPDL-----GIDDKNEKDNIAVLKRGGVE-----KEKEISP-----MHRSTS  223
            MAG  T D+ +      G  + N  ++ AV++  G E      E++++P     +HRS S
Sbjct  1    MAGFGTSDIKEREKEEGGDKNINTLESHAVIRTEGGEVGQSSSERDMAPATGNSIHRSGS  60

Query  224  RPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKR  403
            RPQLDL  AAIQGNFE +DPTI LPNQSDD+SHLALDIGGSLIKL YFS HEG+ ++DKR
Sbjct  61   RPQLDLSKAAIQGNFEERDPTILLPNQSDDLSHLALDIGGSLIKLVYFSRHEGQSIDDKR  120

Query  404  KRKVKE  421
            K+ +KE
Sbjct  121  KKTLKE  126



>ref|XP_006439829.1| hypothetical protein CICLE_v10018751mg [Citrus clementina]
 gb|ESR53069.1| hypothetical protein CICLE_v10018751mg [Citrus clementina]
Length=828

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  188  EKEISPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYF  367
            E+E+  MHRS SRPQLDL  AAIQGNFE K+PTI LPNQSDDISHLALDIGGSLIKL YF
Sbjct  61   EREMPSMHRSGSRPQLDLSKAAIQGNFEVKNPTILLPNQSDDISHLALDIGGSLIKLVYF  120

Query  368  SXHEGRQVEDKRKRKVKE  421
            S HE + ++DKRK+ + E
Sbjct  121  SRHEDQSIDDKRKKTINE  138



>ref|XP_006439830.1| hypothetical protein CICLE_v10018751mg [Citrus clementina]
 gb|ESR53070.1| hypothetical protein CICLE_v10018751mg [Citrus clementina]
Length=927

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  188  EKEISPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYF  367
            E+E+  MHRS SRPQLDL  AAIQGNFE K+PTI LPNQSDDISHLALDIGGSLIKL YF
Sbjct  61   EREMPSMHRSGSRPQLDLSKAAIQGNFEVKNPTILLPNQSDDISHLALDIGGSLIKLVYF  120

Query  368  SXHEGRQVEDKRKRKVKE  421
            S HE + ++DKRK+ + E
Sbjct  121  SRHEDQSIDDKRKKTINE  138



>gb|KDP31092.1| hypothetical protein JCGZ_11468 [Jatropha curcas]
Length=911

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 80/115 (70%), Gaps = 13/115 (11%)
 Frame = +2

Query  116  PDLGIDDKNEKDNIAVLKRGGVEK--------EKEISP-----MHRSTSRPQLDLXGAAI  256
            P LGI+D  E +  A ++ G + K        EK+++P     +HRS SRPQLDL  AAI
Sbjct  8    PVLGINDIMETNEEAEIRDGVIGKVREEAGQSEKDMAPPTGNSIHRSGSRPQLDLSKAAI  67

Query  257  QGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKRKRKVKE  421
            QGN E +DPTI LPNQSDD+SHLALDIGGSLIKL YFS HE R + DKRK+ VKE
Sbjct  68   QGNSEERDPTILLPNQSDDLSHLALDIGGSLIKLVYFSRHEDRSINDKRKKTVKE  122



>ref|XP_008356598.1| PREDICTED: pantothenate kinase 2-like [Malus domestica]
Length=916

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 73/92 (79%), Gaps = 5/92 (5%)
 Frame = +2

Query  161  VLKRGGVEKEKEI-----SPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHL  325
            V++  G E E+++     S +HRS SRPQLDL  AAIQGNFE +DPTI LPNQSDD+SHL
Sbjct  36   VIRTEGGEVERDMAQATGSSIHRSGSRPQLDLSKAAIQGNFEERDPTILLPNQSDDLSHL  95

Query  326  ALDIGGSLIKLXYFSXHEGRQVEDKRKRKVKE  421
            ALDIGGSLIKL YFS HEG+ ++DKRK+ +KE
Sbjct  96   ALDIGGSLIKLVYFSRHEGQSIDDKRKKTLKE  127



>ref|XP_008795923.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Phoenix dactylifera]
 ref|XP_008795924.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Phoenix dactylifera]
Length=909

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  200  SPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHE  379
            +P+HRS+SRPQLD+ GAAIQGNFE ++PTI LPNQSDDISHLALDIGGSLIKL YFS HE
Sbjct  37   APIHRSSSRPQLDVSGAAIQGNFEERNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE  96

Query  380  GRQVEDKRKRKVKE  421
             + ++DKR+R +K+
Sbjct  97   EQSLDDKRRRSIKK  110



>ref|XP_008795922.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Phoenix dactylifera]
Length=913

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  200  SPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHE  379
            +P+HRS+SRPQLD+ GAAIQGNFE ++PTI LPNQSDDISHLALDIGGSLIKL YFS HE
Sbjct  37   APIHRSSSRPQLDVSGAAIQGNFEERNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE  96

Query  380  GRQVEDKRKRKVKE  421
             + ++DKR+R +K+
Sbjct  97   EQSLDDKRRRSIKK  110



>gb|EYU42581.1| hypothetical protein MIMGU_mgv1a001050mg [Erythranthe guttata]
Length=904

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 78/107 (73%), Gaps = 13/107 (12%)
 Frame = +2

Query  119  DLGID---DKNEKDNIAVLKRGGVEKEKEISPM-----HRSTSRPQLDLXGAAIQGNFEX  274
            ++GID     N  DN   + RG    EKE++P+     HRS+SRPQLDL GAAIQGNFE 
Sbjct  12   NIGIDGGGSINNTDN-QFIGRG----EKEMAPIAGNSIHRSSSRPQLDLSGAAIQGNFEE  66

Query  275  KDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKRKRKV  415
            +DPTI LPNQSDDISHLALDIGGSLIKL YFS HE + V D+R++ +
Sbjct  67   RDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHENQTVTDRRRKII  113



>ref|XP_008393114.1| PREDICTED: pantothenate kinase 2-like [Malus domestica]
Length=260

 Score =   114 bits (285),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 79/118 (67%), Gaps = 7/118 (6%)
 Frame = +2

Query  89   MAGVTTGDLP----DLGIDDKNEKDNIAVLKRGGVE---KEKEISPMHRSTSRPQLDLXG  247
            MAG  T D+     + G  + N  ++  V++  G E      E   +H S SRPQLDL  
Sbjct  1    MAGFGTKDIKGREKEEGDKNSNTLESHVVIRTEGGEVGQSSSERDTIHGSGSRPQLDLSK  60

Query  248  AAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKRKRKVKE  421
            AAIQGNFE +DP I LPNQSDD+SHLALDIGGSLIKL YFS HEG+ ++DKRK+ +KE
Sbjct  61   AAIQGNFEERDPXILLPNQSDDLSHLALDIGGSLIKLVYFSRHEGQSIDDKRKKTLKE  118



>gb|KDO69623.1| hypothetical protein CISIN_1g042742mg [Citrus sinensis]
Length=834

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  206  MHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGR  385
            MHRS SRPQLDL  AAIQGNFE K+PTI LPNQSDDISHLALDIGGSLIKL YFS HE +
Sbjct  4    MHRSGSRPQLDLSKAAIQGNFEVKNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEDQ  63

Query  386  QVEDKRKRKVKE  421
             ++DKRK+ +KE
Sbjct  64   SIDDKRKKTIKE  75



>ref|XP_004152477.1| PREDICTED: pantothenate kinase 2-like [Cucumis sativus]
 ref|XP_004167266.1| PREDICTED: pantothenate kinase 2-like [Cucumis sativus]
 gb|KGN64313.1| hypothetical protein Csa_1G046095 [Cucumis sativus]
Length=911

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 75/102 (74%), Gaps = 8/102 (8%)
 Frame = +2

Query  131  DDKNEKDNIAVLKRGGVEKEKEISP-----MHRSTSRPQLDLXGAAIQGNFEXKDPTIQL  295
            DDKN+  +      GG   E++++P     +HRS SRPQLDL  A IQGNFE +DPTI L
Sbjct  23   DDKNQLVDKEAGLSGG---ERDMAPVTGNSIHRSGSRPQLDLSKAEIQGNFEERDPTILL  79

Query  296  PNQSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKRKRKVKE  421
            PNQSDDISHLALDIGGSLIKL YFS HE + V+DKRKR VK+
Sbjct  80   PNQSDDISHLALDIGGSLIKLVYFSRHEDQSVDDKRKRSVKQ  121



>ref|XP_008239770.1| PREDICTED: pantothenate kinase 2 [Prunus mume]
Length=910

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 82/114 (72%), Gaps = 12/114 (11%)
 Frame = +2

Query  116  PDLGI------DDKNEKDNIAVLKRGGV-EKEKEISP-----MHRSTSRPQLDLXGAAIQ  259
            P LGI      +++NEK    V+K   V + E++++      +HRS SRPQLDL  AAIQ
Sbjct  8    PVLGISYIKEREEENEKGKTQVVKTEEVGQSERDMASATGNSIHRSGSRPQLDLSKAAIQ  67

Query  260  GNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKRKRKVKE  421
            GNFE +DPTI LPNQSDD+SHLALDIGGSLIKL YFS HE + ++DKRK+ +KE
Sbjct  68   GNFEERDPTILLPNQSDDLSHLALDIGGSLIKLVYFSRHEDQSIDDKRKKTLKE  121



>ref|XP_008438456.1| PREDICTED: pantothenate kinase 2 [Cucumis melo]
Length=911

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 75/102 (74%), Gaps = 8/102 (8%)
 Frame = +2

Query  131  DDKNEKDNIAVLKRGGVEKEKEISP-----MHRSTSRPQLDLXGAAIQGNFEXKDPTIQL  295
            DDKN+  +      GG   E++++P     +HRS SRPQLDL  A IQGNFE +DPTI L
Sbjct  23   DDKNQLVDKEAGLSGG---ERDMAPVTGNSIHRSGSRPQLDLSKAEIQGNFEERDPTILL  79

Query  296  PNQSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKRKRKVKE  421
            PNQSDDISHLALDIGGSLIKL YFS HE + V+DKRKR +K+
Sbjct  80   PNQSDDISHLALDIGGSLIKLVYFSRHEDQSVDDKRKRSIKQ  121



>gb|KJB53155.1| hypothetical protein B456_008G295400 [Gossypium raimondii]
Length=730

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 74/100 (74%), Gaps = 5/100 (5%)
 Frame = +2

Query  122  LGIDDKNEKDNIAVLKRGGVEKEKEISPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPN  301
            +G D  N K+N     +GG EK+   + +HRS SRPQLDL  A IQGN E +DPTI LPN
Sbjct  38   IGEDSSNNKNN----NQGG-EKDMAGNSIHRSGSRPQLDLSKAEIQGNSEERDPTILLPN  92

Query  302  QSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKRKRKVKE  421
            Q+DDISHLALDIGGSLIKL YFS HE + V+DKRK+ VKE
Sbjct  93   QTDDISHLALDIGGSLIKLVYFSRHEDQSVDDKRKKTVKE  132



>gb|EPS64631.1| hypothetical protein M569_10149, partial [Genlisea aurea]
Length=601

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 69/86 (80%), Gaps = 5/86 (6%)
 Frame = +2

Query  179  VEKEKEISPM-----HRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGG  343
            + +EK+++P+      RS+SRPQLDL GAAIQGNFE ++PTI LPNQSDDISHLALDIGG
Sbjct  34   IPEEKDMAPLSGNSIRRSSSRPQLDLSGAAIQGNFEERNPTILLPNQSDDISHLALDIGG  93

Query  344  SLIKLXYFSXHEGRQVEDKRKRKVKE  421
            SLIKL YFS HE + V D R++ +KE
Sbjct  94   SLIKLVYFSRHENQPVNDTRRKVIKE  119



>ref|XP_010940068.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Elaeis guineensis]
 ref|XP_010940069.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Elaeis guineensis]
Length=922

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  200  SPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHE  379
            +P+HRS+SR QLDL GAAIQGNFE ++PTI LPNQSDDISHLALDIGGSLIKL YFS HE
Sbjct  36   APIHRSSSRLQLDLSGAAIQGNFEERNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE  95

Query  380  GRQVEDKRKRKVKE  421
             +  +DKRKR +K+
Sbjct  96   EQSPDDKRKRSIKK  109



>gb|KJB39191.1| hypothetical protein B456_007G001600 [Gossypium raimondii]
Length=678

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +2

Query  206  MHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGR  385
            +HRS SRPQLDL  AAIQGN E +DPTI LPNQSDDISH ALDIGGSLIKL YFS HEG+
Sbjct  67   LHRSGSRPQLDLSKAAIQGNSEERDPTILLPNQSDDISHFALDIGGSLIKLVYFSRHEGQ  126

Query  386  QVEDKRKRKVKE  421
             ++DKRK+ VKE
Sbjct  127  SIDDKRKKTVKE  138



>gb|KJB53156.1| hypothetical protein B456_008G295400 [Gossypium raimondii]
 gb|KJB53158.1| hypothetical protein B456_008G295400 [Gossypium raimondii]
Length=922

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 74/100 (74%), Gaps = 5/100 (5%)
 Frame = +2

Query  122  LGIDDKNEKDNIAVLKRGGVEKEKEISPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPN  301
            +G D  N K+N     +GG EK+   + +HRS SRPQLDL  A IQGN E +DPTI LPN
Sbjct  38   IGEDSSNNKNN----NQGG-EKDMAGNSIHRSGSRPQLDLSKAEIQGNSEERDPTILLPN  92

Query  302  QSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKRKRKVKE  421
            Q+DDISHLALDIGGSLIKL YFS HE + V+DKRK+ VKE
Sbjct  93   QTDDISHLALDIGGSLIKLVYFSRHEDQSVDDKRKKTVKE  132



>ref|XP_010940070.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Elaeis guineensis]
Length=908

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  200  SPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHE  379
            +P+HRS+SR QLDL GAAIQGNFE ++PTI LPNQSDDISHLALDIGGSLIKL YFS HE
Sbjct  36   APIHRSSSRLQLDLSGAAIQGNFEERNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE  95

Query  380  GRQVEDKRKRKVKE  421
             +  +DKRKR +K+
Sbjct  96   EQSPDDKRKRSIKK  109



>ref|XP_007138072.1| hypothetical protein PHAVU_009G178200g [Phaseolus vulgaris]
 ref|XP_007138073.1| hypothetical protein PHAVU_009G178200g [Phaseolus vulgaris]
 gb|ESW10066.1| hypothetical protein PHAVU_009G178200g [Phaseolus vulgaris]
 gb|ESW10067.1| hypothetical protein PHAVU_009G178200g [Phaseolus vulgaris]
Length=915

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 71/101 (70%), Gaps = 5/101 (5%)
 Frame = +2

Query  134  DKNEKDNIAVLKRGGVEKEKEISP-----MHRSTSRPQLDLXGAAIQGNFEXKDPTIQLP  298
            D     NIA  +    E E+E++P     MHRS SRPQLD+  A IQGN E K PTI LP
Sbjct  27   DSENNSNIARTQLESGEGEREMAPTPANSMHRSGSRPQLDVSKAEIQGNEEEKYPTILLP  86

Query  299  NQSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKRKRKVKE  421
            NQSDD+SHLALDIGGSLIKL YFS HE + V+DKRKR VKE
Sbjct  87   NQSDDLSHLALDIGGSLIKLVYFSRHEDQSVDDKRKRSVKE  127



>ref|XP_002279079.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
 ref|XP_010663163.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
 ref|XP_010663164.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
 ref|XP_010663165.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
 ref|XP_010663166.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
 ref|XP_010663167.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
 ref|XP_010663168.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
Length=906

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +2

Query  206  MHRSTSRPQLDLXGAAIQGN-FEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEG  382
            +HRS SRPQLDL GAAIQGN FE + PTI LPNQSDDISHLALDIGGSLIKL YFS HE 
Sbjct  45   IHRSGSRPQLDLSGAAIQGNNFEERHPTILLPNQSDDISHLALDIGGSLIKLVYFSRHED  104

Query  383  RQVEDKRKRKVKE  421
            R ++DKRKR +KE
Sbjct  105  RSIDDKRKRSIKE  117



>gb|KHG28314.1| hypothetical protein F383_13494 [Gossypium arboreum]
Length=950

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 74/100 (74%), Gaps = 5/100 (5%)
 Frame = +2

Query  122  LGIDDKNEKDNIAVLKRGGVEKEKEISPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPN  301
            +G D  N K+N     +GG EK+   + +HRS SRPQLDL  A IQGN E +DPTI LPN
Sbjct  38   IGEDSSNNKNN----NQGG-EKDMAGNSIHRSGSRPQLDLSKAEIQGNSEERDPTILLPN  92

Query  302  QSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKRKRKVKE  421
            Q+DDISHLALDIGGSLIKL YFS HE + V+DKRK+ VKE
Sbjct  93   QTDDISHLALDIGGSLIKLVYFSRHEDQSVDDKRKKTVKE  132



>emb|CBI15019.3| unnamed protein product [Vitis vinifera]
Length=988

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +2

Query  206  MHRSTSRPQLDLXGAAIQGN-FEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEG  382
            +HRS SRPQLDL GAAIQGN FE + PTI LPNQSDDISHLALDIGGSLIKL YFS HE 
Sbjct  9    IHRSGSRPQLDLSGAAIQGNNFEERHPTILLPNQSDDISHLALDIGGSLIKLVYFSRHED  68

Query  383  RQVEDKRKRKVKE  421
            R ++DKRKR +KE
Sbjct  69   RSIDDKRKRSIKE  81



>ref|XP_004298946.1| PREDICTED: pantothenate kinase 2 [Fragaria vesca subsp. vesca]
 ref|XP_011464015.1| PREDICTED: pantothenate kinase 2 [Fragaria vesca subsp. vesca]
Length=908

 Score =   115 bits (289),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 85/121 (70%), Gaps = 12/121 (10%)
 Frame = +2

Query  89   MAGVTTGDLPDLGIDDKNEKDNIA-----VLKRGGVEKEKEISP-----MHRSTSRPQLD  238
            MAG+T    P LG +D  ++  ++     V++ GG + EK+++P     +HRS SRPQLD
Sbjct  1    MAGLTQH--PILGSNDAIKEKPLSSLEDKVVESGGGQTEKDMAPVTGSSIHRSGSRPQLD  58

Query  239  LXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKRKRKVK  418
            L  AAIQG FE +DPTI LPNQSD +SHLALDIGGSLIKL YFS  E + ++DKRK+ +K
Sbjct  59   LSKAAIQGTFEERDPTILLPNQSDHLSHLALDIGGSLIKLVYFSRREDQAIDDKRKKTLK  118

Query  419  E  421
            E
Sbjct  119  E  119



>gb|KJB39190.1| hypothetical protein B456_007G001600 [Gossypium raimondii]
 gb|KJB39192.1| hypothetical protein B456_007G001600 [Gossypium raimondii]
Length=924

 Score =   115 bits (289),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +2

Query  206  MHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGR  385
            +HRS SRPQLDL  AAIQGN E +DPTI LPNQSDDISH ALDIGGSLIKL YFS HEG+
Sbjct  67   LHRSGSRPQLDLSKAAIQGNSEERDPTILLPNQSDDISHFALDIGGSLIKLVYFSRHEGQ  126

Query  386  QVEDKRKRKVKE  421
             ++DKRK+ VKE
Sbjct  127  SIDDKRKKTVKE  138



>ref|XP_008393029.1| PREDICTED: pantothenate kinase 2 [Malus domestica]
Length=907

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 79/118 (67%), Gaps = 7/118 (6%)
 Frame = +2

Query  89   MAGVTTGDLP----DLGIDDKNEKDNIAVLKRGGVE---KEKEISPMHRSTSRPQLDLXG  247
            MAG  T D+     + G  + N  ++  V++  G E      E   +H S SRPQLDL  
Sbjct  1    MAGFGTKDIKGREKEEGDKNSNTLESHVVIRTEGGEVGQSSSERDTIHXSGSRPQLDLSK  60

Query  248  AAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKRKRKVKE  421
            AAIQGNFE +DP I LPNQSDD+SHLALDIGGSLIKL YFS HEG+ ++DKRK+ +KE
Sbjct  61   AAIQGNFEERDPXILLPNQSDDLSHLALDIGGSLIKLVYFSRHEGQSIDDKRKKTLKE  118



>ref|XP_011001529.1| PREDICTED: pantothenate kinase 2-like [Populus euphratica]
 ref|XP_011001530.1| PREDICTED: pantothenate kinase 2-like [Populus euphratica]
Length=935

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 67/87 (77%), Gaps = 5/87 (6%)
 Frame = +2

Query  176  GVEKEKEISP-----MHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIG  340
            G + E+++ P     +HRS SRPQLDL  AAI+GNFE +DPTI LPNQSDDISHLALDIG
Sbjct  60   GGQGERDMVPPTSNSIHRSGSRPQLDLSKAAIEGNFEERDPTILLPNQSDDISHLALDIG  119

Query  341  GSLIKLXYFSXHEGRQVEDKRKRKVKE  421
            GSLIKL YFS H+ R   DKRK+ VKE
Sbjct  120  GSLIKLVYFSRHQDRPTNDKRKKTVKE  146



>ref|XP_002318651.1| hypothetical protein POPTR_0012s08310g [Populus trichocarpa]
 gb|EEE96871.1| hypothetical protein POPTR_0012s08310g [Populus trichocarpa]
Length=939

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +2

Query  200  SPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHE  379
            + +HRS SRPQLDL  AAI+GNFE +DPTI LPNQSDDISHLALDIGGSLIKL YFS H+
Sbjct  73   TSIHRSGSRPQLDLSKAAIEGNFEERDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHQ  132

Query  380  GRQVEDKRKRKVKE  421
             R   DKRK+ VKE
Sbjct  133  DRPTNDKRKKTVKE  146



>ref|XP_010037560.1| PREDICTED: pantothenate kinase 2 [Eucalyptus grandis]
 gb|KCW49279.1| hypothetical protein EUGRSUZ_K02840 [Eucalyptus grandis]
Length=915

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +2

Query  206  MHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGR  385
            +HRS+SRPQLDL  AAIQGNFE +DPTI LPNQSDDISHLALDIGGSLIKL YFS HE +
Sbjct  49   IHRSSSRPQLDLSKAAIQGNFEERDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEDQ  108

Query  386  QVEDKRKRKVK  418
               DKRK+ VK
Sbjct  109  STIDKRKKTVK  119



>gb|KCW49278.1| hypothetical protein EUGRSUZ_K02840 [Eucalyptus grandis]
Length=916

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +2

Query  206  MHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGR  385
            +HRS+SRPQLDL  AAIQGNFE +DPTI LPNQSDDISHLALDIGGSLIKL YFS HE +
Sbjct  49   IHRSSSRPQLDLSKAAIQGNFEERDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEDQ  108

Query  386  QVEDKRKRKVK  418
               DKRK+ VK
Sbjct  109  STIDKRKKTVK  119



>gb|KCW49280.1| hypothetical protein EUGRSUZ_K02840 [Eucalyptus grandis]
Length=906

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +2

Query  206  MHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGR  385
            +HRS+SRPQLDL  AAIQGNFE +DPTI LPNQSDDISHLALDIGGSLIKL YFS HE +
Sbjct  49   IHRSSSRPQLDLSKAAIQGNFEERDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEDQ  108

Query  386  QVEDKRKRKVK  418
               DKRK+ VK
Sbjct  109  STIDKRKKTVK  119



>ref|XP_007036235.1| Pantothenate kinase 2 isoform 2, partial [Theobroma cacao]
 gb|EOY20736.1| Pantothenate kinase 2 isoform 2, partial [Theobroma cacao]
Length=919

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 5/83 (6%)
 Frame = +2

Query  188  EKEISP-----MHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLI  352
            E++++P     +HRS SRPQLDL  AAIQG+ E +DPTI LPNQSDDISHLALDIGGSLI
Sbjct  60   ERDMAPPASNSIHRSGSRPQLDLSKAAIQGSSEERDPTILLPNQSDDISHLALDIGGSLI  119

Query  353  KLXYFSXHEGRQVEDKRKRKVKE  421
            KL YFS HE R ++DKRK+ VKE
Sbjct  120  KLVYFSRHEDRSIDDKRKKTVKE  142



>ref|XP_007036234.1| Pantothenate kinase 2 isoform 1 [Theobroma cacao]
 gb|EOY20735.1| Pantothenate kinase 2 isoform 1 [Theobroma cacao]
Length=973

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 5/83 (6%)
 Frame = +2

Query  188  EKEISP-----MHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLI  352
            E++++P     +HRS SRPQLDL  AAIQG+ E +DPTI LPNQSDDISHLALDIGGSLI
Sbjct  60   ERDMAPPASNSIHRSGSRPQLDLSKAAIQGSSEERDPTILLPNQSDDISHLALDIGGSLI  119

Query  353  KLXYFSXHEGRQVEDKRKRKVKE  421
            KL YFS HE R ++DKRK+ VKE
Sbjct  120  KLVYFSRHEDRSIDDKRKKTVKE  142



>ref|XP_010447427.1| PREDICTED: pantothenate kinase 2 isoform X1 [Camelina sativa]
Length=905

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 78/119 (66%), Gaps = 10/119 (8%)
 Frame = +2

Query  89   MAGVTTGDLPDLGIDDKNEKDNIAVLKRGGVEKEKE-------ISPMHRSTSRPQLDLXG  247
            MAG   GD  D  +DDK E +  + +  G  EK+          SP+HRS SRPQLDL  
Sbjct  1    MAG--PGDEHDPSLDDKKEAEAKSQVCVGVGEKDMSPSSSVPGTSPIHRSGSRPQLDLSK  58

Query  248  AAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQV-EDKRKRKVKE  421
            A IQGN E +DPTI LPNQSDDISHLALDIGGSLIKL YFS HE     +DKRKR +KE
Sbjct  59   AEIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLLYFSRHEDYSNDDDKRKRTIKE  117



>emb|CDX75226.1| BnaA01g04760D [Brassica napus]
Length=910

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 77/119 (65%), Gaps = 8/119 (7%)
 Frame = +2

Query  89   MAGVTTGDLPDLGIDDKNEKDNIAVLKRGGVEKEKEISP------MHRSTSRPQLDLXGA  250
            MAG    D  D  +DD  E +       GG   E++++P      +HRS SRPQLDL  A
Sbjct  1    MAGPGDDDEHDPILDDSIEAEAKTQTCVGGGSGERDMAPSAPGPSIHRSGSRPQLDLSKA  60

Query  251  AIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHE--GRQVEDKRKRKVKE  421
             IQGNFE +DPTI LPNQSDDISHLALDIGGSLIKL YFS HE      +DKRKR +KE
Sbjct  61   EIQGNFEERDPTILLPNQSDDISHLALDIGGSLIKLLYFSRHEEDYSNDDDKRKRTIKE  119



>ref|XP_009126332.1| PREDICTED: pantothenate kinase 2 [Brassica rapa]
Length=910

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 78/119 (66%), Gaps = 8/119 (7%)
 Frame = +2

Query  89   MAGVTTGDLPDLGIDDKNEKDNIAVLKRGGVEKEKEISP------MHRSTSRPQLDLXGA  250
            MAG    D  D  +DD  E +  +    GG   E++++P      +HRS SRPQLDL  A
Sbjct  1    MAGPGDDDEHDPILDDSIEAEVKSHAFVGGGSGERDMAPSAPGPSIHRSGSRPQLDLSKA  60

Query  251  AIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHE--GRQVEDKRKRKVKE  421
             IQGNFE +DPTI LPNQSDDISHLALDIGGSLIKL YFS HE      +DKRKR +KE
Sbjct  61   EIQGNFEERDPTILLPNQSDDISHLALDIGGSLIKLLYFSRHEEDYSNDDDKRKRTIKE  119



>ref|XP_011028555.1| PREDICTED: pantothenate kinase 2-like [Populus euphratica]
 ref|XP_011028556.1| PREDICTED: pantothenate kinase 2-like [Populus euphratica]
Length=936

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +2

Query  206  MHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGR  385
            +HRS SRPQLDL  AAI+G FE +DPTI LPNQSDDISHLALDIGGSLIKL YFS H+ R
Sbjct  76   IHRSGSRPQLDLSKAAIEGTFEERDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHQDR  135

Query  386  QVEDKRKRKVKE  421
               DKRK+ VKE
Sbjct  136  PTNDKRKKTVKE  147



>ref|XP_010437940.1| PREDICTED: pantothenate kinase 2-like [Camelina sativa]
Length=902

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 79/120 (66%), Gaps = 15/120 (13%)
 Frame = +2

Query  89   MAGVTTGDLPDLGIDDKNEKDNIAVLKRGGVEKEKEISP--------MHRSTSRPQLDLX  244
            MAG   GD  D  +DDK E +  + +  G    EK++SP        +HRS SRPQLDL 
Sbjct  1    MAG--PGDEHDPSLDDKKEAEAKSQVGVG----EKDMSPSSVPGTSSIHRSGSRPQLDLS  54

Query  245  GAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQV-EDKRKRKVKE  421
             A IQGN E +DPTI LPNQSDDISHLALDIGGSLIKL YFS HE     +DKRKR +KE
Sbjct  55   KAEIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLLYFSRHEDYSNDDDKRKRTIKE  114



>ref|XP_010432761.1| PREDICTED: pantothenate kinase 2-like [Camelina sativa]
Length=902

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 79/120 (66%), Gaps = 15/120 (13%)
 Frame = +2

Query  89   MAGVTTGDLPDLGIDDKNEKDNIAVLKRGGVEKEKEISP--------MHRSTSRPQLDLX  244
            MAG   GD  D  +DDK E +  + +  G    EK++SP        +HRS SRPQLDL 
Sbjct  1    MAG--PGDEHDPSLDDKKEAEAKSQVCVG----EKDMSPSSVPGTSSIHRSGSRPQLDLS  54

Query  245  GAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQV-EDKRKRKVKE  421
             A IQGN E +DPTI LPNQSDDISHLALDIGGSLIKL YFS HE     +DKRKR +KE
Sbjct  55   KAEIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLLYFSRHEDYSNDDDKRKRTIKE  114



>gb|KJB53157.1| hypothetical protein B456_008G295400 [Gossypium raimondii]
Length=867

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  206  MHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGR  385
            +HRS SRPQLDL  A IQGN E +DPTI LPNQ+DDISHLALDIGGSLIKL YFS HE +
Sbjct  6    IHRSGSRPQLDLSKAEIQGNSEERDPTILLPNQTDDISHLALDIGGSLIKLVYFSRHEDQ  65

Query  386  QVEDKRKRKVKE  421
             V+DKRK+ VKE
Sbjct  66   SVDDKRKKTVKE  77



>pir||T05410 hypothetical protein F10M6.180 - Arabidopsis thaliana
 emb|CAA16972.1| putative protein [Arabidopsis thaliana]
 emb|CAB79936.1| putative protein [Arabidopsis thaliana]
Length=838

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = +2

Query  128  IDDKNE---KDNIAVLKRGGVEKEKEISPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLP  298
            +D+K E   K  ++V     +      +P+HRS SRPQLDL  A IQGN E +DPTI LP
Sbjct  12   LDNKREAEAKSQVSVAADKNMAPSTSGTPIHRSGSRPQLDLSKAEIQGNLEERDPTILLP  71

Query  299  NQSDDISHLALDIGGSLIKLXYFSXHEGRQV-EDKRKRKVKE  421
            NQSDDISHLALDIGGSLIKL YFS HE     +DKRKR +KE
Sbjct  72   NQSDDISHLALDIGGSLIKLLYFSRHEDYSNDDDKRKRTIKE  113



>ref|NP_001031768.1| pantothenate kinase 2 [Arabidopsis thaliana]
 ref|NP_001119092.1| pantothenate kinase 2 [Arabidopsis thaliana]
 gb|AEE86016.1| pantothenate kinase 2 [Arabidopsis thaliana]
 gb|AEE86017.1| pantothenate kinase 2 [Arabidopsis thaliana]
Length=783

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = +2

Query  128  IDDKNE---KDNIAVLKRGGVEKEKEISPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLP  298
            +D+K E   K  ++V     +      +P+HRS SRPQLDL  A IQGN E +DPTI LP
Sbjct  12   LDNKREAEAKSQVSVAADKNMAPSTSGTPIHRSGSRPQLDLSKAEIQGNLEERDPTILLP  71

Query  299  NQSDDISHLALDIGGSLIKLXYFSXHEGRQV-EDKRKRKVKE  421
            NQSDDISHLALDIGGSLIKL YFS HE     +DKRKR +KE
Sbjct  72   NQSDDISHLALDIGGSLIKLLYFSRHEDYSNDDDKRKRTIKE  113



>ref|XP_003601259.1| Pantothenate kinase [Medicago truncatula]
 gb|AES71510.1| pantothenate kinase [Medicago truncatula]
Length=893

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 70/100 (70%), Gaps = 7/100 (7%)
 Frame = +2

Query  122  LGIDDKNEKDNIAVLKRGGVEKEKEISPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPN  301
            LGID+    +N   +   G       +P+HRS+SRPQLD+  A IQ N E K PTI LPN
Sbjct  15   LGIDESEGHNNTNNMAPTG-------NPIHRSSSRPQLDVSKAEIQSNVEDKYPTILLPN  67

Query  302  QSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKRKRKVKE  421
            QSDD+SHLALDIGGSLIKL YFS HEG+  +DKRK+ +KE
Sbjct  68   QSDDLSHLALDIGGSLIKLVYFSRHEGQSDDDKRKKTLKE  107



>ref|NP_194945.3| pantothenate kinase 2 [Arabidopsis thaliana]
 sp|Q8L5Y9.2|PANK2_ARATH RecName: Full=Pantothenate kinase 2; Short=AtPANK2; AltName: 
Full=Pantothenic acid kinase 2 [Arabidopsis thaliana]
 gb|AEE86015.1| pantothenate kinase 2 [Arabidopsis thaliana]
Length=901

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = +2

Query  128  IDDKNE---KDNIAVLKRGGVEKEKEISPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLP  298
            +D+K E   K  ++V     +      +P+HRS SRPQLDL  A IQGN E +DPTI LP
Sbjct  12   LDNKREAEAKSQVSVAADKNMAPSTSGTPIHRSGSRPQLDLSKAEIQGNLEERDPTILLP  71

Query  299  NQSDDISHLALDIGGSLIKLXYFSXHEGRQV-EDKRKRKVKE  421
            NQSDDISHLALDIGGSLIKL YFS HE     +DKRKR +KE
Sbjct  72   NQSDDISHLALDIGGSLIKLLYFSRHEDYSNDDDKRKRTIKE  113



>ref|XP_010101220.1| Pantothenate kinase 2 [Morus notabilis]
 gb|EXB87894.1| Pantothenate kinase 2 [Morus notabilis]
Length=912

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = +2

Query  200  SPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDI-SHLALDIGGSLIKLXYFSXH  376
            S +HRS+SRPQLDL  AAIQGN E +DPTI LPNQSDDI SHLALDIGGSLIKL YFS H
Sbjct  49   SSIHRSSSRPQLDLSKAAIQGNSEERDPTILLPNQSDDISSHLALDIGGSLIKLVYFSRH  108

Query  377  EGRQVEDKRKRKVKE  421
            E    +DKRK+ VKE
Sbjct  109  EDHSTDDKRKKNVKE  123



>ref|XP_002867254.1| ATPANK2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43513.1| ATPANK2 [Arabidopsis lyrata subsp. lyrata]
Length=902

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 72/103 (70%), Gaps = 5/103 (5%)
 Frame = +2

Query  128  IDDKNEKDNIAVLKRGGVEKEKEISP----MHRSTSRPQLDLXGAAIQGNFEXKDPTIQL  295
            +DDK E +  + +  GG E++   S     +HRS SRPQLDL  A IQGN E +DPTI L
Sbjct  12   LDDKKEAEAKSEVCVGGGERDMAPSTSGTSIHRSGSRPQLDLSKAEIQGNLEERDPTILL  71

Query  296  PNQSDDISHLALDIGGSLIKLXYFSXHEGRQVE-DKRKRKVKE  421
            PNQSDDISHLALDIGGSLIKL YFS HE    + DKRKR +KE
Sbjct  72   PNQSDDISHLALDIGGSLIKLLYFSRHEDYSNDGDKRKRTIKE  114



>emb|CDX68824.1| BnaC01g06290D [Brassica napus]
Length=906

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 73/106 (69%), Gaps = 11/106 (10%)
 Frame = +2

Query  128  IDDKNEKDNIAVLKRGGVEKEKEISP------MHRSTSRPQLDLXGAAIQGNFEXKDPTI  289
            +DD  E + I+    GG   E++++P      +HRS SRPQLDL  A IQGN E +DPTI
Sbjct  13   LDDNREAEAISQACVGG---ERDMAPSAPGPSIHRSGSRPQLDLSKAEIQGNLEERDPTI  69

Query  290  QLPNQSDDISHLALDIGGSLIKLXYFSXHE--GRQVEDKRKRKVKE  421
             LPNQSDDISHLALDIGGSLIKL YFS HE      +DKRKR +KE
Sbjct  70   LLPNQSDDISHLALDIGGSLIKLLYFSRHEEDYSNDDDKRKRTIKE  115



>ref|XP_006412505.1| hypothetical protein EUTSA_v10024357mg [Eutrema salsugineum]
 gb|ESQ53958.1| hypothetical protein EUTSA_v10024357mg [Eutrema salsugineum]
Length=901

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = +2

Query  200  SPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHE  379
            S +HRS SRPQLDL  A IQGNFE +DPTI LPNQSDDISHLALDIGGSLIKL YFS HE
Sbjct  36   SSIHRSGSRPQLDLSKAEIQGNFEERDPTILLPNQSDDISHLALDIGGSLIKLLYFSRHE  95

Query  380  GRQV-EDKRKRKVKE  421
                 +DKRKR +KE
Sbjct  96   DYSNDDDKRKRTIKE  110



>gb|AAM20690.1| putative protein [Arabidopsis thaliana]
Length=870

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = +2

Query  200  SPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHE  379
            +P+HRS SRPQLDL  A IQGN E +DPTI LPNQSDDISHLALDIGGSLIKL YFS HE
Sbjct  8    TPIHRSGSRPQLDLSKAEIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLLYFSRHE  67

Query  380  GRQV-EDKRKRKVKE  421
                 +DKRKR +KE
Sbjct  68   DYSNDDDKRKRTIKE  82



>ref|XP_003542534.2| PREDICTED: pantothenate kinase 2-like isoform X1 [Glycine max]
Length=910

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +2

Query  206  MHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGR  385
            +HRS SRPQLD+  A IQGN E K PTI LPNQSDD+SHLALDIGGSLIKL YFS HE +
Sbjct  57   IHRSGSRPQLDVSKAEIQGNVEEKYPTILLPNQSDDLSHLALDIGGSLIKLVYFSRHEDQ  116

Query  386  QVEDKRKRKVKE  421
              +DKRKR VKE
Sbjct  117  SADDKRKRSVKE  128



>gb|KHN48232.1| Pantothenate kinase 2 [Glycine soja]
Length=868

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +2

Query  206  MHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGR  385
            +HRS SRPQLD+  A IQGN E K PTI LPNQSDD+SHLALDIGGSLIKL YFS HE +
Sbjct  9    IHRSGSRPQLDVSKAEIQGNVEEKYPTILLPNQSDDLSHLALDIGGSLIKLVYFSRHEDQ  68

Query  386  QVEDKRKRKVKE  421
              +DKRKR VKE
Sbjct  69   SADDKRKRSVKE  80



>ref|XP_006594169.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Glycine max]
Length=920

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +2

Query  206  MHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGR  385
            +HRS SRPQLD+  A IQGN E K PTI LPNQSDD+SHLALDIGGSLIKL YFS HE +
Sbjct  57   IHRSGSRPQLDVSKAEIQGNVEEKYPTILLPNQSDDLSHLALDIGGSLIKLVYFSRHEDQ  116

Query  386  QVEDKRKRKVKE  421
              +DKRKR VKE
Sbjct  117  SADDKRKRSVKE  128



>gb|KHN19302.1| Pantothenate kinase 2 [Glycine soja]
Length=498

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  200  SPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHE  379
            + +HRS SRPQLD+  A IQGN E K PTI LPNQSDD+SHLALDIGGSLIKL YFS HE
Sbjct  51   NSIHRSGSRPQLDVSKAEIQGNVEEKYPTILLPNQSDDLSHLALDIGGSLIKLVYFSRHE  110

Query  380  GRQVEDKRKRKVKE  421
             +  +DKRKR +KE
Sbjct  111  DQSWDDKRKRSMKE  124



>ref|XP_009108890.1| PREDICTED: pantothenate kinase 2 [Brassica rapa]
 emb|CDY61390.1| BnaA08g30620D [Brassica napus]
Length=899

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 71/105 (68%), Gaps = 15/105 (14%)
 Frame = +2

Query  128  IDDKNEKDNIAVLKRGGVEKEKEISP------MHRSTSRPQLDLXGAAIQGNFEXKDPTI  289
            +DDK E +            E++++P      +HRS SRPQLDL  A IQGNFE +DPTI
Sbjct  14   LDDKTEAE--------AKSSERDMAPQGPGTSIHRSGSRPQLDLSKAEIQGNFEERDPTI  65

Query  290  QLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQV-EDKRKRKVKE  421
             LPNQSDDISHLALDIGGSLIKL YFS HE     +DKRK+ +KE
Sbjct  66   LLPNQSDDISHLALDIGGSLIKLLYFSRHEDYSNDDDKRKKTIKE  110



>ref|XP_010534230.1| PREDICTED: pantothenate kinase 2 [Tarenaya hassleriana]
 ref|XP_010534231.1| PREDICTED: pantothenate kinase 2 [Tarenaya hassleriana]
 ref|XP_010534232.1| PREDICTED: pantothenate kinase 2 [Tarenaya hassleriana]
Length=923

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +2

Query  206  MHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGR  385
            +HRS SRPQLDL  AAIQG+ E +DPTI LPNQSDDISHLALDIGGSLIKL YFS HE  
Sbjct  63   IHRSGSRPQLDLSKAAIQGSSEERDPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEDY  122

Query  386  QVEDKRKRKVKE  421
              +DKRK+ +KE
Sbjct  123  SNDDKRKKTIKE  134



>ref|XP_006840740.1| hypothetical protein AMTR_s00096p00130150 [Amborella trichopoda]
 gb|ERN02415.1| hypothetical protein AMTR_s00096p00130150 [Amborella trichopoda]
Length=919

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  200  SPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHE  379
            + MHRS SRPQLDL GAAIQGNFE ++P I LPNQSDDIS +ALDIGGSLIKL YFS HE
Sbjct  52   ASMHRSGSRPQLDLSGAAIQGNFEERNPIILLPNQSDDISCMALDIGGSLIKLVYFSRHE  111

Query  380  GRQVEDKRKRKVKE  421
                +DKRK+ +K+
Sbjct  112  DNPHKDKRKKYMKQ  125



>ref|XP_006282554.1| hypothetical protein CARUB_v10004099mg [Capsella rubella]
 gb|EOA15452.1| hypothetical protein CARUB_v10004099mg [Capsella rubella]
Length=905

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 64/85 (75%), Gaps = 7/85 (8%)
 Frame = +2

Query  188  EKEISP------MHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSL  349
            EK+++P      +HRS SRPQLDL  A IQGN E +DPTI LPNQSDDISHLALDIGGSL
Sbjct  33   EKDMAPSASGTSIHRSGSRPQLDLSKAEIQGNLEERDPTILLPNQSDDISHLALDIGGSL  92

Query  350  IKLXYFSXHEGRQV-EDKRKRKVKE  421
            IKL YFS HE     +DKRKR +KE
Sbjct  93   IKLLYFSRHEDYSNDDDKRKRTIKE  117



>ref|XP_003528148.1| PREDICTED: pantothenate kinase 2-like [Glycine max]
Length=912

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +2

Query  206  MHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGR  385
            +HRS SRPQLD+  A IQGN E K PTI LPNQSDD+SHLALDIGGSLIKL YFS HE +
Sbjct  53   IHRSGSRPQLDVSKAEIQGNVEEKYPTILLPNQSDDLSHLALDIGGSLIKLVYFSRHEDQ  112

Query  386  QVEDKRKRKVKE  421
              +DKRKR +KE
Sbjct  113  SWDDKRKRSMKE  124



>ref|XP_006579568.1| PREDICTED: pantothenate kinase 2-like [Glycine max]
Length=246

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +2

Query  206  MHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGR  385
            MHRS+SRPQLDL  A IQGNFE K PTI LPNQS DISHLALDIGGSLIKL YFS H  +
Sbjct  1    MHRSSSRPQLDLSKAEIQGNFEEKYPTILLPNQSHDISHLALDIGGSLIKLVYFSRHRDQ  60

Query  386  QVEDKRKRKV  415
               DKR   V
Sbjct  61   STYDKRMINV  70



>gb|KHN34316.1| Pantothenate kinase 2 [Glycine soja]
Length=325

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +2

Query  206  MHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGR  385
            MHRS+SRPQLDL  A IQGNFE K PTI LPNQS DISHLALDIGGSLIKL YFS H  +
Sbjct  1    MHRSSSRPQLDLSKAEIQGNFEEKYPTILLPNQSHDISHLALDIGGSLIKLVYFSRHRDQ  60

Query  386  QVEDKRKRKV  415
               DKR   V
Sbjct  61   STYDKRMINV  70



>ref|XP_004501924.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Cicer arietinum]
 ref|XP_004501925.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Cicer arietinum]
 ref|XP_004501926.1| PREDICTED: pantothenate kinase 2-like isoform X3 [Cicer arietinum]
 ref|XP_004501927.1| PREDICTED: pantothenate kinase 2-like isoform X4 [Cicer arietinum]
Length=910

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 63/83 (76%), Gaps = 5/83 (6%)
 Frame = +2

Query  188  EKEISP-----MHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLI  352
            EK++ P     +HRS+SRPQLD+  A IQ N E K PTI LPNQSDD+SHLALDIGGSLI
Sbjct  41   EKDMPPASGNSIHRSSSRPQLDVSKAEIQSNVEDKYPTILLPNQSDDLSHLALDIGGSLI  100

Query  353  KLXYFSXHEGRQVEDKRKRKVKE  421
            KL YFS HEG   +DKRK+ +KE
Sbjct  101  KLVYFSRHEGHSDDDKRKKSLKE  123



>ref|XP_010936708.1| PREDICTED: pantothenate kinase 2-like [Elaeis guineensis]
Length=903

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 64/85 (75%), Gaps = 5/85 (6%)
 Frame = +2

Query  182  EKEKEISPM-----HRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGS  346
            E+ KEISPM     H+S+ RPQLDL  A I+  +E ++PTI LPNQSDDISHLALDIGGS
Sbjct  26   EETKEISPMSLNPMHQSSLRPQLDLTRATIEDKWEERNPTILLPNQSDDISHLALDIGGS  85

Query  347  LIKLXYFSXHEGRQVEDKRKRKVKE  421
            LIKL YFS HE    +DKRKR +K+
Sbjct  86   LIKLVYFSRHEEHSPDDKRKRSIKK  110



>ref|XP_008782481.1| PREDICTED: pantothenate kinase 2-like [Phoenix dactylifera]
 ref|XP_008782482.1| PREDICTED: pantothenate kinase 2-like [Phoenix dactylifera]
 ref|XP_008782483.1| PREDICTED: pantothenate kinase 2-like [Phoenix dactylifera]
Length=904

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 65/85 (76%), Gaps = 5/85 (6%)
 Frame = +2

Query  182  EKEKEIS-----PMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGS  346
            E+ KEIS     PMH+S+  PQLDL  AAI+GN+E ++PTI LPNQSDDISHLA+DIGGS
Sbjct  26   EEMKEISLASLNPMHQSSLWPQLDLTRAAIKGNWEERNPTILLPNQSDDISHLAVDIGGS  85

Query  347  LIKLXYFSXHEGRQVEDKRKRKVKE  421
            LIKL YFS HE    +DKRK  +K+
Sbjct  86   LIKLVYFSRHEEHSPDDKRKISIKK  110



>ref|XP_003576771.1| PREDICTED: pantothenate kinase 2 [Brachypodium distachyon]
Length=912

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +2

Query  170  RGGVEKEKEISPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSL  349
            +G        + +HRS SRPQLDL GAAI G  E ++PTI LPNQSDDISHLALDIGGSL
Sbjct  30   KGKAPASASTTMLHRSGSRPQLDLSGAAIHGTLEDRNPTILLPNQSDDISHLALDIGGSL  89

Query  350  IKLXYFSXHEGRQVEDKRKRKVK  418
            IKL YFS H  +  EDKRK   K
Sbjct  90   IKLVYFSRHADQPTEDKRKISTK  112



>gb|KFK29830.1| hypothetical protein AALP_AA7G184400 [Arabis alpina]
Length=891

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +2

Query  200  SPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHE  379
            + + RS SRPQLDL  A IQGNFE +DPTI LPNQSDDISHLALDIGGSLIKL YFS HE
Sbjct  25   TSITRSGSRPQLDLSKAEIQGNFEERDPTILLPNQSDDISHLALDIGGSLIKLLYFSRHE  84

Query  380  GRQV-EDKRKRKVKE  421
                 +DKRKR +KE
Sbjct  85   DYANDDDKRKRTIKE  99



>gb|EMT07573.1| Pantothenate kinase 2 [Aegilops tauschii]
Length=832

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +2

Query  206  MHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGR  385
            M+RS SRPQLDL GAAI G  E ++PTI LPNQSDDISHLALDIGGSLIKL YFS H  +
Sbjct  1    MNRSGSRPQLDLSGAAIHGTLEDRNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHADQ  60

Query  386  QVEDKRKRKVK  418
              EDKRK   K
Sbjct  61   PTEDKRKLSTK  71



>ref|XP_006840737.1| hypothetical protein AMTR_s00096p00126400 [Amborella trichopoda]
 gb|ERN02412.1| hypothetical protein AMTR_s00096p00126400 [Amborella trichopoda]
Length=516

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 62/85 (73%), Gaps = 4/85 (5%)
 Frame = +2

Query  179  VEKEKEI----SPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGS  346
            +E+E E+    + M RS SRPQLDL GAAIQGNFE + PTI LPNQ DDIS +ALDIGGS
Sbjct  27   LEREGEMVLAAASMRRSGSRPQLDLSGAAIQGNFEERSPTILLPNQFDDISRMALDIGGS  86

Query  347  LIKLXYFSXHEGRQVEDKRKRKVKE  421
            LIKL YFS HE    +DK+   +K+
Sbjct  87   LIKLVYFSRHEESSTKDKKNGHLKK  111



>gb|EEC84941.1| hypothetical protein OsI_32156 [Oryza sativa Indica Group]
Length=903

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +2

Query  212  RSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQV  391
            RS SRPQLDL GAAI GN E ++PTI LPNQSDDISHLALDIGGSLIKL YFS H     
Sbjct  48   RSGSRPQLDLSGAAIHGNLEDRNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHAEHSS  107

Query  392  EDKRKRKVK  418
            EDKRK   K
Sbjct  108  EDKRKLSTK  116



>sp|Q0J035.2|PANK2_ORYSJ RecName: Full=Pantothenate kinase 2; AltName: Full=Pantothenic 
acid kinase 2 [Oryza sativa Japonica Group]
Length=904

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +2

Query  212  RSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQV  391
            RS SRPQLDL GAAI GN E ++PTI LPNQSDDISHLALDIGGSLIKL YFS H     
Sbjct  49   RSGSRPQLDLSGAAIHGNLEDRNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHAEHSS  108

Query  392  EDKRKRKVK  418
            EDKRK   K
Sbjct  109  EDKRKLSTK  117



>ref|XP_004957459.1| PREDICTED: pantothenate kinase 2-like [Setaria italica]
Length=897

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +2

Query  212  RSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQV  391
            RS+SRPQLDL GAAI G  E ++PTI LPNQSDDISHLALDIGGSLIKL YFS H     
Sbjct  42   RSSSRPQLDLSGAAIHGTLEDRNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHAELST  101

Query  392  EDKRKRKVK  418
            EDKRK   K
Sbjct  102  EDKRKISTK  110



>ref|XP_002460569.1| hypothetical protein SORBIDRAFT_02g030920 [Sorghum bicolor]
 gb|EER97090.1| hypothetical protein SORBIDRAFT_02g030920 [Sorghum bicolor]
Length=902

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +2

Query  212  RSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQV  391
            RS+SRPQLDL GAAI G  E ++PTI LPNQSDDISHLALDIGGSLIKL YFS H     
Sbjct  47   RSSSRPQLDLSGAAIHGTLEDRNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHAELST  106

Query  392  EDKRKRKVK  418
            EDKRK   K
Sbjct  107  EDKRKISTK  115



>tpg|DAA62461.1| TPA: hypothetical protein ZEAMMB73_754388 [Zea mays]
Length=477

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +2

Query  212  RSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQV  391
            RS+SRPQLDL GAAI G  E ++PTI LPNQSDDISHLALDIGGSLIKL YFS H     
Sbjct  48   RSSSRPQLDLSGAAIHGTLEDRNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHAELST  107

Query  392  EDKRKRKVK  418
            EDK K   K
Sbjct  108  EDKHKISTK  116



>ref|XP_008652990.1| PREDICTED: pantothenate kinase 2 [Zea mays]
 ref|XP_008652991.1| PREDICTED: pantothenate kinase 2 [Zea mays]
 ref|XP_008652992.1| PREDICTED: pantothenate kinase 2 [Zea mays]
 ref|XP_008652993.1| PREDICTED: pantothenate kinase 2 [Zea mays]
Length=903

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +2

Query  212  RSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQV  391
            RS+SRPQLDL GAAI G  E ++PTI LPNQSDDISHLALDIGGSLIKL YFS H     
Sbjct  48   RSSSRPQLDLSGAAIHGTLEDRNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHAELST  107

Query  392  EDKRKRKVK  418
            EDK K   K
Sbjct  108  EDKHKISTK  116



>ref|XP_006660887.1| PREDICTED: pantothenate kinase 2-like [Oryza brachyantha]
Length=859

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +2

Query  212  RSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQV  391
            RS SRPQLDL GAAI G  E ++PTI LPNQSDDISHLALDIGGSLIKL YFS H     
Sbjct  4    RSGSRPQLDLSGAAIHGTSEDRNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHAEHSN  63

Query  392  EDKRKRKVK  418
            EDKRK   K
Sbjct  64   EDKRKMSTK  72



>ref|XP_009403915.1| PREDICTED: pantothenate kinase 2 [Musa acuminata subsp. malaccensis]
 ref|XP_009403916.1| PREDICTED: pantothenate kinase 2 [Musa acuminata subsp. malaccensis]
Length=899

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  206  MHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGR  385
            MHRS+SRPQLD+  AAIQ + E ++PTI LPNQSDDISHLALDIGGSLIKL YFS HE +
Sbjct  35   MHRSSSRPQLDVSRAAIQEDSEDRNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEEQ  94

Query  386  QVEDKRK  406
              +DKR+
Sbjct  95   SPDDKRR  101



>ref|XP_007155432.1| hypothetical protein PHAVU_003G200700g [Phaseolus vulgaris]
 gb|ESW27426.1| hypothetical protein PHAVU_003G200700g [Phaseolus vulgaris]
Length=867

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +2

Query  200  SPMHRSTSRPQL-DLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXH  376
            S MH S+SRPQL DL  A IQGN E K P+I LPNQS DIS+LALDIGGSLIKL YFS H
Sbjct  7    SSMHGSSSRPQLLDLSKAEIQGNVEEKYPSILLPNQSHDISYLALDIGGSLIKLMYFSRH  66

Query  377  EGRQVEDKRKRKVK  418
            + +   DKR R VK
Sbjct  67   QDQSTNDKRMRNVK  80



>gb|KHN18454.1| Pantothenate kinase 2 [Glycine soja]
Length=755

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +2

Query  224  RPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKR  403
            RPQLDL  A IQGNFE K PTI LPNQS DISHLALDIGGSLIKL YFS H+ +   DKR
Sbjct  48   RPQLDLSKAEIQGNFEEKYPTILLPNQSHDISHLALDIGGSLIKLVYFSRHQDQSTYDKR  107

Query  404  KRKVK  418
             + VK
Sbjct  108  VKNVK  112



>ref|XP_006600640.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Glycine max]
Length=901

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +2

Query  224  RPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKR  403
            RPQLDL  A IQGNFE K PTI LPNQS DISHLALDIGGSLIKL YFS H+ +   DKR
Sbjct  48   RPQLDLSKAEIQGNFEEKYPTILLPNQSHDISHLALDIGGSLIKLVYFSRHQDQSTYDKR  107

Query  404  KRKVK  418
             + VK
Sbjct  108  VKNVK  112



>ref|XP_006600639.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Glycine max]
Length=902

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +2

Query  224  RPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKR  403
            RPQLDL  A IQGNFE K PTI LPNQS DISHLALDIGGSLIKL YFS H+ +   DKR
Sbjct  48   RPQLDLSKAEIQGNFEEKYPTILLPNQSHDISHLALDIGGSLIKLVYFSRHQDQSTYDKR  107

Query  404  KRKVK  418
             + VK
Sbjct  108  VKNVK  112



>ref|XP_006477543.1| PREDICTED: pantothenate kinase 2-like [Citrus sinensis]
Length=865

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +2

Query  188  EKEISPMHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYF  367
            E+E+  MHRS SRPQLDL  AAIQGNFE KDPTI LPNQSDDISHLALDIGG  + L + 
Sbjct  61   EREMPSMHRSGSRPQLDLSKAAIQGNFEVKDPTILLPNQSDDISHLALDIGGDTLILLWL  120



>gb|EMS60500.1| Pantothenate kinase 2 [Triticum urartu]
Length=828

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  227  PQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKRK  406
            P LDL GAAI G  E ++PTI LPNQSDDISHLALDIGGSLIKL YFS H  +  EDKRK
Sbjct  33   PVLDLSGAAIHGTLEDRNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHADQPTEDKRK  92

Query  407  RKVK  418
               K
Sbjct  93   LSTK  96



>gb|EEE70109.1| hypothetical protein OsJ_30119 [Oryza sativa Japonica Group]
Length=872

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +2

Query  233  LDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKRKRK  412
            LDL GAAI GN E ++PTI LPNQSDDISHLALDIGGSLIKL YFS H     EDKRK  
Sbjct  24   LDLSGAAIHGNLEDRNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHAEHSSEDKRKLS  83

Query  413  VK  418
             K
Sbjct  84   TK  85



>gb|ACN39905.1| unknown [Picea sitchensis]
Length=895

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 55/75 (73%), Gaps = 6/75 (8%)
 Frame = +2

Query  212  RSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXH-----  376
            RS+SRPQLD+ GAAIQGN E ++PTI LPNQ+DDISH A+D+GGSLIKL YFS H     
Sbjct  38   RSSSRPQLDVSGAAIQGNSEDRNPTILLPNQTDDISHFAVDLGGSLIKLVYFSRHGELPA  97

Query  377  -EGRQVEDKRKRKVK  418
              G  V  +RK  ++
Sbjct  98   GHGGSVVRRRKEMIE  112



>ref|XP_006374525.1| hypothetical protein POPTR_0015s08840g [Populus trichocarpa]
 gb|ERP52322.1| hypothetical protein POPTR_0015s08840g [Populus trichocarpa]
Length=198

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  206  MHRSTSRPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGG  343
            +HRS SRPQLDL  AAI+G FE +DPTI LPNQSDDISHLALDIGG
Sbjct  81   IHRSGSRPQLDLSKAAIEGTFEERDPTILLPNQSDDISHLALDIGG  126



>ref|XP_001768633.1| predicted protein [Physcomitrella patens]
 gb|EDQ66571.1| predicted protein, partial [Physcomitrella patens]
Length=126

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  224  RPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKR  403
            RP LDL GAAIQG+ E ++P+I LPNQ+++ISH A+D+GGSLIK+ YFS    R+  +  
Sbjct  23   RPVLDLRGAAIQGSHEDRNPSILLPNQTEEISHFAVDLGGSLIKVVYFSRRADREATNSG  82

Query  404  KRKV  415
             R +
Sbjct  83   NRAL  86



>ref|XP_001757682.1| predicted protein [Physcomitrella patens]
 gb|EDQ77322.1| predicted protein [Physcomitrella patens]
Length=884

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +2

Query  203  PMHRSTS--RPQLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXH  376
            P+   TS  RP LDL GAAIQG+ E K+P+I LPNQS++ISH A+D+GGSLIKL YFS  
Sbjct  14   PVSSRTSPIRPLLDLSGAAIQGSREDKNPSIVLPNQSEEISHFAVDLGGSLIKLVYFSRR  73

Query  377  EGRQVEDKRKRKV  415
              R+  +   R +
Sbjct  74   ADRETTNSGNRAL  86



>ref|XP_008789287.1| PREDICTED: pantothenate kinase 1-like [Phoenix dactylifera]
Length=628

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  230  QLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFS  370
            +L+L GA I GN + ++P I LPNQ  D S LALDIGG+LIKL YFS
Sbjct  7    KLELSGAEISGNLDERNPPICLPNQPSDASLLALDIGGTLIKLVYFS  53



>ref|XP_010932472.1| PREDICTED: pantothenate kinase 1 isoform X2 [Elaeis guineensis]
Length=526

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  230  QLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFS  370
            +L+L GA I GN + ++P ++LPNQ  D S LALDIGG+LIKL YFS
Sbjct  7    KLELSGAEIFGNLDERNPPVRLPNQPSDASLLALDIGGTLIKLVYFS  53



>ref|XP_010932471.1| PREDICTED: pantothenate kinase 1 isoform X1 [Elaeis guineensis]
Length=669

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  230  QLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFS  370
            +L+L GA I GN + ++P ++LPNQ  D S LALDIGG+LIKL YFS
Sbjct  7    KLELSGAEIFGNLDERNPPVRLPNQPSDASLLALDIGGTLIKLVYFS  53



>ref|XP_009419129.1| PREDICTED: pantothenate kinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=662

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  230  QLDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKRKR  409
             L+L GA I+G+ + ++P I LPNQ  D S LALDIGG+LIKL YFS      V+ +R+R
Sbjct  7    NLNLGGAEIRGDPDERNPPIFLPNQPPDSSLLALDIGGTLIKLVYFSEGLLHFVKFERRR  66



>ref|XP_005849803.1| hypothetical protein CHLNCDRAFT_34679 [Chlorella variabilis]
 gb|EFN57701.1| hypothetical protein CHLNCDRAFT_34679 [Chlorella variabilis]
Length=815

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +2

Query  281  PTIQLPNQSDDISHLALDIGGSLIKLXYF  367
            P I LP+QSD +SH+ALDIGGSLIKL YF
Sbjct  19   PCIVLPHQSDYVSHIALDIGGSLIKLIYF  47



>gb|AFW85383.1| hypothetical protein ZEAMMB73_434998 [Zea mays]
Length=447

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  233  LDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEG  382
            +DL GA I+G+ E ++P I LP Q      LALDIGG+LIKL Y +   G
Sbjct  12   VDLSGAEIRGDLEDRNPPIFLPRQPAASPLLALDIGGTLIKLVYTASRGG  61



>ref|NP_001147318.1| LOC100280926 [Zea mays]
 gb|ACG26766.1| pantothenate kinase family protein [Zea mays]
 gb|AFW85384.1| pantothenate kinase family protein [Zea mays]
Length=656

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  233  LDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEG  382
            +DL GA I+G+ E ++P I LP Q      LALDIGG+LIKL Y +   G
Sbjct  12   VDLSGAEIRGDLEDRNPPIFLPRQPAASPLLALDIGGTLIKLVYTASRGG  61



>gb|KDD75300.1| fumble, partial [Helicosporidium sp. ATCC 50920]
Length=307

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  281  PTIQLPNQSDDISHLALDIGGSLIKLXYFS  370
            P I LPNQS+++S +ALDIGGSLIKL YF+
Sbjct  14   PCIVLPNQSEEVSLVALDIGGSLIKLVYFT  43



>ref|XP_009621068.1| PREDICTED: pantothenate kinase 1 [Nicotiana tomentosiformis]
Length=430

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = +2

Query  254  IQGNFEXKDPTIQLPNQS-DDISHLALDIGGSLIKLXYFSXHEGRQVEDK  400
            I G  E  D T +L  QS D+ISHLA+DIGGSLIK+ YFS +      D+
Sbjct  6    IDGKLENTDSTSELIKQSADEISHLAIDIGGSLIKIVYFSTNSKCSTNDE  55



>ref|XP_635721.1| pantothenate kinase [Dictyostelium discoideum AX4]
 gb|EAL62216.1| pantothenate kinase [Dictyostelium discoideum AX4]
Length=685

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 30/52 (58%), Gaps = 7/52 (13%)
 Frame = +2

Query  266  FEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKRKRKVKE  421
            F  KD  I LPNQS  I H ALDIGG+L KL YF       V++K K  V E
Sbjct  220  FNPKDRPISLPNQSGPIKHFALDIGGTLAKLVYF-------VQNKDKSNVNE  264



>ref|XP_002507494.1| pantothenate kinase [Micromonas sp. RCC299]
 gb|ACO68752.1| pantothenate kinase [Micromonas sp. RCC299]
Length=940

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +2

Query  281  PTIQLPNQSDDISHLALDIGGSLIKLXYFS  370
            P+I LP QS D+ H A+D+GGSL+KL YFS
Sbjct  60   PSITLPRQSSDVRHFAMDMGGSLVKLVYFS  89



>ref|XP_005649526.1| fumble-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE24982.1| fumble-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=890

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 7/64 (11%)
 Frame = +2

Query  200  SPMHRSTSRPQLDLXGAAI--QGNFEXKD-PTIQLPNQSDD-ISHLALDIGGSLIKLXYF  367
            SP  RS +   LDL  A I  Q + + +D P+I LP+Q+ + ISH+A+DIGGSLIKL YF
Sbjct  40   SPSKRSAA---LDLTDAVISLQTDPKRRDAPSIVLPHQNAEFISHIAIDIGGSLIKLVYF  96

Query  368  SXHE  379
            S  +
Sbjct  97   SPED  100



>ref|XP_002951581.1| hypothetical protein VOLCADRAFT_61514 [Volvox carteri f. nagariensis]
 gb|EFJ47392.1| hypothetical protein VOLCADRAFT_61514 [Volvox carteri f. nagariensis]
Length=842

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 28/31 (90%), Gaps = 1/31 (3%)
 Frame = +2

Query  281  PTIQLPNQ-SDDISHLALDIGGSLIKLXYFS  370
            P+IQLPNQ ++ +SH+A+DIGGSLIKL YFS
Sbjct  1    PSIQLPNQDAEYVSHIAIDIGGSLIKLVYFS  31



>ref|XP_004964926.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Setaria italica]
Length=667

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  233  LDLXGAAIQGNFEXKDPTIQLPNQSDDISHLALDIGGSLIKLXY  364
            +DL GA I+G+ E ++P I LP Q      LALDIGG+LIKL Y
Sbjct  12   VDLSGAEIRGDIEGRNPPIFLPRQPAASPLLALDIGGTLIKLVY  55



>ref|XP_003287654.1| hypothetical protein DICPUDRAFT_54979 [Dictyostelium purpureum]
 gb|EGC35817.1| hypothetical protein DICPUDRAFT_54979 [Dictyostelium purpureum]
Length=535

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 30/52 (58%), Gaps = 7/52 (13%)
 Frame = +2

Query  266  FEXKDPTIQLPNQSDDISHLALDIGGSLIKLXYFSXHEGRQVEDKRKRKVKE  421
            F  KD  I LPNQS  I H ALDIGG+L KL YF       V++K K  V E
Sbjct  108  FNPKDRPISLPNQSAPIKHFALDIGGTLAKLVYF-------VQNKDKSNVNE  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557844602525