BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF010L04

Length=620
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011080124.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    310   3e-101   Sesamum indicum [beniseed]
gb|EYU46388.1|  hypothetical protein MIMGU_mgv1a007681mg                302   5e-98    Erythranthe guttata [common monkey flower]
ref|XP_002271401.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    301   8e-98    Vitis vinifera
emb|CDP03802.1|  unnamed protein product                                301   2e-97    Coffea canephora [robusta coffee]
ref|XP_008789505.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    300   2e-97    Phoenix dactylifera
ref|XP_010936110.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    299   7e-97    Elaeis guineensis
ref|XP_002301843.1|  hypothetical protein POPTR_0002s25720g             298   1e-96    Populus trichocarpa [western balsam poplar]
ref|XP_011024495.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    298   2e-96    Populus euphratica
gb|ACU23211.1|  unknown                                                 296   6e-96    Glycine max [soybeans]
ref|XP_003542442.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    296   8e-96    Glycine max [soybeans]
gb|KJB42342.1|  hypothetical protein B456_007G150200                    290   2e-95    Gossypium raimondii
ref|XP_010940664.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    295   2e-95    
gb|ABK94679.1|  unknown                                                 295   2e-95    Populus trichocarpa [western balsam poplar]
gb|KJB42341.1|  hypothetical protein B456_007G150200                    291   7e-95    Gossypium raimondii
gb|KDP26455.1|  hypothetical protein JCGZ_17613                         293   1e-94    Jatropha curcas
gb|KJB42337.1|  hypothetical protein B456_007G150200                    292   1e-94    Gossypium raimondii
ref|XP_009370595.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    293   2e-94    Pyrus x bretschneideri [bai li]
ref|XP_008235764.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    292   2e-94    Prunus mume [ume]
gb|KJB42338.1|  hypothetical protein B456_007G150200                    291   3e-94    Gossypium raimondii
gb|KJB42340.1|  hypothetical protein B456_007G150200                    292   3e-94    Gossypium raimondii
ref|XP_009395307.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    292   3e-94    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009370589.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    292   6e-94    Pyrus x bretschneideri [bai li]
ref|XP_007201067.1|  hypothetical protein PRUPE_ppa006705mg             291   6e-94    
gb|KJB42335.1|  hypothetical protein B456_007G150200                    291   6e-94    Gossypium raimondii
ref|XP_008382707.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    292   1e-93    
ref|XP_010684864.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    289   4e-93    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011458045.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    289   4e-93    Fragaria vesca subsp. vesca
ref|XP_009335235.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    290   4e-93    Pyrus x bretschneideri [bai li]
ref|XP_007144408.1|  hypothetical protein PHAVU_007G153700g             289   5e-93    Phaseolus vulgaris [French bean]
ref|XP_010091822.1|  hypothetical protein L484_015891                   289   7e-93    Morus notabilis
gb|AFK48198.1|  unknown                                                 288   9e-93    Lotus japonicus
ref|XP_002321296.2|  hypothetical protein POPTR_0014s18680g             288   1e-92    
ref|XP_007050145.1|  NAD(P)-binding Rossmann-fold superfamily pro...    288   1e-92    
ref|XP_007050147.1|  NAD(P)-binding Rossmann-fold superfamily pro...    288   2e-92    
gb|KGN46368.1|  hypothetical protein Csa_6G087960                       287   3e-92    Cucumis sativus [cucumbers]
ref|XP_006355892.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    286   7e-92    Solanum tuberosum [potatoes]
ref|XP_008459972.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    285   3e-91    Cucumis melo [Oriental melon]
ref|XP_010264829.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    285   3e-91    Nelumbo nucifera [Indian lotus]
ref|XP_004247128.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    285   3e-91    
ref|XP_009586626.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    284   6e-91    Nicotiana tomentosiformis
ref|XP_009763970.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    279   3e-90    Nicotiana sylvestris
ref|XP_008372401.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    282   3e-90    Malus domestica [apple tree]
ref|XP_010540921.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    282   4e-90    Tarenaya hassleriana [spider flower]
ref|XP_006648113.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    280   6e-90    
ref|XP_006408954.1|  hypothetical protein EUTSA_v10002002mg             280   1e-89    Eutrema salsugineum [saltwater cress]
ref|NP_001048516.1|  Os02g0816800                                       281   2e-89    
gb|ACJ84721.1|  unknown                                                 280   2e-89    Medicago truncatula
ref|XP_009102039.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    279   6e-89    Brassica rapa
emb|CDY31970.1|  BnaA07g00250D                                          279   7e-89    Brassica napus [oilseed rape]
emb|CDY39772.1|  BnaA09g10240D                                          278   8e-89    Brassica napus [oilseed rape]
ref|XP_010036149.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    278   1e-88    Eucalyptus grandis [rose gum]
gb|EEC74241.1|  hypothetical protein OsI_09443                          278   1e-88    Oryza sativa Indica Group [Indian rice]
ref|XP_009112664.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    278   1e-88    Brassica rapa
ref|XP_006854436.1|  hypothetical protein AMTR_s00039p00218660          278   2e-88    Amborella trichopoda
emb|CDY03308.1|  BnaC09g10400D                                          277   4e-88    
gb|KFK40412.1|  hypothetical protein AALP_AA3G370500                    277   4e-88    Arabis alpina [alpine rockcress]
ref|XP_006296717.1|  hypothetical protein CARUB_v10014190mg             274   4e-88    
emb|CDY05746.1|  BnaC07g00570D                                          276   5e-88    
ref|XP_010548735.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    276   1e-87    Tarenaya hassleriana [spider flower]
emb|CDX81965.1|  BnaC08g36360D                                          275   1e-87    
ref|XP_009117495.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    275   2e-87    Brassica rapa
emb|CDY13877.1|  BnaA09g43790D                                          275   2e-87    Brassica napus [oilseed rape]
ref|XP_002453037.1|  hypothetical protein SORBIDRAFT_04g037200          274   6e-87    Sorghum bicolor [broomcorn]
ref|XP_002884196.1|  catalytic/ coenzyme binding protein                273   2e-86    Arabidopsis lyrata subsp. lyrata
ref|NP_565469.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomp...    271   4e-86    Arabidopsis thaliana [mouse-ear cress]
gb|EPS69627.1|  hypothetical protein M569_05135                         270   7e-86    Genlisea aurea
ref|XP_010467837.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    271   9e-86    Camelina sativa [gold-of-pleasure]
ref|XP_010489051.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    270   1e-85    Camelina sativa [gold-of-pleasure]
ref|XP_010415893.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    270   1e-85    Camelina sativa [gold-of-pleasure]
ref|XP_002526534.1|  NADH-ubiquinone oxidoreductase 39 kD subunit...    270   2e-85    
ref|XP_004954373.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    270   3e-85    Setaria italica
ref|NP_001149069.1|  LOC100282690                                       268   1e-84    
ref|XP_004495054.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    268   1e-84    Cicer arietinum [garbanzo]
gb|ACF85773.1|  unknown                                                 268   1e-84    Zea mays [maize]
gb|ABK24353.1|  unknown                                                 266   4e-84    Picea sitchensis
gb|AFW74028.1|  NADH-ubiquinone oxidoreductase subunit                  268   7e-84    
ref|XP_006443722.1|  hypothetical protein CICLE_v10020464mg             263   7e-83    
dbj|BAJ86608.1|  predicted protein                                      262   3e-82    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003570393.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    250   2e-77    
gb|KJB42336.1|  hypothetical protein B456_007G150200                    241   8e-75    Gossypium raimondii
dbj|BAH20309.1|  AT2G20360                                              231   3e-71    Arabidopsis thaliana [mouse-ear cress]
gb|KDO37085.1|  hypothetical protein CISIN_1g047628mg                   222   8e-68    Citrus sinensis [apfelsine]
ref|XP_001765756.1|  predicted protein                                  223   3e-67    
gb|KHG08643.1|  hypothetical protein F383_12346                         218   8e-66    Gossypium arboreum [tree cotton]
gb|EEE58042.1|  hypothetical protein OsJ_08874                          205   2e-61    Oryza sativa Japonica Group [Japonica rice]
dbj|BAG95473.1|  unnamed protein product                                201   7e-60    Oryza sativa Japonica Group [Japonica rice]
gb|KJB42339.1|  hypothetical protein B456_007G150200                    198   3e-58    Gossypium raimondii
ref|XP_007050148.1|  NAD(P)-binding Rossmann-fold superfamily pro...    192   4e-56    
ref|XP_001757609.1|  predicted protein                                  192   3e-55    
gb|EMS47161.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    187   2e-54    Triticum urartu
gb|EMT17104.1|  putative NADH dehydrogenase (ubiquinone) 1 alpha ...    186   5e-54    
ref|XP_002976090.1|  hypothetical protein SELMODRAFT_104564             183   3e-52    
ref|XP_002968287.1|  hypothetical protein SELMODRAFT_89106              181   1e-51    
ref|XP_004339653.1|  NADH dehydrogenase, putative                       163   2e-44    Acanthamoeba castellanii str. Neff
ref|XP_007510295.1|  predicted protein                                  162   8e-44    Bathycoccus prasinos
gb|KIJ17694.1|  hypothetical protein PAXINDRAFT_167681                  160   1e-43    Paxillus involutus ATCC 200175
dbj|GAA99675.1|  hypothetical protein E5Q_06378                         159   5e-43    Mixia osmundae IAM 14324
gb|KIK91888.1|  hypothetical protein PAXRUDRAFT_830459                  158   1e-42    Paxillus rubicundulus Ve08.2h10
ref|XP_002504449.1|  predicted protein                                  158   1e-42    Micromonas commoda
ref|XP_001626712.1|  predicted protein                                  157   3e-42    Nematostella vectensis
ref|XP_001420142.1|  predicted protein                                  156   4e-42    Ostreococcus lucimarinus CCE9901
ref|XP_003390219.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    155   1e-41    Amphimedon queenslandica
ref|XP_008274666.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    155   1e-41    Stegastes partitus
ref|XP_003126608.2|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    155   1e-41    Sus scrofa [pigs]
ref|XP_002736180.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    152   1e-41    Saccoglossus kowalevskii
ref|XP_001835685.1|  NADH dehydrogenase                                 154   2e-41    Coprinopsis cinerea okayama7#130
ref|XP_006795902.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    152   3e-41    Neolamprologus brichardi [lyretail cichlid]
ref|XP_007872120.1|  hypothetical protein PNEG_00249                    154   4e-41    Pneumocystis murina B123
ref|XP_005681037.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    154   4e-41    Capra hircus [domestic goat]
ref|NP_001094222.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    154   5e-41    Rattus norvegicus [brown rat]
ref|XP_004006995.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    154   5e-41    
gb|AAH91192.1|  Ndufa9 protein                                          154   5e-41    Rattus norvegicus [brown rat]
ref|XP_006237562.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    154   5e-41    Rattus norvegicus [brown rat]
ref|XP_006633741.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    154   7e-41    Lepisosteus oculatus
ref|XP_006987942.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    153   8e-41    
dbj|BAK63310.1|  NADH dehydrogenase                                     151   9e-41    Pan troglodytes
ref|XP_002712902.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    153   9e-41    Oryctolagus cuniculus [domestic rabbit]
gb|EAW88839.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomple...    150   9e-41    Homo sapiens [man]
ref|XP_006957558.1|  NAD(P)-binding protein                             153   1e-40    Wallemia mellicola CBS 633.66
ref|XP_007902354.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    152   2e-40    Callorhinchus milii [Australian ghost shark]
ref|XP_008574858.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    152   2e-40    Galeopterus variegatus [Malayan flying lemur]
gb|KIO18953.1|  hypothetical protein M407DRAFT_153532                   152   2e-40    Tulasnella calospora MUT 4182
ref|NP_001279619.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...    152   2e-40    Callorhinchus milii [Australian ghost shark]
ref|XP_010963120.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    152   2e-40    Camelus bactrianus [camel]
ref|XP_006210904.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    152   2e-40    Vicugna pacos
ref|XP_006175621.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    152   2e-40    
ref|XP_005334075.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    151   3e-40    
gb|KDN41067.1|  putative NADH2 dehydrogenase 40K chain                  152   3e-40    Tilletiaria anomala UBC 951
ref|XP_005365321.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    152   3e-40    Microtus ochrogaster [prairie voles]
ref|NP_001073383.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    152   3e-40    Pan troglodytes
ref|XP_005365322.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    152   3e-40    
gb|ETN62206.1|  NADH-ubiquinone oxidoreductase 39 kda subunit           152   3e-40    Anopheles darlingi [American malaria mosquito]
gb|KDQ20806.1|  hypothetical protein BOTBODRAFT_26820                   151   3e-40    Botryobasidium botryosum FD-172 SS1
gb|ABH12231.1|  mitochondrial complex I subunit NDUFA9                  152   4e-40    Pongo pygmaeus [orang utan]
ref|NP_001127602.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    151   4e-40    Pongo abelii [orang utan]
gb|KIJ64483.1|  hypothetical protein HYDPIDRAFT_28424                   151   4e-40    Hydnomerulius pinastri MD-312
ref|XP_005734821.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    151   4e-40    Pundamilia nyererei
ref|XP_007469502.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    151   4e-40    Lipotes vexillifer [baiji]
ref|XP_005950395.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    151   4e-40    Haplochromis burtoni
ref|XP_005734820.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    151   4e-40    Pundamilia nyererei
ref|XP_005950396.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    151   4e-40    Haplochromis burtoni
ref|NP_001013477.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    150   4e-40    
gb|AAH03351.1|  Similar to NADH dehydrogenase (ubiquinone) 1 alph...    150   4e-40    Homo sapiens [man]
ref|XP_005084120.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    151   4e-40    Mesocricetus auratus [Syrian golden hamster]
ref|XP_009546417.1|  hypothetical protein HETIRDRAFT_475334             150   6e-40    Heterobasidion irregulare TC 32-1
sp|Q0MQB3.2|NDUA9_GORGO  RecName: Full=NADH dehydrogenase [ubiqui...    150   7e-40    Gorilla gorilla gorilla [lowland gorilla]
ref|XP_007170262.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    150   7e-40    Balaenoptera acutorostrata scammoni
ref|NP_001266630.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...    151   7e-40    Gorilla gorilla [gorilla]
ref|XP_003796469.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    150   7e-40    Otolemur garnettii
gb|AAH05760.1|  Ndufa9 protein                                          150   8e-40    Mus musculus [mouse]
gb|AAA36350.1|  NADH dehydrogenase (ubiquinone)                         150   8e-40    Homo sapiens [man]
ref|XP_001515711.2|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    151   8e-40    
ref|NP_004993.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomp...    150   8e-40    Homo sapiens [man]
ref|XP_007304718.1|  NADH dehydrogenase                                 150   9e-40    Stereum hirsutum FP-91666 SS1
gb|AIC62000.1|  NDUFA9                                                  150   9e-40    synthetic construct
gb|AAI53423.1|  Ndufa9 protein                                          150   1e-39    Danio rerio [leopard danio]
ref|XP_004279068.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    150   1e-39    Orcinus orca [Orca]
ref|XP_003988339.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    150   1e-39    Felis catus [cat]
ref|XP_006053611.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    150   1e-39    Bubalus bubalis [domestic water buffalo]
ref|XP_010843290.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    150   1e-39    Bison bison bison
ref|NP_079634.2|  NADH dehydrogenase [ubiquinone] 1 alpha subcomp...    150   1e-39    Mus musculus [mouse]
ref|XP_003447104.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    150   1e-39    Oreochromis niloticus
ref|XP_005957904.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    150   1e-39    Pantholops hodgsonii [Tibetan antelope]
emb|CBQ67793.1|  probable NADH2 dehydrogenase (ubiquinone) 40K chain    150   1e-39    Sporisorium reilianum SRZ2
ref|XP_003496081.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    150   1e-39    Cricetulus griseus [Chinese hamsters]
gb|EAW88838.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomple...    150   1e-39    Homo sapiens [man]
gb|AAH68378.1|  Ndufa9 protein                                          150   2e-39    Danio rerio [leopard danio]
ref|XP_005174380.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    150   2e-39    
gb|EFB28697.1|  hypothetical protein PANDA_009221                       149   2e-39    Ailuropoda melanoleuca
ref|XP_004381326.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    149   2e-39    
ref|XP_002920485.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    149   2e-39    Ailuropoda melanoleuca
ref|XP_003331391.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...    149   2e-39    Puccinia graminis f. sp. tritici CRL 75-36-700-3
gb|AAI52140.1|  Ndufa9 protein                                          149   2e-39    Danio rerio [leopard danio]
gb|KIY67124.1|  NAD(P)-binding protein                                  149   3e-39    Cylindrobasidium torrendii FP15055 ss-10
ref|XP_009266962.1|  hypothetical protein J056_003464                   149   3e-39    Wallemia ichthyophaga EXF-994
ref|XP_002920484.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    149   4e-39    
emb|CCF54116.1|  probable NADH2 dehydrogenase (ubiquinone) 40K chain    149   4e-39    Ustilago hordei
ref|XP_010357461.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    149   4e-39    Rhinopithecus roxellana
emb|CEF99374.1|  NAD(P)-binding domain                                  148   4e-39    Ostreococcus tauri
ref|XP_007089756.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    150   4e-39    
ref|XP_007935381.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    149   4e-39    Orycteropus afer afer
gb|KIK69637.1|  hypothetical protein GYMLUDRAFT_992204                  149   4e-39    Gymnopus luxurians FD-317 M1
ref|XP_001494651.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    149   5e-39    Equus caballus [domestic horse]
gb|ABF57357.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomple...    148   5e-39    Bos taurus [bovine]
ref|XP_008528773.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    149   5e-39    Equus przewalskii [Przewalski horse]
ref|XP_008141973.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    148   5e-39    Eptesicus fuscus
ref|NP_991386.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomp...    148   6e-39    Bos taurus [bovine]
gb|KDQ62587.1|  hypothetical protein JAAARDRAFT_30488                   148   6e-39    Jaapia argillacea MUCL 33604
dbj|BAF83756.1|  unnamed protein product                                148   6e-39    Homo sapiens [man]
ref|XP_534915.3|  PREDICTED: NADH dehydrogenase [ubiquinone] 1 al...    148   6e-39    Canis lupus familiaris [dogs]
gb|EST09999.1|  NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit    148   8e-39    Kalmanozyma brasiliensis GHG001
ref|XP_004459092.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    148   9e-39    Dasypus novemcinctus
ref|XP_009989270.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    147   1e-38    Tauraco erythrolophus
gb|KFV03415.1|  hypothetical protein N340_03010                         147   1e-38    Tauraco erythrolophus
dbj|GAC73597.1|  NADH:ubiquinone oxidoreductase, NDUFA9/39kDa sub...    147   1e-38    Moesziomyces antarcticus T-34
ref|XP_003059930.1|  predicted protein                                  147   1e-38    Micromonas pusilla CCMP1545
gb|ETS63618.1|  hypothetical protein PaG_01917                          147   1e-38    Moesziomyces aphidis DSM 70725
dbj|GAK62286.1|  NAD(P)-binding protein                                 147   1e-38    Moesziomyces antarcticus
emb|CDI51333.1|  probable NADH2 dehydrogenase (ubiquinone) 40K chain    147   1e-38    Melanopsichium pennsylvanicum 4
dbj|GAC95510.1|  hypothetical protein PHSY_003086                       148   1e-38    Pseudozyma hubeiensis SY62
ref|XP_009178281.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    147   1e-38    Papio anubis [baboon]
ref|XP_004778323.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    147   1e-38    Mustela putorius furo [black ferret]
ref|XP_009178280.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    147   1e-38    Papio anubis [baboon]
ref|XP_007503809.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    147   1e-38    Monodelphis domestica
dbj|BAB22596.1|  unnamed protein product                                147   1e-38    Mus musculus [mouse]
ref|XP_003410681.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    147   1e-38    Loxodonta africana [African bush elephant]
ref|XP_006754928.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    147   2e-38    Myotis davidii
ref|XP_004692611.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    149   2e-38    
ref|XP_011386267.1|  putative NADH2 dehydrogenase (ubiquinone) 40...    147   2e-38    Ustilago maydis 521
ref|XP_006862735.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    147   2e-38    Chrysochloris asiatica
gb|KIM65954.1|  hypothetical protein SCLCIDRAFT_1211966                 147   2e-38    Scleroderma citrinum Foug A
ref|XP_007527887.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    147   2e-38    Erinaceus europaeus [common hedgehog]
ref|XP_004347048.1|  Ndufa9 protein                                     145   2e-38    Capsaspora owczarzaki ATCC 30864
ref|XP_007882091.1|  hypothetical protein PFL1_06359                    147   2e-38    Anthracocystis flocculosa PF-1
ref|XP_008703115.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    147   2e-38    Ursus maritimus [white bear]
ref|XP_008823675.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    147   2e-38    Nannospalax galili
ref|XP_007965492.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    147   2e-38    Chlorocebus sabaeus
ref|XP_006739694.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    147   3e-38    Leptonychotes weddellii
gb|KDE07008.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    147   3e-38    Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_008703114.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    147   3e-38    Ursus maritimus [white bear]
ref|XP_004610502.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    146   3e-38    Sorex araneus [Eurasian shrew]
gb|ELR54825.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    146   3e-38    Bos mutus
ref|XP_001372251.2|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    146   3e-38    Monodelphis domestica
ref|XP_005569923.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    145   3e-38    Macaca fascicularis [crab eating macaque]
gb|KFP08708.1|  hypothetical protein N300_02598                         146   3e-38    Calypte anna
gb|ESA03096.1|  hypothetical protein GLOINDRAFT_336975                  146   3e-38    
gb|EXX58721.1|  hypothetical protein RirG_195270                        146   4e-38    Rhizophagus irregularis DAOM 197198w
ref|XP_005897993.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    146   4e-38    Bos mutus
ref|XP_008502666.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    146   5e-38    Calypte anna
ref|XP_005533361.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    146   5e-38    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005877078.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    146   5e-38    Myotis brandtii
gb|KFV11223.1|  hypothetical protein N339_08758                         143   5e-38    Pterocles gutturalis
gb|KFV92623.1|  hypothetical protein N326_00630                         142   5e-38    Eurypyga helias
ref|XP_010148325.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    142   5e-38    Eurypyga helias
gb|ENN72465.1|  hypothetical protein YQE_10807                          146   6e-38    Dendroctonus ponderosae
gb|ERL95049.1|  hypothetical protein D910_12319                         146   6e-38    Dendroctonus ponderosae
gb|AEE61636.1|  unknown                                                 146   6e-38    Dendroctonus ponderosae
ref|XP_005537134.1|  NADH dehydrogenase I alpha subcomplex 9, mit...    146   6e-38    Cyanidioschyzon merolae strain 10D
gb|ERE67037.1|  putative polypeptide N-acetylgalactosaminyltransf...    150   6e-38    Cricetulus griseus [Chinese hamsters]
ref|XP_004992628.1|  hypothetical protein PTSG_07208                    145   7e-38    Salpingoeca rosetta
ref|XP_006923900.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    145   7e-38    Pteropus alecto
ref|XP_004568347.1|  PREDICTED: probable polypeptide N-acetylgala...    149   7e-38    
ref|XP_010076803.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    143   8e-38    Pterocles gutturalis
ref|XP_005492469.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    145   8e-38    Zonotrichia albicollis
gb|EHH20407.1|  NADH-ubiquinone oxidoreductase 39 kDa subunit           145   1e-37    Macaca mulatta [rhesus macaque]
gb|KDR23820.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    145   1e-37    Zootermopsis nevadensis
ref|XP_005426929.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    146   1e-37    Geospiza fortis
ref|XP_004210520.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    139   1e-37    
ref|XP_004438802.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    145   1e-37    Ceratotherium simum simum [southern square-lipped rhinoceros]
gb|KIM89048.1|  hypothetical protein PILCRDRAFT_812944                  144   1e-37    Piloderma croceum F 1598
ref|XP_005569922.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    145   1e-37    Macaca fascicularis [crab eating macaque]
ref|XP_318516.3|  AGAP010792-PA                                         145   1e-37    Anopheles gambiae str. PEST
ref|XP_003771339.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    145   1e-37    Sarcophilus harrisii
ref|XP_007008648.1|  hypothetical protein TREMEDRAFT_72592              145   1e-37    Tremella mesenterica DSM 1558
gb|KFB35184.1|  AGAP010792-PA-like protein                              145   2e-37    Anopheles sinensis
ref|NP_001187320.1|  mitochondrial NADH dehydrogenase (ubiquinone...    144   2e-37    Ictalurus punctatus
ref|XP_006123105.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    144   2e-37    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_003273859.2|  PREDICTED: probable polypeptide N-acetylgala...    147   2e-37    
gb|EFA77105.1|  NADH dehydrogenase 1 alpha subcomplex subunit 9         144   2e-37    Heterostelium album PN500
gb|KIK24507.1|  hypothetical protein PISMIDRAFT_401487                  144   2e-37    Pisolithus microcarpus 441
gb|EMD40072.1|  hypothetical protein CERSUDRAFT_112285                  144   2e-37    Gelatoporia subvermispora B
ref|XP_002188497.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    144   2e-37    Taeniopygia guttata
ref|XP_009092324.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    144   2e-37    Serinus canaria [canary]
ref|XP_010171650.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    144   3e-37    
ref|XP_007270771.1|  NADH dehydrogenase                                 144   3e-37    Fomitiporia mediterranea MF3/22
emb|CCM05932.1|  predicted protein                                      144   3e-37    Fibroporia radiculosa
gb|KFZ63522.1|  hypothetical protein N321_03654                         143   3e-37    Antrostomus carolinensis
ref|XP_007870444.1|  NAD P-binding protein                              144   3e-37    Gloeophyllum trabeum ATCC 11539
gb|KFO82303.1|  hypothetical protein N303_06049                         143   3e-37    Cuculus canorus
ref|XP_010195242.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    143   3e-37    Colius striatus
ref|XP_009567541.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    143   3e-37    Cuculus canorus
gb|KFP29723.1|  hypothetical protein N325_09765                         143   4e-37    Colius striatus
ref|XP_004416912.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    144   4e-37    Odobenus rosmarus divergens
ref|XP_001876312.1|  predicted protein                                  142   4e-37    Laccaria bicolor S238N-H82
ref|XP_001118102.2|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    145   4e-37    
ref|NP_001082699.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...    143   4e-37    Xenopus laevis [clawed frog]
ref|XP_001865472.1|  NADH-ubiquinone oxidoreductase 39 kda subunit      144   4e-37    Culex quinquefasciatus
gb|KFO62876.1|  hypothetical protein N302_08675                         143   4e-37    Corvus brachyrhynchos
ref|XP_007399771.1|  hypothetical protein PHACADRAFT_199484             143   5e-37    Phanerochaete carnosa HHB-10118-sp
ref|XP_005378797.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    143   5e-37    
ref|XP_009015040.1|  hypothetical protein HELRODRAFT_98836              143   5e-37    
gb|KFV62438.1|  hypothetical protein N307_14752                         142   5e-37    
gb|KJA24071.1|  hypothetical protein HYPSUDRAFT_39211                   143   5e-37    
gb|AAH45076.1|  MGC64316 protein                                        143   5e-37    
ref|XP_007845659.1|  nadh dehydrogenase                                 143   6e-37    
ref|XP_010408555.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    143   6e-37    
ref|XP_003221407.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    143   6e-37    
ref|XP_008071131.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    144   6e-37    
gb|ADO28252.1|  mitochondrial NADH dehydrogenase 1 alpha subcompl...    143   7e-37    
ref|XP_007435737.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    142   7e-37    
ref|XP_008636784.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    143   7e-37    
gb|KFP45254.1|  hypothetical protein N324_11766                         140   7e-37    
ref|XP_009908154.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    143   7e-37    
gb|KFV38950.1|  hypothetical protein N341_11120                         139   7e-37    
ref|XP_010125588.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    140   8e-37    
ref|XP_010609901.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    142   9e-37    
ref|XP_007353556.1|  NAD(P)-binding protein                             143   9e-37    
ref|XP_006891427.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    142   9e-37    
ref|XP_004643624.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    142   9e-37    
ref|XP_009973803.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    139   9e-37    
ref|XP_008037591.1|  NADH dehydrogenase                                 142   9e-37    
ref|XP_645194.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomp...    142   9e-37    
ref|XP_002108719.1|  expressed hypothetical protein                     142   1e-36    
ref|XP_008486857.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    141   1e-36    
gb|EPS94725.1|  hypothetical protein FOMPIDRAFT_1133771                 142   1e-36    
gb|KFP83910.1|  hypothetical protein N310_12825                         142   1e-36    
ref|NP_001011432.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...    142   1e-36    
ref|XP_005097061.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    142   1e-36    
ref|XP_009076582.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    142   1e-36    
gb|KFQ75039.1|  hypothetical protein N335_03526                         141   2e-36    
ref|XP_006681739.1|  hypothetical protein BATDEDRAFT_37370              142   2e-36    
ref|XP_005040230.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    143   2e-36    
ref|XP_010573635.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   2e-36    
ref|XP_010285464.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    141   2e-36    
gb|KIK47221.1|  hypothetical protein CY34DRAFT_21544                    141   2e-36    
gb|KFV95211.1|  hypothetical protein N327_03132                         141   2e-36    
ref|XP_001985349.1|  GH14554                                            142   3e-36    
ref|XP_001660001.1|  AAEL009414-PA                                      142   3e-36    
ref|XP_010133323.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   3e-36    
ref|XP_003463318.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    141   3e-36    
ref|XP_005234795.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    141   3e-36    
gb|KFO89045.1|  hypothetical protein N320_01399                         139   3e-36    
ref|XP_009582483.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    141   3e-36    
ref|XP_011401632.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    141   3e-36    
dbj|GAM27735.1|  hypothetical protein SAMD00019534_109110               140   3e-36    
ref|XP_009917119.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   3e-36    
gb|EPB89825.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    140   4e-36    
gb|KIP02896.1|  hypothetical protein PHLGIDRAFT_130473                  140   4e-36    
gb|KFQ03890.1|  hypothetical protein N329_07841                         140   4e-36    
gb|KFO07725.1|  hypothetical protein N312_01006                         140   4e-36    
gb|KFP63610.1|  hypothetical protein N322_12220                         140   4e-36    
gb|EMP38439.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    139   4e-36    
gb|KFP53101.1|  hypothetical protein N323_09262                         140   4e-36    
ref|XP_001702653.1|  NADH:ubiquinone oxidoreductase 39 kDa subunit      141   4e-36    
ref|XP_010005482.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   4e-36    
gb|KFV57640.1|  hypothetical protein N328_11892                         140   4e-36    
gb|KFU84818.1|  hypothetical protein M959_04911                         140   4e-36    
ref|XP_009815144.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    140   4e-36    
dbj|GAN07940.1|  NAD(P)-binding protein                                 140   5e-36    
gb|KFQ73922.1|  hypothetical protein N337_04487                         140   5e-36    
emb|CCA67799.1|  probable NADH2 dehydrogenase (ubiquinone) 40K chain    140   5e-36    
emb|CCJ28978.1|  unnamed protein product                                140   5e-36    
ref|XP_009954998.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   6e-36    
gb|KFQ14782.1|  hypothetical protein N330_12470                         140   6e-36    
ref|XP_011188849.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    141   6e-36    
gb|KDQ25989.1|  39kDa subunit of NDUFA9, NADH ubiquinone oxidored...    140   6e-36    
ref|XP_010573634.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   6e-36    
ref|XP_009695607.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   6e-36    
ref|XP_010310531.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   6e-36    
ref|XP_011208110.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   6e-36    
ref|XP_011304899.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   6e-36    
ref|XP_009473697.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    140   7e-36    
ref|XP_006172086.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   7e-36    
ref|XP_005148026.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   7e-36    
gb|KFQ91966.1|  hypothetical protein Y956_15987                         140   7e-36    
ref|XP_009001694.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   7e-36    
ref|XP_002048107.1|  GJ11526                                            140   8e-36    
ref|XP_009863298.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   8e-36    
ref|XP_002008276.1|  GI13402                                            140   8e-36    
gb|KFQ30066.1|  hypothetical protein N332_01289                         139   8e-36    
ref|XP_003034456.1|  hypothetical protein SCHCODRAFT_14900              139   8e-36    
gb|KFP80801.1|  hypothetical protein N311_08372                         139   8e-36    
gb|EOB06411.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    139   9e-36    
ref|XP_005012705.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    139   1e-35    
ref|XP_007768401.1|  NAD(P)-binding protein                             139   1e-35    
ref|XP_009936776.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    139   1e-35    
ref|XP_570308.1|  NADH dehydrogenase (ubiquinone)                       140   1e-35    
gb|EMS25072.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    139   1e-35    
ref|XP_010021537.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    139   1e-35    
gb|KDR82718.1|  hypothetical protein GALMADRAFT_238218                  139   1e-35    
ref|XP_006273618.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    139   1e-35    
gb|KFQ44899.1|  hypothetical protein N333_02601                         139   1e-35    
gb|KFR13833.1|  hypothetical protein N306_14448                         139   1e-35    
emb|CDO68262.1|  hypothetical protein BN946_scf184842.g25               139   1e-35    
ref|XP_005503104.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    139   1e-35    
ref|XP_010881814.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    139   1e-35    
ref|XP_010714872.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    139   1e-35    
ref|XP_006027877.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    139   1e-35    
ref|XP_975235.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1 al...    139   2e-35    
ref|XP_009892508.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    139   2e-35    
gb|KGL85955.1|  hypothetical protein N301_03034                         139   2e-35    
ref|XP_786784.2|  PREDICTED: NADH dehydrogenase [ubiquinone] 1 al...    139   2e-35    
emb|CEI86940.1|  Putative Genomic scaffold, msy_sf_1                    137   2e-35    
ref|XP_001730360.1|  hypothetical protein MGL_2742                      138   2e-35    
emb|CEP08222.1|  hypothetical protein                                   139   2e-35    
gb|KFW94971.1|  hypothetical protein N336_08738                         138   2e-35    
ref|XP_009510411.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    139   2e-35    
ref|XP_002954591.1|  NADH:ubiquinone oxidoreductase 39 kDa subunit      139   2e-35    
ref|XP_009673696.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    138   2e-35    
ref|XP_004522227.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    139   3e-35    
ref|XP_008549223.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    139   3e-35    
gb|KFV81563.1|  hypothetical protein N308_11418                         138   3e-35    
gb|KFW86271.1|  hypothetical protein N305_07548                         138   3e-35    
ref|XP_010176933.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    139   3e-35    
ref|XP_003932646.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    138   3e-35    
ref|XP_007056976.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    138   3e-35    
ref|XP_008928534.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    138   3e-35    
ref|XP_009673695.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    138   3e-35    
gb|KFM13739.1|  hypothetical protein AS27_14184                         138   4e-35    
gb|KIR68354.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    139   4e-35    
ref|XP_008118146.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   4e-35    
ref|NP_001006281.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    138   4e-35    
ref|XP_002040681.1|  GM22299                                            139   4e-35    
ref|XP_002086632.1|  GE23238                                            139   4e-35    
ref|XP_009483609.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   5e-35    
emb|CEJ03407.1|  Putative Genomic scaffold, msy_sf_1                    138   5e-35    
emb|CEG64935.1|  Putative Genomic scaffold, msy_sf_1                    138   5e-35    
gb|KFQ62461.1|  hypothetical protein N334_13818                         137   5e-35    
gb|KDN34620.1|  hypothetical protein RSAG8_12282                        137   5e-35    
gb|KGB74721.1|  NADH dehydrogenase                                      138   6e-35    
gb|KGL84591.1|  hypothetical protein N309_12483                         137   6e-35    
gb|KIR57388.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    138   6e-35    
gb|KIK07979.1|  hypothetical protein K443DRAFT_128758                   137   6e-35    
ref|XP_003193480.1|  NADH dehydrogenase (ubiquinone)                    138   7e-35    
ref|XP_010223608.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   7e-35    
gb|KIR80601.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    138   7e-35    
emb|CEG82390.1|  Putative Genomic scaffold, msy_sf_1                    137   8e-35    
gb|KFW67319.1|  hypothetical protein AS28_12998                         137   8e-35    
gb|KDN34621.1|  hypothetical protein RSAG8_12283                        132   8e-35    
gb|KIR89560.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    137   9e-35    
ref|XP_001973503.1|  GG16121                                            137   1e-34    
gb|KIR50051.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    137   1e-34    
gb|AHZ64223.1|  FI24283p1                                               137   1e-34    
gb|KIJ54415.1|  hypothetical protein M422DRAFT_775527                   136   1e-34    
ref|XP_005188922.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   1e-34    
ref|XP_004879593.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    136   1e-34    
ref|XP_002069018.1|  GK12296                                            137   2e-34    
gb|EHJ77228.1|  hypothetical protein KGM_02785                          137   2e-34    
gb|KIM28918.1|  hypothetical protein M408DRAFT_328984                   136   2e-34    
ref|XP_004869427.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   2e-34    
ref|XP_009286807.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    138   2e-34    
gb|KFH67974.1|  hypothetical protein MVEG_06705                         136   2e-34    
ref|XP_007379939.1|  NAD(P)-binding protein                             135   2e-34    
ref|XP_009322637.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   2e-34    
ref|XP_007370168.1|  NADH dehydrogenase                                 135   2e-34    
ref|XP_010731332.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    136   3e-34    
ref|XP_005307068.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    136   3e-34    
ref|XP_008309204.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   4e-34    
ref|XP_001352990.1|  GA19302                                            136   4e-34    
ref|XP_007319751.1|  39kDa subunit of NDUFA9, NADH:ubiquinone oxi...    135   4e-34    
gb|KII87009.1|  hypothetical protein PLICRDRAFT_700259                  135   4e-34    
ref|XP_002026863.1|  GL12793                                            136   4e-34    
ref|XP_001957289.1|  GF10349                                            136   4e-34    
ref|XP_007409682.1|  hypothetical protein MELLADRAFT_77647              135   4e-34    
ref|XP_006462703.1|  NdufA9 NADH ubiquinone oxidoreductase subunit      135   4e-34    
gb|ELU16423.1|  hypothetical protein CAPTEDRAFT_138749                  135   5e-34    
gb|AFR95169.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    135   5e-34    
ref|XP_003145987.1|  hypothetical protein LOAG_10415                    132   6e-34    
emb|CEL51784.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcompl...    135   6e-34    
gb|EFZ15204.1|  hypothetical protein SINV_03405                         135   6e-34    
ref|XP_011164362.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   6e-34    
gb|KIY44806.1|  NAD(P)-binding protein                                  134   7e-34    
gb|KEP53453.1|  putative NADH-ubiquinone oxidoreductase 39 kDa pr...    134   7e-34    
gb|EUC62263.1|  NADH-ubiquinone oxidoreductase 39 kDa protein, pu...    134   8e-34    
ref|XP_009634820.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    134   9e-34    
ref|XP_005850526.1|  hypothetical protein CHLNCDRAFT_34039              135   9e-34    
ref|XP_007330075.1|  39kDa subunit of NdufA9, NADH ubiquinone oxi...    134   9e-34    
gb|EJW71823.1|  hypothetical protein WUBG_17270                         129   9e-34    
gb|KFP14044.1|  hypothetical protein Z169_06947                         134   9e-34    
ref|XP_011067114.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   1e-33    
ref|XP_001545366.1|  NADH-ubiquinone oxidoreductase 40 kDa subunit      132   1e-33    
ref|NP_649234.1|  CG6020, isoform A                                     135   1e-33    
emb|CDS05157.1|  Putative NADH dehydrogenase (Ubiquinone) 1FT alp...    134   1e-33    
emb|CDH57814.1|  nadh-ubiquinone oxidoreductase 40 kdamitochondrial     134   1e-33    
ref|XP_001948072.2|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   1e-33    
gb|KIL67845.1|  hypothetical protein M378DRAFT_185427                   134   1e-33    
gb|EJT98653.1|  NADP-binding protein                                    134   1e-33    
ref|XP_011256589.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   1e-33    
gb|KIM43379.1|  hypothetical protein M413DRAFT_403196                   134   1e-33    
emb|CCO27961.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcompl...    134   2e-33    
ref|XP_005712083.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    134   3e-33    
ref|NP_001165787.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...    133   3e-33    
ref|XP_008876068.1|  hypothetical protein H310_11254                    132   4e-33    
ref|XP_003286992.1|  hypothetical protein DICPUDRAFT_97564              132   4e-33    
ref|XP_002839474.1|  hypothetical protein                               132   5e-33    
gb|KFM58002.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    132   6e-33    
ref|XP_001893752.1|  NADH-ubiquinone oxidoreductase 39 kDa subuni...    133   6e-33    
ref|XP_011339338.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   6e-33    
gb|EMR82952.1|  putative nadh-ubiquinone oxidoreductase 39 kda pr...    132   6e-33    
ref|XP_011339337.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   6e-33    
ref|XP_005840852.1|  hypothetical protein GUITHDRAFT_160957             132   8e-33    
ref|XP_004354956.1|  Transcription regulatory protein SNF5              136   1e-32    
dbj|BAM18246.1|  NADH-ubiquinone oxidoreductase 39 kda subunit          132   1e-32    
ref|XP_009162600.1|  hypothetical protein T265_00532                    130   1e-32    
gb|EJD76220.1|  hypothetical protein LOAG_16787                         132   1e-32    
emb|CCG80684.1|  putative NADH-ubiquinone oxidoreductase 39 kDa s...    130   1e-32    
ref|XP_004927924.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    131   1e-32    
gb|EIE86946.1|  hypothetical protein RO3G_11657                         131   2e-32    
ref|XP_011152700.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    131   2e-32    
ref|XP_010789215.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    128   2e-32    
gb|EGT46270.1|  hypothetical protein CAEBREN_21857                      131   2e-32    
ref|XP_004069890.2|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    131   2e-32    
ref|XP_003967219.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    130   3e-32    
emb|CAX69804.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcompl...    128   3e-32    
ref|XP_010760174.1|  NADH-ubiquinone oxidoreductase 40 kDa subuni...    130   3e-32    
gb|EEH22277.2|  NADH-ubiquinone oxidoreductase 40 kDa subunit, mi...    130   4e-32    
ref|XP_007228414.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    130   4e-32    
gb|ERE67038.1|  putative polypeptide N-acetylgalactosaminyltransf...    134   5e-32    
gb|ERE67036.1|  putative polypeptide N-acetylgalactosaminyltransf...    134   5e-32    
gb|EEH33982.2|  NADH-ubiquinone oxidoreductase 40 kDa subunit           130   5e-32    



>ref|XP_011080124.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Sesamum indicum]
Length=400

 Score =   310 bits (795),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  117  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  296
            YLL DQCYG  + R+AS+L  KG GH+VRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL
Sbjct  27   YLLPDQCYGAESTRFASSLATKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  86

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
            AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE
Sbjct  87   AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  146

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            YETRN+SFEEVNH+MA+QLA IAKEHGGI+R+IQ+S LGASP+S SRM
Sbjct  147  YETRNFSFEEVNHHMAEQLALIAKEHGGIMRYIQVSCLGASPSSSSRM  194



>gb|EYU46388.1| hypothetical protein MIMGU_mgv1a007681mg [Erythranthe guttata]
 gb|EYU46389.1| hypothetical protein MIMGU_mgv1a007681mg [Erythranthe guttata]
Length=399

 Score =   302 bits (773),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = +3

Query  60   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGI  239
            LG Q +  S+  IS+ KS+Y L DQ YG   PR+ASTL  KG GH+VRKGTGGRSSVSGI
Sbjct  8    LGYQYIRHSAAPISSFKSAYSLPDQYYGADNPRWASTLATKGVGHLVRKGTGGRSSVSGI  67

Query  240  VATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDEN  419
            +ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKY+PRDE+
Sbjct  68   IATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYDPRDED  127

Query  420  SIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGAS  599
            SIKAVMAKANVVINLIGR+YETRNYSFEEVNH+MA+QLA IAKEHGGI+R+IQ+S LGAS
Sbjct  128  SIKAVMAKANVVINLIGRDYETRNYSFEEVNHHMAEQLAVIAKEHGGIMRYIQVSCLGAS  187

Query  600  PTSPSRM  620
            P+SPS++
Sbjct  188  PSSPSKL  194



>ref|XP_002271401.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Vitis vinifera]
 emb|CBI37199.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   301 bits (772),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 167/187 (89%), Gaps = 1/187 (1%)
 Frame = +3

Query  60   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGI  239
            LG QS N  SP+IS+LKS Y LSD  YG   PR  STL  KG GH+VRKGTGGRSSVSGI
Sbjct  8    LGHQSFN-QSPAISSLKSIYPLSDHYYGADHPRLGSTLAPKGVGHLVRKGTGGRSSVSGI  66

Query  240  VATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDEN  419
            VA VFGATGFLGRY+VQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDEN
Sbjct  67   VAVVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDEN  126

Query  420  SIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGAS  599
            SIKAVMAKANVV+NLIGREYETRNYSFEEVNH+MA+QLA I+KEHGGI+RFIQ+S LGAS
Sbjct  127  SIKAVMAKANVVLNLIGREYETRNYSFEEVNHHMAEQLAMISKEHGGIMRFIQVSCLGAS  186

Query  600  PTSPSRM  620
            P+SPSRM
Sbjct  187  PSSPSRM  193



>emb|CDP03802.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +3

Query  141  GIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVL  320
            G   PRYAS LTA+GTGHIVRKGTGGRSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVL
Sbjct  37   GADNPRYASNLTARGTGHIVRKGTGGRSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVL  96

Query  321  VPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSF  500
            VPFRGSED HRHLKLMGDLGQIVPM+YNPRDENSIKAVMAKANVVINLIGREYETRNYSF
Sbjct  97   VPFRGSEDSHRHLKLMGDLGQIVPMQYNPRDENSIKAVMAKANVVINLIGREYETRNYSF  156

Query  501  EEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            EEVNH+MA++LA IAKEHGGI+RFIQ+S LGASP+SPSRM
Sbjct  157  EEVNHHMAEELAMIAKEHGGIMRFIQVSCLGASPSSPSRM  196



>ref|XP_008789505.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Phoenix dactylifera]
Length=398

 Score =   300 bits (769),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  117  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  296
            Y LS   YGI  PR+ ST++ KG GHI+RKGTGGRSSVSGIVATVFGATGFLGRY+VQQL
Sbjct  26   YPLSSDGYGIDHPRHVSTISVKGGGHIIRKGTGGRSSVSGIVATVFGATGFLGRYVVQQL  85

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
            AKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVV+NLIGRE
Sbjct  86   AKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVLNLIGRE  145

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            YETRNYSFEEVNH MA+QLA IAKEHGGI+RFIQ+S LGASP+SPSRM
Sbjct  146  YETRNYSFEEVNHAMAEQLAVIAKEHGGIMRFIQVSCLGASPSSPSRM  193



>ref|XP_010936110.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Elaeis guineensis]
Length=398

 Score =   299 bits (766),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  117  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  296
            Y LS   YGI  PRY ST++ KG GH+VRKGTGGRSSVSGI+ATVFGATGFLGRY+VQQL
Sbjct  26   YPLSSDGYGIDHPRYVSTISIKGAGHVVRKGTGGRSSVSGIIATVFGATGFLGRYVVQQL  85

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
            AKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVV+NLIGRE
Sbjct  86   AKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVLNLIGRE  145

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            YETRNYSFEEVNH MA+QLA IAKEHGGI+RFIQ+S LGAS +SPSRM
Sbjct  146  YETRNYSFEEVNHAMAEQLAVIAKEHGGIMRFIQVSCLGASSSSPSRM  193



>ref|XP_002301843.1| hypothetical protein POPTR_0002s25720g [Populus trichocarpa]
 gb|EEE81116.1| hypothetical protein POPTR_0002s25720g [Populus trichocarpa]
Length=399

 Score =   298 bits (764),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 163/187 (87%), Gaps = 1/187 (1%)
 Frame = +3

Query  60   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGI  239
            LG QSL P++   S     Y LSD  YG   PR+AS+L AKG GH++RKGTGGRSSVSGI
Sbjct  8    LGHQSLKPAASLSSFKSI-YPLSDHHYGADHPRHASSLAAKGVGHLIRKGTGGRSSVSGI  66

Query  240  VATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDEN  419
            VATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDEN
Sbjct  67   VATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDEN  126

Query  420  SIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGAS  599
            SIKAVMAKANVVINLIGR++ETRNYSFEE+NH M +QLA I+KEHGGI+RFIQ+S LGAS
Sbjct  127  SIKAVMAKANVVINLIGRDHETRNYSFEELNHGMTEQLAMISKEHGGIMRFIQVSCLGAS  186

Query  600  PTSPSRM  620
             +SPSRM
Sbjct  187  ASSPSRM  193



>ref|XP_011024495.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Populus euphratica]
Length=399

 Score =   298 bits (762),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 163/187 (87%), Gaps = 1/187 (1%)
 Frame = +3

Query  60   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGI  239
            LG QSL P++   S     Y LSD  YG   PR+AS+L AKG GH++RKGTGGRSSVSGI
Sbjct  8    LGHQSLKPAASLSSFKSI-YPLSDHHYGADHPRHASSLPAKGVGHLIRKGTGGRSSVSGI  66

Query  240  VATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDEN  419
            VATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDEN
Sbjct  67   VATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDEN  126

Query  420  SIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGAS  599
            SIKAVMAKANVVINLIGR++ETRNYSFEE+NH M +QLA I+KEHGGI+RFIQ+S LGAS
Sbjct  127  SIKAVMAKANVVINLIGRDHETRNYSFEELNHGMTEQLAMISKEHGGIMRFIQVSCLGAS  186

Query  600  PTSPSRM  620
             +SPSRM
Sbjct  187  ASSPSRM  193



>gb|ACU23211.1| unknown [Glycine max]
Length=396

 Score =   296 bits (759),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 164/187 (88%), Gaps = 4/187 (2%)
 Frame = +3

Query  60   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGI  239
            LGQQSL PS+   S     Y +SD  YG+   RY STL  KG GH+VRKGTGGRSSVSGI
Sbjct  8    LGQQSLRPSTSLKSI----YPISDHHYGMDHERYVSTLATKGVGHLVRKGTGGRSSVSGI  63

Query  240  VATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDEN  419
            +ATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKYNPRDE+
Sbjct  64   IATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYNPRDES  123

Query  420  SIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGAS  599
            S+KAVMAKANVVINLIGR+YETRNYSFEEV+++MA+QLA I+KEHGGILRFIQ+S LGAS
Sbjct  124  SVKAVMAKANVVINLIGRDYETRNYSFEEVHYHMAEQLAKISKEHGGILRFIQVSCLGAS  183

Query  600  PTSPSRM  620
            P+SPSRM
Sbjct  184  PSSPSRM  190



>ref|XP_003542442.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Glycine max]
 gb|KHN48948.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Glycine soja]
Length=396

 Score =   296 bits (758),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 164/187 (88%), Gaps = 4/187 (2%)
 Frame = +3

Query  60   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGI  239
            LGQQSL PS+   S     Y +SD  YG+   RY STL  KG GH+VRKGTGGRSSVSGI
Sbjct  8    LGQQSLRPSTSLKSI----YPISDHHYGMDHERYVSTLATKGVGHLVRKGTGGRSSVSGI  63

Query  240  VATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDEN  419
            +ATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKYNPRDE+
Sbjct  64   IATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYNPRDES  123

Query  420  SIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGAS  599
            S+KAVMAKANVVINLIGR+YETRNYSFEEV+++MA+QLA I+KEHGGILRFIQ+S LGAS
Sbjct  124  SVKAVMAKANVVINLIGRDYETRNYSFEEVHYHMAEQLAKISKEHGGILRFIQVSCLGAS  183

Query  600  PTSPSRM  620
            P+SPSRM
Sbjct  184  PSSPSRM  190



>gb|KJB42342.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=234

 Score =   290 bits (742),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 162/188 (86%), Gaps = 2/188 (1%)
 Frame = +3

Query  60   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTA-KGTGHIVRKGTGGRSSVSG  236
            LG QSL P++   S     Y LSD  YG   PRY STL + KG GH+VRKGTGGRSSVSG
Sbjct  8    LGHQSLRPTASISSIKSI-YPLSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGGRSSVSG  66

Query  237  IVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDE  416
            I+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PRDE
Sbjct  67   IIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYDPRDE  126

Query  417  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGA  596
            NSIKAVMAKANVVINLIGREYETRN+SFEEVNH+MA+QLA IAKEHGGI+RFIQ+S LG+
Sbjct  127  NSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVIAKEHGGIMRFIQVSCLGS  186

Query  597  SPTSPSRM  620
            S +SPSR 
Sbjct  187  SLSSPSRF  194



>ref|XP_010940664.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Elaeis guineensis]
Length=398

 Score =   295 bits (756),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  117  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  296
            Y LS   YG+   R+ ST++ KGTGH+VRKGTGGRSSVSGIVATVFGATGFLGRY+VQQL
Sbjct  26   YPLSSDGYGLDHLRHVSTISVKGTGHLVRKGTGGRSSVSGIVATVFGATGFLGRYVVQQL  85

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
            AKMGSQVLVPFRGSED HRHLKLMGDLGQIVPM YNPRDENSIKAVMAKANVV+NLIGRE
Sbjct  86   AKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMNYNPRDENSIKAVMAKANVVLNLIGRE  145

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            YETRNYSFEEVNH MA+QLA IAKEHGGI+RFIQ+S LGASP+SPSRM
Sbjct  146  YETRNYSFEEVNHAMAEQLAVIAKEHGGIMRFIQVSCLGASPSSPSRM  193



>gb|ABK94679.1| unknown [Populus trichocarpa]
Length=399

 Score =   295 bits (756),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 162/187 (87%), Gaps = 1/187 (1%)
 Frame = +3

Query  60   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGI  239
            LG QSL P++   S     Y LSD  YG   PR+AS+L AKG  H++RKGTGGRSSVSGI
Sbjct  8    LGHQSLKPAASLSSFKSI-YPLSDHHYGADHPRHASSLAAKGVCHLIRKGTGGRSSVSGI  66

Query  240  VATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDEN  419
            VATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDEN
Sbjct  67   VATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDEN  126

Query  420  SIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGAS  599
            SIKAVMAKANVVINLIGR++ETRNYSFEE+NH M +QLA I+KEHGGI+RFIQ+S LGAS
Sbjct  127  SIKAVMAKANVVINLIGRDHETRNYSFEELNHGMTEQLAMISKEHGGIMRFIQVSCLGAS  186

Query  600  PTSPSRM  620
             +SPSRM
Sbjct  187  ASSPSRM  193



>gb|KJB42341.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=312

 Score =   291 bits (745),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 162/188 (86%), Gaps = 2/188 (1%)
 Frame = +3

Query  60   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTA-KGTGHIVRKGTGGRSSVSG  236
            LG QSL P++   S     Y LSD  YG   PRY STL + KG GH+VRKGTGGRSSVSG
Sbjct  8    LGHQSLRPTASISSIKSI-YPLSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGGRSSVSG  66

Query  237  IVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDE  416
            I+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PRDE
Sbjct  67   IIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYDPRDE  126

Query  417  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGA  596
            NSIKAVMAKANVVINLIGREYETRN+SFEEVNH+MA+QLA IAKEHGGI+RFIQ+S LG+
Sbjct  127  NSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVIAKEHGGIMRFIQVSCLGS  186

Query  597  SPTSPSRM  620
            S +SPSR 
Sbjct  187  SLSSPSRF  194



>gb|KDP26455.1| hypothetical protein JCGZ_17613 [Jatropha curcas]
Length=396

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 160/187 (86%), Gaps = 4/187 (2%)
 Frame = +3

Query  60   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGI  239
            LGQQ+ NP++   S      L     YG   PRY STLT KG GH+VRKGTGGRSSVSGI
Sbjct  8    LGQQAHNPAASIASLKSIYPL----YYGTDHPRYGSTLTPKGVGHLVRKGTGGRSSVSGI  63

Query  240  VATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDEN  419
            +ATVFGATGFLGRY+VQQLAKMG+QVLVPFRGSED HRHLKLMGDLGQIVPM YNPRDEN
Sbjct  64   IATVFGATGFLGRYVVQQLAKMGTQVLVPFRGSEDSHRHLKLMGDLGQIVPMLYNPRDEN  123

Query  420  SIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGAS  599
            SIKAVMAKANVVINLIGREYETRNYSFEEVNH MA+QLA IAKEHGGI+R+IQ+S LGAS
Sbjct  124  SIKAVMAKANVVINLIGREYETRNYSFEEVNHGMAEQLAMIAKEHGGIMRYIQVSCLGAS  183

Query  600  PTSPSRM  620
             +SPSRM
Sbjct  184  ASSPSRM  190



>gb|KJB42337.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=358

 Score =   292 bits (747),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 162/188 (86%), Gaps = 2/188 (1%)
 Frame = +3

Query  60   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTA-KGTGHIVRKGTGGRSSVSG  236
            LG QSL P++   S     Y LSD  YG   PRY STL + KG GH+VRKGTGGRSSVSG
Sbjct  8    LGHQSLRPTASISSIKSI-YPLSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGGRSSVSG  66

Query  237  IVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDE  416
            I+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PRDE
Sbjct  67   IIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYDPRDE  126

Query  417  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGA  596
            NSIKAVMAKANVVINLIGREYETRN+SFEEVNH+MA+QLA IAKEHGGI+RFIQ+S LG+
Sbjct  127  NSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVIAKEHGGIMRFIQVSCLGS  186

Query  597  SPTSPSRM  620
            S +SPSR 
Sbjct  187  SLSSPSRF  194



>ref|XP_009370595.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Pyrus x bretschneideri]
Length=399

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  117  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  296
            Y LSD  YG   P+Y STL  KG GH+VRKGTGGRSSVSGIVA VFG+TGFLGRYLVQQL
Sbjct  26   YPLSDHYYGADRPKYGSTLATKGVGHLVRKGTGGRSSVSGIVAAVFGSTGFLGRYLVQQL  85

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
            AKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDE+SIKAVMAKANVVINLIGR+
Sbjct  86   AKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDEDSIKAVMAKANVVINLIGRD  145

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            YETRN+SFEEVNH MA+QLA+I+KEHGGI+RFIQ+S LGAS +SPSR 
Sbjct  146  YETRNFSFEEVNHSMAQQLATISKEHGGIMRFIQVSCLGASSSSPSRF  193



>ref|XP_008235764.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Prunus mume]
Length=387

 Score =   292 bits (748),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  117  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  296
            Y +SD  YG   P+Y STL  KG GH+VRKGTGGRSSVSGIVA VFG+TGFLGRYLVQQL
Sbjct  26   YPVSDHYYGADRPKYGSTLATKGVGHLVRKGTGGRSSVSGIVAAVFGSTGFLGRYLVQQL  85

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
            AKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDE+SIKAVMAKANVVINLIGR+
Sbjct  86   AKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDEDSIKAVMAKANVVINLIGRD  145

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            YETRN+SFEEVNH MA+QLA+I+KEHGGI+RFIQ+S LGAS +SPSR 
Sbjct  146  YETRNFSFEEVNHSMAEQLATISKEHGGIMRFIQVSCLGASSSSPSRF  193



>gb|KJB42338.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=367

 Score =   291 bits (745),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 162/188 (86%), Gaps = 2/188 (1%)
 Frame = +3

Query  60   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTA-KGTGHIVRKGTGGRSSVSG  236
            LG QSL P++   S     Y LSD  YG   PRY STL + KG GH+VRKGTGGRSSVSG
Sbjct  8    LGHQSLRPTASISSIKSI-YPLSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGGRSSVSG  66

Query  237  IVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDE  416
            I+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PRDE
Sbjct  67   IIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYDPRDE  126

Query  417  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGA  596
            NSIKAVMAKANVVINLIGREYETRN+SFEEVNH+MA+QLA IAKEHGGI+RFIQ+S LG+
Sbjct  127  NSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVIAKEHGGIMRFIQVSCLGS  186

Query  597  SPTSPSRM  620
            S +SPSR 
Sbjct  187  SLSSPSRF  194



>gb|KJB42340.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=383

 Score =   292 bits (747),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 162/188 (86%), Gaps = 2/188 (1%)
 Frame = +3

Query  60   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTA-KGTGHIVRKGTGGRSSVSG  236
            LG QSL P++   S     Y LSD  YG   PRY STL + KG GH+VRKGTGGRSSVSG
Sbjct  8    LGHQSLRPTASISSIKSI-YPLSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGGRSSVSG  66

Query  237  IVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDE  416
            I+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PRDE
Sbjct  67   IIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYDPRDE  126

Query  417  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGA  596
            NSIKAVMAKANVVINLIGREYETRN+SFEEVNH+MA+QLA IAKEHGGI+RFIQ+S LG+
Sbjct  127  NSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVIAKEHGGIMRFIQVSCLGS  186

Query  597  SPTSPSRM  620
            S +SPSR 
Sbjct  187  SLSSPSRF  194



>ref|XP_009395307.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Musa acuminata subsp. malaccensis]
Length=397

 Score =   292 bits (748),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  117  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  296
            Y LS    G+  PRY ST+  KGTGH++RKGTGGRSSVSGIVATVFGATGFLGRY+V QL
Sbjct  27   YPLSSSECGVDRPRYGSTVAVKGTGHLIRKGTGGRSSVSGIVATVFGATGFLGRYVVSQL  86

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
            AKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDENSIKAVMAK+NVV NLIGRE
Sbjct  87   AKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKSNVVFNLIGRE  146

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            YETRNYSFEEVNH MA+QLA IAKEHGGI+RF+Q+S LGAS +SPSRM
Sbjct  147  YETRNYSFEEVNHAMAEQLAVIAKEHGGIMRFVQVSCLGASSSSPSRM  194



>ref|XP_009370589.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Pyrus x bretschneideri]
Length=422

 Score =   292 bits (748),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  117  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  296
            Y LSD  YG   P+Y STL  KG GH+VRKGTGGRSSVSGIVA VFG+TGFLGRYLVQQL
Sbjct  26   YPLSDHYYGADRPKYGSTLATKGVGHLVRKGTGGRSSVSGIVAAVFGSTGFLGRYLVQQL  85

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
            AKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDE+SIKAVMAKANVVINLIGR+
Sbjct  86   AKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDEDSIKAVMAKANVVINLIGRD  145

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            YETRN+SFEEVNH MA+QLA+I+KEHGGI+RFIQ+S LGAS +SPSR 
Sbjct  146  YETRNFSFEEVNHSMAQQLATISKEHGGIMRFIQVSCLGASSSSPSRF  193



>ref|XP_007201067.1| hypothetical protein PRUPE_ppa006705mg [Prunus persica]
 gb|EMJ02266.1| hypothetical protein PRUPE_ppa006705mg [Prunus persica]
Length=399

 Score =   291 bits (746),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  117  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  296
            Y +SD  YG   P+Y STL  KG GH+VRKGTGGRSSVSGIVA VFG+TGFLGRYLVQQL
Sbjct  26   YPVSDHYYGADRPKYGSTLATKGVGHLVRKGTGGRSSVSGIVAAVFGSTGFLGRYLVQQL  85

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
            AKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDE+SIKAVMAKANVVINLIGR+
Sbjct  86   AKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDEDSIKAVMAKANVVINLIGRD  145

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            YETRN+SFEEVNH MA+QLA+I+KEHGGI+RFIQ+S LGAS +SPSR 
Sbjct  146  YETRNFSFEEVNHSMAEQLATISKEHGGIMRFIQVSCLGASSSSPSRF  193



>gb|KJB42335.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=400

 Score =   291 bits (746),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 162/188 (86%), Gaps = 2/188 (1%)
 Frame = +3

Query  60   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTA-KGTGHIVRKGTGGRSSVSG  236
            LG QSL P++   S     Y LSD  YG   PRY STL + KG GH+VRKGTGGRSSVSG
Sbjct  8    LGHQSLRPTASISSIKSI-YPLSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGGRSSVSG  66

Query  237  IVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDE  416
            I+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PRDE
Sbjct  67   IIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYDPRDE  126

Query  417  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGA  596
            NSIKAVMAKANVVINLIGREYETRN+SFEEVNH+MA+QLA IAKEHGGI+RFIQ+S LG+
Sbjct  127  NSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVIAKEHGGIMRFIQVSCLGS  186

Query  597  SPTSPSRM  620
            S +SPSR 
Sbjct  187  SLSSPSRF  194



>ref|XP_008382707.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Malus domestica]
Length=437

 Score =   292 bits (748),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  117  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  296
            Y LSD  YG   P+Y STL  KG GH+VRKGTGGRSSVSGIVA VFG+TGFLGRYLVQQL
Sbjct  64   YPLSDHYYGADRPKYGSTLATKGVGHLVRKGTGGRSSVSGIVAAVFGSTGFLGRYLVQQL  123

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
            AKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDE+SIKAVM+KANVVINLIGR+
Sbjct  124  AKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDEDSIKAVMSKANVVINLIGRD  183

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            YETRN+SFEEVNH MA+QLA+I+KEHGGI+RFIQ+S LGAS +SPSR 
Sbjct  184  YETRNFSFEEVNHSMAQQLATISKEHGGIMRFIQVSCLGASSSSPSRF  231



>ref|XP_010684864.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Beta vulgaris subsp. vulgaris]
Length=395

 Score =   289 bits (740),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = +3

Query  117  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  296
            Y LSD  YG+   RY STL  KG  H+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQL
Sbjct  22   YALSDPRYGVDHSRYGSTLATKGVAHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  81

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
            AKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PRDE SIKAVMAKANVVINLIGRE
Sbjct  82   AKMGSQVLVPFRGSEDSPRHLKLMGDLGQIVPMKYDPRDECSIKAVMAKANVVINLIGRE  141

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            YETRNYSFEEVNH+MA+ LA IAKEHGGI+RFIQ+S LGASPTS SRM
Sbjct  142  YETRNYSFEEVNHHMAEHLAMIAKEHGGIMRFIQVSCLGASPTSASRM  189



>ref|XP_011458045.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Fragaria vesca subsp. vesca]
Length=397

 Score =   289 bits (740),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  117  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  296
            Y  SD  YG   P+Y STL  KG GH+VRKGTGGRSSVSGIVA VFG+TGFLGRYLVQQL
Sbjct  24   YPTSDHYYGAERPKYGSTLATKGVGHLVRKGTGGRSSVSGIVAAVFGSTGFLGRYLVQQL  83

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
            AKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDE+SIKAVMAKANVVINLIGRE
Sbjct  84   AKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDESSIKAVMAKANVVINLIGRE  143

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSR  617
            YETRN+SFEEVNH MA+QLA I+KEHGGI+RFIQ+S LGASP+S SR
Sbjct  144  YETRNFSFEEVNHSMAEQLAMISKEHGGIMRFIQVSCLGASPSSESR  190



>ref|XP_009335235.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Pyrus x bretschneideri]
Length=399

 Score =   290 bits (741),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  117  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  296
            Y LSD  YG   P+  STL  KG GH+VRKGTGGRSSVSGIVA VFG+TGFLGRYLVQQL
Sbjct  26   YPLSDHYYGADRPKCGSTLATKGVGHLVRKGTGGRSSVSGIVAAVFGSTGFLGRYLVQQL  85

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
            AKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDE+SIKAVMAKANVVINLIGR+
Sbjct  86   AKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDEDSIKAVMAKANVVINLIGRD  145

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            YETRN+SFEEVNH MA+QLA+I+KEHGGI+RFIQ+S LGAS +SPSR 
Sbjct  146  YETRNFSFEEVNHSMAQQLATISKEHGGIMRFIQVSCLGASSSSPSRF  193



>ref|XP_007144408.1| hypothetical protein PHAVU_007G153700g [Phaseolus vulgaris]
 gb|ESW16402.1| hypothetical protein PHAVU_007G153700g [Phaseolus vulgaris]
Length=394

 Score =   289 bits (740),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 163/187 (87%), Gaps = 4/187 (2%)
 Frame = +3

Query  60   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGI  239
            LG QSL     S ++L++ Y +SD  Y     R+ ST+  KG GH+VRKGTGGRSSVSGI
Sbjct  8    LGHQSLK----SSTSLRAIYPISDHHYVADHERFVSTIANKGVGHLVRKGTGGRSSVSGI  63

Query  240  VATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDEN  419
            +ATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSEDC RHLKLMGDLGQIVPMKYNPRDE+
Sbjct  64   IATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDCPRHLKLMGDLGQIVPMKYNPRDES  123

Query  420  SIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGAS  599
            S+KAVMAKANVVINLIGR+YETRNYSFEEVN++MA+ LA I+KEHGGILRFIQ+S LGAS
Sbjct  124  SVKAVMAKANVVINLIGRDYETRNYSFEEVNYHMAENLAKISKEHGGILRFIQVSCLGAS  183

Query  600  PTSPSRM  620
            P+SPSRM
Sbjct  184  PSSPSRM  190



>ref|XP_010091822.1| hypothetical protein L484_015891 [Morus notabilis]
 gb|EXB46030.1| hypothetical protein L484_015891 [Morus notabilis]
Length=399

 Score =   289 bits (739),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 158/187 (84%), Gaps = 1/187 (1%)
 Frame = +3

Query  60   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGI  239
            LG QSL+PS    +     + L D  YG   PR  STL  KG GH+VRKGTGGRSSVSGI
Sbjct  8    LGHQSLSPSPSISALKSI-HPLFDSYYGADHPRCGSTLATKGLGHLVRKGTGGRSSVSGI  66

Query  240  VATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDEN  419
            VATVFGATGFLGRY+VQQLAKMGSQVLVPFRG ED HRHLKLMGDLGQIVPMKYNPRDE 
Sbjct  67   VATVFGATGFLGRYVVQQLAKMGSQVLVPFRGCEDSHRHLKLMGDLGQIVPMKYNPRDEA  126

Query  420  SIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGAS  599
            SIKAVMAKANVV+NLIGREYETRNYSFE  NH+MA+QLA+IAKEHGGI+R+IQ+S LGAS
Sbjct  127  SIKAVMAKANVVVNLIGREYETRNYSFEVANHFMAEQLATIAKEHGGIIRYIQVSCLGAS  186

Query  600  PTSPSRM  620
             +SPSRM
Sbjct  187  ASSPSRM  193



>gb|AFK48198.1| unknown [Lotus japonicus]
Length=396

 Score =   288 bits (738),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 160/185 (86%), Gaps = 4/185 (2%)
 Frame = +3

Query  66   QQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVA  245
             QSL PS+   S     Y +SD  YG    R+ ST+  KG GH+VRKGTGGRSSVSGIVA
Sbjct  10   HQSLKPSTSLKSI----YPISDHHYGADHERFVSTIATKGVGHLVRKGTGGRSSVSGIVA  65

Query  246  TVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSI  425
            TVFGATGFLGRY+VQ LAKMGSQVLVPFRGSEDCHRHLKLMGDLGQ+VPMKYNPRDE+S+
Sbjct  66   TVFGATGFLGRYVVQHLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQVVPMKYNPRDESSV  125

Query  426  KAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPT  605
            KAVMAKANVVINLIGR++ETRNYS+E+V+++MA QLA I+KEHGGI+RFIQ+S LGASP+
Sbjct  126  KAVMAKANVVINLIGRDFETRNYSYEQVHYHMADQLARISKEHGGIMRFIQVSCLGASPS  185

Query  606  SPSRM  620
            SPSRM
Sbjct  186  SPSRM  190



>ref|XP_002321296.2| hypothetical protein POPTR_0014s18680g [Populus trichocarpa]
 gb|EEE99611.2| hypothetical protein POPTR_0014s18680g [Populus trichocarpa]
Length=384

 Score =   288 bits (737),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  117  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  296
            Y LSD  YG   PRY STL  +G GH++RKGTGGRSSVSGIVATVFGATGFLGRY+VQQL
Sbjct  21   YPLSDHLYGADHPRYGSTLATRGVGHLIRKGTGGRSSVSGIVATVFGATGFLGRYVVQQL  80

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
            AKMGSQVLVPFRGS+D  RHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGR+
Sbjct  81   AKMGSQVLVPFRGSDDDPRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRD  140

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            YETRNYSFEE+NH MA QLA I+KEHGGI+RFIQ+S LGAS +SPSR+
Sbjct  141  YETRNYSFEELNHAMAGQLAMISKEHGGIMRFIQVSCLGASASSPSRL  188



>ref|XP_007050145.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007050146.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX94302.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX94303.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
Length=400

 Score =   288 bits (737),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 159/188 (85%), Gaps = 2/188 (1%)
 Frame = +3

Query  60   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTA-KGTGHIVRKGTGGRSSVSG  236
            LGQQSL P+    S     Y L    YG   PRY STL A KG GH+VRKGTGGRSSVSG
Sbjct  8    LGQQSLRPTPSIYSIECI-YPLFHHYYGCDHPRYGSTLAAHKGLGHLVRKGTGGRSSVSG  66

Query  237  IVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDE  416
            I+ATVFGATGF GRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PRDE
Sbjct  67   IIATVFGATGFFGRYVVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYDPRDE  126

Query  417  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGA  596
            NSIKAVMAKANVVINLIGREYETRNYSFEEVNH+MA+QLA IA+EHGGI+RFIQ+S LG+
Sbjct  127  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHFMAEQLAVIAREHGGIMRFIQVSCLGS  186

Query  597  SPTSPSRM  620
            SP+S SR 
Sbjct  187  SPSSASRF  194



>ref|XP_007050147.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOX94304.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 3 [Theobroma 
cacao]
Length=392

 Score =   288 bits (736),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 159/188 (85%), Gaps = 10/188 (5%)
 Frame = +3

Query  60   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTA-KGTGHIVRKGTGGRSSVSG  236
            LGQQSL P+           + S + YG   PRY STL A KG GH+VRKGTGGRSSVSG
Sbjct  8    LGQQSLRPTPS---------IYSIEYYGCDHPRYGSTLAAHKGLGHLVRKGTGGRSSVSG  58

Query  237  IVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDE  416
            I+ATVFGATGF GRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PRDE
Sbjct  59   IIATVFGATGFFGRYVVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYDPRDE  118

Query  417  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGA  596
            NSIKAVMAKANVVINLIGREYETRNYSFEEVNH+MA+QLA IA+EHGGI+RFIQ+S LG+
Sbjct  119  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHFMAEQLAVIAREHGGIMRFIQVSCLGS  178

Query  597  SPTSPSRM  620
            SP+S SR 
Sbjct  179  SPSSASRF  186



>gb|KGN46368.1| hypothetical protein Csa_6G087960 [Cucumis sativus]
Length=401

 Score =   287 bits (735),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +3

Query  117  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  296
            Y LS    G   PRY STL  +G GH+VRKGTGGRSSVSGIVATVFGATGFLGRY+VQQL
Sbjct  28   YPLSHHYCGADRPRYDSTLATRGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYVVQQL  87

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
            AKMGSQVLVPFRGSED  RHLK+MGDLGQIVPMKYNPRDENS+KAVMAKANVV+NLIGRE
Sbjct  88   AKMGSQVLVPFRGSEDSPRHLKIMGDLGQIVPMKYNPRDENSVKAVMAKANVVLNLIGRE  147

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            YETRNYSFEEVNH MA+QLA+IAKEHGGILRFIQ+S LGAS +SPSR 
Sbjct  148  YETRNYSFEEVNHSMAEQLATIAKEHGGILRFIQVSCLGASSSSPSRF  195



>ref|XP_006355892.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Solanum tuberosum]
Length=401

 Score =   286 bits (733),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 164/188 (87%), Gaps = 1/188 (1%)
 Frame = +3

Query  60   LGQQSLNPsspsisalkssYLLSD-QCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSG  236
            LG QSL   SP+IS+ KS Y LSD   YG  TPRYAS L   G G ++RKGTGGRSSVSG
Sbjct  8    LGHQSLKHHSPAISSFKSLYPLSDDHYYGYLTPRYASNLATGGVGPLIRKGTGGRSSVSG  67

Query  237  IVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDE  416
            IVATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKYNPRDE
Sbjct  68   IVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQIVPMKYNPRDE  127

Query  417  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGA  596
            NS+KAVMAKANVVINLIGR+YETRNYSF+EVN +MA+QLA IAKEHGGI+RFIQ+SSLGA
Sbjct  128  NSVKAVMAKANVVINLIGRDYETRNYSFDEVNLHMAEQLAMIAKEHGGIMRFIQVSSLGA  187

Query  597  SPTSPSRM  620
            SP S SR+
Sbjct  188  SPASSSRL  195



>ref|XP_008459972.1| PREDICTED: LOW QUALITY PROTEIN: NADH dehydrogenase [ubiquinone] 
1 alpha subcomplex subunit 9, mitochondrial [Cucumis melo]
Length=402

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +3

Query  117  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  296
            Y LS    G   PRY STL  +G GH+VRKGTGGRSSVSGIVATVFGATGFLGRY+VQQL
Sbjct  29   YPLSHHYCGADRPRYDSTLATRGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYVVQQL  88

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
            AKMGSQVLVPFRGSED  RHLK+MGDLGQIVPMKYNPRDE+S+KAVMAKANVV+NLIGRE
Sbjct  89   AKMGSQVLVPFRGSEDSPRHLKIMGDLGQIVPMKYNPRDESSVKAVMAKANVVLNLIGRE  148

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            YETRNYSFEEVNH MA+QLA+IAKEHGGILRFIQ+S LGAS +SPSR 
Sbjct  149  YETRNYSFEEVNHSMAEQLATIAKEHGGILRFIQVSCLGASSSSPSRF  196



>ref|XP_010264829.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nelumbo nucifera]
 ref|XP_010264830.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nelumbo nucifera]
Length=397

 Score =   285 bits (728),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = +3

Query  138  YGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQV  317
            Y    PRY STL  KG GH+VRKGTGGRSSVSGIVATVFGATGFLGRY+VQQLAKMGSQV
Sbjct  32   YVTDHPRYGSTLAPKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYVVQQLAKMGSQV  91

Query  318  LVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYS  497
            LVPFRGSED  RHLKLMGDLGQIVPMKYNPRDE+SIKAVMAKANVV+NLIGREYETRN+S
Sbjct  92   LVPFRGSEDSPRHLKLMGDLGQIVPMKYNPRDESSIKAVMAKANVVLNLIGREYETRNFS  151

Query  498  FEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            FEEVNH MA+QLA IAKEHGGI+RFIQ+S LGAS +SPSRM
Sbjct  152  FEEVNHSMAEQLAMIAKEHGGIMRFIQVSCLGASTSSPSRM  192



>ref|XP_004247128.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Solanum lycopersicum]
Length=401

 Score =   285 bits (728),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 164/188 (87%), Gaps = 1/188 (1%)
 Frame = +3

Query  60   LGQQSLNPsspsisalkssYLLSD-QCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSG  236
            LG QSL   SP+IS+ KS Y LSD   YG  TPRYAS L   G G ++RKGTGGRSSVSG
Sbjct  8    LGHQSLKHHSPAISSFKSLYPLSDDHYYGYLTPRYASNLATGGAGPLIRKGTGGRSSVSG  67

Query  237  IVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDE  416
            IVATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKYNPRDE
Sbjct  68   IVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQIVPMKYNPRDE  127

Query  417  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGA  596
            NS+KAVMAKANVVINLIGR+YETRNYSF+EVN ++A+QLA IAKEHGGI+RFIQ+SSLGA
Sbjct  128  NSVKAVMAKANVVINLIGRDYETRNYSFDEVNLHIAEQLAMIAKEHGGIMRFIQVSSLGA  187

Query  597  SPTSPSRM  620
            SP S SR+
Sbjct  188  SPASSSRL  195



>ref|XP_009586626.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586627.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586628.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586629.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586630.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
Length=397

 Score =   284 bits (726),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 155/187 (83%), Gaps = 3/187 (2%)
 Frame = +3

Query  60   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGI  239
            LG QSL  S    S         DQ YG    R+AS +   G GH+ RKGTGGRSSVSGI
Sbjct  8    LGHQSLKHSPAISSFKSLYPPSDDQYYG---SRFASNVATSGGGHLARKGTGGRSSVSGI  64

Query  240  VATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDEN  419
            VATVFGATGFLGRY+VQ+LAKMG+QVLVPFRGSED  RHLKLMGDLGQIVPMKYNPRDEN
Sbjct  65   VATVFGATGFLGRYVVQELAKMGTQVLVPFRGSEDSPRHLKLMGDLGQIVPMKYNPRDEN  124

Query  420  SIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGAS  599
            S+KAVMAKANVVINLIGREYETRNYSFEEVNH+MA+QLA IAKEHGGI+RFIQ+S LG S
Sbjct  125  SVKAVMAKANVVINLIGREYETRNYSFEEVNHHMAEQLAMIAKEHGGIMRFIQVSCLGVS  184

Query  600  PTSPSRM  620
            PTSPSRM
Sbjct  185  PTSPSRM  191



>ref|XP_009763970.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Nicotiana sylvestris]
Length=314

 Score =   279 bits (714),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 163/187 (87%), Gaps = 3/187 (2%)
 Frame = +3

Query  60   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGI  239
            LG QSL   SP+IS+ KS Y  SD  Y  G+ R+AS +   G GH+ RKGTGGRSSVSGI
Sbjct  8    LGHQSLK-HSPAISSFKSLYPPSDDHY-CGS-RFASNVATSGGGHLARKGTGGRSSVSGI  64

Query  240  VATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDEN  419
            VATVFGATGFLGRY+VQ+LAKMG+QVLVPFRGSED  RHLKLMGDLGQIVPMKYNPRDEN
Sbjct  65   VATVFGATGFLGRYVVQELAKMGTQVLVPFRGSEDSPRHLKLMGDLGQIVPMKYNPRDEN  124

Query  420  SIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGAS  599
            S+KAVMAKANVVINLIGREYETRNYSFEEVNH+MA+QLA IAKEHGGI+RFIQ+S LG S
Sbjct  125  SVKAVMAKANVVINLIGREYETRNYSFEEVNHHMAEQLAMIAKEHGGIIRFIQVSCLGVS  184

Query  600  PTSPSRM  620
            PTSPSRM
Sbjct  185  PTSPSRM  191



>ref|XP_008372401.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Malus domestica]
Length=399

 Score =   282 bits (722),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  117  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  296
            Y LSD  YG   P+Y STL  KG GH+VRKGTGGRSSVSGIVA VFG+TGFLGRYLVQQL
Sbjct  26   YPLSDHYYGADRPKYGSTLATKGVGHLVRKGTGGRSSVSGIVAAVFGSTGFLGRYLVQQL  85

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
            AKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMKYNPRDE+SIKAVMAKANVVINLIGR+
Sbjct  86   AKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKYNPRDEDSIKAVMAKANVVINLIGRD  145

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGA  596
            +ETRN+SFEEVNH MA+QLA+I+KEHGGI+RFIQ+S LGA
Sbjct  146  FETRNFSFEEVNHSMAQQLATISKEHGGIMRFIQVSCLGA  185



>ref|XP_010540921.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Tarenaya hassleriana]
Length=402

 Score =   282 bits (721),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  117  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  296
            Y + D  +GI   RY+S+L  KG GH+ RKGTGGRSSVSGI+ATVFGATGFLGRYLVQQL
Sbjct  29   YEVPDHYHGIDDRRYSSSLATKGMGHLARKGTGGRSSVSGIIATVFGATGFLGRYLVQQL  88

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
            AKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK+NPRDE+SIKAVMAKANVVINLIGR+
Sbjct  89   AKMGSQVLVPFRGSEDDPRHLKLMGDLGQIVPMKFNPRDEDSIKAVMAKANVVINLIGRD  148

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            YETRN+SFEEVNH+M+++LA +AKEHGGI+RFIQ+S LGA+ TSPSRM
Sbjct  149  YETRNFSFEEVNHHMSEKLAMLAKEHGGIMRFIQVSCLGAAATSPSRM  196



>ref|XP_006648113.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Oryza brachyantha]
Length=360

 Score =   280 bits (716),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 132/147 (90%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +3

Query  180  KGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHL  359
            KGTGH+VRKGTGGRSSVSGI+ATVFGATGFLGRYLVQQLAKMG+QVLVPFRGSEDCHRHL
Sbjct  9    KGTGHLVRKGTGGRSSVSGIIATVFGATGFLGRYLVQQLAKMGTQVLVPFRGSEDCHRHL  68

Query  360  KLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLAS  539
            KLMGDLGQIVPMKYNPRD NSIKAVMAK+NVVINLIGREYETRNY FEEVNH+MA+QLA 
Sbjct  69   KLMGDLGQIVPMKYNPRDVNSIKAVMAKSNVVINLIGREYETRNYGFEEVNHHMAEQLAM  128

Query  540  IAKEHGGILRFIQLSSLGASPTSPSRM  620
            I+KEHGGI+RFIQ+S LGAS +SPSRM
Sbjct  129  ISKEHGGIMRFIQVSCLGASASSPSRM  155



>ref|XP_006408954.1| hypothetical protein EUTSA_v10002002mg [Eutrema salsugineum]
 gb|ESQ50407.1| hypothetical protein EUTSA_v10002002mg [Eutrema salsugineum]
Length=402

 Score =   280 bits (717),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  117  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  296
            Y +SD   G  + RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQL
Sbjct  29   YGVSDHLNGTDSRRYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  88

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
            AKMGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGRE
Sbjct  89   AKMGSQVLVPFRGSEDSPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGRE  148

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            YETRN+SFEE NH+MA++LA +AKEHGGI+RFIQ+S LGAS +SPSRM
Sbjct  149  YETRNFSFEEANHHMAEKLALVAKEHGGIMRFIQVSCLGASVSSPSRM  196



>ref|NP_001048516.1| Os02g0816800 [Oryza sativa Japonica Group]
 dbj|BAD21515.1| putative NADH dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAD22016.1| putative NADH dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAF10430.1| Os02g0816800 [Oryza sativa Japonica Group]
Length=408

 Score =   281 bits (718),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/147 (90%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +3

Query  180  KGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHL  359
            KGTGH+VRKGTGGRSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHL
Sbjct  57   KGTGHLVRKGTGGRSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHL  116

Query  360  KLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLAS  539
            KLMGDLGQIVPMKYNPRD +SIKAVMAK+NVVINLIGREYETRNY F+EVNH+MA+QLA 
Sbjct  117  KLMGDLGQIVPMKYNPRDVDSIKAVMAKSNVVINLIGREYETRNYGFDEVNHHMAEQLAM  176

Query  540  IAKEHGGILRFIQLSSLGASPTSPSRM  620
            I+KEHGGI+RFIQ+SSLGAS +SPSRM
Sbjct  177  ISKEHGGIMRFIQVSSLGASASSPSRM  203



>gb|ACJ84721.1| unknown [Medicago truncatula]
 gb|AFK38059.1| unknown [Medicago truncatula]
 gb|KEH42458.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Medicago truncatula]
Length=396

 Score =   280 bits (716),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +3

Query  117  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  296
            Y +SD  YG+   RY ST+  KG GH+VRKGTGGRSSVSGIVATVFGATGFLGRY+VQQL
Sbjct  23   YPISDHYYGVNHERYVSTIATKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYVVQQL  82

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
            AKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK+NPRDE+S+KAVMA+ANVVINLIGR+
Sbjct  83   AKMGSQVLVPFRGSEDSPRHLKLMGDLGQIVPMKFNPRDESSVKAVMARANVVINLIGRD  142

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            YETRN+S+EEV+++MA++LA I+KEHGGI+RFIQ+S LGASP+S SRM
Sbjct  143  YETRNFSYEEVHYHMAEKLAKISKEHGGIMRFIQVSCLGASPSSSSRM  190



>ref|XP_009102039.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Brassica rapa]
Length=402

 Score =   279 bits (713),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  LSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  302
            +SD   G    RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK
Sbjct  31   VSDHLNGSDNRRYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  90

Query  303  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYE  482
            MGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGREYE
Sbjct  91   MGSQVLVPFRGSEDNPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREYE  150

Query  483  TRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            TRN+SFEEVNH+MA++LA +AKEHGGI+RFIQ+S LGAS +SPSRM
Sbjct  151  TRNFSFEEVNHHMAEKLALVAKEHGGIMRFIQVSCLGASVSSPSRM  196



>emb|CDY31970.1| BnaA07g00250D [Brassica napus]
Length=402

 Score =   279 bits (713),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  LSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  302
            +SD   G    RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK
Sbjct  31   VSDHLNGSDNRRYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  90

Query  303  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYE  482
            MGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGREYE
Sbjct  91   MGSQVLVPFRGSEDNPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREYE  150

Query  483  TRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            TRN+SFEEVNH+MA++LA +AKEHGGI+RFIQ+S LGAS +SPSRM
Sbjct  151  TRNFSFEEVNHHMAEKLALVAKEHGGIMRFIQVSCLGASVSSPSRM  196



>emb|CDY39772.1| BnaA09g10240D [Brassica napus]
Length=403

 Score =   278 bits (712),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  LSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  302
            +SD   G    RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK
Sbjct  32   VSDYLNGSDNRRYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  91

Query  303  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYE  482
            MGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGREYE
Sbjct  92   MGSQVLVPFRGSEDNPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREYE  151

Query  483  TRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            TRN+SFEEVNH+MA++LA +AKEHGGI+RFIQ+S LGAS +SPSRM
Sbjct  152  TRNFSFEEVNHHMAEKLALVAKEHGGIMRFIQVSCLGASVSSPSRM  197



>ref|XP_010036149.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Eucalyptus grandis]
 gb|KCW47684.1| hypothetical protein EUGRSUZ_K01422 [Eucalyptus grandis]
Length=394

 Score =   278 bits (711),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = +3

Query  117  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  296
            Y L +  YG    RY ST+  KG GH+VRKGTGGRSSVSGIVATVFGATGFLGRY+VQQL
Sbjct  21   YPLCNHYYGADDGRYVSTVATKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYVVQQL  80

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
            AKMGSQVLVPFR SED HRHLKLMGDLGQIVPM++NPRDE SIKAVMAKANVVINLIGRE
Sbjct  81   AKMGSQVLVPFRCSEDSHRHLKLMGDLGQIVPMQFNPRDEGSIKAVMAKANVVINLIGRE  140

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            YETRNYSFEEVNH MA+ LA+IAKEHGGI+R+IQ+S LGAS +SPS+ 
Sbjct  141  YETRNYSFEEVNHSMAEVLANIAKEHGGIMRYIQVSCLGASSSSPSKF  188



>gb|EEC74241.1| hypothetical protein OsI_09443 [Oryza sativa Indica Group]
Length=408

 Score =   278 bits (712),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/147 (89%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +3

Query  180  KGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHL  359
            KGTGH+VRKGTGGRSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHL
Sbjct  57   KGTGHLVRKGTGGRSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHL  116

Query  360  KLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLAS  539
            KLMGDLGQIVPMKYNPRD +SIKAVMAK+NVVINLIGREYETRNY F+EVNH+MA+QLA 
Sbjct  117  KLMGDLGQIVPMKYNPRDVDSIKAVMAKSNVVINLIGREYETRNYGFDEVNHHMAEQLAM  176

Query  540  IAKEHGGILRFIQLSSLGASPTSPSRM  620
            I+KEHGGI+RFI +SSLGAS +SPSRM
Sbjct  177  ISKEHGGIMRFIHVSSLGASASSPSRM  203



>ref|XP_009112664.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Brassica rapa]
Length=403

 Score =   278 bits (711),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  LSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  302
            + D   G    RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK
Sbjct  32   VPDYLNGSDNRRYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  91

Query  303  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYE  482
            MGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGREYE
Sbjct  92   MGSQVLVPFRGSEDNPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREYE  151

Query  483  TRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            TRN+SFEEVNH+MA++LA +AKEHGGI+RFIQ+S LGAS TSPSRM
Sbjct  152  TRNFSFEEVNHHMAEKLALVAKEHGGIMRFIQVSCLGASVTSPSRM  197



>ref|XP_006854436.1| hypothetical protein AMTR_s00039p00218660 [Amborella trichopoda]
 gb|ERN15903.1| hypothetical protein AMTR_s00039p00218660 [Amborella trichopoda]
Length=397

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  156  RYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG  335
            RY S++  KG+G++VRKGTGGRSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRG
Sbjct  37   RYGSSVALKGSGYLVRKGTGGRSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRG  96

Query  336  SEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNH  515
             ED HRHLKLMGDLGQIVPMKY+PRDE SIKAVMAKANVVINLIGREYETRNYSFEEVNH
Sbjct  97   CEDSHRHLKLMGDLGQIVPMKYDPRDEGSIKAVMAKANVVINLIGREYETRNYSFEEVNH  156

Query  516  YMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
             MA+QL+ IAKEHGGI+RFIQ+S LGAS +SPSRM
Sbjct  157  VMAEQLSMIAKEHGGIMRFIQVSCLGASSSSPSRM  191



>emb|CDY03308.1| BnaC09g10400D [Brassica napus]
Length=402

 Score =   277 bits (708),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  LSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  302
            + D   G    RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK
Sbjct  31   VPDYLNGSDNRRYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  90

Query  303  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYE  482
            MGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGREYE
Sbjct  91   MGSQVLVPFRGSEDNPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREYE  150

Query  483  TRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            TRN+SFEEVNH+MA++LA +AKEHGGI+RFIQ+S LGAS +SPSRM
Sbjct  151  TRNFSFEEVNHHMAEKLALVAKEHGGIMRFIQVSCLGASVSSPSRM  196



>gb|KFK40412.1| hypothetical protein AALP_AA3G370500 [Arabis alpina]
Length=404

 Score =   277 bits (708),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  117  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  296
            Y +SD   G    RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQL
Sbjct  31   YGVSDHLNGTDNRRYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  90

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
            AKMGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGRE
Sbjct  91   AKMGSQVLVPFRGSEDDPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGRE  150

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            YETRN+SFE+VNH+MA++LA +AKEHGGI+R+IQ+S LGAS +SPSRM
Sbjct  151  YETRNFSFEDVNHHMAEKLALVAKEHGGIMRYIQVSCLGASVSSPSRM  198



>ref|XP_006296717.1| hypothetical protein CARUB_v10014190mg [Capsella rubella]
 gb|EOA29615.1| hypothetical protein CARUB_v10014190mg [Capsella rubella]
Length=323

 Score =   274 bits (701),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  LSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  302
            +S+   G    RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK
Sbjct  31   VSNHLNGSDNRRYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  90

Query  303  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYE  482
            MGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGREYE
Sbjct  91   MGSQVLVPFRGSEDSPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREYE  150

Query  483  TRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            TRN+SFEEVNH++A++LA +AKEHGGI+R+IQ+S LGAS +SPSRM
Sbjct  151  TRNFSFEEVNHHIAEKLALVAKEHGGIMRYIQVSCLGASMSSPSRM  196



>emb|CDY05746.1| BnaC07g00570D [Brassica napus]
Length=402

 Score =   276 bits (707),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  LSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  302
            +SD   G    RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK
Sbjct  31   VSDHFNGNDNRRYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  90

Query  303  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYE  482
            MGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGREYE
Sbjct  91   MGSQVLVPFRGSEDNPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREYE  150

Query  483  TRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            TRN+SF+EVNH+MA++LA +AKEHGGI+RFIQ+S LGAS +SPSRM
Sbjct  151  TRNFSFKEVNHHMAEKLALVAKEHGGIMRFIQVSCLGASVSSPSRM  196



>ref|XP_010548735.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Tarenaya hassleriana]
Length=402

 Score =   276 bits (705),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +3

Query  126  SDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKM  305
            S   +G    RY+S+L AKG GH+ RKGTGGRSSVSGI+ATVFGATGFLGRYLVQQLAKM
Sbjct  32   SSHHHGKDNRRYSSSLAAKGVGHLARKGTGGRSSVSGIIATVFGATGFLGRYLVQQLAKM  91

Query  306  GSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYET  485
            GSQVLVPFRGSED  RHLKLMGDLGQIVPMK+NPRDE+SIKAVMAKANVVINL GREYET
Sbjct  92   GSQVLVPFRGSEDDPRHLKLMGDLGQIVPMKFNPRDEDSIKAVMAKANVVINLTGREYET  151

Query  486  RNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            RN+SFEEVNH+MA++LA +AKEHGGI+RFIQ+S LGAS +SPS+M
Sbjct  152  RNFSFEEVNHHMAEKLALLAKEHGGIMRFIQVSCLGASASSPSKM  196



>emb|CDX81965.1| BnaC08g36360D [Brassica napus]
Length=403

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = +3

Query  117  YLLSDQ-CYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQ  293
            Y +SD    G    RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQ
Sbjct  29   YGVSDHHLNGADNRRYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQ  88

Query  294  LAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGR  473
            LAKMGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGR
Sbjct  89   LAKMGSQVLVPFRGSEDNPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGR  148

Query  474  EYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            EYETRN+SFEEVNH+MA++LA +AKEHGGI+RFIQ+S LGAS +SPSRM
Sbjct  149  EYETRNFSFEEVNHHMAEKLALVAKEHGGIMRFIQVSCLGASLSSPSRM  197



>ref|XP_009117495.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Brassica rapa]
Length=403

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  156  RYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG  335
            RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG
Sbjct  43   RYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG  102

Query  336  SEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNH  515
            SED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGREYETRN+SFEEVNH
Sbjct  103  SEDNPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEEVNH  162

Query  516  YMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            +MA++LA +AKEHGGI+RFIQ+S LGAS +SPSRM
Sbjct  163  HMAEKLALVAKEHGGIMRFIQVSCLGASLSSPSRM  197



>emb|CDY13877.1| BnaA09g43790D [Brassica napus]
Length=403

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  156  RYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG  335
            RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG
Sbjct  43   RYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG  102

Query  336  SEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNH  515
            SED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGREYETRN+SFEEVNH
Sbjct  103  SEDNPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEEVNH  162

Query  516  YMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            +MA++LA +AKEHGGI+RFIQ+S LGAS +SPSRM
Sbjct  163  HMAEKLALVAKEHGGIMRFIQVSCLGASLSSPSRM  197



>ref|XP_002453037.1| hypothetical protein SORBIDRAFT_04g037200 [Sorghum bicolor]
 gb|EES06013.1| hypothetical protein SORBIDRAFT_04g037200 [Sorghum bicolor]
Length=408

 Score =   274 bits (700),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 147/158 (93%), Gaps = 3/158 (2%)
 Frame = +3

Query  156  RYASTLTA---KGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVP  326
            RY S+  A   KG+GH+VRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVP
Sbjct  46   RYMSSARAPAVKGSGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVP  105

Query  327  FRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEE  506
            FRG ED HRHLK+MGDLGQIVPMKY+PRD +SIKAVMAK+NVVINLIGREYETRNYSFEE
Sbjct  106  FRGCEDSHRHLKIMGDLGQIVPMKYHPRDVDSIKAVMAKSNVVINLIGREYETRNYSFEE  165

Query  507  VNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            VNH+MA+QLA+IAKEHGGI+RFIQ+S LGASP+S SR+
Sbjct  166  VNHHMAEQLATIAKEHGGIMRFIQVSCLGASPSSESRL  203



>ref|XP_002884196.1| catalytic/ coenzyme binding protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60455.1| catalytic/ coenzyme binding protein [Arabidopsis lyrata subsp. 
lyrata]
Length=402

 Score =   273 bits (697),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  LSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  302
            +S+   G    RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK
Sbjct  31   VSNHLNGTDNRRYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  90

Query  303  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYE  482
            MGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGREYE
Sbjct  91   MGSQVLVPFRGSEDSPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREYE  150

Query  483  TRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            TRN+SFE+ NH++A++LA +AKEHGGI+R+IQ+S LGAS +SPSRM
Sbjct  151  TRNFSFEDANHHIAEKLALVAKEHGGIMRYIQVSCLGASASSPSRM  196



>ref|NP_565469.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 [Arabidopsis 
thaliana]
 sp|Q9SK66.2|NDUA9_ARATH RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK59545.1| putative NADH-ubiquinone oxireductase [Arabidopsis thaliana]
 gb|AAK93749.1| putative NADH-ubiquinone oxireductase [Arabidopsis thaliana]
 gb|AAD21752.2| putative NADH-ubiquinone oxireductase [Arabidopsis thaliana]
 gb|AAT68351.1| hypothetical protein At2g20360 [Arabidopsis thaliana]
 gb|AAX23820.1| hypothetical protein At2g20360 [Arabidopsis thaliana]
 gb|AEC06997.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 [Arabidopsis 
thaliana]
Length=402

 Score =   271 bits (694),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  LSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  302
            +S+   G    RY+S+L  KG GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK
Sbjct  31   VSNHLNGTDNCRYSSSLATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  90

Query  303  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYE  482
            MGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGREYE
Sbjct  91   MGSQVLVPFRGSEDSPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREYE  150

Query  483  TRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            TRN+SFE+ NH++A++LA +AKEHGGI+R+IQ+S LGAS +SPSRM
Sbjct  151  TRNFSFEDANHHIAEKLALVAKEHGGIMRYIQVSCLGASVSSPSRM  196



>gb|EPS69627.1| hypothetical protein M569_05135, partial [Genlisea aurea]
Length=360

 Score =   270 bits (689),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +3

Query  162  ASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  341
            +S L  KG GH++RKGTGGRSSVSGI+ATVFGATGFLGRYLVQQLAK GSQVLVPFRGSE
Sbjct  2    SSNLATKGVGHLIRKGTGGRSSVSGIIATVFGATGFLGRYLVQQLAKNGSQVLVPFRGSE  61

Query  342  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  521
            D  RHLKLMGDLGQIVPMKYNPRDE+SIKAVMAKANVVINLIGREYETRN+SFEEVNH M
Sbjct  62   DSSRHLKLMGDLGQIVPMKYNPRDEDSIKAVMAKANVVINLIGREYETRNFSFEEVNHRM  121

Query  522  AKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            A+QLA+IA+EHGGI+RFIQ+S LGAS  S SRM
Sbjct  122  AEQLAAIAREHGGIMRFIQVSCLGASLASQSRM  154



>ref|XP_010467837.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Camelina sativa]
Length=403

 Score =   271 bits (692),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = +3

Query  117  YLLSDQCYGIGTPRYASTLTAK-GTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQ  293
            Y +S+   G    RYAS+L  K G GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQ
Sbjct  29   YGVSNHLNGTDNRRYASSLANKWGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQ  88

Query  294  LAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGR  473
            LAKMGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGR
Sbjct  89   LAKMGSQVLVPFRGSEDSPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGR  148

Query  474  EYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            EYETRN+SFE+VNH++A++LA +AKEHGGI+R+IQ+S LGAS +SPSRM
Sbjct  149  EYETRNFSFEDVNHHIAEKLALVAKEHGGIMRYIQVSCLGASMSSPSRM  197



>ref|XP_010489051.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Camelina sativa]
Length=403

 Score =   270 bits (691),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = +3

Query  117  YLLSDQCYGIGTPRYASTLTAKG-TGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQ  293
            Y +S+   G    RYAS+L  KG  GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQ
Sbjct  29   YGVSNHLNGTDNRRYASSLAKKGGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQ  88

Query  294  LAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGR  473
            LAKMGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGR
Sbjct  89   LAKMGSQVLVPFRGSEDSPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGR  148

Query  474  EYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            EYETRN+SFE+VNH++A++LA +AKEHGGI+R+IQ+S LGAS +SPSRM
Sbjct  149  EYETRNFSFEDVNHHIAEKLALVAKEHGGIMRYIQVSCLGASMSSPSRM  197



>ref|XP_010415893.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Camelina sativa]
Length=403

 Score =   270 bits (691),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 150/169 (89%), Gaps = 1/169 (1%)
 Frame = +3

Query  117  YLLSDQCYGIGTPRYASTLTAKG-TGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQ  293
            Y  S+   G    RYAS+L  KG  GH+ RKGTGGRSSVSGIVATVFGATGFLGRYLVQQ
Sbjct  29   YGFSNHLNGTDNRRYASSLANKGGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQ  88

Query  294  LAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGR  473
            LAKMGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE+SIKAVMAKANVVINLIGR
Sbjct  89   LAKMGSQVLVPFRGSEDSPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGR  148

Query  474  EYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            EYETRN+SFE+VNH++A++LA +AKEHGGI+R+IQ+S LGAS +SPSRM
Sbjct  149  EYETRNFSFEDVNHHIAEKLALVAKEHGGIMRYIQVSCLGASMSSPSRM  197



>ref|XP_002526534.1| NADH-ubiquinone oxidoreductase 39 kD subunit, putative [Ricinus 
communis]
 gb|EEF35812.1| NADH-ubiquinone oxidoreductase 39 kD subunit, putative [Ricinus 
communis]
Length=394

 Score =   270 bits (690),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  156  RYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG  335
            RY STLT KG  H+VRKGTGGRSSVSGIVATVFGATGFLGRY+VQ+LAKMGSQVLVPFRG
Sbjct  40   RYVSTLTPKGVAHLVRKGTGGRSSVSGIVATVFGATGFLGRYVVQRLAKMGSQVLVPFRG  99

Query  336  SEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNH  515
            SED HRHLKLMGDLGQIVPMKYNPRDE SIKAVMAKANVVINLIGREYETRNYSFEEVNH
Sbjct  100  SEDSHRHLKLMGDLGQIVPMKYNPRDEASIKAVMAKANVVINLIGREYETRNYSFEEVNH  159

Query  516  YMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
             MA+QLA IAKEHGGI+R+IQ+S LG+S +SPSRM
Sbjct  160  GMAEQLAMIAKEHGGIMRYIQVSCLGSSSSSPSRM  194



>ref|XP_004954373.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Setaria italica]
Length=408

 Score =   270 bits (689),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +3

Query  180  KGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHL  359
            +G+G++VRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED HRHL
Sbjct  57   EGSGYLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHL  116

Query  360  KLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLAS  539
            K+MGDLGQIVPMKYNPRD +SIKAVMAK+NVV+NLIGREYETRNYSFEEVNH+MA QLA 
Sbjct  117  KIMGDLGQIVPMKYNPRDVDSIKAVMAKSNVVVNLIGREYETRNYSFEEVNHHMAGQLAM  176

Query  540  IAKEHGGILRFIQLSSLGASPTSPSRM  620
            IAKEHGGI+RFIQ+S LGASP+S S+M
Sbjct  177  IAKEHGGIMRFIQVSCLGASPSSESKM  203



>ref|NP_001149069.1| LOC100282690 [Zea mays]
 gb|ACG34074.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Zea mays]
Length=407

 Score =   268 bits (685),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +3

Query  180  KGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHL  359
            KG+GH+VRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG ED  RHL
Sbjct  56   KGSGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGCEDSPRHL  115

Query  360  KLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLAS  539
            K+MGDLGQIVPMKY+PRD +SIKAVMAK+NVVINLIGREYETRNYSFEEVNH+M +QLA+
Sbjct  116  KIMGDLGQIVPMKYHPRDVDSIKAVMAKSNVVINLIGREYETRNYSFEEVNHHMPEQLAT  175

Query  540  IAKEHGGILRFIQLSSLGASPTSPSRM  620
            IAKEHGGI+RFIQ+S LGASP+S SRM
Sbjct  176  IAKEHGGIIRFIQVSCLGASPSSESRM  202



>ref|XP_004495054.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Cicer arietinum]
Length=396

 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  117  YLLSDQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  296
            Y +SD  YG+   RY ST+  KG GH+VRKGTGGRSSVSGIVATVFGATGFLGRY+VQQL
Sbjct  23   YPISDHYYGVDHERYVSTVATKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYVVQQL  82

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
            AKMGSQ+LVPFRGSEDC RHLKLMGDLGQ+VPMKYNPRDE+S+KAVMA+ANVVINL+GR+
Sbjct  83   AKMGSQILVPFRGSEDCPRHLKLMGDLGQVVPMKYNPRDESSVKAVMARANVVINLLGRD  142

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            YETRNYSFEEV+++MA++ A IAKEHGGI+RFIQ+SSLGASP+S SRM
Sbjct  143  YETRNYSFEEVHYHMAEKFAKIAKEHGGIMRFIQVSSLGASPSSSSRM  190



>gb|ACF85773.1| unknown [Zea mays]
 gb|ACR35734.1| unknown [Zea mays]
Length=407

 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +3

Query  180  KGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHL  359
            KG+GH+VRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG ED  RHL
Sbjct  56   KGSGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGCEDSPRHL  115

Query  360  KLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLAS  539
            K+MGDLGQIVPMKY+PRD +SIKAVMAK+NVVINLIGREYETRNYSFEEVNH+M +QLA+
Sbjct  116  KIMGDLGQIVPMKYHPRDVDSIKAVMAKSNVVINLIGREYETRNYSFEEVNHHMPEQLAT  175

Query  540  IAKEHGGILRFIQLSSLGASPTSPSRM  620
            IAKEHGGI+RFIQ+S LGASP+S SRM
Sbjct  176  IAKEHGGIIRFIQVSCLGASPSSESRM  202



>gb|ABK24353.1| unknown [Picea sitchensis]
Length=401

 Score =   266 bits (681),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +3

Query  138  YGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQV  317
            Y     R AS+LT KG GH++RKGTGGRSSVSGI+ATVFGATGFLGRY+VQQLAK GSQV
Sbjct  36   YKFDHSRSASSLTDKGIGHLIRKGTGGRSSVSGIIATVFGATGFLGRYVVQQLAKTGSQV  95

Query  318  LVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYS  497
            LVPFRGSED  RHLKLMGDLGQIVPMKYNPRDE+SIKAVMAK+NVVINLIGREYETRN+S
Sbjct  96   LVPFRGSEDSPRHLKLMGDLGQIVPMKYNPRDESSIKAVMAKSNVVINLIGREYETRNFS  155

Query  498  FEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            FEEVN  +++ LA IAKEHGGI+RFIQLS LGAS +SPS+M
Sbjct  156  FEEVNVDISEHLAKIAKEHGGIVRFIQLSCLGASSSSPSKM  196



>gb|AFW74028.1| NADH-ubiquinone oxidoreductase subunit [Zea mays]
Length=460

 Score =   268 bits (684),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +3

Query  162  ASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  341
            A     KG+GH+VRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG E
Sbjct  103  ARAPAVKGSGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGCE  162

Query  342  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  521
            D  RHLK+MGDLGQIVPMKY+PRD +SIKAVMAK+NVVINLIGREYETRNYSFEEVNH+M
Sbjct  163  DSPRHLKIMGDLGQIVPMKYHPRDVDSIKAVMAKSNVVINLIGREYETRNYSFEEVNHHM  222

Query  522  AKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
             +QLA+IAKEHGGI+RFIQ+S LGASP+S SRM
Sbjct  223  PEQLATIAKEHGGIIRFIQVSCLGASPSSESRM  255



>ref|XP_006443722.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
 ref|XP_006443723.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
 ref|XP_006479428.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like isoform X1 [Citrus sinensis]
 gb|ESR56962.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
 gb|ESR56963.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
Length=400

 Score =   263 bits (673),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 150/180 (83%), Gaps = 2/180 (1%)
 Frame = +3

Query  60   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYAST-LTAKGTGHIVRKGTGGRSSVSG  236
            LG QSL P++   S     Y LSD   G    R+ +T +   GTGH+VRKGTGGRSSVSG
Sbjct  8    LGHQSLQPATSISSLKSV-YPLSDYYNGADHRRFGTTSIATPGTGHLVRKGTGGRSSVSG  66

Query  237  IVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDE  416
            I+ATVFG TGFLGRY+VQQLAKMGSQVLVPFRG ED  RHLKLMGDLGQIVPMK+NPRD+
Sbjct  67   IIATVFGTTGFLGRYVVQQLAKMGSQVLVPFRGCEDDPRHLKLMGDLGQIVPMKFNPRDD  126

Query  417  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGA  596
            N+IKA MAKANVVINLIGREYETRNYSFE+VNH+MA+++A IAKEHGGI+RFIQ+S LGA
Sbjct  127  NTIKATMAKANVVINLIGREYETRNYSFEDVNHFMAERIAGIAKEHGGIMRFIQISCLGA  186



>dbj|BAJ86608.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96242.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88789.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=413

 Score =   262 bits (670),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = +3

Query  180  KGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHL  359
            KG GH+VRKGTGGRSSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFRG ED HRHL
Sbjct  58   KGAGHLVRKGTGGRSSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGCEDSHRHL  117

Query  360  KLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLAS  539
            KLMGDLGQIVPM YNPRD NSIK  +AK+NVVINLIGREYETRNY FEEVNH MA+QLA 
Sbjct  118  KLMGDLGQIVPMNYNPRDVNSIKTAVAKSNVVINLIGREYETRNYGFEEVNHQMAEQLAM  177

Query  540  IAKEHGGILRFIQLSSLGASPTSPSRM  620
            I+KEHGGI+RFIQ+S+LGAS +SPSR+
Sbjct  178  ISKEHGGIVRFIQVSALGASASSPSRL  204



>ref|XP_003570393.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Brachypodium distachyon]
Length=412

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 144/162 (89%), Gaps = 2/162 (1%)
 Frame = +3

Query  141  GIGTPRYASTLT--AKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQ  314
            G+   RY S  T   KG GH+VRKGTGGRSSVSGIVATVFGATGFLGRY+VQQLAKMGSQ
Sbjct  42   GVDGARYMSARTPAVKGAGHLVRKGTGGRSSVSGIVATVFGATGFLGRYVVQQLAKMGSQ  101

Query  315  VLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNY  494
            VLVPFRG ED HRHLKLMGDLGQIVPMKYNPRD +SIK  +AK+NVVINLIGREYETRNY
Sbjct  102  VLVPFRGCEDSHRHLKLMGDLGQIVPMKYNPRDVDSIKTAVAKSNVVINLIGREYETRNY  161

Query  495  SFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
             FEEVNH+MA+QLA I+KEHGGI+RFIQ+SSLGAS +SPSRM
Sbjct  162  GFEEVNHHMAEQLAMISKEHGGIVRFIQVSSLGASSSSPSRM  203



>gb|KJB42336.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=345

 Score =   241 bits (614),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  231  SGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPR  410
            SGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PR
Sbjct  10   SGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYDPR  69

Query  411  DENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSL  590
            DENSIKAVMAKANVVINLIGREYETRN+SFEEVNH+MA+QLA IAKEHGGI+RFIQ+S L
Sbjct  70   DENSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVIAKEHGGIMRFIQVSCL  129

Query  591  GASPTSPSRM  620
            G+S +SPSR 
Sbjct  130  GSSLSSPSRF  139



>dbj|BAH20309.1| AT2G20360 [Arabidopsis thaliana]
Length=335

 Score =   231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +3

Query  234  GIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRD  413
            GIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRD
Sbjct  1    GIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQVVPMKFDPRD  60

Query  414  ENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLG  593
            E+SIKAVMAKANVVINLIGREYETRN+SFE+ NH++A++LA +AKEHGGI+R+IQ+S LG
Sbjct  61   EDSIKAVMAKANVVINLIGREYETRNFSFEDANHHIAEKLALVAKEHGGIMRYIQVSCLG  120

Query  594  ASPTSPSRM  620
            AS +SPSRM
Sbjct  121  ASVSSPSRM  129



>gb|KDO37085.1| hypothetical protein CISIN_1g047628mg, partial [Citrus sinensis]
Length=327

 Score =   222 bits (566),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +3

Query  231  SGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPR  410
            SGI+ATVFG TGFLGRY+VQQLAKMGSQVLVPFRG ED  RHLKLMGDLGQIVPMK+NPR
Sbjct  6    SGIIATVFGTTGFLGRYVVQQLAKMGSQVLVPFRGCEDDPRHLKLMGDLGQIVPMKFNPR  65

Query  411  DENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSL  590
            D+N+IKA MAKANVVINLIGREYETRNYSFE+VNH+MA+++A IAKEHGGI+RFIQ+S L
Sbjct  66   DDNTIKATMAKANVVINLIGREYETRNYSFEDVNHFMAERIAGIAKEHGGIMRFIQISCL  125

Query  591  GA  596
            GA
Sbjct  126  GA  127



>ref|XP_001765756.1| predicted protein [Physcomitrella patens]
 gb|EDQ69347.1| predicted protein [Physcomitrella patens]
Length=405

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  129  DQCYGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMG  308
            D  +G G  R +S+L   G+   V++GTGGRSSVSG+VATVFGATGFLGRY+VQQLA+MG
Sbjct  38   DLGFGSGRVRESSSLAVSGSHRPVKRGTGGRSSVSGVVATVFGATGFLGRYVVQQLARMG  97

Query  309  SQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETR  488
            SQV+VP+RG ++  RHLKLMGDLGQIVP+KY+ RDE+SIKA +A +NV++N IG+EYETR
Sbjct  98   SQVMVPYRGLDEEWRHLKLMGDLGQIVPIKYDARDEDSIKAAIANSNVIVNCIGKEYETR  157

Query  489  NYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            N+SF++VN+ ++ +++ +AKEHGGIL+++Q+S L A P SPSR+
Sbjct  158  NFSFDDVNYGISNRISKLAKEHGGILKYVQMSCLAADPHSPSRL  201



>gb|KHG08643.1| hypothetical protein F383_12346 [Gossypium arboreum]
Length=370

 Score =   218 bits (556),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 132/188 (70%), Gaps = 32/188 (17%)
 Frame = +3

Query  60   LGQQSLNPsspsisalkssYLLSDQCYGIGTPRYASTLTA-KGTGHIVRKGTGGRSSVSG  236
            LG QSL P++   S       LSD  YG   PRY STL + KG GH+VRKGTGGRSSVSG
Sbjct  8    LGHQSLRPTASISSIKSIC-ALSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGGRSSVSG  66

Query  237  IVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDE  416
            I+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PRDE
Sbjct  67   IIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYDPRDE  126

Query  417  NSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGA  596
            NSIKAVMAKAN                              IAKEHGGI+RFIQ+S LG+
Sbjct  127  NSIKAVMAKAN------------------------------IAKEHGGIMRFIQVSCLGS  156

Query  597  SPTSPSRM  620
            S TSPSR 
Sbjct  157  SLTSPSRF  164



>gb|EEE58042.1| hypothetical protein OsJ_08874 [Oryza sativa Japonica Group]
Length=310

 Score =   205 bits (522),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +3

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
            AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRD +SIKAVMAK+NVVINLIGRE
Sbjct  39   AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDVDSIKAVMAKSNVVINLIGRE  98

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            YETRNY F+EVNH+MA+QLA I+KEHGGI+RFIQ+SSLGAS +SPSRM
Sbjct  99   YETRNYGFDEVNHHMAEQLAMISKEHGGIMRFIQVSSLGASASSPSRM  146



>dbj|BAG95473.1| unnamed protein product [Oryza sativa Japonica Group]
Length=311

 Score =   201 bits (512),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 102/106 (96%), Gaps = 0/106 (0%)
 Frame = +3

Query  303  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYE  482
            MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRD +SIKAVMAK+NVVINLIGREYE
Sbjct  1    MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDVDSIKAVMAKSNVVINLIGREYE  60

Query  483  TRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            TRNY F+EVNH+MA+QLA I+KEHGGI+RFIQ+SSLGAS +SPSRM
Sbjct  61   TRNYGFDEVNHHMAEQLAMISKEHGGIMRFIQVSSLGASASSPSRM  106



>gb|KJB42339.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=356

 Score =   198 bits (504),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +3

Query  294  LAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGR  473
            ++KMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PRDENSIKAVMAKANVVINLIGR
Sbjct  42   MSKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYDPRDENSIKAVMAKANVVINLIGR  101

Query  474  EYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            EYETRN+SFEEVNH+MA+QLA IAKEHGGI+RFIQ+S LG+S +SPSR 
Sbjct  102  EYETRNFSFEEVNHFMAEQLAVIAKEHGGIMRFIQVSCLGSSLSSPSRF  150



>ref|XP_007050148.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 4 [Theobroma 
cacao]
 gb|EOX94305.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 4 [Theobroma 
cacao]
Length=313

 Score =   192 bits (487),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 100/107 (93%), Gaps = 1/107 (1%)
 Frame = +3

Query  303  MGSQVLVPFRGSEDCHRHLKLMGDLGQ-IVPMKYNPRDENSIKAVMAKANVVINLIGREY  479
            MGSQVLVPFRGSED  RHLKLMGDLGQ IVPMKY+PRDENSIKAVMAKANVVINLIGREY
Sbjct  1    MGSQVLVPFRGSEDNPRHLKLMGDLGQQIVPMKYDPRDENSIKAVMAKANVVINLIGREY  60

Query  480  ETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            ETRNYSFEEVNH+MA+QLA IA+EHGGI+RFIQ+S LG+SP+S SR 
Sbjct  61   ETRNYSFEEVNHFMAEQLAVIAREHGGIMRFIQVSCLGSSPSSASRF  107



>ref|XP_001757609.1| predicted protein [Physcomitrella patens]
 gb|EDQ77666.1| predicted protein [Physcomitrella patens]
Length=393

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 128/171 (75%), Gaps = 14/171 (8%)
 Frame = +3

Query  117  YLLSDQC---YGIGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLV  287
            + L DQ    +G    R++S+L   G+   V++GTGGRSSVSG+VATVFGATGFLGRY++
Sbjct  30   HFLRDQANLGFGNAAVRHSSSLAVSGSHRPVKRGTGGRSSVSGVVATVFGATGFLGRYVI  89

Query  288  QQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLI  467
            QQLA+MGSQV+             +  G LGQIVP+KY+ RDE SIK V+A +NV++N I
Sbjct  90   QQLARMGSQVMA-----------FEAHGRLGQIVPIKYDARDEGSIKPVIANSNVIVNCI  138

Query  468  GREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            G+EYETRN+SFE+VNH ++ +++ +A+EHGGIL+++Q+S L A+P SPSR+
Sbjct  139  GKEYETRNFSFEDVNHGISNRISKLAREHGGILKYVQMSCLAAAPDSPSRL  189



>gb|EMS47161.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Triticum urartu]
Length=315

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +3

Query  303  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYE  482
            MGSQVLVPFRG ED HRHLKLMGDLGQIVPM YNPRD NSIK  +AK+NVVINLIGREYE
Sbjct  1    MGSQVLVPFRGCEDSHRHLKLMGDLGQIVPMNYNPRDVNSIKTAVAKSNVVINLIGREYE  60

Query  483  TRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            TRNY FEEVNH MA+QLA I+KEHGGI+RFIQ+SSLGAS +SPSR+
Sbjct  61   TRNYGFEEVNHQMAEQLAMISKEHGGIVRFIQVSSLGASASSPSRL  106



>gb|EMT17104.1| putative NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 
9, mitochondrial [Aegilops tauschii]
Length=315

 Score =   186 bits (473),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +3

Query  303  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYE  482
            MGSQVLVPFRG ED HRHLKLMGDLGQIVPM YNPRD NSIK  +AK+NVVINLIGREYE
Sbjct  1    MGSQVLVPFRGCEDSHRHLKLMGDLGQIVPMNYNPRDVNSIKTAVAKSNVVINLIGREYE  60

Query  483  TRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            TRNY FEEVNH MA+QLA I+KEHGGI+RFIQ+S+LGAS +SPSR+
Sbjct  61   TRNYGFEEVNHQMAEQLAMISKEHGGIVRFIQVSALGASASSPSRL  106



>ref|XP_002976090.1| hypothetical protein SELMODRAFT_104564, partial [Selaginella 
moellendorffii]
 gb|EFJ22995.1| hypothetical protein SELMODRAFT_104564, partial [Selaginella 
moellendorffii]
Length=353

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 117/154 (76%), Gaps = 0/154 (0%)
 Frame = +3

Query  156  RYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG  335
            R+A  L  +G   +V K  GG S+ +G + T+FG+TG LGR +V  LAK+G+Q ++P+RG
Sbjct  1    RHAFNLATRGGTPLVVKTAGGLSAATGFIVTIFGSTGMLGRAVVNNLAKIGAQCMIPYRG  60

Query  336  SEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNH  515
             ED  RHLK+MGDLGQIVP   N RDE++I+A +AK+NVVINLIG+EYETRNY FEEVN 
Sbjct  61   LEDKPRHLKVMGDLGQIVPFVCNIRDEDAIRAAIAKSNVVINLIGQEYETRNYGFEEVNI  120

Query  516  YMAKQLASIAKEHGGILRFIQLSSLGASPTSPSR  617
             +A+++A I+KEHGGI+R+I  S +GA   SPS+
Sbjct  121  DIAQRIARISKEHGGIVRYIHTSCVGADENSPSK  154



>ref|XP_002968287.1| hypothetical protein SELMODRAFT_89106, partial [Selaginella moellendorffii]
 gb|EFJ30541.1| hypothetical protein SELMODRAFT_89106, partial [Selaginella moellendorffii]
Length=362

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 117/154 (76%), Gaps = 0/154 (0%)
 Frame = +3

Query  156  RYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG  335
            R+A  L  +G   +V K  GG S+ +G + T+FG+TG LGR +V  LAK+G+Q ++P+RG
Sbjct  10   RHAFNLATRGGTPLVVKTAGGLSAATGFIVTIFGSTGMLGRAVVNNLAKIGAQCMIPYRG  69

Query  336  SEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNH  515
             ED  RHLK+MGDLGQIVP   N RD+++I+A +AK+NVVINLIG+EYETRNY FEEVN 
Sbjct  70   LEDKPRHLKVMGDLGQIVPFVCNIRDDDAIRAAIAKSNVVINLIGQEYETRNYGFEEVNI  129

Query  516  YMAKQLASIAKEHGGILRFIQLSSLGASPTSPSR  617
             +A+++A I+KEHGGI+R+I  S +GA   SPS+
Sbjct  130  DIAQRIARISKEHGGIVRYIHTSCVGADENSPSK  163



>ref|XP_004339653.1| NADH dehydrogenase, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR17640.1| NADH dehydrogenase, putative [Acanthamoeba castellanii str. Neff]
Length=376

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 104/134 (78%), Gaps = 1/134 (1%)
 Frame = +3

Query  213  GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVP  392
            GGRSSVSG+VATVFG TGFLGR++V +L K+GSQV+VP+RG E   RHLK+MGDLGQI P
Sbjct  37   GGRSSVSGVVATVFGCTGFLGRFVVNRLGKIGSQVIVPYRGEESAFRHLKVMGDLGQIAP  96

Query  393  MKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRF  572
            + ++ RD+ +++  +  +NVVINL+G+ +ETRN+SF++V+    + +A  AKE  G+ RF
Sbjct  97   VWFDLRDKETVRRAVQYSNVVINLLGKRWETRNFSFDDVHPEATRTIAEAAKE-AGVERF  155

Query  573  IQLSSLGASPTSPS  614
            IQ+S+ GA   SPS
Sbjct  156  IQVSAAGADVNSPS  169



>ref|XP_007510295.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18640.1| predicted protein [Bathycoccus prasinos]
Length=431

 Score =   162 bits (410),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 103/139 (74%), Gaps = 0/139 (0%)
 Frame = +3

Query  201  RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLG  380
            +KGTGGRSS SGI A VFG+TGFLGRY+V  LAK GS+VLVP R SE+  +HLK MGDLG
Sbjct  82   KKGTGGRSSYSGITAAVFGSTGFLGRYVVNHLAKNGSRVLVPTRCSENHRQHLKPMGDLG  141

Query  381  QIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGG  560
            QIV   Y+ RD+ +IK  + +ANVVIN++GRE+ETRN+SFE+V+    ++LA   KE   
Sbjct  142  QIVQFDYSMRDDEAIKYAVERANVVINMVGREWETRNFSFEDVHRDFPRRLAEACKESSS  201

Query  561  ILRFIQLSSLGASPTSPSR  617
            + R I +S+LGA   + S+
Sbjct  202  VKRLIHVSALGADVNAKSK  220



>gb|KIJ17694.1| hypothetical protein PAXINDRAFT_167681 [Paxillus involutus ATCC 
200175]
Length=359

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 109/147 (74%), Gaps = 2/147 (1%)
 Frame = +3

Query  174  TAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHR  353
            T  G   +V +GT G S+VSG V TVFG TGFLGRYLV +LA+MG+QV+VP+R  ED  R
Sbjct  27   TLPGRKAVVSQGTPGYSAVSGHVVTVFGCTGFLGRYLVSKLARMGTQVIVPYR-EEDEKR  85

Query  354  HLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQL  533
            HLKLMGDLGQIVPM+++ R+EN I   +  +++V NL+GR+YET+N+ + +V+   A+++
Sbjct  86   HLKLMGDLGQIVPMEWDIRNENQIAECLRHSDIVYNLVGRDYETKNFKYADVHVTGAERI  145

Query  534  ASIAKEHGGILRFIQLSSLGASPTSPS  614
            A +A E  G+ RF+QLS L ASP S S
Sbjct  146  AKLASE-TGVQRFVQLSHLNASPDSTS  171



>dbj|GAA99675.1| hypothetical protein E5Q_06378 [Mixia osmundae IAM 14324]
 gb|KEI40362.1| hypothetical protein L969DRAFT_94166 [Mixia osmundae IAM 14324]
Length=386

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 111/155 (72%), Gaps = 4/155 (3%)
 Frame = +3

Query  156  RYASTLTAKGTG--HIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPF  329
            RY   LT K      I+R G GGR S +G VATVFG TGFLGRYLV +LAK G+QV++P+
Sbjct  32   RYQHDLTIKQKDGRPILRSGPGGRHSFTGHVATVFGCTGFLGRYLVHKLAKKGTQVIIPY  91

Query  330  RGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEV  509
            R  ED  RHLK+MGDLGQIVPM+++ R+++ I+  +  ++VV NL+GR+YET+N+ F EV
Sbjct  92   R-DEDEKRHLKVMGDLGQIVPMEWDIRNDSQIEEAVRHSDVVYNLVGRDYETKNFKFHEV  150

Query  510  NHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPS  614
            +   A+++ASIA +  G+ R I +S L A P SPS
Sbjct  151  HIDGARRIASIA-QLAGVSRLIHVSHLNADPDSPS  184



>gb|KIK91888.1| hypothetical protein PAXRUDRAFT_830459 [Paxillus rubicundulus 
Ve08.2h10]
Length=359

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 109/149 (73%), Gaps = 2/149 (1%)
 Frame = +3

Query  174  TAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHR  353
            T  G   +V +GT G S+VSG V TVFG TGFLGRYLV +LA+MG+QV+VP+R  ED  R
Sbjct  27   TLPGRKAVVSQGTPGYSAVSGHVVTVFGCTGFLGRYLVSKLARMGTQVIVPYR-EEDEKR  85

Query  354  HLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQL  533
            HLKLMGDLGQIVPM+++ R+E+ I   +  +++V NL+GR+YET+N+ + +V+   A+++
Sbjct  86   HLKLMGDLGQIVPMEWDIRNEDQIAECLRHSDIVYNLVGRDYETKNFKYADVHVTGAERI  145

Query  534  ASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            A +A E  G+ RF+QLS L ASP S S  
Sbjct  146  AKLASEL-GVQRFVQLSHLNASPDSTSEF  173



>ref|XP_002504449.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65707.1| predicted protein [Micromonas sp. RCC299]
Length=390

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 116/154 (75%), Gaps = 5/154 (3%)
 Frame = +3

Query  156  RYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG  335
            R AS+L    TG    +GTGGRSS+SGI +TVFG++GFLGRY+V  + K GS++++P R 
Sbjct  36   RDASSLPVTYTG----RGTGGRSSISGITSTVFGSSGFLGRYVVNHIGKSGSKMILPNRC  91

Query  336  SEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNH  515
            +E+  +HLK+MGDLGQIV + ++ RD ++IK  + ++NVV+N++GRE+ETRN+SFE+V+ 
Sbjct  92   NENARQHLKVMGDLGQIVHLDFSIRDADAIKYAVERSNVVVNMVGREWETRNFSFEDVHV  151

Query  516  YMAKQLASIAKEHGGILRFIQLSSLGASPTSPSR  617
                +LA I KE  G+ R + +S+LGAS T+PS+
Sbjct  152  EFPAKLAEICKE-VGVERLVHVSALGASHTNPSK  184



>ref|XP_001626712.1| predicted protein [Nematostella vectensis]
 gb|EDO34612.1| predicted protein [Nematostella vectensis]
Length=372

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 118/169 (70%), Gaps = 8/169 (5%)
 Frame = +3

Query  123  LSDQCYG---IGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQ  293
            L  QC G   IGT    + ++ +   ++ +KGTGGRSS +G+ ATVFGATGFLGRY++ +
Sbjct  9    LVAQCQGKPLIGT----AVVSTRKISYLPKKGTGGRSSFNGVSATVFGATGFLGRYVINR  64

Query  294  LAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGR  473
            L ++G+Q+ VP+RG E   RHL+LMGDLGQI    ++ +DE SI  ++  +NVV+NLIGR
Sbjct  65   LGRVGTQLTVPYRGDEHDIRHLRLMGDLGQIDFFDFHLKDEESIAKMVKHSNVVVNLIGR  124

Query  474  EYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
             +ETRN++FEEV+   A+ +A  AKE  G+ R I +S+L A+  SPS+ 
Sbjct  125  GFETRNFNFEEVHVDGARTIAKAAKE-AGVERLIHVSALNAAVDSPSKF  172



>ref|XP_001420142.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98435.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=366

 Score =   156 bits (395),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 102/136 (75%), Gaps = 1/136 (1%)
 Frame = +3

Query  207  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  386
            GTGGRSS SGI  TVFG+TGFLGRY+V  +AK GS++++P R SE+  +HLK+MGDLGQI
Sbjct  22   GTGGRSSFSGITCTVFGSTGFLGRYVVHHVAKSGSRMILPTRCSENDRQHLKVMGDLGQI  81

Query  387  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGIL  566
            V + Y  RDE +I+  + ++NVVIN++GRE+ETRN+SFE+VN    K+LA I  +  G+ 
Sbjct  82   VQLDYGIRDEETIRYAVERSNVVINMVGREWETRNFSFEDVNVTFPKKLAEICAD-VGVR  140

Query  567  RFIQLSSLGASPTSPS  614
            R + +S+LGA    PS
Sbjct  141  RLVHVSALGAEEDHPS  156



>ref|XP_003390219.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Amphimedon queenslandica]
Length=367

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 105/150 (70%), Gaps = 1/150 (1%)
 Frame = +3

Query  171  LTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCH  350
            LT K     V++GTGGRSS SG VATVFG TGF GRY+V +L ++GSQ++ P+RG E  +
Sbjct  23   LTKKSISSDVKRGTGGRSSFSGTVATVFGCTGFCGRYIVNRLGQVGSQIVAPYRGDEHDY  82

Query  351  RHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQ  530
            RHL+ MGDLGQI+   +N RD  S+   +  +NVV+N IGR+YETRN+ F++V+   ++ 
Sbjct  83   RHLRPMGDLGQILFRSFNLRDPESVTKTLEYSNVVVNAIGRDYETRNFKFDDVHVQGSRV  142

Query  531  LASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            +A  AK+  G+ R I  S+LGAS  SPS+ 
Sbjct  143  IAEAAKK-AGVKRLIHFSALGASKDSPSKF  171



>ref|XP_008274666.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Stegastes partitus]
Length=381

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            I+ KG GGRSS SG  ATVFGATGFLGRY+V +L +MGSQV+VP R       +++ MGD
Sbjct  43   IIPKGKGGRSSFSGFSATVFGATGFLGRYVVNRLGRMGSQVIVPHRCDRYDLMYMRPMGD  102

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ M+++ RD++SIK  MA +NVVINL+GRE+ETRNY FE+V   + +Q+A  A+E 
Sbjct  103  LGQIIFMEWDARDKDSIKQAMASSNVVINLVGREWETRNYRFEDVFVSIPQQIAKAARE-  161

Query  555  GGILRFIQLSSLGASPTSPSR  617
             GI + I +S L A   SPS+
Sbjct  162  AGITKLIHMSHLNADIRSPSK  182



>ref|XP_003126608.2| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Sus scrofa]
Length=377

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ M++N +D++SI+ V+  +NVVINL+GRE+ET+N+ FE+V   +   +A ++KE 
Sbjct  100  LGQIIFMEWNGKDKDSIRKVVEHSNVVINLVGREWETKNFDFEDVFVKIPHAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ + I +S L A   SPSR
Sbjct  159  AGVEKLIHISHLNADIKSPSR  179



>ref|XP_002736180.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Saccoglossus kowalevskii]
Length=253

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 112/149 (75%), Gaps = 4/149 (3%)
 Frame = +3

Query  183  GTGH--IVRKGTGGRSSVSGIVATVFG-ATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHR  353
            GT H  +V +G GGRSS SG++ATVFG +TGF+GRY++ +L + GSQ++VP+R   D  R
Sbjct  41   GTYHDAMVPRGRGGRSSFSGVIATVFGGSTGFVGRYVINRLGREGSQIIVPYRCDPDDIR  100

Query  354  HLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQL  533
            HLK+MGDLGQI+P+ ++   ++S++ +M  +NVVINL+G++YETRNY FE+++  +A ++
Sbjct  101  HLKVMGDLGQIIPLTFDVNSDDSLREMMQHSNVVINLMGKDYETRNYRFEDIHIDIAGRV  160

Query  534  ASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            ASIA E   I R I LS+LG+   SPS+ 
Sbjct  161  ASIASEL-KIPRLIHLSALGSDWKSPSKF  188



>ref|XP_001835685.1| NADH dehydrogenase [Coprinopsis cinerea okayama7#130]
 gb|EAU86256.1| NADH dehydrogenase [Coprinopsis cinerea okayama7#130]
Length=366

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 108/159 (68%), Gaps = 2/159 (1%)
 Frame = +3

Query  144  IGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  323
            +G   Y   +T      +V  G  G S+VSG   TVFG TGFLGRYLV +L K+G+QV+ 
Sbjct  17   VGKRAYHDLVTLPSKKPVVSYGPPGYSAVSGHTVTVFGCTGFLGRYLVSKLGKIGTQVVA  76

Query  324  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFE  503
            P+R  ED  RHLKLMGDLGQIV M+++ RDE SI   +  ++ VINL+GR+Y T+N+ F+
Sbjct  77   PYR-DEDESRHLKLMGDLGQIVRMEWDLRDEKSIAECLRHSDTVINLVGRDYTTKNFDFK  135

Query  504  EVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            +VN   A+++A IA E+ G+ RFIQ+S L AS  SPS+ 
Sbjct  136  QVNALGAERIAKIAAEN-GVSRFIQVSHLNASENSPSKF  173



>ref|XP_006795902.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Neolamprologus brichardi]
Length=303

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 115/167 (69%), Gaps = 3/167 (2%)
 Frame = +3

Query  123  LSDQCY-GIGTPRYASTLTAKGTGH-IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  296
            +S  CY  + +    +T+  +   H ++ KG GGRSS SGI ATVFGATGFLGRY+V +L
Sbjct  17   ISSNCYPALLSAASVTTVQQRKLHHALIPKGKGGRSSFSGIAATVFGATGFLGRYVVNRL  76

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
             ++GSQ+++P R  +    H + MGDLGQI+ ++++ R+++SIK  M  +NVVINL+GRE
Sbjct  77   GRIGSQIIIPHRCDQYDLMHFRPMGDLGQILFLQWDARNKDSIKRAMEHSNVVINLVGRE  136

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSR  617
            +ETRN+ FE+V   + +Q+A  A+E  GI +F+ +S L A   SPS+
Sbjct  137  WETRNFRFEDVYVTIPQQIARAARE-AGITKFVHMSHLNADIRSPSK  182



>ref|XP_007872120.1| hypothetical protein PNEG_00249 [Pneumocystis murina B123]
 gb|EMR11825.1| hypothetical protein PNEG_00249 [Pneumocystis murina B123]
Length=361

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 107/142 (75%), Gaps = 2/142 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            +++KGT GRSS+SG +AT+FGATGFLGRYLV  LAK G+ +++P+R  +D  RHLK++GD
Sbjct  43   LIKKGTEGRSSISGHIATIFGATGFLGRYLVNNLAKQGTTIIIPWR-DQDSKRHLKVLGD  101

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQIV M+++ RDE SIK  +  +N+V NLIGR+YET+N+S+E+V+ + A ++A    E+
Sbjct  102  LGQIVMMEFDLRDEISIKESVRHSNIVYNLIGRDYETKNFSYEDVHIHGAAKIAKACVEY  161

Query  555  GGILRFIQLSSLGASPTSPSRM  620
              I R I +S+L A+  SPS  
Sbjct  162  -NIDRLIHISTLNANIKSPSNF  182



>ref|XP_005681037.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Capra hircus]
Length=380

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRYLV  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYLVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ M +N RD++SI+  +  +NVVINL+GRE+ET+N+ FE+V   + + +A ++KE 
Sbjct  100  LGQIIFMDWNGRDKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A   S S+
Sbjct  159  AGVEKFIHISHLNADIKSSSK  179



>ref|NP_001094222.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Rattus norvegicus]
 sp|Q5BK63.2|NDUA9_RAT RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; AltName: Full=Sperm flagella protein 3; Flags: 
Precursor [Rattus norvegicus]
 gb|EDM01826.1| rCG30092 [Rattus norvegicus]
 gb|AAI68777.1| Ndufa9 protein [Rattus norvegicus]
Length=377

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+LMGD
Sbjct  40   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDIYDTMHLRLMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ++ ++++ RD++SI+  +  +NVVINLIGRE+ETRN+ FE+V   + + +A  +KE 
Sbjct  100  LGQLIFLEWDARDKDSIRKAVQHSNVVINLIGREWETRNFDFEDVFVNIPRAIAQASKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ RFI +S L AS  S ++
Sbjct  159  AGVERFIHVSHLNASMKSSAK  179



>ref|XP_004006995.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Ovis aries]
Length=380

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRYLV  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYLVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ M +N RD++SI+  +  +NVVINL+GRE+ET+N+ FE+V   + + +A ++KE 
Sbjct  100  LGQIIFMDWNGRDKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A   S S+
Sbjct  159  AGVEKFIHISHLNADIKSSSK  179



>gb|AAH91192.1| Ndufa9 protein, partial [Rattus norvegicus]
Length=370

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+LMGD
Sbjct  33   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDIYDTMHLRLMGD  92

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ++ ++++ RD++SI+  +  +NVVINLIGRE+ETRN+ FE+V   + + +A  +KE 
Sbjct  93   LGQLIFLEWDARDKDSIRKAVQHSNVVINLIGREWETRNFDFEDVFVNIPRAIAQASKE-  151

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ RFI +S L AS  S ++
Sbjct  152  AGVERFIHVSHLNASMKSSAK  172



>ref|XP_006237562.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Rattus norvegicus]
Length=373

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+LMGD
Sbjct  36   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDIYDTMHLRLMGD  95

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ++ ++++ RD++SI+  +  +NVVINLIGRE+ETRN+ FE+V   + + +A  +KE 
Sbjct  96   LGQLIFLEWDARDKDSIRKAVQHSNVVINLIGREWETRNFDFEDVFVNIPRAIAQASKE-  154

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ RFI +S L AS  S ++
Sbjct  155  AGVERFIHVSHLNASMKSSAK  175



>ref|XP_006633741.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Lepisosteus oculatus]
Length=380

 Score =   154 bits (388),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 107/141 (76%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++ +G GGRSS SGI ATVFGATGFLGRY+V +L ++GSQ+++P R  +    +L+ MGD
Sbjct  42   VIPRGKGGRSSFSGIAATVFGATGFLGRYVVNRLGRVGSQIVIPHRCDQYDIMYLRPMGD  101

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ ++++ RD+ SI+  +A +NVVINL+GRE+ETR++SFE+V+  + KQ+A  A+E 
Sbjct  102  LGQIIFLEWDARDKESIRRALAHSNVVINLVGREWETRHFSFEDVHVNIPKQIAKAARE-  160

Query  555  GGILRFIQLSSLGASPTSPSR  617
             GI +FI +S L A   SPSR
Sbjct  161  AGIEKFIHMSHLNADIRSPSR  181



>ref|XP_006987942.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Peromyscus maniculatus bairdii]
Length=377

 Score =   153 bits (387),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 111/158 (70%), Gaps = 7/158 (4%)
 Frame = +3

Query  162  ASTLTAKGTGH------IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  323
            A+T   +G  H      ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++
Sbjct  23   AATSVFRGPPHRQLHHAVMPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVII  82

Query  324  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFE  503
            P+R       HL+ MGDLGQI+ ++++ RD++SI+  +  +NVVINLIGR++ETRN+ FE
Sbjct  83   PYRCDVYDTMHLRPMGDLGQIIFLEWDARDKDSIRRAVQHSNVVINLIGRDWETRNFDFE  142

Query  504  EVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSR  617
            +V   + + +A ++KE  G+ RFI +S L AS  S SR
Sbjct  143  DVFVKIPQVIAQLSKE-AGVERFIHVSHLNASMKSSSR  179



>dbj|BAK63310.1| NADH dehydrogenase [Pan troglodytes]
Length=284

 Score =   151 bits (381),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 105/137 (77%), Gaps = 1/137 (1%)
 Frame = +3

Query  207  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  386
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGDLGQ+
Sbjct  4    GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCGKYDIMHLRPMGDLGQL  63

Query  387  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGIL  566
            + ++++ RD++SI+ V+  +NVVINLIGR++ET+NY FE+V   + + +A ++KE  G+ 
Sbjct  64   LFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNYDFEDVFVKIPQAIAQLSKE-AGVE  122

Query  567  RFIQLSSLGASPTSPSR  617
            +FI +S L A+  S SR
Sbjct  123  KFIHVSHLNANIKSSSR  139



>ref|XP_002712902.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Oryctolagus cuniculus]
Length=377

 Score =   153 bits (387),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDIMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ +++N RD++SI+  +  +NVVINL+GRE+ETRN+ FE+V   + + +A ++KE 
Sbjct  100  LGQIIFLEWNGRDKDSIRRAVQHSNVVINLVGREWETRNFDFEDVFVKIPQAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A   S SR
Sbjct  159  AGVEKFIHVSHLNADIKSSSR  179



>gb|EAW88839.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa, 
isoform CRA_c [Homo sapiens]
Length=254

 Score =   150 bits (379),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 105/137 (77%), Gaps = 1/137 (1%)
 Frame = +3

Query  207  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  386
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGDLGQ+
Sbjct  23   GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQL  82

Query  387  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGIL  566
            + ++++ RD++SI+ V+  +NVVINLIGR++ET+N+ FE+V   + + +A ++KE  G+ 
Sbjct  83   LFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKE-AGVE  141

Query  567  RFIQLSSLGASPTSPSR  617
            +FI +S L A+  S SR
Sbjct  142  KFIHVSHLNANIKSSSR  158



>ref|XP_006957558.1| NAD(P)-binding protein [Wallemia sebi CBS 633.66]
 gb|EIM22301.1| NAD(P)-binding protein [Wallemia sebi CBS 633.66]
Length=378

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 107/148 (72%), Gaps = 2/148 (1%)
 Frame = +3

Query  171  LTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCH  350
            +T K    ++R G GGRSS +G VATVFG TGFLGRYLVQ++A+ G+QV+VP+R  E   
Sbjct  29   ITPKSKSPVLRLGPGGRSSTTGHVATVFGCTGFLGRYLVQKIARTGAQVVVPYR-DEMEK  87

Query  351  RHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQ  530
            RHLK+MGDLGQIVPM+++ R  + I   +  ++VV NL+GR++ET+N+S+E+V+  +A  
Sbjct  88   RHLKVMGDLGQIVPMEWDARRPDQIAECLRHSDVVYNLVGRDHETKNFSYEDVHTKVASD  147

Query  531  LASIAKEHGGILRFIQLSSLGASPTSPS  614
            +ASIA +  GI R I +S   A+  SPS
Sbjct  148  IASIATQE-GIERLIHVSHFNAAHDSPS  174



>ref|XP_007902354.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Callorhinchus milii]
Length=370

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 105/142 (74%), Gaps = 1/142 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            I+ +G GGRSS SGIVATVFGATGFLGRY+V +L ++GSQ+++P+R       HLK MGD
Sbjct  32   IIPRGKGGRSSFSGIVATVFGATGFLGRYVVNRLGRIGSQIVIPYRCDPYDTMHLKPMGD  91

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI  + ++ RD++SI+  +  +NVVINL+GRE+ET NY FE+VN  + +Q+A  A+E 
Sbjct  92   LGQITLLHWDARDKDSIRRAVENSNVVINLVGREWETWNYKFEDVNINIPRQIALAARE-  150

Query  555  GGILRFIQLSSLGASPTSPSRM  620
             G+ +FI +S L A+  S S++
Sbjct  151  AGVEKFIHISHLNANIKSISKL  172



>ref|XP_008574858.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Galeopterus variegatus]
Length=377

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++PFR       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPFRCERYDTMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ++ +++N RD++SI+  +  +NVVINLIGRE+ETRN+ FE+V   + + +A ++KE 
Sbjct  100  LGQLIFLEWNGRDKDSIQRAVQHSNVVINLIGREWETRNFYFEDVFVKIPQAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A   S SR
Sbjct  159  AGVEKFIHVSHLNADIKSSSR  179



>gb|KIO18953.1| hypothetical protein M407DRAFT_153532 [Tulasnella calospora MUT 
4182]
Length=374

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 103/142 (73%), Gaps = 2/142 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G  GRSSVSG VATVFG TGFLGRYLV +LAK G+QV+VPFR  ED  RHLK+MGD
Sbjct  31   VISYGPAGRSSVSGHVATVFGCTGFLGRYLVSKLAKAGTQVIVPFR-DEDEKRHLKVMGD  89

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ++P+ ++ RD ++I   +  ++VV NL GREYET+N++FE+VN   A+ +A ++  +
Sbjct  90   LGQVIPLMWDMRDPDTIAECVRHSDVVYNLAGREYETKNFTFEDVNVTGAQLIAEVSMAN  149

Query  555  GGILRFIQLSSLGASPTSPSRM  620
              +  FI +S L A+  SPSR 
Sbjct  150  -SVSNFIHVSHLNANANSPSRF  170



>ref|NP_001279619.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Callorhinchus milii]
 gb|AFK11425.1| Ndufa9 protein [Callorhinchus milii]
Length=380

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 105/142 (74%), Gaps = 1/142 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            I+ +G GGRSS SGIVATVFGATGFLGRY+V +L ++GSQ+++P+R       HLK MGD
Sbjct  42   IIPRGKGGRSSFSGIVATVFGATGFLGRYVVNRLGRIGSQIVIPYRCDPYDTMHLKPMGD  101

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI  + ++ RD++SI+  +  +NVVINL+GRE+ET NY FE+VN  + +Q+A  A+E 
Sbjct  102  LGQITLLHWDARDKDSIRRAVENSNVVINLVGREWETWNYKFEDVNINIPRQIALAARE-  160

Query  555  GGILRFIQLSSLGASPTSPSRM  620
             G+ +FI +S L A+  S S++
Sbjct  161  AGVEKFIHISHLNANIKSISKL  182



>ref|XP_010963120.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Camelus bactrianus]
Length=377

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 102/137 (74%), Gaps = 1/137 (1%)
 Frame = +3

Query  207  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  386
            G GGRSSVSGIVATVFGATG+LGRY+V  L +MGSQV+VP+R       HL+ MGDLGQI
Sbjct  44   GKGGRSSVSGIVATVFGATGYLGRYIVNHLGRMGSQVVVPYRCEPYDTMHLRPMGDLGQI  103

Query  387  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGIL  566
            + ++++ RD++SI+  +  +NVVINL+GRE+ETRN+ FE+V   + + +A ++KE  G+ 
Sbjct  104  LFLEWDGRDKDSIRRAVEHSNVVINLVGREWETRNFDFEDVFVKIPQAIAQVSKE-AGVE  162

Query  567  RFIQLSSLGASPTSPSR  617
            R I +S L A   SPSR
Sbjct  163  RLIHVSHLNADIKSPSR  179



>ref|XP_006210904.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Vicugna pacos]
Length=376

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 102/137 (74%), Gaps = 1/137 (1%)
 Frame = +3

Query  207  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  386
            G GGRSSVSGIVATVFGATG+LGRY+V  L +MGSQV+VP+R       HL+ MGDLGQI
Sbjct  44   GKGGRSSVSGIVATVFGATGYLGRYVVNHLGRMGSQVVVPYRCEPYDTMHLRPMGDLGQI  103

Query  387  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGIL  566
            + ++++ RD++SI+  +  +NVVINL+GRE+ETRN+ FE+V   + + +A ++KE  G+ 
Sbjct  104  LFLEWDGRDKDSIRRAVEHSNVVINLVGREWETRNFDFEDVFVKIPQAIAQVSKE-AGVE  162

Query  567  RFIQLSSLGASPTSPSR  617
            R I +S L A   SPSR
Sbjct  163  RLIHVSHLNADIKSPSR  179



>ref|XP_006175621.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Camelus ferus]
 ref|XP_010981110.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Camelus dromedarius]
Length=363

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 102/137 (74%), Gaps = 1/137 (1%)
 Frame = +3

Query  207  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  386
            G GGRSSVSGIVATVFGATG+LGRY+V  L +MGSQV+VP+R       HL+ MGDLGQI
Sbjct  30   GKGGRSSVSGIVATVFGATGYLGRYVVNHLGRMGSQVVVPYRCEPYDTMHLRPMGDLGQI  89

Query  387  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGIL  566
            + ++++ RD++SI+  +  +NVVINL+GRE+ETRN+ FE+V   + + +A ++KE  G+ 
Sbjct  90   LFLEWDGRDKDSIRRAVEHSNVVINLVGREWETRNFDFEDVFVKIPQAIAQVSKE-AGVE  148

Query  567  RFIQLSSLGASPTSPSR  617
            R I +S L A   SPSR
Sbjct  149  RLIHVSHLNADIKSPSR  165



>ref|XP_005334075.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Ictidomys tridecemlineatus]
Length=354

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDPYDVMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ +++N RD++SI+  +  +NVVINL+GR++ETRN+ FE+V   + + +A I+KE 
Sbjct  100  LGQIIFLEWNGRDKDSIRRAVEHSNVVINLVGRDWETRNFDFEDVFVKIPQTIAQISKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A+  S SR
Sbjct  159  AGVEKFIHVSHLNANIRSSSR  179



>gb|KDN41067.1| putative NADH2 dehydrogenase 40K chain [Tilletiaria anomala UBC 
951]
Length=398

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 99/134 (74%), Gaps = 2/134 (1%)
 Frame = +3

Query  213  GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVP  392
            GGR+SVSG VATVFG TGFLGRYLV +LA+ G+QV+VPFR  ED  RHLK+MGDLGQ+VP
Sbjct  64   GGRNSVSGHVATVFGCTGFLGRYLVSRLAQKGTQVIVPFR-DEDEKRHLKIMGDLGQVVP  122

Query  393  MKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGILRF  572
            M+++ RDE  I+  +  ++ V NL GR YET+N+SF +VN   A+++A +A E  G+ RF
Sbjct  123  MEWDIRDEGMIEECLRHSDTVYNLTGRAYETKNFSFADVNRDGARRIAEVA-EASGVSRF  181

Query  573  IQLSSLGASPTSPS  614
            I +S L A   S S
Sbjct  182  IHVSHLNADANSES  195



>ref|XP_005365321.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Microtus ochrogaster]
Length=377

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 111/158 (70%), Gaps = 7/158 (4%)
 Frame = +3

Query  162  ASTLTAKGTGH------IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  323
            A+T   +G  H      ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++
Sbjct  23   AATSVFRGPSHRQLHHALIPHGQGGRSSVSGVVATVFGATGFLGRYVVNALGRMGSQVII  82

Query  324  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFE  503
            P+R       HL+ MGDLGQ++ ++++ RD++SI+  +  +NVVINLIGR++ETRN+ FE
Sbjct  83   PYRCDIYDTMHLRPMGDLGQLIFLEWDARDKDSIRRAVQHSNVVINLIGRDWETRNFDFE  142

Query  504  EVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSR  617
            +V   + + +A ++KE  G+ RFI +S L A+  S SR
Sbjct  143  DVFVKIPQTIAQVSKE-AGVERFIHVSHLNANMKSSSR  179



>ref|NP_001073383.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial precursor [Pan troglodytes]
 ref|XP_008972004.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Pan paniscus]
 sp|Q0MQB4.1|NDUA9_PANTR RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Pan troglodytes]
 gb|ABH12229.1| mitochondrial complex I subunit NDUFA9 [Pan troglodytes]
Length=377

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 105/137 (77%), Gaps = 1/137 (1%)
 Frame = +3

Query  207  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  386
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGDLGQ+
Sbjct  44   GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQL  103

Query  387  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGIL  566
            + ++++ RD++SI+ V+  +NVVINLIGR++ET+NY FE+V   + + +A ++KE  G+ 
Sbjct  104  LFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNYDFEDVFVKIPQAIAQLSKE-AGVE  162

Query  567  RFIQLSSLGASPTSPSR  617
            +FI +S L A+  S SR
Sbjct  163  KFIHVSHLNANIKSSSR  179



>ref|XP_005365322.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Microtus ochrogaster]
Length=377

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 111/158 (70%), Gaps = 7/158 (4%)
 Frame = +3

Query  162  ASTLTAKGTGH------IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  323
            A+T   +G  H      ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++
Sbjct  23   AATSVFRGPSHRQLHHALIPHGQGGRSSVSGVVATVFGATGFLGRYVVNALGRMGSQVII  82

Query  324  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFE  503
            P+R       HL+ MGDLGQ++ ++++ RD++SI+  +  +NVVINLIGR++ETRN+ FE
Sbjct  83   PYRCDIYDTMHLRPMGDLGQLIFLEWDARDKDSIRRAVQHSNVVINLIGRDWETRNFDFE  142

Query  504  EVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSR  617
            +V   + + +A ++KE  G+ RFI +S L A+  S SR
Sbjct  143  DVFVKIPQTIAQVSKE-AGVERFIHVSHLNANMKSSSR  179



>gb|ETN62206.1| NADH-ubiquinone oxidoreductase 39 kda subunit [Anopheles darlingi]
Length=401

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 107/136 (79%), Gaps = 1/136 (1%)
 Frame = +3

Query  198  VRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDL  377
            +++GTGGRSS +GIVATVFG+TGFLGRY+  +L K+GSQV++P+R        LKL+GDL
Sbjct  45   IKRGTGGRSSFNGIVATVFGSTGFLGRYVCNKLGKIGSQVIIPYRADHYEALRLKLVGDL  104

Query  378  GQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHG  557
            GQ++   Y+ RDE++I+  +  +NVVINL+GR++ET+N+SF++V+   A++LA IA+E  
Sbjct  105  GQVLFHPYDLRDEDAIRKAVKYSNVVINLVGRDWETKNFSFKDVHVEGARRLARIARE-A  163

Query  558  GILRFIQLSSLGASPT  605
            G+ +F+ +SSL A+PT
Sbjct  164  GVEKFVHVSSLNATPT  179



>gb|KDQ20806.1| hypothetical protein BOTBODRAFT_26820 [Botryobasidium botryosum 
FD-172 SS1]
Length=366

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 108/155 (70%), Gaps = 1/155 (1%)
 Frame = +3

Query  150  TPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPF  329
            T R A  LT   +  ++  G  GRS+VSG VATVFGATGFLGRYL+ +LAK G+QV+VPF
Sbjct  17   TRRAAHDLTVLPSKPVISYGPAGRSAVSGHVATVFGATGFLGRYLIAKLAKGGTQVIVPF  76

Query  330  RGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEV  509
            R  ED  RHL++ GDLGQIVP++++ R+E  I+  +  +++V NL+GR+YET+N+ ++ V
Sbjct  77   R-EEDEARHLRVTGDLGQIVPLEWDLRNEEQIRECVRHSDIVYNLVGRDYETKNFDYQSV  135

Query  510  NHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPS  614
            +   A+ +A I  E   + RF+ +S L AS  SPS
Sbjct  136  HVKGAELIAQICAESPSVSRFVHVSHLNASVDSPS  170



>gb|ABH12231.1| mitochondrial complex I subunit NDUFA9 [Pongo pygmaeus]
Length=381

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  44   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDIMHLRPMGD  103

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ++ ++++ RD++SI+ V+  +NVVINLIGR++ETRN+ FE+V   + + +A ++KE 
Sbjct  104  LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETRNFDFEDVFVKIPQAIAQLSKE-  162

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A+  S SR
Sbjct  163  AGVEKFIHVSHLNANIKSSSR  183



>ref|NP_001127602.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial precursor [Pongo abelii]
 sp|P0CB81.1|NDUA9_PONAB RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Pongo abelii]
 sp|P0CB82.1|NDUA9_PONPY RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Pongo pygmaeus]
 emb|CAH92896.1| hypothetical protein [Pongo abelii]
Length=377

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDIMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ++ ++++ RD++SI+ V+  +NVVINLIGR++ETRN+ FE+V   + + +A ++KE 
Sbjct  100  LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETRNFDFEDVFVKIPQAIAQLSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A+  S SR
Sbjct  159  AGVEKFIHVSHLNANIKSSSR  179



>gb|KIJ64483.1| hypothetical protein HYDPIDRAFT_28424 [Hydnomerulius pinastri 
MD-312]
Length=359

 Score =   151 bits (381),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 106/148 (72%), Gaps = 2/148 (1%)
 Frame = +3

Query  171  LTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCH  350
            +T  G   I+ +GT G S+VSG V TVFG TGFLGRYLV +LA+MG+QV+VP+R  ED  
Sbjct  26   VTLPGRKPIISQGTPGYSAVSGHVVTVFGCTGFLGRYLVSKLARMGTQVIVPYR-EEDEK  84

Query  351  RHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQ  530
            RHLK MGDLGQIVPM+++ R+E  I   +  +++V NL+GR+YET+N+   +V+   A++
Sbjct  85   RHLKPMGDLGQIVPMEWDIRNEEQIAECLRHSDIVYNLVGRDYETKNFKSADVHVAGAER  144

Query  531  LASIAKEHGGILRFIQLSSLGASPTSPS  614
            +A +A E  G+ RF+ LS L ASP S S
Sbjct  145  VAKVAAE-SGVQRFVHLSHLNASPDSRS  171



>ref|XP_005734821.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like isoform X2 [Pundamilia nyererei]
Length=381

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++ KG GGRSS SGI ATVFGATGFLGRY+V +L ++GSQ+++P R  +    H + MGD
Sbjct  43   LIPKGKGGRSSFSGIAATVFGATGFLGRYVVNRLGRIGSQIIIPHRCDQYDLMHFRPMGD  102

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ ++++ R+++SIK  M  +NVVINL+GRE+ETRN+ FE+V   + +Q+A  A+E 
Sbjct  103  LGQILFLEWDARNKDSIKQAMENSNVVINLVGREWETRNFRFEDVYVTIPQQIARAARE-  161

Query  555  GGILRFIQLSSLGASPTSPSR  617
             GI +F+ +S L A   SPS+
Sbjct  162  AGITKFVHMSHLNADIRSPSK  182



>ref|XP_007469502.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Lipotes vexillifer]
Length=377

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ +++N RD++SI+  +  +NVVINL+GRE+ET+N+ FE+V   + + +A ++KE 
Sbjct  100  LGQIIFLEWNGRDKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A   S S+
Sbjct  159  AGVEKFIHVSHLNADIKSSSK  179



>ref|XP_005950395.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like isoform X1 [Haplochromis burtoni]
Length=382

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++ KG GGRSS SGI ATVFGATGFLGRY+V +L ++GSQ+++P R  +    H + MGD
Sbjct  44   LIPKGKGGRSSFSGIAATVFGATGFLGRYVVNRLGRIGSQIIIPHRCDQYDLMHFRPMGD  103

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ ++++ R+++SIK  M  +NVVINL+GRE+ETRN+ FE+V   + +Q+A  A+E 
Sbjct  104  LGQILFLEWDARNKDSIKQAMENSNVVINLVGREWETRNFRFEDVYVTIPQQIARAARE-  162

Query  555  GGILRFIQLSSLGASPTSPSR  617
             GI +F+ +S L A   SPS+
Sbjct  163  AGITKFVHMSHLNADIRSPSK  183



>ref|XP_005734820.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like isoform X1 [Pundamilia nyererei]
Length=382

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++ KG GGRSS SGI ATVFGATGFLGRY+V +L ++GSQ+++P R  +    H + MGD
Sbjct  44   LIPKGKGGRSSFSGIAATVFGATGFLGRYVVNRLGRIGSQIIIPHRCDQYDLMHFRPMGD  103

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ ++++ R+++SIK  M  +NVVINL+GRE+ETRN+ FE+V   + +Q+A  A+E 
Sbjct  104  LGQILFLEWDARNKDSIKQAMENSNVVINLVGREWETRNFRFEDVYVTIPQQIARAARE-  162

Query  555  GGILRFIQLSSLGASPTSPSR  617
             GI +F+ +S L A   SPS+
Sbjct  163  AGITKFVHMSHLNADIRSPSK  183



>ref|XP_005950396.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like isoform X2 [Haplochromis burtoni]
Length=381

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++ KG GGRSS SGI ATVFGATGFLGRY+V +L ++GSQ+++P R  +    H + MGD
Sbjct  43   LIPKGKGGRSSFSGIAATVFGATGFLGRYVVNRLGRIGSQIIIPHRCDQYDLMHFRPMGD  102

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ ++++ R+++SIK  M  +NVVINL+GRE+ETRN+ FE+V   + +Q+A  A+E 
Sbjct  103  LGQILFLEWDARNKDSIKQAMENSNVVINLVGREWETRNFRFEDVYVTIPQQIARAARE-  161

Query  555  GGILRFIQLSSLGASPTSPSR  617
             GI +F+ +S L A   SPS+
Sbjct  162  AGITKFVHMSHLNADIRSPSK  182



>ref|NP_001013477.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Danio rerio]
 gb|AAH91545.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 [Danio 
rerio]
 gb|AAI64086.1| Ndufa9 protein [Danio rerio]
Length=309

 Score =   150 bits (378),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 113/166 (68%), Gaps = 2/166 (1%)
 Frame = +3

Query  123  LSDQCYGIGTPRYASTLTAKGTGH-IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLA  299
            LS  C  +       T+  +   H +V +G GGRSS+SG+ ATVFGATGFLGRY+V +L 
Sbjct  17   LSGTCSPVLLAAAPVTVQQRKIHHAVVPRGKGGRSSISGLAATVFGATGFLGRYVVNRLG  76

Query  300  KMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREY  479
            +MGSQV++P+R  +    +L+ MGDLGQI+ M+++PR++ SI+  ++ +NVVINL+GRE+
Sbjct  77   RMGSQVVIPYRCDQYDLMYLRPMGDLGQIIFMEWDPRNKESIQRAISHSNVVINLVGREW  136

Query  480  ETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSR  617
            ET NY +E+V   +  Q+A   +E  GI +FI +S L A   SPS+
Sbjct  137  ETSNYKYEDVFVSIPLQIARATRE-AGIKKFIHMSHLNADIRSPSK  181



>gb|AAH03351.1| Similar to NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 
9 (39kD), partial [Homo sapiens]
Length=338

 Score =   150 bits (380),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 105/137 (77%), Gaps = 1/137 (1%)
 Frame = +3

Query  207  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  386
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGDLGQ+
Sbjct  5    GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQL  64

Query  387  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGIL  566
            + ++++ RD++SI+ V+  +NVVINLIGR++ET+N+ FE+V   + + +A ++KE  G+ 
Sbjct  65   LFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKE-AGVE  123

Query  567  RFIQLSSLGASPTSPSR  617
            +FI +S L A+  S SR
Sbjct  124  KFIHVSHLNANIKSSSR  140



>ref|XP_005084120.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Mesocricetus auratus]
Length=377

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 108/158 (68%), Gaps = 7/158 (4%)
 Frame = +3

Query  162  ASTLTAKGTGH------IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  323
            A+T   +G  H      ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++
Sbjct  23   AATSVFRGPSHRQLHHAVIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVII  82

Query  324  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFE  503
            P+R       HL+ MGDLGQI+ ++++ RD++SIK  +  +NVVINL+GR++ETRN+ FE
Sbjct  83   PYRCDPYDTMHLRPMGDLGQIIFLEWDARDKDSIKRAVQHSNVVINLVGRDWETRNFDFE  142

Query  504  EVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSR  617
            +V   +   +A  +KE  G+ R I +S L AS  S SR
Sbjct  143  DVFVKIPHAIAQASKE-AGVERLIHVSHLNASIKSSSR  179



>ref|XP_009546417.1| hypothetical protein HETIRDRAFT_475334 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW81816.1| hypothetical protein HETIRDRAFT_475334 [Heterobasidion irregulare 
TC 32-1]
Length=347

 Score =   150 bits (379),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 104/142 (73%), Gaps = 2/142 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            I+  G  GRS+V+G VATVFG TGFLGRYLV +LAK G+QV++P+R  ED  RHLK+MGD
Sbjct  20   ILSYGPAGRSAVTGHVATVFGCTGFLGRYLVSKLAKTGTQVIIPYR-DEDEKRHLKVMGD  78

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQIVPM+++ R++N  +  +  +++V NL+GREYET+N+S+ + N     ++A I+ + 
Sbjct  79   LGQIVPMEWDLRNDNQTEECVRHSDIVYNLVGREYETKNFSYRDANALGPARIADISAK-  137

Query  555  GGILRFIQLSSLGASPTSPSRM  620
             G+ RF+ +S L A+  SPS+ 
Sbjct  138  SGVSRFVHVSHLNAAADSPSKF  159



>sp|Q0MQB3.2|NDUA9_GORGO RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Gorilla gorilla gorilla]
Length=377

 Score =   150 bits (380),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 107/141 (76%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ++ ++++ RD++SI+ V+  +NVVINLIGR++ET+N+ FE+V   + + +A ++KE 
Sbjct  100  LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A+  S SR
Sbjct  159  AGVEKFIHVSHLNANIKSSSR  179



>ref|XP_007170262.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Balaenoptera acutorostrata scammoni]
Length=377

 Score =   150 bits (380),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 102/137 (74%), Gaps = 1/137 (1%)
 Frame = +3

Query  207  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  386
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGDLGQI
Sbjct  44   GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDTMHLRPMGDLGQI  103

Query  387  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGIL  566
            + M+++ RD++SI+  +  +NVV+NL+GRE+ET+N+ FE+V   + + +A ++KE  G+ 
Sbjct  104  IFMEWSGRDKDSIRRAVEHSNVVVNLVGREWETKNFDFEDVFVKIPQAIAQVSKE-AGVE  162

Query  567  RFIQLSSLGASPTSPSR  617
            + I +S L A   SPS+
Sbjct  163  KLIHVSHLNADIKSPSK  179



>ref|NP_001266630.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Gorilla gorilla]
 gb|ABH12230.1| mitochondrial complex I subunit NDUFA9 [Gorilla gorilla]
Length=381

 Score =   151 bits (381),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 107/141 (76%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGD
Sbjct  44   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGD  103

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ++ ++++ RD++SI+ V+  +NVVINLIGR++ET+N+ FE+V   + + +A ++KE 
Sbjct  104  LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKE-  162

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A+  S SR
Sbjct  163  AGVEKFIHVSHLNANIKSSSR  183



>ref|XP_003796469.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Otolemur garnettii]
Length=377

 Score =   150 bits (380),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDFMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ++ +++N RD++SI+  +  +NVVINLIGR++ET+N+ FE+V   + + +A ++KE 
Sbjct  100  LGQLIFLEWNGRDKDSIRRAVEHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A+  S SR
Sbjct  159  AGVEKFIHVSHLNANIKSSSR  179



>gb|AAH05760.1| Ndufa9 protein, partial [Mus musculus]
Length=348

 Score =   150 bits (379),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 100/134 (75%), Gaps = 1/134 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+LMGD
Sbjct  11   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDVYDIMHLRLMGD  70

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ+  ++++ RD++SI+  +  +NVVINLIGRE+ETRN+ FE+V   + + +A  +KE 
Sbjct  71   LGQLTFLEWDARDKDSIRKAVQHSNVVINLIGREWETRNFDFEDVFVNIPRAIAQASKE-  129

Query  555  GGILRFIQLSSLGA  596
             G+ RFI +S L A
Sbjct  130  AGVERFIHVSHLNA  143



>gb|AAA36350.1| NADH dehydrogenase (ubiquinone), partial [Homo sapiens]
Length=375

 Score =   150 bits (380),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 105/137 (77%), Gaps = 1/137 (1%)
 Frame = +3

Query  207  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  386
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGDLGQ+
Sbjct  42   GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQL  101

Query  387  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGIL  566
            + ++++ RD++SI+ V+  +NVVINLIGR++ET+N+ FE+V   + + +A ++KE  G+ 
Sbjct  102  LFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKE-AGVE  160

Query  567  RFIQLSSLGASPTSPSR  617
            +FI +S L A+  S SR
Sbjct  161  KFIHVSHLNANIKSSSR  177



>ref|XP_001515711.2| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial, partial [Ornithorhynchus anatinus]
Length=405

 Score =   151 bits (381),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  68   VMPHGQGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVVIPYRCEPYDIMHLRPMGD  127

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ++ M++N RD+ SI+  +A +NVVINLIGR++ET+N+ F++V   + + +A +AKE 
Sbjct  128  LGQLLFMEWNARDKESIRRALAHSNVVINLIGRDWETKNFDFDDVFVKIPQSIAQLAKE-  186

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A   S SR
Sbjct  187  AGVEKFIHVSHLNADMKSSSR  207



>ref|NP_004993.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial precursor [Homo sapiens]
 sp|Q16795.2|NDUA9_HUMAN RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Homo sapiens]
 gb|AAD42055.1|AF050641_1 NADH-ubiquinone oxidoreductase 39kDa subunit [Homo sapiens]
 gb|AAH09311.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Homo sapiens]
 gb|AAH15837.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Homo sapiens]
 gb|AAI11547.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Homo sapiens]
 gb|EAW88837.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa, 
isoform CRA_a [Homo sapiens]
 gb|ADQ31784.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[synthetic construct]
 gb|AIC49261.1| NDUFA9, partial [synthetic construct]
Length=377

 Score =   150 bits (380),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 105/137 (77%), Gaps = 1/137 (1%)
 Frame = +3

Query  207  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  386
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGDLGQ+
Sbjct  44   GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQL  103

Query  387  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGIL  566
            + ++++ RD++SI+ V+  +NVVINLIGR++ET+N+ FE+V   + + +A ++KE  G+ 
Sbjct  104  LFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKE-AGVE  162

Query  567  RFIQLSSLGASPTSPSR  617
            +FI +S L A+  S SR
Sbjct  163  KFIHVSHLNANIKSSSR  179



>ref|XP_007304718.1| NADH dehydrogenase [Stereum hirsutum FP-91666 SS1]
 gb|EIM85758.1| NADH dehydrogenase [Stereum hirsutum FP-91666 SS1]
Length=379

 Score =   150 bits (380),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 102/142 (72%), Gaps = 2/142 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            I+  G  GRS+ +G VATVFG TGFLGRYLV +LAK G+QV+VP+R  ED  RHLK+MGD
Sbjct  35   IIAYGPPGRSATTGHVATVFGCTGFLGRYLVSKLAKAGTQVVVPYR-DEDEKRHLKVMGD  93

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQIVP++++ R EN I+  +  +++V NL GREY+T+ +S  +VN   A ++AS+A   
Sbjct  94   LGQIVPLEWDIRSENQIEECLRHSDIVYNLTGREYDTKRFSLHDVNSTGAGRIASVAAR-  152

Query  555  GGILRFIQLSSLGASPTSPSRM  620
             G+ RF+ +S L AS  SPSR 
Sbjct  153  AGVPRFVHVSHLNASRDSPSRF  174



>gb|AIC62000.1| NDUFA9, partial [synthetic construct]
Length=377

 Score =   150 bits (380),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 105/137 (77%), Gaps = 1/137 (1%)
 Frame = +3

Query  207  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  386
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGDLGQ+
Sbjct  44   GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQL  103

Query  387  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGIL  566
            + ++++ RD++SI+ V+  +NVVINLIGR++ET+N+ FE+V   + + +A ++KE  G+ 
Sbjct  104  LFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKE-AGVE  162

Query  567  RFIQLSSLGASPTSPSR  617
            +FI +S L A+  S SR
Sbjct  163  KFIHVSHLNANIKSSSR  179



>gb|AAI53423.1| Ndufa9 protein [Danio rerio]
Length=380

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 113/166 (68%), Gaps = 2/166 (1%)
 Frame = +3

Query  123  LSDQCYGIGTPRYASTLTAKGTGH-IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLA  299
            LS  C  +       T+  +   H IV +G GGRSS+SG+ ATVFGATGFLGRY+V +L 
Sbjct  17   LSGTCSPVLLAAAPVTVQQRKIHHAIVPRGKGGRSSISGLAATVFGATGFLGRYVVNRLG  76

Query  300  KMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREY  479
            +MGSQV++P+R  +    +L+ MGDLGQI+ M+++PR++ SI+  ++ +NVVINL+GRE+
Sbjct  77   RMGSQVVIPYRCDQYDLMYLRPMGDLGQIIFMEWDPRNKESIQRAISHSNVVINLVGREW  136

Query  480  ETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSR  617
            ET NY +E+V   +  Q+A   +E  GI +FI +S L A   SPS+
Sbjct  137  ETSNYKYEDVFVSIPLQIARATRE-AGIKKFIHMSHLNADIRSPSK  181



>ref|XP_004279068.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Orcinus orca]
Length=377

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 102/137 (74%), Gaps = 1/137 (1%)
 Frame = +3

Query  207  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  386
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGDLGQI
Sbjct  44   GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDTMHLRPMGDLGQI  103

Query  387  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGIL  566
            + +++N RD++SI+  +  +NVVINL+GRE+ET+N+ FE+V   + + +A ++KE  G+ 
Sbjct  104  IFLEWNGRDKDSIRRAVEHSNVVINLVGREWETKNFGFEDVFVKIPQAIAQVSKE-AGVE  162

Query  567  RFIQLSSLGASPTSPSR  617
            +FI +S L A   S S+
Sbjct  163  KFIHVSHLNADIKSSSK  179



>ref|XP_003988339.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Felis catus]
Length=377

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSG+VATVFGATGFLGRY+V +L +MGSQV++P+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNRLGRMGSQVIIPYRCEAYDTMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ +++N +D++SI+  +  +NVVINL+GRE+ET+N+ FE+V   + + +A ++KE 
Sbjct  100  LGQIIFLEWNGKDKDSIRRAVKHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A   S SR
Sbjct  159  AGVEKFIHVSHLNADIKSSSR  179



>ref|XP_006053611.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Bubalus bubalis]
Length=380

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ M +N RD++SI+  +  ++VVINL+GRE+ET+N+ FE+V   + + +A ++KE 
Sbjct  100  LGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETQNFDFEDVFVKIPQAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A   S S+
Sbjct  159  AGVEKFIHISHLNADIKSSSK  179



>ref|XP_010843290.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Bison bison bison]
Length=376

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP R       HL+ MGD
Sbjct  36   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPHRCEPYDTMHLRPMGD  95

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ M +N RD++SI+  +  ++VVINL+GRE+ETRN+ FE+V   + + +A ++KE 
Sbjct  96   LGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETRNFDFEDVFVKIPQAIAQVSKE-  154

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A   S S+
Sbjct  155  AGVEKFIHISHLNADIKSSSK  175



>ref|NP_079634.2| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial precursor [Mus musculus]
 sp|Q9DC69.2|NDUA9_MOUSE RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Mus musculus]
 gb|AAH58378.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 [Mus musculus]
 gb|EDK99844.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 [Mus musculus]
Length=377

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 100/134 (75%), Gaps = 1/134 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+LMGD
Sbjct  40   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDVYDIMHLRLMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ+  ++++ RD++SI+  +  +NVVINLIGRE+ETRN+ FE+V   + + +A  +KE 
Sbjct  100  LGQLTFLEWDARDKDSIRKAVQHSNVVINLIGREWETRNFDFEDVFVNIPRAIAQASKE-  158

Query  555  GGILRFIQLSSLGA  596
             G+ RFI +S L A
Sbjct  159  AGVERFIHVSHLNA  172



>ref|XP_003447104.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Oreochromis niloticus]
Length=381

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++ KG GGRSS SGI ATVFGATGFLGRY+V +L ++GSQ+++P R  +    H + MGD
Sbjct  43   LIPKGKGGRSSFSGIAATVFGATGFLGRYVVNRLGRIGSQIIIPHRCDQYDLMHFRPMGD  102

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ ++++ R+++SIK  M  ++VVINL+GRE+ETRN+ FE+V   + +Q+A  A+E 
Sbjct  103  LGQIIFLEWDARNKDSIKRAMEHSDVVINLVGREWETRNFRFEDVFVTIPQQIARAARE-  161

Query  555  GGILRFIQLSSLGASPTSPSR  617
             GI +F+ +S L A   SPS+
Sbjct  162  AGITKFVHMSHLNADIRSPSK  182



>ref|XP_005957904.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Pantholops hodgsonii]
Length=380

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ++ M +N RD++SI+  +  ++VVINL+GRE+ET+N+ FE+V   + + +A ++KE 
Sbjct  100  LGQVIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A   S S+
Sbjct  159  AGVEKFIHISHLNADIKSSSK  179



>emb|CBQ67793.1| probable NADH2 dehydrogenase (ubiquinone) 40K chain [Sporisorium 
reilianum SRZ2]
Length=392

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 107/151 (71%), Gaps = 4/151 (3%)
 Frame = +3

Query  168  TLTAKGTGHIVRKG--TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  341
            T+  K    I++ G   GGRSSVSG V TVFG TGFLGRYLV +LA+ G+QV++P+R  E
Sbjct  41   TINRKTGKPIIKSGPYAGGRSSVSGHVVTVFGCTGFLGRYLVNRLAQKGTQVIIPYR-DE  99

Query  342  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  521
            D  RHLK+MGDLGQIVPM+++ R +  I+  +  ++VV NL+GR YET+N++F +V+   
Sbjct  100  DEKRHLKVMGDLGQIVPMEWDLRHDEQIEECVRHSDVVYNLVGRHYETKNFTFNDVHVTG  159

Query  522  AKQLASIAKEHGGILRFIQLSSLGASPTSPS  614
            A+++A IA E  G+ RFI +S L A   SPS
Sbjct  160  AQRIAQIA-ESAGVGRFIHVSHLNADANSPS  189



>ref|XP_003496081.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Cricetulus griseus]
 ref|XP_007637435.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Cricetulus griseus]
 gb|EGV98504.1| hypothetical protein I79_001369 [Cricetulus griseus]
Length=377

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 109/158 (69%), Gaps = 7/158 (4%)
 Frame = +3

Query  162  ASTLTAKGTGH------IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  323
            A+T   +G  H      ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++
Sbjct  23   AATSVFRGPSHRQLHHAVIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVII  82

Query  324  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFE  503
            P+R       HL+ MGDLGQ++ ++++ RD++SI+  +  +NVVINLIGR++ETRN+ FE
Sbjct  83   PYRCDTYDTMHLRPMGDLGQLIFLEWDARDKDSIRRAVQHSNVVINLIGRDWETRNFDFE  142

Query  504  EVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSR  617
            ++   + + +A  +KE  G+ R I +S L AS  S SR
Sbjct  143  DIFVKIPQAIAQASKE-AGVERLIHVSHLNASMKSSSR  179



>gb|EAW88838.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa, 
isoform CRA_b [Homo sapiens]
Length=399

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 105/137 (77%), Gaps = 1/137 (1%)
 Frame = +3

Query  207  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  386
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGDLGQ+
Sbjct  66   GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQL  125

Query  387  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGIL  566
            + ++++ RD++SI+ V+  +NVVINLIGR++ET+N+ FE+V   + + +A ++KE  G+ 
Sbjct  126  LFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKE-AGVE  184

Query  567  RFIQLSSLGASPTSPSR  617
            +FI +S L A+  S SR
Sbjct  185  KFIHVSHLNANIKSSSR  201



>gb|AAH68378.1| Ndufa9 protein, partial [Danio rerio]
Length=374

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            +V +G GGRSS+SG+ ATVFGATGFLGRY+V +L +MGSQV++P+R  +    +L+ MGD
Sbjct  36   VVPRGKGGRSSISGLAATVFGATGFLGRYVVNRLGRMGSQVVIPYRCDQYDLMYLRPMGD  95

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ M+++PR++ SI+  ++ +NVVINL+GRE+ET NY +E+V   +  Q+A   +E 
Sbjct  96   LGQIIFMEWDPRNKESIQRAISHSNVVINLVGREWETSNYKYEDVFVSIPLQIARATRE-  154

Query  555  GGILRFIQLSSLGASPTSPSR  617
             GI +FI +S L A   SPS+
Sbjct  155  AGIKKFIHMSHLNADIRSPSK  175



>ref|XP_005174380.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Danio rerio]
Length=380

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 113/166 (68%), Gaps = 2/166 (1%)
 Frame = +3

Query  123  LSDQCYGIGTPRYASTLTAKGTGH-IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLA  299
            LS  C  +       T+  +   H +V +G GGRSS+SG+ ATVFGATGFLGRY+V +L 
Sbjct  17   LSGTCSPVLLAAAPVTVQQRKIHHAVVPRGKGGRSSISGLAATVFGATGFLGRYVVNRLG  76

Query  300  KMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREY  479
            +MGSQV++P+R  +    +L+ MGDLGQI+ M+++PR++ SI+  ++ +NVVINL+GRE+
Sbjct  77   RMGSQVVIPYRCDQYDLMYLRPMGDLGQIIFMEWDPRNKESIQRAISHSNVVINLVGREW  136

Query  480  ETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSR  617
            ET NY +E+V   +  Q+A   +E  GI +FI +S L A   SPS+
Sbjct  137  ETSNYKYEDVFVSIPLQIARATRE-AGIKKFIHMSHLNADIRSPSK  181



>gb|EFB28697.1| hypothetical protein PANDA_009221 [Ailuropoda melanoleuca]
Length=360

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  23   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDPYDTMHLRPMGD  82

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ ++++ R+++SI+  +  +NVVINL+GRE+ET+N+ FE+V   + + +A ++KE 
Sbjct  83   LGQIIFLEWDGRNKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  141

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A   S SR
Sbjct  142  AGVEKFIHVSHLNADIKSSSR  162



>ref|XP_004381326.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Trichechus manatus latirostris]
Length=359

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 102/137 (74%), Gaps = 1/137 (1%)
 Frame = +3

Query  207  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  386
            G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       +L+ MGDLGQI
Sbjct  44   GKGGRSSVSGVVATVFGATGFLGRYIVNHLGRMGSQVIIPYRCDAYELMYLRPMGDLGQI  103

Query  387  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGIL  566
            + +++N RD++SI+  +  +NVVINL+GRE+ETRN+ +++V   + + +A ++KE  G+ 
Sbjct  104  IFLEWNGRDKDSIRRAVEHSNVVINLVGREWETRNFDYDDVFVKIPQAIAQVSKE-AGVE  162

Query  567  RFIQLSSLGASPTSPSR  617
            R I +S L A   SPSR
Sbjct  163  RLIHVSHLNADIKSPSR  179



>ref|XP_002920485.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Ailuropoda melanoleuca]
Length=377

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDPYDTMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ ++++ R+++SI+  +  +NVVINL+GRE+ET+N+ FE+V   + + +A ++KE 
Sbjct  100  LGQIIFLEWDGRNKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A   S SR
Sbjct  159  AGVEKFIHVSHLNADIKSSSR  179



>ref|XP_003331391.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 [Puccinia 
graminis f. sp. tritici CRL 75-36-700-3]
 gb|EFP86972.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 [Puccinia 
graminis f. sp. tritici CRL 75-36-700-3]
Length=386

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 113/159 (71%), Gaps = 4/159 (3%)
 Frame = +3

Query  150  TPRYASTLTAK-GTGHIVRK-GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  323
            T R+   L  + GTG +++  G  GR S +G+VATVFGATGFLGRYLV +LAK G+QV+V
Sbjct  28   TKRWRHDLIKQSGTGKVIQSSGPSGRHSNTGLVATVFGATGFLGRYLVHKLAKQGTQVIV  87

Query  324  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFE  503
            P+R  ED  RHL++MGDLGQIVP++++  +E  I   +  ++VV NL+GRE+ET+NYSF+
Sbjct  88   PYR-DEDSKRHLRVMGDLGQIVPLEFDLENEGFINECVRHSHVVYNLLGREHETKNYSFD  146

Query  504  EVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
             +    A ++  IAKE+ G+ R I +S L AS  SPS++
Sbjct  147  RLFIEGASKITRIAKEN-GVGRLIHVSHLNASLDSPSKL  184



>gb|AAI52140.1| Ndufa9 protein [Danio rerio]
Length=380

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 113/166 (68%), Gaps = 2/166 (1%)
 Frame = +3

Query  123  LSDQCYGIGTPRYASTLTAKGTGH-IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLA  299
            LS  C  +       T+  +   H +V +G GGRSS+SG+ ATVFGATGFLGRY+V +L 
Sbjct  17   LSGTCSPVLLAAAPVTVQQRKIHHAVVPRGKGGRSSISGLAATVFGATGFLGRYVVNRLG  76

Query  300  KMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREY  479
            +MGSQV++P+R  +    +L+ MGDLGQI+ M+++PR++ SI+  ++ +NVVINL+GRE+
Sbjct  77   RMGSQVVIPYRCDQYDLMYLRPMGDLGQIIFMEWDPRNKESIQRAISHSNVVINLVGREW  136

Query  480  ETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSR  617
            ET NY +E+V   +  Q+A   +E  GI +FI +S L A   SPS+
Sbjct  137  ETSNYKYEDVFVSIPLQIARPTRE-AGIKKFIHMSHLNADIRSPSK  181



>gb|KIY67124.1| NAD(P)-binding protein [Cylindrobasidium torrendii FP15055 ss-10]
Length=368

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 109/159 (69%), Gaps = 2/159 (1%)
 Frame = +3

Query  144  IGTPRYASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  323
            IGT +Y       G   ++  G  G S+VSG V TVFGATGFLGRYL+ +LA+ G+QV+V
Sbjct  18   IGTRQYHDLHKLPGDRSVLASGPPGYSAVSGHVVTVFGATGFLGRYLISKLARTGTQVIV  77

Query  324  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFE  503
            P+R  ED  RHLKLMGDLGQIVPM+++ R E+ I   +  +++V NL GR++ET+N++++
Sbjct  78   PYR-DEDSKRHLKLMGDLGQIVPMEWDIRREDQIAECLRHSDIVYNLTGRDFETKNFTYD  136

Query  504  EVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
             +    A ++A IA+E  G+ RF+ +S L AS TS S+ 
Sbjct  137  SLLVDGAARIARIAREE-GVPRFVHMSHLNASATSTSKF  174



>ref|XP_009266962.1| hypothetical protein J056_003464 [Wallemia ichthyophaga EXF-994]
 gb|EOR02902.1| hypothetical protein J056_003464 [Wallemia ichthyophaga EXF-994]
Length=372

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 106/149 (71%), Gaps = 2/149 (1%)
 Frame = +3

Query  168  TLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDC  347
             +T K    I+R+G GGRSSV+G VATVFG TGFLGRY VQ++A+ G+QV+ P+R  E  
Sbjct  26   NITPKSKSPILRQGPGGRSSVTGHVATVFGCTGFLGRYTVQKIARTGAQVVTPYR-DELE  84

Query  348  HRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAK  527
             RHLK MGDLGQIVPM+++ R+   I   +  ++VV NL+GR++ET+N+++++V+   A 
Sbjct  85   RRHLKPMGDLGQIVPMEWDARNHQQIAECLRHSDVVYNLVGRDHETKNFNYDDVHVKAAA  144

Query  528  QLASIAKEHGGILRFIQLSSLGASPTSPS  614
             +ASIA++  GI R I +S   A+  SPS
Sbjct  145  DIASIAQQE-GIERLIHVSHFNAAHDSPS  172



>ref|XP_002920484.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Ailuropoda melanoleuca]
Length=401

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  64   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDPYDTMHLRPMGD  123

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ ++++ R+++SI+  +  +NVVINL+GRE+ET+N+ FE+V   + + +A ++KE 
Sbjct  124  LGQIIFLEWDGRNKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  182

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A   S SR
Sbjct  183  AGVEKFIHVSHLNADIKSSSR  203



>emb|CCF54116.1| probable NADH2 dehydrogenase (ubiquinone) 40K chain [Ustilago 
hordei]
Length=392

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 107/151 (71%), Gaps = 4/151 (3%)
 Frame = +3

Query  168  TLTAKGTGHIVRKGT--GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  341
            T+  K    I++ G   GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV++P+R  E
Sbjct  41   TINRKTGKPIIKSGPYGGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIIPYR-DE  99

Query  342  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  521
            D  RHLK+MGDLGQ+VPM+++ R++  I+  +  ++VV NL GR YET+N++F +V+   
Sbjct  100  DEKRHLKVMGDLGQVVPMEWDLRNDEQIEECVRHSDVVYNLTGRHYETKNFTFNDVHATG  159

Query  522  AKQLASIAKEHGGILRFIQLSSLGASPTSPS  614
            A+++A IA E  G+ RFI +S L A   SPS
Sbjct  160  AQRIAQIA-EAAGVGRFIHVSHLNADANSPS  189



>ref|XP_010357461.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Rhinopithecus roxellana]
Length=377

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = +3

Query  207  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  386
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGDLGQ+
Sbjct  44   GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDIMHLRPMGDLGQL  103

Query  387  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGIL  566
            + ++++ RD++SI+  +  +NVVINLIGR++ET+N+ FE+V   + + +A ++KE  G+ 
Sbjct  104  LFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFEDVYVKIPQAIAQVSKE-AGVE  162

Query  567  RFIQLSSLGASPTSPSR  617
            +FI +S L A+  S SR
Sbjct  163  KFIHVSHLNANIKSSSR  179



>emb|CEF99374.1| NAD(P)-binding domain [Ostreococcus tauri]
Length=359

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 100/136 (74%), Gaps = 1/136 (1%)
 Frame = +3

Query  207  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  386
            GTGGRSS SGI  TVFG+TGFLGRY+   +AK GS++++P R  E+  +HLK+MGDLGQI
Sbjct  21   GTGGRSSFSGITCTVFGSTGFLGRYVTHHVAKSGSRMILPTRCGENDRQHLKVMGDLGQI  80

Query  387  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGIL  566
            + M Y   DE +I+  + ++NVVIN++GRE+ETRN+SFE+V+    K+LA I  +  G+ 
Sbjct  81   LQMDYAISDEGAIRHAVERSNVVINMVGREWETRNFSFEDVHVTFPKKLAEICAD-VGVR  139

Query  567  RFIQLSSLGASPTSPS  614
            R I +S+LGA+   PS
Sbjct  140  RLIHVSALGAADDHPS  155



>ref|XP_007089756.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Panthera tigris altaica]
Length=462

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSG+VATVFGATGFLGRY+V +L +MGSQV++P+R       HL+ MGD
Sbjct  125  LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNRLGRMGSQVIIPYRCEAYDTMHLRPMGD  184

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ +++N +D++SI+  +  +NVVINL+GRE+ET+N+ FE+V   + + +A ++KE 
Sbjct  185  LGQIIFLEWNGKDKDSIRRAVKHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  243

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A   S SR
Sbjct  244  AGVEKFIHVSHLNADIKSSSR  264



>ref|XP_007935381.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Orycteropus afer afer]
Length=377

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 102/137 (74%), Gaps = 1/137 (1%)
 Frame = +3

Query  207  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  386
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGDLGQI
Sbjct  44   GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDPYDTMHLRPMGDLGQI  103

Query  387  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGIL  566
            + +++N RD++SI+  +  +NVVINL+GRE+ET+N+ FE++   + + +A ++KE  G+ 
Sbjct  104  IFLEWNGRDKDSIRRAVEHSNVVINLVGREWETKNFDFEDIFVKIPQAIAQVSKE-AGVE  162

Query  567  RFIQLSSLGASPTSPSR  617
            + I +S L A+  S SR
Sbjct  163  KLIHVSHLNANIKSSSR  179



>gb|KIK69637.1| hypothetical protein GYMLUDRAFT_992204 [Gymnopus luxurians FD-317 
M1]
Length=369

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 105/154 (68%), Gaps = 2/154 (1%)
 Frame = +3

Query  159  YASTLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  338
            Y    T      IV +G  G S+VSG V TVFG TGFLGRYLV +LA+MG+QV+VP+R  
Sbjct  22   YHDLTTLPSKKPIVAQGPPGYSAVSGHVVTVFGCTGFLGRYLVSKLARMGTQVIVPYR-D  80

Query  339  EDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHY  518
            ED  RHLK MGDLGQIVPM+++ R+EN I   +  +++V NL+GR+Y T+++ F  V   
Sbjct  81   EDEKRHLKPMGDLGQIVPMEWDLRNENQIAECVRHSDIVFNLVGRDYATKSFDFASVQVD  140

Query  519  MAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
             A+++A IA +  G+ R + +S L AS TSPS++
Sbjct  141  GAERIAQIAAQ-SGVPRLVHVSHLNASATSPSKL  173



>ref|XP_001494651.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Equus caballus]
Length=377

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVMVPYRCDTYDTMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ +++N R+++SI+  +  +NVVINL+GRE+ET+N+ FE+V   +   +A ++KE 
Sbjct  100  LGQIIFLEWNGRNKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPLAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A   S SR
Sbjct  159  AGVEKFIHVSHLNADIKSSSR  179



>gb|ABF57357.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Bos taurus]
Length=369

 Score =   148 bits (374),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP R       HL+ MGD
Sbjct  29   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPHRCEPYDTMHLRPMGD  88

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ M +N RD++SI+  +  ++VVINL+GRE+ET+N+ FE+V   + + +A ++KE 
Sbjct  89   LGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETQNFDFEDVFVKIPQAIAQVSKE-  147

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A   S S+
Sbjct  148  AGVEKFIHISHLNADIKSSSK  168



>ref|XP_008528773.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Equus przewalskii]
Length=377

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDTYDTMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ +++N R+++SI+  +  +NVVINL+GRE+ET+N+ FE+V   +   +A ++KE 
Sbjct  100  LGQIIFLEWNGRNKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPLAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A   S SR
Sbjct  159  AGVEKFIHVSHLNADIKSSSR  179



>ref|XP_008141973.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Eptesicus fuscus]
Length=377

 Score =   148 bits (374),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G  GRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R     + HL+ MGD
Sbjct  40   LIPHGRSGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDYMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ +++N R+++SI+  +  +NVVINL+GR++ET+N+ FE+V   + + +A ++KE 
Sbjct  100  LGQIIFLEWNVRNKDSIRRAVEHSNVVINLVGRDWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             GI +FI +S L A   S SR
Sbjct  159  AGIEKFIHISHLNADIKSTSR  179



>ref|NP_991386.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial precursor [Bos taurus]
 sp|P34943.1|NDUA9_BOVIN RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Bos taurus]
 emb|CAA42053.1| NADH dehydrogenase (ubiquinone) 42 kDa subunit [Bos taurus]
 gb|AAI02360.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Bos taurus]
 tpg|DAA29189.1| TPA: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 
9, mitochondrial precursor [Bos taurus]
Length=380

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPHRCEPYDTMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ M +N RD++SI+  +  ++VVINL+GRE+ET+N+ FE+V   + + +A ++KE 
Sbjct  100  LGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETQNFDFEDVFVKIPQAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A   S S+
Sbjct  159  AGVEKFIHISHLNADIKSSSK  179



>gb|KDQ62587.1| hypothetical protein JAAARDRAFT_30488 [Jaapia argillacea MUCL 
33604]
Length=373

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 104/142 (73%), Gaps = 2/142 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            I+  G  GRS+++G VATVFG TGFLGRYLV +LAK G+QV+VP+R S+D  RHLK MGD
Sbjct  36   IISYGPPGRSALTGHVATVFGCTGFLGRYLVSKLAKAGTQVIVPYRESDDA-RHLKPMGD  94

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ+VPM+++ R+E+ I   +  +++V NL+GR+YET+NYSF +VN   A ++A +A + 
Sbjct  95   LGQVVPMEWDIRNEDQIAECLRHSDIVYNLVGRDYETKNYSFGDVNAAGAGRIAKVAAQ-  153

Query  555  GGILRFIQLSSLGASPTSPSRM  620
              I RF+ +S L AS  S S+ 
Sbjct  154  CNIPRFVHVSHLNASHESTSKF  175



>dbj|BAF83756.1| unnamed protein product [Homo sapiens]
Length=377

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 104/137 (76%), Gaps = 1/137 (1%)
 Frame = +3

Query  207  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  386
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGDLGQ+
Sbjct  44   GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQL  103

Query  387  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGIL  566
            + ++++ RD++SI+ V+  +NVVINLIGR++ET+N+ FE V   + + +A ++KE  G+ 
Sbjct  104  LFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEGVFVKIPQAIAQLSKE-AGVE  162

Query  567  RFIQLSSLGASPTSPSR  617
            +FI +S L A+  S SR
Sbjct  163  KFIHVSHLNANIKSSSR  179



>ref|XP_534915.3| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform 1 [Canis lupus familiaris]
Length=377

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 112/167 (67%), Gaps = 13/167 (8%)
 Frame = +3

Query  153  PRYASTLTAKGTGH------------IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  296
            P   S++TA+ T              ++  G GGRSSVSG+VATVFGATGFLGRY+V  L
Sbjct  14   PMSRSSITARATAMFHGPLRRQLHHALIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHL  73

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
             +MGSQV++P+R       HL+ MGDLGQI+ ++++ R+++SI+  +  +NVVINLIGRE
Sbjct  74   GRMGSQVIIPYRCDPYDTMHLRPMGDLGQIIFLEWDGRNKDSIQRAVKHSNVVINLIGRE  133

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSR  617
            +ET+N+ FE+V   + + +A ++KE  G+ +FI +S L A   S SR
Sbjct  134  WETKNFDFEDVFVKIPQAIAKVSKE-AGVEKFIHVSHLNADIKSSSR  179



>gb|EST09999.1| NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Pseudozyma 
brasiliensis GHG001]
Length=392

 Score =   148 bits (374),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 107/151 (71%), Gaps = 4/151 (3%)
 Frame = +3

Query  168  TLTAKGTGHIVRKGT--GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  341
            T+  K    I++ G   GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV+VP+R  E
Sbjct  41   TINRKTGKPIIKSGPYGGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIVPYR-DE  99

Query  342  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  521
            D  RHLK+MGDLGQ+VPM+++ R +  I+  +  ++VV NL GR YET+N++F +V+   
Sbjct  100  DEKRHLKVMGDLGQVVPMEWDLRHDEQIEECVRHSDVVYNLTGRHYETKNFTFNDVHVTG  159

Query  522  AKQLASIAKEHGGILRFIQLSSLGASPTSPS  614
            A+++A IA E  G+ RFI +S L A+  SPS
Sbjct  160  AQRIAQIA-EAAGVGRFIHVSHLNAAADSPS  189



>ref|XP_004459092.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Dasypus novemcinctus]
Length=384

 Score =   148 bits (373),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDLMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ +++N R+++SI+  +  +NVVINL+GR++ET+N+S+E+V   + + +A ++KE 
Sbjct  100  LGQIIFLEWNARNKDSIRRAVEHSNVVINLVGRDWETKNFSYEDVFVKIPQGIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             GI +FI +S L A   S SR
Sbjct  159  VGIEKFIHVSHLNADIKSSSR  179



>ref|XP_009989270.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial, partial [Tauraco erythrolophus]
Length=360

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 107/141 (76%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  +    +L+ MGD
Sbjct  23   VIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCDQYDLMYLRPMGD  82

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ+V ++++ +D++SI+  +  +NVVINL+G+E+ET+N+SFE+V   + K++A I +E 
Sbjct  83   LGQLVFLEWDCKDKDSIRRAVEHSNVVINLVGKEWETKNFSFEDVFVNIPKRIAQITRE-  141

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+  FI +S L AS  SPS+
Sbjct  142  AGVETFIHISHLNASMKSPSK  162



>gb|KFV03415.1| hypothetical protein N340_03010, partial [Tauraco erythrolophus]
Length=361

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 107/141 (76%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  +    +L+ MGD
Sbjct  24   VIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCDQYDLMYLRPMGD  83

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ+V ++++ +D++SI+  +  +NVVINL+G+E+ET+N+SFE+V   + K++A I +E 
Sbjct  84   LGQLVFLEWDCKDKDSIRRAVEHSNVVINLVGKEWETKNFSFEDVFVNIPKRIAQITRE-  142

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+  FI +S L AS  SPS+
Sbjct  143  AGVETFIHISHLNASMKSPSK  163



>dbj|GAC73597.1| NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Pseudozyma 
antarctica T-34]
Length=385

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 106/151 (70%), Gaps = 4/151 (3%)
 Frame = +3

Query  168  TLTAKGTGHIVRKG--TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  341
            T+  K    I++ G   GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV++P+R  E
Sbjct  34   TINRKTGKPIIKSGPYAGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIIPYR-DE  92

Query  342  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  521
            D  RHLK+MGDLGQIVPM+++ R++  I+  +  ++VV NL GR YET+N+SF +V+   
Sbjct  93   DEKRHLKVMGDLGQIVPMEWDLRNDEQIEECVRHSDVVYNLTGRHYETKNFSFNDVHVAG  152

Query  522  AKQLASIAKEHGGILRFIQLSSLGASPTSPS  614
            A+++A IA E  G+ R I +S L A   SPS
Sbjct  153  AQRIAQIA-ESAGVGRLIHVSHLNADADSPS  182



>ref|XP_003059930.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55882.1| predicted protein [Micromonas pusilla CCMP1545]
Length=353

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 106/139 (76%), Gaps = 2/139 (1%)
 Frame = +3

Query  204  KGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQ  383
            +GTGGRSS+SGI +TVFGATG+LGRY+V  L K GS++++P R  ++  +HLK+MGDLGQ
Sbjct  13   RGTGGRSSISGITSTVFGATGYLGRYVVNHLGKSGSRMILPTRCGDNAKQHLKVMGDLGQ  72

Query  384  IVPMK-YNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGG  560
            IV +     RD+++IK  + ++NVV+NL+GRE+ETRN+SF++V+    ++LA I KE  G
Sbjct  73   IVDLAGLKIRDDSAIKYAVERSNVVVNLLGREWETRNFSFDDVHRDFPERLARICKEL-G  131

Query  561  ILRFIQLSSLGASPTSPSR  617
            + R + +S+LGA+   PS+
Sbjct  132  VERLVHVSALGATLDHPSK  150



>gb|ETS63618.1| hypothetical protein PaG_01917 [Pseudozyma aphidis DSM 70725]
Length=385

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 106/151 (70%), Gaps = 4/151 (3%)
 Frame = +3

Query  168  TLTAKGTGHIVRKG--TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  341
            T+  K    I++ G   GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV++P+R  E
Sbjct  34   TINRKTGKPIIKSGPYAGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIIPYR-DE  92

Query  342  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  521
            D  RHLK+MGDLGQIVPM+++ R++  I+  +  ++VV NL GR YET+N+SF +V+   
Sbjct  93   DEKRHLKVMGDLGQIVPMEWDLRNDEQIEECVRHSDVVYNLTGRHYETKNFSFNDVHVAG  152

Query  522  AKQLASIAKEHGGILRFIQLSSLGASPTSPS  614
            A+++A IA E  G+ R I +S L A   SPS
Sbjct  153  AQRIAQIA-ESAGVGRLIHVSHLNADADSPS  182



>dbj|GAK62286.1| NAD(P)-binding protein [Pseudozyma antarctica]
Length=386

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 106/151 (70%), Gaps = 4/151 (3%)
 Frame = +3

Query  168  TLTAKGTGHIVRKG--TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  341
            T+  K    I++ G   GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV++P+R  E
Sbjct  35   TINRKTGKPIIKSGPYAGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIIPYR-DE  93

Query  342  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  521
            D  RHLK+MGDLGQIVPM+++ R++  I+  +  ++VV NL GR YET+N+SF +V+   
Sbjct  94   DEKRHLKVMGDLGQIVPMEWDLRNDEQIEECVRHSDVVYNLTGRHYETKNFSFNDVHVAG  153

Query  522  AKQLASIAKEHGGILRFIQLSSLGASPTSPS  614
            A+++A IA E  G+ R I +S L A   SPS
Sbjct  154  AQRIAQIA-ESAGVGRLIHVSHLNADADSPS  183



>emb|CDI51333.1| probable NADH2 dehydrogenase (ubiquinone) 40K chain [Melanopsichium 
pennsylvanicum 4]
Length=388

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 106/151 (70%), Gaps = 4/151 (3%)
 Frame = +3

Query  168  TLTAKGTGHIVRKGT--GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  341
            T+  K    I++ G   GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV+VP+R  E
Sbjct  37   TINRKTGKPIIKSGPYGGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIVPYR-DE  95

Query  342  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  521
            D  RHLK+MGDLGQ+VPM+++ R +  I+  +  ++VV NL GR YET+N++F +V+   
Sbjct  96   DEKRHLKVMGDLGQVVPMEWDLRHDEQIEECVRHSDVVYNLTGRHYETKNFTFNDVHVTG  155

Query  522  AKQLASIAKEHGGILRFIQLSSLGASPTSPS  614
            A+++A IA E  G+ RFI +S L A   SPS
Sbjct  156  AQRIAQIA-EAAGVGRFIHVSHLNADADSPS  185



>dbj|GAC95510.1| hypothetical protein PHSY_003086 [Pseudozyma hubeiensis SY62]
Length=392

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 106/151 (70%), Gaps = 4/151 (3%)
 Frame = +3

Query  168  TLTAKGTGHIVRKGT--GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  341
            T+  K    I++ G   GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV++P+R  E
Sbjct  41   TINRKTGKPIIKSGPYGGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIIPYR-DE  99

Query  342  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  521
            D  RHLK+MGDLGQ+VPM+++ R +  I+  +  ++VV NL GR YET+N++F +V+   
Sbjct  100  DEKRHLKVMGDLGQVVPMEWDLRHDEQIEECLRHSDVVYNLTGRHYETKNFTFNDVHVAG  159

Query  522  AKQLASIAKEHGGILRFIQLSSLGASPTSPS  614
            A+++A IA E  G+ RFI +S L A   SPS
Sbjct  160  AQRIAQIA-EAAGVGRFIHVSHLNADAESPS  189



>ref|XP_009178281.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Papio anubis]
Length=375

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L ++GSQV++P+R       HL+ MGD
Sbjct  38   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRIGSQVIIPYRCDIYDTMHLRPMGD  97

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ++ ++++ RD++SI+  +  +NVVINLIGR++ET+N+ FE+V   + + +A ++KE 
Sbjct  98   LGQLLFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFEDVYVKIPQAIAQVSKE-  156

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A+  S SR
Sbjct  157  AGVEKFIHVSHLNANIKSSSR  177



>ref|XP_004778323.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Mustela putorius furo]
 ref|XP_004823819.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Mustela putorius furo]
Length=377

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDPYDTMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ ++++ R+ +SI   +  +NVVINL+GRE+ET+N+ FE+V   + + +A ++KE 
Sbjct  100  LGQIIFLEWDGRNRDSIHRAVKHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A   S SR
Sbjct  159  AGVEKFIHVSHLNADIKSSSR  179



>ref|XP_009178280.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Papio anubis]
Length=377

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L ++GSQV++P+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRIGSQVIIPYRCDIYDTMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ++ ++++ RD++SI+  +  +NVVINLIGR++ET+N+ FE+V   + + +A ++KE 
Sbjct  100  LGQLLFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFEDVYVKIPQAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A+  S SR
Sbjct  159  AGVEKFIHVSHLNANIKSSSR  179



>ref|XP_007503809.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Monodelphis domestica]
Length=345

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       +L+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDFTYLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ +++N +D++SI+  +  +NVVINL+GR++ETRN+ F +V   + + +A +AKE 
Sbjct  100  LGQIIFLEWNSKDKSSIQRALEHSNVVINLVGRDWETRNFDFTDVFADIPESIAQLAKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+  FI +S L A   S S+
Sbjct  159  AGVETFIHVSHLNADIKSTSK  179



>dbj|BAB22596.1| unnamed protein product [Mus musculus]
Length=377

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 105/151 (70%), Gaps = 7/151 (5%)
 Frame = +3

Query  162  ASTLTAKGTGH------IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  323
            A+T    G+ H      ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++
Sbjct  23   AATSVFCGSSHRQLHHAVIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVII  82

Query  324  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFE  503
            P+R       HL+LMGD GQ+  ++++ RD++SI+  +  +NVVINLIGRE+ETRN+ FE
Sbjct  83   PYRCDVYDIMHLRLMGDPGQLTFLEWDARDKDSIRKAVQHSNVVINLIGREWETRNFDFE  142

Query  504  EVNHYMAKQLASIAKEHGGILRFIQLSSLGA  596
            +V   + + +A  +KE  G+ RFI +S L A
Sbjct  143  DVFVNIPRAIAQASKE-AGVERFIHVSHLNA  172



>ref|XP_003410681.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Loxodonta africana]
Length=380

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 105/143 (73%), Gaps = 2/143 (1%)
 Frame = +3

Query  192  HIVR-KGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLM  368
            H++R  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       +L+ M
Sbjct  41   HVLRPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDLMYLRPM  100

Query  369  GDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAK  548
            GDLGQI+ +++N RD++SI+  +  +NVVINL+G+++ETRN+ FE+V   + + +A ++K
Sbjct  101  GDLGQIIFLEWNGRDKDSIRRAVEHSNVVINLVGQDWETRNFDFEDVFVKIPQAIAQVSK  160

Query  549  EHGGILRFIQLSSLGASPTSPSR  617
            E  G+ R I +S L A   S SR
Sbjct  161  E-AGVERLIHVSHLNADIKSSSR  182



>ref|XP_006754928.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Myotis davidii]
Length=377

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G  GRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R     + HL+ MGD
Sbjct  40   LIPHGRSGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDYMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ +++N R+++SI+  +  +NVVINL+GRE+ET+N+ FE+V   + + +A ++KE 
Sbjct  100  LGQIIFLEWNARNKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ + I +S L A   S SR
Sbjct  159  AGVEKLIHISHLNADIKSTSR  179



>ref|XP_004692611.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Condylura cristata]
Length=569

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   VMPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCEPYDVMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ ++++ R+++SI+  +  +NVVINL+GRE+ETRN+ FE+V   + + +A ++KE 
Sbjct  100  LGQIIFLEWDARNKDSIRRAVEHSNVVINLVGREWETRNFDFEDVYVKIPQAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             GI +FI +S L A   S SR
Sbjct  159  AGIEKFIHVSHLNADIKSSSR  179



>ref|XP_011386267.1| putative NADH2 dehydrogenase (ubiquinone) 40K chain [Ustilago 
maydis 521]
 gb|KIS71955.1| putative NADH2 dehydrogenase (ubiquinone) 40K chain [Ustilago 
maydis 521]
Length=392

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 106/151 (70%), Gaps = 4/151 (3%)
 Frame = +3

Query  168  TLTAKGTGHIVRKGT--GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  341
            T+  K    I++ G   GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV+VP+R  E
Sbjct  41   TINRKTGKPIIKSGPYGGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIVPYR-DE  99

Query  342  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  521
            D  RHLK+MGDLGQ+VPM+++ R +  I+  +  ++VV NL GR YET+N++F +V+   
Sbjct  100  DEKRHLKVMGDLGQVVPMEWDLRHDEQIEECVRHSDVVYNLTGRHYETKNFTFNDVHVTG  159

Query  522  AKQLASIAKEHGGILRFIQLSSLGASPTSPS  614
            A+++A IA E  G+ RFI +S L A   SPS
Sbjct  160  AQRIAQIA-EASGVGRFIHVSHLNADANSPS  189



>ref|XP_006862735.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Chrysochloris asiatica]
Length=377

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 102/137 (74%), Gaps = 1/137 (1%)
 Frame = +3

Query  207  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  386
            G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGDLGQI
Sbjct  44   GKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDTYDLMHLRPMGDLGQI  103

Query  387  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGIL  566
            + +++N RD++SI+  +  +NVVINL+GRE+ET+N+ +E+V   + + +A ++KE  G+ 
Sbjct  104  IFLEWNGRDKDSIRRAVEHSNVVINLVGREWETKNFDYEDVFVKIPQAIAQVSKE-AGVE  162

Query  567  RFIQLSSLGASPTSPSR  617
            + I +S L A+  S SR
Sbjct  163  KLIHVSHLNANMKSSSR  179



>gb|KIM65954.1| hypothetical protein SCLCIDRAFT_1211966 [Scleroderma citrinum 
Foug A]
Length=356

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 106/149 (71%), Gaps = 2/149 (1%)
 Frame = +3

Query  174  TAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHR  353
            T  G   ++  G  G S+VSG VATVFG TGFLGRYLV +LA+MG+QV+VP+R  ED  R
Sbjct  24   TLPGRKPVISHGPPGYSAVSGHVATVFGCTGFLGRYLVSKLARMGTQVIVPYR-EEDEKR  82

Query  354  HLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQL  533
            HLK MGDLGQIV M+++ R+E+ I   +  +++V NL+GR+YET+N+ F +V+   A+++
Sbjct  83   HLKPMGDLGQIVSMEWDIRNEDQIAECLRHSDIVYNLVGRDYETKNFKFADVHVAGAERI  142

Query  534  ASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            A +A +  G+ R + +S L AS TSPS+ 
Sbjct  143  AKVAAQ-VGVQRMVHVSHLNASATSPSQF  170



>ref|XP_007527887.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Erinaceus europaeus]
Length=377

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   VMPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDLMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ +++N R+++SI+  +  +NVVINLIG+++ETRN+ FE++   +   +A ++KE 
Sbjct  100  LGQIIFLEWNGRNKDSIRRTVEHSNVVINLIGKDWETRNFDFEDIYVKIPHAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ + I +S L A   SPS+
Sbjct  159  AGVKKLIHISHLNADLKSPSK  179



>ref|XP_004347048.1| Ndufa9 protein [Capsaspora owczarzaki ATCC 30864]
 gb|KJE94781.1| Ndufa9 protein [Capsaspora owczarzaki ATCC 30864]
Length=324

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 106/149 (71%), Gaps = 1/149 (1%)
 Frame = +3

Query  168  TLTAKGTGHIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDC  347
            TL     G + R GTGGRSSVSG+VATVFG+TGF+GRYLV +L ++GSQ+++P+RG E  
Sbjct  56   TLAKWSGGPVSRAGTGGRSSVSGVVATVFGSTGFIGRYLVNRLGRVGSQLILPYRGDEHA  115

Query  348  HRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAK  527
            +RHLK MGDLGQ     Y+ RD++++K ++  +NVV NL+G+E+ TRN+S  +V+   A+
Sbjct  116  YRHLKPMGDLGQFSFPFYHLRDKDTVKRLVEHSNVVFNLVGQEFATRNFSLHDVHVTGAE  175

Query  528  QLASIAKEHGGILRFIQLSSLGASPTSPS  614
             +A   +E  G+ R I +S+L AS  S S
Sbjct  176  TIARACQE-AGVGRLIHVSALNASTESRS  203



>ref|XP_007882091.1| hypothetical protein PFL1_06359 [Pseudozyma flocculosa PF-1]
 gb|EPQ26151.1| hypothetical protein PFL1_06359 [Pseudozyma flocculosa PF-1]
Length=390

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 108/151 (72%), Gaps = 4/151 (3%)
 Frame = +3

Query  168  TLTAKGTGHIVRKGT--GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  341
            T+  K    I+R+G   GGRSSVSG VATVFG TGFLGRYLV +L++ G+QV+VP+R  E
Sbjct  39   TIKRKTGKPIIRQGPYGGGRSSVSGHVATVFGCTGFLGRYLVNRLSQKGTQVIVPYR-DE  97

Query  342  DCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYM  521
            D  RHLK+MGDLGQ+VP++++ R++  I+  +  ++ V NL GR+YET+N+SF +V+   
Sbjct  98   DEKRHLKVMGDLGQVVPLEWDIRNDQQIQECIRHSDTVYNLTGRQYETKNFSFSDVHVTG  157

Query  522  AKQLASIAKEHGGILRFIQLSSLGASPTSPS  614
            A+++A +A E  G  RFI +S L A   SPS
Sbjct  158  ARRIAEMA-EALGASRFIHVSHLNADKDSPS  187



>ref|XP_008703115.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Ursus maritimus]
Length=410

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQ++VP+R       HL+ MGD
Sbjct  73   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQMIVPYRCDPYDTMHLRPMGD  132

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ ++++ R+++SI+  +  +NVVINL+GRE+ET+N+ FE++   + + +A ++KE 
Sbjct  133  LGQIIFLEWDGRNKDSIRRAVKHSNVVINLVGREWETKNFDFEDIFVKIPQAIAQVSKE-  191

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A   S SR
Sbjct  192  AGVEKFIHVSHLNADIKSSSR  212



>ref|XP_008823675.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nannospalax galili]
Length=377

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 101/141 (72%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDTMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ ++++ RD  SI+  +  +NVVINL+GRE+ETRN+ FE V   + + +A ++KE 
Sbjct  100  LGQIIFLEWDARDRASIRRAVEYSNVVINLVGREWETRNFDFENVFVKIPQAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ R I +S L A+  S S+
Sbjct  159  AGVERLIHVSHLNANIRSSSK  179



>ref|XP_007965492.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Chlorocebus sabaeus]
Length=377

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       +L+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDIYDTMYLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ++ ++++ RD++SI+  +  +NVVINLIGR++ET+N+ FE+V   + + +A ++KE 
Sbjct  100  LGQLLFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFEDVYVKIPQAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A+  S SR
Sbjct  159  AGVEKFIHVSHLNANIKSSSR  179



>ref|XP_006739694.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Leptonychotes weddellii]
Length=377

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 111/167 (66%), Gaps = 13/167 (8%)
 Frame = +3

Query  153  PRYASTLTAKGTG------------HIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQL  296
            P   S++TA+ T              ++  G GGRSSVSGIVATVFGATGFLGRY+V  L
Sbjct  14   PMSRSSITARATAVFHGPPQRQLHHALIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHL  73

Query  297  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGRE  476
             +MGSQV+VP+R       HL+ MGDLGQI+ ++++ R+++SI+  +  +NVVINL+GRE
Sbjct  74   GRMGSQVIVPYRCDPYDTMHLRPMGDLGQIIFLEWDGRNKDSIRRAVKHSNVVINLVGRE  133

Query  477  YETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSR  617
            +ET+N+ FE++   + + +A ++KE  G+ + I +S L A   S SR
Sbjct  134  WETKNFDFEDIFVKIPRAIAQVSKE-AGVEKLIHVSHLNADIKSSSR  179



>gb|KDE07008.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 [Microbotryum 
violaceum p1A1 Lamole]
Length=378

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 103/139 (74%), Gaps = 2/139 (1%)
 Frame = +3

Query  204  KGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQ  383
            KG GGR S +G VATVFGATGFLGRYLV +LAK G+QV+VP+R  +D  RHLK+ GDLGQ
Sbjct  44   KGPGGRHSSTGHVATVFGATGFLGRYLVSKLAKAGTQVVVPYR-DQDEARHLKVCGDLGQ  102

Query  384  IVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGI  563
            +VPM+++ +++  I+  +  ++ V NL+GR+Y T+N+SF++V+   A++LA IA    G+
Sbjct  103  VVPMEWDLKNDTQIEECLRHSDTVYNLVGRDYTTKNFSFDDVHVSGARRLARIA-HISGV  161

Query  564  LRFIQLSSLGASPTSPSRM  620
             RFI LS L A+P S S+ 
Sbjct  162  SRFIHLSHLNAAPDSASQF  180



>ref|XP_008703114.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Ursus maritimus]
Length=434

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQ++VP+R       HL+ MGD
Sbjct  97   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQMIVPYRCDPYDTMHLRPMGD  156

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ ++++ R+++SI+  +  +NVVINL+GRE+ET+N+ FE++   + + +A ++KE 
Sbjct  157  LGQIIFLEWDGRNKDSIRRAVKHSNVVINLVGREWETKNFDFEDIFVKIPQAIAQVSKE-  215

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A   S SR
Sbjct  216  AGVEKFIHVSHLNADIKSSSR  236



>ref|XP_004610502.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Sorex araneus]
Length=378

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            +V  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  41   VVPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDLMHLRPMGD  100

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ +++N RD++SI+  + ++NVVINL+GRE+ETRN+ FE+V   + + +A   KE 
Sbjct  101  LGQIIFLEWNGRDKDSIRRAVEQSNVVINLVGREWETRNFGFEDVYVKIPQTIAQTCKE-  159

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ + I +S L A   S S+
Sbjct  160  VGVEKLIHVSHLNADIKSSSK  180



>gb|ELR54825.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial, partial [Bos mutus]
Length=363

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 101/141 (72%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP R       HL+ MGD
Sbjct  23   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPHRCEPYDTMHLRPMGD  82

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ M +N RD++SI+  +  ++VVINL+GRE+ET+N+ FE+V   + + +A ++KE 
Sbjct  83   LGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETQNFDFEDVFVKIPQAIAQVSKE-  141

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ + I +S L A   S S+
Sbjct  142  AGVEKLIHISHLNADIKSSSK  162



>ref|XP_001372251.2| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Monodelphis domestica]
Length=377

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       +L+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDFTYLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ +++N +D++SI+  +  +NVVINL+GR++ETRN+ F +V   + + +A +AKE 
Sbjct  100  LGQIIFLEWNSKDKSSIQRALEHSNVVINLVGRDWETRNFDFTDVFADIPESIAQLAKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+  FI +S L A   S S+
Sbjct  159  AGVETFIHVSHLNADIKSTSK  179



>ref|XP_005569923.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Macaca fascicularis]
Length=304

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L ++GSQV++P R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRIGSQVIIPHRCDIYDTMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ++ ++++ RD++SI+  +  +NVVINLIGR++ET+N+ F++V   + + +A ++KE 
Sbjct  100  LGQLLFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFDDVYVKIPQAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A+  S SR
Sbjct  159  AGVEKFIHVSHLNANIKSSSR  179



>gb|KFP08708.1| hypothetical protein N300_02598, partial [Calypte anna]
Length=362

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 107/141 (76%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            +V +G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  +    +L+ MGD
Sbjct  25   VVPRGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCDQYDLMYLRPMGD  84

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ++ ++++ +D++SI+  +  +NVVINL+G+E+ET+N+SFE+    + K +A IA+E 
Sbjct  85   LGQLLFLEWDCKDKDSIRRALEHSNVVINLVGKEWETKNFSFEDEFVNIPKSIAQIARE-  143

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+  F+ +S L AS  SPS+
Sbjct  144  AGVKTFVHISHLNASMKSPSK  164



>gb|ESA03096.1| hypothetical protein GLOINDRAFT_336975 [Rhizophagus irregularis 
DAOM 181602]
Length=384

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 119/171 (70%), Gaps = 10/171 (6%)
 Frame = +3

Query  132  QCYGIGT------PRYASTLTA-KGTGH-IVRKGTGGRSSVSGIVATVFGATGFLGRYLV  287
            Q +GI T       R+A  L   K TG  I++ G GGRSSVSG +ATVFG+TGFLGRYLV
Sbjct  14   QNFGIITFKQFKQKRFAHDLVVRKTTGKPIIKYGPGGRSSVSGHIATVFGSTGFLGRYLV  73

Query  288  QQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLI  467
             +LAK G+QV++P+R  ED  RHLK+ GDLGQ+V ++++ R+E +I   +  +++V NLI
Sbjct  74   SKLAKHGTQVVLPYR-DEDAKRHLKVTGDLGQVVFLEFDLRNEQNIIEAVRHSDIVYNLI  132

Query  468  GREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            GR+YET+N+++E+V+   A+++A + K+   + R + +S+L A   SPSR 
Sbjct  133  GRDYETKNFTYEKVHIEGAERIAKLCKKF-DVSRLVHVSALNADINSPSRF  182



>gb|EXX58721.1| hypothetical protein RirG_195270 [Rhizophagus irregularis DAOM 
197198w]
Length=386

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 119/171 (70%), Gaps = 10/171 (6%)
 Frame = +3

Query  132  QCYGIGT------PRYASTLTA-KGTGH-IVRKGTGGRSSVSGIVATVFGATGFLGRYLV  287
            Q +GI T       R+A  L   K TG  I++ G GGRSSVSG +ATVFG+TGFLGRYLV
Sbjct  16   QNFGIITFKQFKQKRFAHDLVVRKTTGKPIIKYGPGGRSSVSGHIATVFGSTGFLGRYLV  75

Query  288  QQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLI  467
             +LAK G+QV++P+R  ED  RHLK+ GDLGQ+V ++++ R+E +I   +  +++V NLI
Sbjct  76   SKLAKHGTQVVLPYR-DEDAKRHLKVTGDLGQVVFLEFDLRNEQNIIEAVRHSDIVYNLI  134

Query  468  GREYETRNYSFEEVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSRM  620
            GR+YET+N+++E+V+   A+++A + K+   + R + +S+L A   SPSR 
Sbjct  135  GRDYETKNFTYEKVHIEGAERIAKLCKKF-DVSRLVHVSALNADINSPSRF  184



>ref|XP_005897993.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Bos mutus]
Length=380

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 101/141 (72%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPHRCEPYDTMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ M +N RD++SI+  +  ++VVINL+GRE+ET+N+ FE+V   + + +A ++KE 
Sbjct  100  LGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETQNFDFEDVFVKIPQAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ + I +S L A   S S+
Sbjct  159  AGVEKLIHISHLNADIKSSSK  179



>ref|XP_008502666.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Calypte anna]
Length=380

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 107/141 (76%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            +V +G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  +    +L+ MGD
Sbjct  43   VVPRGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCDQYDLMYLRPMGD  102

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ++ ++++ +D++SI+  +  +NVVINL+G+E+ET+N+SFE+    + K +A IA+E 
Sbjct  103  LGQLLFLEWDCKDKDSIRRALEHSNVVINLVGKEWETKNFSFEDEFVNIPKSIAQIARE-  161

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+  F+ +S L AS  SPS+
Sbjct  162  AGVKTFVHISHLNASMKSPSK  182



>ref|XP_005533361.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Pseudopodoces humilis]
Length=376

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  +    +L+ MGD
Sbjct  40   VIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCDQYDLMYLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ++ M+++ RD++SI+  +  +NVVINLIG+E+ET+N+ FE+    + + +A I+KE 
Sbjct  100  LGQLLFMEWDCRDKDSIRRAVEHSNVVINLIGKEWETKNFKFEDEFVNIPQNIAHISKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L AS  SPS+
Sbjct  159  AGVEKFIHISHLNASMKSPSK  179



>ref|XP_005877078.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Myotis brandtii]
 ref|XP_006096122.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Myotis lucifugus]
 gb|EPQ14420.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Myotis brandtii]
Length=377

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G  GRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R     + HL+ MGD
Sbjct  40   LIPHGRSGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDYMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ +++N R+++SI+  +  +NVVINL+GR++ET+N+ FE+V   + + +A ++KE 
Sbjct  100  LGQIIFLEWNARNKDSIRRAVEHSNVVINLVGRDWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ + I +S L A   S SR
Sbjct  159  AGVEKLIHISHLNADIKSTSR  179



>gb|KFV11223.1| hypothetical protein N339_08758, partial [Pterocles gutturalis]
Length=251

 Score =   143 bits (360),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  +    +L+ MGD
Sbjct  24   VIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCDQYDLMYLRPMGD  83

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ++ ++++ +D++SI+  +  +NVVINL+G+E+ET+N+SFE+V   + K +A I +E 
Sbjct  84   LGQLLFLEWDCKDKDSIRRAVEHSNVVINLVGKEWETKNFSFEDVFVNIPKSIAQITRE-  142

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+   I +S L AS  SPS+
Sbjct  143  AGVETLIHISHLNASMKSPSK  163



>gb|KFV92623.1| hypothetical protein N326_00630, partial [Eurypyga helias]
Length=226

 Score =   142 bits (358),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G   RSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  +    +L+ MGD
Sbjct  24   VIPHGKSRRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCDQYDLMYLRPMGD  83

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ++ ++++ +D++SI+  +  +NVVINL+G+E+ET+N+SFE+V   + K +A I +E 
Sbjct  84   LGQLLFLEWDCKDKDSIRRAVEHSNVVINLVGKEWETKNFSFEDVFVNIPKSIAQITRE-  142

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+  FI +S L AS  SPS+
Sbjct  143  AGVETFIHVSHLNASMKSPSK  163



>ref|XP_010148325.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial, partial [Eurypyga helias]
Length=224

 Score =   142 bits (358),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G   RSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  +    +L+ MGD
Sbjct  23   VIPHGKSRRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCDQYDLMYLRPMGD  82

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ++ ++++ +D++SI+  +  +NVVINL+G+E+ET+N+SFE+V   + K +A I +E 
Sbjct  83   LGQLLFLEWDCKDKDSIRRAVEHSNVVINLVGKEWETKNFSFEDVFVNIPKSIAQITRE-  141

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+  FI +S L AS  SPS+
Sbjct  142  AGVETFIHVSHLNASMKSPSK  162



>gb|ENN72465.1| hypothetical protein YQE_10807, partial [Dendroctonus ponderosae]
Length=399

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 103/135 (76%), Gaps = 1/135 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            + ++G+GGRSS +GIVATVFG+TGF+ RY+  +L K+G+Q+++P+RG       LK++GD
Sbjct  41   LYKRGSGGRSSFNGIVATVFGSTGFISRYVCNKLGKIGTQLILPYRGDNYDPMRLKVVGD  100

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ+    YN +DE+SI+ V+  +NVVINL+GR++ETRN++F +V+   A++LA IAKE 
Sbjct  101  LGQVYFHPYNLKDEDSIRKVVQYSNVVINLVGRDWETRNFNFNQVHVEGARRLARIAKE-  159

Query  555  GGILRFIQLSSLGAS  599
             G+ RFI  SSL AS
Sbjct  160  AGVERFIHFSSLNAS  174



>gb|ERL95049.1| hypothetical protein D910_12319 [Dendroctonus ponderosae]
Length=399

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 103/135 (76%), Gaps = 1/135 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            + ++G+GGRSS +GIVATVFG+TGF+ RY+  +L K+G+Q+++P+RG       LK++GD
Sbjct  41   LYKRGSGGRSSFNGIVATVFGSTGFISRYVCNKLGKIGTQLILPYRGDNYDPMRLKVVGD  100

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ+    YN +DE+SI+ V+  +NVVINL+GR++ETRN++F +V+   A++LA IAKE 
Sbjct  101  LGQVYFHPYNLKDEDSIRKVVQYSNVVINLVGRDWETRNFNFNQVHVEGARRLARIAKE-  159

Query  555  GGILRFIQLSSLGAS  599
             G+ RFI  SSL AS
Sbjct  160  AGVERFIHFSSLNAS  174



>gb|AEE61636.1| unknown [Dendroctonus ponderosae]
Length=399

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 103/135 (76%), Gaps = 1/135 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            + ++G+GGRSS +GIVATVFG+TGF+ RY+  +L K+G+Q+++P+RG       LK++GD
Sbjct  41   LYKRGSGGRSSFNGIVATVFGSTGFISRYVCNKLGKIGTQLILPYRGDNYDPMRLKVVGD  100

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ+    YN +DE+SI+ V+  +NVVINL+GR++ETRN++F +V+   A++LA IAKE 
Sbjct  101  LGQVYFHPYNLKDEDSIRKVVQYSNVVINLVGRDWETRNFNFNQVHVEGARRLARIAKE-  159

Query  555  GGILRFIQLSSLGAS  599
             G+ RFI  SSL AS
Sbjct  160  AGVERFIHFSSLNAS  174



>ref|XP_005537134.1| NADH dehydrogenase I alpha subcomplex 9, mitochondrial precursor 
[Cyanidioschyzon merolae strain 10D]
 dbj|BAM81098.1| NADH dehydrogenase I alpha subcomplex 9, mitochondrial precursor 
[Cyanidioschyzon merolae strain 10D]
Length=392

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 100/135 (74%), Gaps = 9/135 (7%)
 Frame = +3

Query  204  KGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQ  383
            +GTGGRSSVSGI+ATVFG+TGFLGRY+V QL ++GS V V +RG E  +RHLK+MGDLGQ
Sbjct  46   EGTGGRSSVSGIIATVFGSTGFLGRYVVSQLGRIGSTVFVAWRGDELDNRHLKVMGDLGQ  105

Query  384  IVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAK----E  551
            I P++   RD NS++  +A +NVVINLIG+ Y+TR YS E+VN  +A+ +A +A     E
Sbjct  106  INPIQIEARDINSLRRSIAGSNVVINLIGKWYDTRYYSLEDVNIGVAETIARLASLEQVE  165

Query  552  HGGILRFIQLSSLGA  596
            H     FI +S+L A
Sbjct  166  H-----FIHVSALPA  175



>gb|ERE67037.1| putative polypeptide N-acetylgalactosaminyltransferase 8-like 
protein [Cricetulus griseus]
Length=958

 Score =   150 bits (379),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 109/158 (69%), Gaps = 7/158 (4%)
 Frame = +3

Query  162  ASTLTAKGTGH------IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  323
            A+T   +G  H      ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++
Sbjct  23   AATSVFRGPSHRQLHHAVIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVII  82

Query  324  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFE  503
            P+R       HL+ MGDLGQ++ ++++ RD++SI+  +  +NVVINLIGR++ETRN+ FE
Sbjct  83   PYRCDTYDTMHLRPMGDLGQLIFLEWDARDKDSIRRAVQHSNVVINLIGRDWETRNFDFE  142

Query  504  EVNHYMAKQLASIAKEHGGILRFIQLSSLGASPTSPSR  617
            ++   + + +A  +KE  G+ R I +S L AS  S SR
Sbjct  143  DIFVKIPQAIAQASKE-AGVERLIHVSHLNASMKSSSR  179



>ref|XP_004992628.1| hypothetical protein PTSG_07208 [Salpingoeca rosetta]
 gb|EGD74983.1| hypothetical protein PTSG_07208 [Salpingoeca rosetta]
Length=341

 Score =   145 bits (365),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 102/138 (74%), Gaps = 1/138 (1%)
 Frame = +3

Query  207  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  386
            G GGR SVSG+VATVFGATGF+GRY+V +L K+GSQV+VPFRG E  +RHL++ GDLGQI
Sbjct  15   GKGGRCSVSGVVATVFGATGFMGRYVVNRLGKVGSQVVVPFRGDEHDYRHLRVAGDLGQI  74

Query  387  VPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHGGIL  566
              + +   D+++++  +  +NVVINLIG++ ++R++S E+V+   A  +A  AKE  G+ 
Sbjct  75   HFLPFQLLDKDTVRRAVEHSNVVINLIGQDTDSRHFSLEDVHVTGALNIAEAAKE-AGVE  133

Query  567  RFIQLSSLGASPTSPSRM  620
            R I +S+LGA  TS SR 
Sbjct  134  RLIHMSALGADKTSNSRF  151



>ref|XP_006923900.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Pteropus alecto]
 gb|ELK02573.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Pteropus alecto]
Length=377

 Score =   145 bits (367),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQ+++P R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQIIIPHRCERYDIMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ +++N R+++SI+  +  +NVVINL+GR++ET+NY FE+V   + + +A ++KE 
Sbjct  100  LGQIIFLEWNGRNKDSIRRAVEHSNVVINLVGRDWETKNYDFEDVFVKIPQAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ + I +S L A   S SR
Sbjct  159  AGVEKLIHVSHLNADIKSSSR  179



>ref|XP_004568347.1| PREDICTED: probable polypeptide N-acetylgalactosaminyltransferase 
8-like [Maylandia zebra]
Length=804

 Score =   149 bits (377),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++ KG GGRSS  GI ATVFGATGFLGRY+V +L ++GSQ+++P R  +    H + MGD
Sbjct  44   LIPKGKGGRSSFRGIAATVFGATGFLGRYVVNRLGRIGSQIIIPHRCDQYDLMHFRPMGD  103

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ ++++ R+++SIK  M  +NVVINL+GRE+ETRN+ FE+V   + +Q+A  A+E 
Sbjct  104  LGQILFLEWDARNKDSIKQAMEHSNVVINLVGREWETRNFRFEDVYVTIPQQIARAARE-  162

Query  555  GGILRFIQLSSLGASPTSPSR  617
             GI +F+ +S L A   SPS+
Sbjct  163  AGITKFVHMSHLNADIRSPSK  183



>ref|XP_010076803.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial, partial [Pterocles gutturalis]
Length=270

 Score =   143 bits (360),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  +    +L+ MGD
Sbjct  43   VIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCDQYDLMYLRPMGD  102

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ++ ++++ +D++SI+  +  +NVVINL+G+E+ET+N+SFE+V   + K +A I +E 
Sbjct  103  LGQLLFLEWDCKDKDSIRRAVEHSNVVINLVGKEWETKNFSFEDVFVNIPKSIAQITRE-  161

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+   I +S L AS  SPS+
Sbjct  162  AGVETLIHISHLNASMKSPSK  182



>ref|XP_005492469.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Zonotrichia albicollis]
Length=373

 Score =   145 bits (366),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  +    +L+ MGD
Sbjct  37   VIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCDQYDLMYLRPMGD  96

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ++ M+++ RD+ SI+  +  +NVVINLIG+E+ET+N+ FE+    + + +A I+KE 
Sbjct  97   LGQLLFMEWDCRDKESIRRAVEHSNVVINLIGKEWETKNFKFEDEFVNIPQSIAQISKE-  155

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L AS  SPS+
Sbjct  156  AGVEKFIHISHLNASMKSPSK  176



>gb|EHH20407.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Macaca mulatta]
 gb|EHH66007.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Macaca fascicularis]
Length=377

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L ++GSQV++P R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRIGSQVIIPHRCDIYDTMHLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ++ ++++ RD++SI+  +  +NVVINLIGR++ET+N+ F++V   + + +A ++KE 
Sbjct  100  LGQLLFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFDDVYVKIPQAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L A+  S SR
Sbjct  159  AGVEKFIHVSHLNANIKSSSR  179



>gb|KDR23820.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Zootermopsis nevadensis]
Length=401

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 104/134 (78%), Gaps = 1/134 (1%)
 Frame = +3

Query  198  VRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDL  377
            +++GTGGRSS +GIVATVFGATGF+GRY+  +L K+G+Q+++P+RG    +  LKL+GDL
Sbjct  45   LKRGTGGRSSFNGIVATVFGATGFVGRYVCNRLGKIGTQLILPYRGDHYDNLRLKLVGDL  104

Query  378  GQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEHG  557
            GQ++ + Y+ RDE SI   +  +NVVINL+GR++ETRN+SF +V+   A+ LA ++KE  
Sbjct  105  GQVLFVPYDLRDEESIYKAIQYSNVVINLVGRDWETRNFSFHDVHVQGARTLARLSKE-A  163

Query  558  GILRFIQLSSLGAS  599
            G+ +F+ +S+L AS
Sbjct  164  GVEKFVHVSALNAS  177



>ref|XP_005426929.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Geospiza fortis]
Length=454

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  +    +L+ MGD
Sbjct  118  VIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCDQYDLMYLRPMGD  177

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQ++ M+++ RD++SI+  +  +NVVINLIG+E+ET+N+ FE+    + + +A I+KE 
Sbjct  178  LGQLLFMEWDCRDKDSIRRAVEHSNVVINLIGKEWETKNFKFEDEFVNIPQSIAQISKE-  236

Query  555  GGILRFIQLSSLGASPTSPSR  617
             G+ +FI +S L AS  SPS+
Sbjct  237  AGVEKFIHISHLNASMKSPSK  257



>ref|XP_004210520.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like, partial [Hydra vulgaris]
Length=163

 Score =   139 bits (351),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 99/141 (70%), Gaps = 1/141 (1%)
 Frame = +3

Query  192  HIVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMG  371
            H ++ G GGR+S +G + TVFGATGFLGRY+V +LA+ G+Q+++P+RG +D  R+++LMG
Sbjct  18   HGLKYGDGGRNSFNGSIVTVFGATGFLGRYVVNRLARRGTQLIIPYRGVDDEVRNIRLMG  77

Query  372  DLGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKE  551
            DLGQI    YN RD  S+   M  ++ VINL+G+ ++TRN++  +     A  LA  AKE
Sbjct  78   DLGQIKFFNYNLRDYESLLKTMTHSSTVINLVGKNFDTRNFTMSDCIVTGAADLAKAAKE  137

Query  552  HGGILRFIQLSSLGASPTSPS  614
              G+ RFI +S+LGA  +SPS
Sbjct  138  -SGVKRFIHVSALGAEGSSPS  157



>ref|XP_004438802.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Ceratotherium simum simum]
Length=377

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            ++  G GGRSSVSG+VATVFGATGFLGRY+V +L +MGSQV++P+R       +L+ MGD
Sbjct  40   LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNRLGRMGSQVIIPYRCDTYDIMYLRPMGD  99

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQI+ +++N R+++SI+  +  +NVVINL+GR++ET+N+ FE+V   +   +A ++KE 
Sbjct  100  LGQIIFLEWNGRNKDSIRRAVEHSNVVINLVGRDWETKNFDFEDVFVKIPLAIAQVSKE-  158

Query  555  GGILRFIQLSSLGASPTSPSR  617
             GI +FI +S L A   S SR
Sbjct  159  AGIEKFIHISHLNADIKSSSR  179



>gb|KIM89048.1| hypothetical protein PILCRDRAFT_812944 [Piloderma croceum F 1598]
Length=361

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 103/142 (73%), Gaps = 2/142 (1%)
 Frame = +3

Query  195  IVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  374
            I+  G  G S+VSG + TVFG TGFLGRY+V +L KMG+QV++P+R  ED  RHLKL GD
Sbjct  34   IISSGIPGYSAVSGHIVTVFGCTGFLGRYVVSKLGKMGTQVIIPYR-EEDDKRHLKLTGD  92

Query  375  LGQIVPMKYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHYMAKQLASIAKEH  554
            LGQIVPM+++ R+E  I+  +  +++V NL+GR+YET+N+S+ +V+   A+++A IA + 
Sbjct  93   LGQIVPMEWDIRNEQQIEECLRHSDIVYNLVGRDYETKNFSYSDVHAKGAQRIARIAAQ-  151

Query  555  GGILRFIQLSSLGASPTSPSRM  620
             G+ RF+ +S L AS  S S+ 
Sbjct  152  AGVSRFVHVSHLNASHNSKSKF  173



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520