BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF010G02

Length=593
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP15690.1|  unnamed protein product                                244   1e-75   Coffea canephora [robusta coffee]
ref|XP_010644665.1|  PREDICTED: uncharacterized protein LOC100245856    241   2e-74   Vitis vinifera
ref|XP_011073252.1|  PREDICTED: protein notum homolog isoform X2        240   4e-74   Sesamum indicum [beniseed]
ref|XP_011073171.1|  PREDICTED: protein notum homolog isoform X1        240   9e-74   
ref|XP_011082149.1|  PREDICTED: protein notum homolog isoform X1        239   1e-73   
gb|KCW72726.1|  hypothetical protein EUGRSUZ_E01170                     235   2e-72   Eucalyptus grandis [rose gum]
gb|ACF05806.1|  PAE                                                     236   3e-72   Litchi chinensis [litchi]
gb|KCW72723.1|  hypothetical protein EUGRSUZ_E01170                     235   3e-72   Eucalyptus grandis [rose gum]
gb|KCW72722.1|  hypothetical protein EUGRSUZ_E01170                     235   4e-72   Eucalyptus grandis [rose gum]
gb|KCW72721.1|  hypothetical protein EUGRSUZ_E01170                     235   4e-72   Eucalyptus grandis [rose gum]
ref|XP_010056136.1|  PREDICTED: protein notum homolog                   235   5e-72   Eucalyptus grandis [rose gum]
gb|KDO40418.1|  hypothetical protein CISIN_1g013734mg                   230   8e-72   Citrus sinensis [apfelsine]
ref|XP_006432878.1|  hypothetical protein CICLE_v100013712mg            229   3e-71   
ref|XP_008808358.1|  PREDICTED: protein notum homolog                   233   4e-71   Phoenix dactylifera
ref|XP_006878664.1|  hypothetical protein AMTR_s00011p00266820          231   1e-70   Amborella trichopoda
gb|KDO40416.1|  hypothetical protein CISIN_1g013734mg                   228   2e-70   Citrus sinensis [apfelsine]
ref|XP_010942978.1|  PREDICTED: uncharacterized protein LOC105060...    230   2e-70   Elaeis guineensis
ref|XP_010942979.1|  PREDICTED: uncharacterized protein LOC105060...    229   2e-70   Elaeis guineensis
ref|XP_009794297.1|  PREDICTED: protein notum homolog                   231   2e-70   Nicotiana sylvestris
ref|XP_010942975.1|  PREDICTED: protein notum homolog isoform X1        229   6e-70   Elaeis guineensis
ref|XP_010056135.1|  PREDICTED: protein notum homolog                   229   6e-70   Eucalyptus grandis [rose gum]
ref|XP_009616254.1|  PREDICTED: protein notum homolog                   229   6e-70   Nicotiana tomentosiformis
gb|EYU37455.1|  hypothetical protein MIMGU_mgv1a007934mg                229   6e-70   Erythranthe guttata [common monkey flower]
gb|KDO40412.1|  hypothetical protein CISIN_1g013734mg                   228   8e-70   Citrus sinensis [apfelsine]
ref|XP_006363875.1|  PREDICTED: protein notum homolog                   229   1e-69   Solanum tuberosum [potatoes]
gb|EYU29130.1|  hypothetical protein MIMGU_mgv1a007782mg                229   1e-69   Erythranthe guttata [common monkey flower]
gb|EYU29131.1|  hypothetical protein MIMGU_mgv1a007782mg                228   1e-69   Erythranthe guttata [common monkey flower]
gb|AFK37998.1|  unknown                                                 224   2e-69   Lotus japonicus
ref|XP_004509524.1|  PREDICTED: uncharacterized protein LOC101493...    225   2e-69   
ref|XP_006471634.1|  PREDICTED: uncharacterized protein LOC102628021    228   2e-69   Citrus sinensis [apfelsine]
gb|KDO40410.1|  hypothetical protein CISIN_1g013734mg                   229   3e-69   Citrus sinensis [apfelsine]
gb|KCW72720.1|  hypothetical protein EUGRSUZ_E01169                     228   7e-69   Eucalyptus grandis [rose gum]
ref|XP_010434420.1|  PREDICTED: protein notum homolog                   226   1e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010325633.1|  PREDICTED: uncharacterized protein LOC101257...    226   2e-68   Solanum lycopersicum
ref|XP_010056129.1|  PREDICTED: protein notum homolog isoform X1        227   2e-68   Eucalyptus grandis [rose gum]
ref|XP_010056132.1|  PREDICTED: protein notum homolog isoform X3        227   2e-68   Eucalyptus grandis [rose gum]
ref|XP_010325632.1|  PREDICTED: protein notum homolog isoform X1        226   2e-68   Solanum lycopersicum
ref|XP_010056131.1|  PREDICTED: protein notum homolog isoform X2        227   2e-68   Eucalyptus grandis [rose gum]
ref|XP_010439718.1|  PREDICTED: protein notum homolog                   225   2e-68   Camelina sativa [gold-of-pleasure]
ref|NP_193677.2|  putative pectinacetylesterase                         225   3e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007158098.1|  hypothetical protein PHAVU_002G123900g             225   4e-68   Phaseolus vulgaris [French bean]
ref|XP_010529277.1|  PREDICTED: protein notum homolog                   224   5e-68   Tarenaya hassleriana [spider flower]
ref|XP_004509522.1|  PREDICTED: uncharacterized protein LOC101493...    224   9e-68   Cicer arietinum [garbanzo]
emb|CAA67728.1|  pectinacetylesterase precursor                         223   2e-67   Vigna radiata var. radiata [golden gram]
gb|KDP28068.1|  hypothetical protein JCGZ_19476                         223   2e-67   Jatropha curcas
gb|AFK45147.1|  unknown                                                 222   3e-67   Lotus japonicus
ref|XP_002519911.1|  pectin acetylesterase, putative                    223   3e-67   
ref|XP_010449357.1|  PREDICTED: protein notum homolog                   222   4e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010244169.1|  PREDICTED: protein notum homolog                   221   8e-67   Nelumbo nucifera [Indian lotus]
ref|XP_008451860.1|  PREDICTED: protein notum homolog isoform X1        221   1e-66   Cucumis melo [Oriental melon]
ref|XP_006573492.1|  PREDICTED: protein notum homolog isoform X2        221   1e-66   
gb|EEC73846.1|  hypothetical protein OsI_08601                          217   2e-66   Oryza sativa Indica Group [Indian rice]
gb|KHN41567.1|  Protein notum like                                      220   2e-66   Glycine soja [wild soybean]
ref|XP_002867938.1|  pectinacetylesterase family protein                219   3e-66   
ref|XP_006573491.1|  PREDICTED: protein notum homolog isoform X1        221   4e-66   Glycine max [soybeans]
gb|KHN41756.1|  Protein notum like                                      221   4e-66   Glycine soja [wild soybean]
ref|XP_008451861.1|  PREDICTED: protein notum homolog isoform X2        219   4e-66   Cucumis melo [Oriental melon]
ref|XP_006599203.1|  PREDICTED: uncharacterized protein LOC100781...    219   4e-66   Glycine max [soybeans]
ref|XP_004172255.1|  PREDICTED: protein notum homolog                   219   5e-66   
ref|XP_010054028.1|  PREDICTED: uncharacterized protein LOC104442...    219   7e-66   Eucalyptus grandis [rose gum]
ref|XP_010244170.1|  PREDICTED: uncharacterized protein LOC104588061    218   1e-65   Nelumbo nucifera [Indian lotus]
ref|XP_007156330.1|  hypothetical protein PHAVU_003G277500g             218   1e-65   Phaseolus vulgaris [French bean]
ref|XP_007040902.1|  Pectinacetylesterase family protein                218   2e-65   
ref|XP_006385140.1|  hypothetical protein POPTR_0004s24220g             216   2e-65   
ref|NP_001151183.1|  LOC100284816 precursor                             218   2e-65   Zea mays [maize]
ref|XP_011028483.1|  PREDICTED: uncharacterized protein LOC105128...    218   2e-65   Populus euphratica
ref|XP_007156331.1|  hypothetical protein PHAVU_003G277500g             218   3e-65   Phaseolus vulgaris [French bean]
ref|NP_001047850.1|  Os02g0702400                                       217   4e-65   
ref|XP_009132797.1|  PREDICTED: protein notum homolog                   217   4e-65   Brassica rapa
emb|CDX99377.1|  BnaC01g11750D                                          218   5e-65   
ref|XP_008238012.1|  PREDICTED: protein notum homolog isoform X2        217   6e-65   Prunus mume [ume]
ref|XP_006413980.1|  hypothetical protein EUTSA_v10025385mg             216   6e-65   
ref|XP_010266386.1|  PREDICTED: uncharacterized protein LOC104603...    216   6e-65   Nelumbo nucifera [Indian lotus]
emb|CDX78933.1|  BnaA01g10000D                                          218   6e-65   
ref|XP_008238015.1|  PREDICTED: protein notum homolog isoform X5        214   7e-65   
ref|XP_004150551.1|  PREDICTED: protein notum homolog                   219   9e-65   
ref|XP_008238014.1|  PREDICTED: protein notum homolog isoform X4        214   9e-65   
ref|XP_006385136.1|  hypothetical protein POPTR_0004s24220g             216   9e-65   
ref|XP_011028482.1|  PREDICTED: uncharacterized protein LOC105128...    218   1e-64   Populus euphratica
gb|KEH20327.1|  pectinacetylesterase family protein                     216   1e-64   Medicago truncatula
ref|XP_011028479.1|  PREDICTED: uncharacterized protein LOC105128...    219   1e-64   Populus euphratica
gb|ACJ85294.1|  unknown                                                 216   1e-64   Medicago truncatula
ref|XP_003628995.1|  Notum-like protein                                 216   1e-64   
ref|XP_008238013.1|  PREDICTED: protein notum homolog isoform X3        213   1e-64   
gb|ACG39759.1|  carboxylic ester hydrolase                              216   1e-64   Zea mays [maize]
ref|XP_006587657.1|  PREDICTED: protein notum homolog isoform X3        216   2e-64   
ref|XP_009108427.1|  PREDICTED: protein notum homolog                   215   2e-64   Brassica rapa
emb|CDY09289.1|  BnaC03g63190D                                          215   2e-64   Brassica napus [oilseed rape]
ref|XP_006385138.1|  hypothetical protein POPTR_0004s24220g             215   2e-64   
ref|XP_010266384.1|  PREDICTED: uncharacterized protein LOC104603...    215   3e-64   Nelumbo nucifera [Indian lotus]
ref|XP_006385137.1|  hypothetical protein POPTR_0004s24220g             215   3e-64   
ref|XP_009398466.1|  PREDICTED: protein notum homolog                   214   3e-64   
ref|XP_006587655.1|  PREDICTED: protein notum homolog isoform X1        216   3e-64   Glycine max [soybeans]
gb|AET03471.2|  pectinacetylesterase family protein                     215   3e-64   Medicago truncatula
ref|XP_006587656.1|  PREDICTED: protein notum homolog isoform X2        216   3e-64   Glycine max [soybeans]
ref|XP_007209211.1|  hypothetical protein PRUPE_ppa006668mg             214   3e-64   Prunus persica
ref|XP_006385134.1|  hypothetical protein POPTR_0004s24220g             215   4e-64   
ref|XP_004953591.1|  PREDICTED: protein notum homolog isoform X2        212   4e-64   
gb|EMT14315.1|  hypothetical protein F775_08483                         214   4e-64   
ref|XP_010266381.1|  PREDICTED: uncharacterized protein LOC104603...    214   4e-64   Nelumbo nucifera [Indian lotus]
gb|AGT16732.1|  carboxylic ester hydrolase                              214   5e-64   Saccharum hybrid cultivar R570
ref|XP_010536220.1|  PREDICTED: protein notum homolog isoform X1        214   6e-64   Tarenaya hassleriana [spider flower]
ref|XP_010266380.1|  PREDICTED: uncharacterized protein LOC104603...    214   6e-64   
ref|XP_010266383.1|  PREDICTED: uncharacterized protein LOC104603...    215   6e-64   Nelumbo nucifera [Indian lotus]
gb|EYU29129.1|  hypothetical protein MIMGU_mgv1a023759mg                213   9e-64   Erythranthe guttata [common monkey flower]
ref|XP_009627060.1|  PREDICTED: uncharacterized protein LOC104117690    213   1e-63   Nicotiana tomentosiformis
ref|XP_010235850.1|  PREDICTED: protein notum homolog isoform X1        213   1e-63   Brachypodium distachyon [annual false brome]
ref|XP_008238011.1|  PREDICTED: protein notum homolog isoform X1        213   1e-63   Prunus mume [ume]
ref|XP_006361581.1|  PREDICTED: protein notum homolog                   212   2e-63   Solanum tuberosum [potatoes]
gb|EPS71696.1|  hypothetical protein M569_03061                         213   2e-63   Genlisea aurea
ref|XP_009771151.1|  PREDICTED: uncharacterized protein LOC104221730    213   2e-63   Nicotiana sylvestris
ref|XP_004244443.1|  PREDICTED: uncharacterized protein LOC101251798    212   3e-63   Solanum lycopersicum
gb|KJB24941.1|  hypothetical protein B456_004G175900                    212   4e-63   Gossypium raimondii
ref|XP_006432880.1|  hypothetical protein CICLE_v10001467mg             211   4e-63   Citrus clementina [clementine]
gb|ACS68714.1|  pectinacetylesterase precursor                          203   5e-63   Sonneratia alba
gb|ABK24433.1|  unknown                                                 211   6e-63   Picea sitchensis
ref|XP_004953590.1|  PREDICTED: protein notum homolog isoform X1        211   7e-63   Setaria italica
gb|ABK24994.1|  unknown                                                 211   7e-63   Picea sitchensis
ref|XP_009797415.1|  PREDICTED: uncharacterized protein LOC104243851    211   8e-63   Nicotiana sylvestris
ref|XP_010676220.1|  PREDICTED: uncharacterized protein LOC104892094    212   8e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007156332.1|  hypothetical protein PHAVU_003G277600g             211   9e-63   Phaseolus vulgaris [French bean]
ref|XP_006368062.1|  PREDICTED: protein notum homolog                   209   1e-62   Solanum tuberosum [potatoes]
ref|XP_010677538.1|  PREDICTED: protein notum homolog isoform X1        210   1e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010327577.1|  PREDICTED: uncharacterized protein LOC101244626    210   1e-62   
ref|XP_010248193.1|  PREDICTED: uncharacterized protein LOC104591101    209   4e-62   
ref|XP_002454426.1|  hypothetical protein SORBIDRAFT_04g030720          209   4e-62   Sorghum bicolor [broomcorn]
ref|XP_008238076.1|  PREDICTED: uncharacterized protein LOC103336755    206   4e-62   Prunus mume [ume]
ref|XP_006432881.1|  hypothetical protein CICLE_v10001426mg             209   4e-62   Citrus clementina [clementine]
ref|XP_006494119.1|  PREDICTED: protein notum homolog isoform X1        208   8e-62   
ref|XP_008365238.1|  PREDICTED: uncharacterized protein LOC103428882    206   1e-61   
ref|XP_002303225.2|  pectinacetylesterase family protein                208   1e-61   
ref|XP_009592441.1|  PREDICTED: uncharacterized protein LOC104089292    207   2e-61   Nicotiana tomentosiformis
ref|XP_011012520.1|  PREDICTED: protein notum homolog                   207   3e-61   Populus euphratica
ref|XP_004300392.1|  PREDICTED: pectin acetylesterase 8-like            207   3e-61   Fragaria vesca subsp. vesca
ref|XP_007209217.1|  hypothetical protein PRUPE_ppa006718mg             207   3e-61   Prunus persica
ref|XP_004512351.1|  PREDICTED: protein notum homolog isoform X3        208   3e-61   Cicer arietinum [garbanzo]
ref|XP_004512349.1|  PREDICTED: protein notum homolog isoform X1        209   5e-61   
ref|XP_003628996.1|  Carboxylic ester hydrolase                         205   2e-60   Medicago truncatula
ref|XP_009350399.1|  PREDICTED: protein notum homolog                   205   2e-60   Pyrus x bretschneideri [bai li]
ref|XP_008355284.1|  PREDICTED: uncharacterized protein LOC103418943    204   3e-60   
ref|XP_004300391.1|  PREDICTED: pectin acetylesterase 8-like            204   3e-60   Fragaria vesca subsp. vesca
ref|XP_010677539.1|  PREDICTED: protein notum homolog isoform X2        204   4e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008373439.1|  PREDICTED: protein notum homolog isoform X2        204   1e-59   Malus domestica [apple tree]
gb|AAP72959.1|  pectin acetylesterase                                   202   2e-59   Lactuca sativa [cultivated lettuce]
ref|XP_006385133.1|  pectinacetylesterase family protein                202   2e-59   Populus trichocarpa [western balsam poplar]
ref|XP_008378614.1|  PREDICTED: uncharacterized protein LOC103441693    202   2e-59   
ref|XP_008373438.1|  PREDICTED: protein notum homolog isoform X1        204   3e-59   Malus domestica [apple tree]
gb|KDP28067.1|  hypothetical protein JCGZ_19475                         202   3e-59   Jatropha curcas
ref|XP_003547821.1|  PREDICTED: protein notum homolog                   201   4e-59   Glycine max [soybeans]
ref|XP_008347803.1|  PREDICTED: uncharacterized protein LOC103410929    201   5e-59   
gb|KHN27509.1|  Protein notum like                                      201   7e-59   Glycine soja [wild soybean]
ref|XP_003547731.1|  PREDICTED: protein notum homolog isoform X1        201   7e-59   Glycine max [soybeans]
ref|XP_011028476.1|  PREDICTED: protein notum homolog                   201   7e-59   Populus euphratica
ref|XP_010054026.1|  PREDICTED: uncharacterized protein LOC104442...    201   8e-59   Eucalyptus grandis [rose gum]
ref|XP_004509558.1|  PREDICTED: protein notum homolog                   200   1e-58   Cicer arietinum [garbanzo]
gb|EMT15342.1|  hypothetical protein F775_17167                         199   5e-58   
gb|KHG23648.1|  Notum                                                   198   6e-58   Gossypium arboreum [tree cotton]
gb|ADR82372.1|  pectin acetylesterase                                   198   7e-58   Populus trichocarpa [western balsam poplar]
gb|AFK37852.1|  unknown                                                 198   9e-58   Lotus japonicus
ref|XP_003613922.1|  Notum-like protein                                 197   1e-57   Medicago truncatula
ref|XP_007040900.1|  Pectinacetylesterase family protein                197   2e-57   
gb|KCW72718.1|  hypothetical protein EUGRSUZ_E01169                     197   2e-57   Eucalyptus grandis [rose gum]
ref|XP_010111521.1|  hypothetical protein L484_021346                   196   4e-57   
ref|XP_010536210.1|  PREDICTED: uncharacterized protein LOC104811251    196   6e-57   Tarenaya hassleriana [spider flower]
ref|XP_009397056.1|  PREDICTED: protein notum homolog                   196   7e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011082152.1|  PREDICTED: protein notum homolog isoform X2        194   1e-56   
ref|XP_002519912.1|  pectin acetylesterase, putative                    196   1e-56   
gb|KHG09455.1|  Protein notum                                           195   1e-56   Gossypium arboreum [tree cotton]
gb|KJB25075.1|  hypothetical protein B456_004G176200                    195   1e-56   Gossypium raimondii
gb|KDP28066.1|  hypothetical protein JCGZ_19474                         194   2e-56   Jatropha curcas
ref|XP_006424455.1|  hypothetical protein CICLE_v10030247mg             192   2e-56   
ref|XP_006359968.1|  PREDICTED: protein notum homolog                   194   2e-56   
ref|XP_008808367.1|  PREDICTED: uncharacterized protein LOC103720...    194   2e-56   
ref|XP_003547822.1|  PREDICTED: protein notum homolog                   194   3e-56   Glycine max [soybeans]
ref|XP_008808370.1|  PREDICTED: uncharacterized protein LOC103720...    194   3e-56   
ref|XP_008808368.1|  PREDICTED: uncharacterized protein LOC103720...    194   3e-56   
gb|KHN27511.1|  Protein notum like                                      193   5e-56   Glycine soja [wild soybean]
ref|XP_003548585.1|  PREDICTED: protein notum homolog                   193   6e-56   
ref|XP_010911666.1|  PREDICTED: protein notum homolog                   192   8e-56   Elaeis guineensis
ref|XP_009388128.1|  PREDICTED: protein notum homolog                   192   1e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010942974.1|  PREDICTED: protein notum homolog                   192   1e-55   Elaeis guineensis
ref|XP_008797987.1|  PREDICTED: protein notum homolog isoform X1        191   2e-55   Phoenix dactylifera
ref|NP_974575.2|  putative pectinacetylesterase                         190   4e-55   
gb|AAM65412.1|  pectin acetylesterase                                   189   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010536189.1|  PREDICTED: uncharacterized protein LOC104811...    189   2e-54   Tarenaya hassleriana [spider flower]
ref|XP_010494620.1|  PREDICTED: uncharacterized protein LOC104771742    189   2e-54   Camelina sativa [gold-of-pleasure]
gb|EMS35701.1|  hypothetical protein TRIUR3_33758                       181   3e-54   Triticum urartu
ref|XP_006280604.1|  hypothetical protein CARUB_v10026563mg             189   3e-54   Capsella rubella
ref|NP_851135.1|  pectinacetylesterase family protein                   188   3e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010441760.1|  PREDICTED: uncharacterized protein LOC104724893    188   3e-54   Camelina sativa [gold-of-pleasure]
ref|NP_199341.1|  pectinacetylesterase family protein                   188   5e-54   Arabidopsis thaliana [mouse-ear cress]
emb|CDY67801.1|  BnaAnng25210D                                          188   5e-54   Brassica napus [oilseed rape]
ref|XP_006398195.1|  hypothetical protein EUTSA_v10000914mg             188   6e-54   Eutrema salsugineum [saltwater cress]
ref|XP_009128780.1|  PREDICTED: uncharacterized protein LOC103853624    187   7e-54   Brassica rapa
ref|XP_010481611.1|  PREDICTED: uncharacterized protein LOC104760390    187   8e-54   Camelina sativa [gold-of-pleasure]
emb|CDX87799.1|  BnaC02g31500D                                          187   8e-54   
emb|CDY26383.1|  BnaA02g23870D                                          187   9e-54   Brassica napus [oilseed rape]
ref|XP_002865253.1|  pectin acetylesterase                              187   9e-54   
gb|KDO40409.1|  hypothetical protein CISIN_1g016608mg                   186   1e-53   Citrus sinensis [apfelsine]
ref|XP_006283887.1|  hypothetical protein CARUB_v10005004mg             186   2e-53   Capsella rubella
dbj|BAD94756.1|  putative pectinacetylesterase protein                  183   3e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009108426.1|  PREDICTED: protein notum homolog                   186   3e-53   Brassica rapa
emb|CDY09287.1|  BnaC03g63170D                                          186   3e-53   Brassica napus [oilseed rape]
emb|CDX99378.1|  BnaC01g11740D                                          186   4e-53   
ref|XP_009132784.1|  PREDICTED: uncharacterized protein LOC103857370    186   5e-53   Brassica rapa
emb|CDX78932.1|  BnaA01g09990D                                          185   5e-53   
ref|XP_009413211.1|  PREDICTED: protein notum homolog                   184   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010434425.1|  PREDICTED: uncharacterized protein LOC104718...    182   4e-52   Camelina sativa [gold-of-pleasure]
ref|XP_006413981.1|  hypothetical protein EUTSA_v10024796mg             186   6e-52   
ref|XP_002867940.1|  hypothetical protein ARALYDRAFT_492921             182   7e-52   
ref|NP_567585.1|  pectinacetylesterase family protein                   182   7e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009589854.1|  PREDICTED: uncharacterized protein LOC104087...    180   7e-52   Nicotiana tomentosiformis
ref|XP_009803843.1|  PREDICTED: uncharacterized protein LOC104249167    182   7e-52   Nicotiana sylvestris
ref|XP_010439720.1|  PREDICTED: uncharacterized protein LOC104723107    182   7e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010449359.1|  PREDICTED: uncharacterized protein LOC104731629    182   8e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010434424.1|  PREDICTED: uncharacterized protein LOC104718...    182   8e-52   Camelina sativa [gold-of-pleasure]
ref|NP_001190770.1|  pectinacetylesterase family protein                184   3e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009763243.1|  PREDICTED: protein notum homolog isoform X2        179   3e-51   Nicotiana sylvestris
ref|XP_010235852.1|  PREDICTED: protein notum homolog isoform X2        179   4e-51   Brachypodium distachyon [annual false brome]
ref|XP_009589853.1|  PREDICTED: uncharacterized protein LOC104087...    179   8e-51   Nicotiana tomentosiformis
ref|XP_009763242.1|  PREDICTED: protein notum homolog isoform X1        178   4e-50   Nicotiana sylvestris
ref|XP_009589914.1|  PREDICTED: uncharacterized protein LOC104087...    177   6e-50   Nicotiana tomentosiformis
ref|XP_009589915.1|  PREDICTED: uncharacterized protein LOC104087...    177   6e-50   Nicotiana tomentosiformis
ref|XP_009771487.1|  PREDICTED: protein notum homolog                   177   7e-50   Nicotiana sylvestris
ref|XP_009771153.1|  PREDICTED: uncharacterized protein LOC104221731    179   2e-49   Nicotiana sylvestris
ref|XP_006363883.1|  PREDICTED: uncharacterized protein LOC102589191    177   3e-49   
gb|KJB25078.1|  hypothetical protein B456_004G176200                    176   4e-49   Gossypium raimondii
ref|XP_009603755.1|  PREDICTED: protein notum homolog isoform X2        173   5e-49   Nicotiana tomentosiformis
ref|XP_004244682.2|  PREDICTED: uncharacterized protein LOC101248898    174   6e-49   Solanum lycopersicum
ref|XP_009612887.1|  PREDICTED: uncharacterized protein LOC104106115    174   7e-49   Nicotiana tomentosiformis
ref|XP_009590665.1|  PREDICTED: uncharacterized protein LOC104087...    173   9e-49   Nicotiana tomentosiformis
ref|XP_010325697.1|  PREDICTED: uncharacterized protein LOC101260962    178   9e-49   
ref|XP_010314003.1|  PREDICTED: protein notum homolog isoform X1        174   9e-49   
ref|XP_006365947.1|  PREDICTED: uncharacterized protein LOC102601254    174   9e-49   
ref|XP_006652763.1|  PREDICTED: protein notum homolog                   174   1e-48   
ref|XP_010314004.1|  PREDICTED: protein notum homolog isoform X2        174   1e-48   
ref|XP_006367726.1|  PREDICTED: uncharacterized protein LOC102600035    174   1e-48   Solanum tuberosum [potatoes]
ref|XP_009590664.1|  PREDICTED: uncharacterized protein LOC104087...    173   2e-48   Nicotiana tomentosiformis
ref|XP_009590663.1|  PREDICTED: protein notum homolog isoform X1        173   3e-48   Nicotiana tomentosiformis
ref|XP_009603747.1|  PREDICTED: protein notum homolog isoform X1        172   5e-48   Nicotiana tomentosiformis
emb|CAD41867.2|  OSJNBa0041A02.14                                       172   6e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009407790.1|  PREDICTED: protein notum homolog                   172   8e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004246219.1|  PREDICTED: protein notum homolog                   171   1e-47   
ref|NP_001053773.1|  Os04g0602500                                       172   2e-47   
ref|XP_009621957.1|  PREDICTED: uncharacterized protein LOC104113...    167   2e-47   Nicotiana tomentosiformis
ref|XP_009621956.1|  PREDICTED: uncharacterized protein LOC104113...    166   4e-47   Nicotiana tomentosiformis
gb|KHG23649.1|  Notum                                                   169   5e-47   Gossypium arboreum [tree cotton]
emb|CAA18628.1|  putative pectinacetylesterase protein                  169   5e-47   Arabidopsis thaliana [mouse-ear cress]
gb|EEC77932.1|  hypothetical protein OsI_17271                          172   6e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_003580427.1|  PREDICTED: uncharacterized protein LOC100827...    169   6e-47   Brachypodium distachyon [annual false brome]
ref|XP_010240371.1|  PREDICTED: uncharacterized protein LOC100827...    170   6e-47   
ref|XP_009626489.1|  PREDICTED: protein notum homolog isoform X1        169   9e-47   Nicotiana tomentosiformis
ref|XP_009624847.1|  PREDICTED: protein notum homolog isoform X2        169   1e-46   Nicotiana tomentosiformis
ref|XP_009624845.1|  PREDICTED: protein notum homolog isoform X1        169   1e-46   Nicotiana tomentosiformis
ref|XP_010914804.1|  PREDICTED: protein notum homolog isoform X2        168   2e-46   
ref|XP_009612083.1|  PREDICTED: uncharacterized protein LOC104105...    164   2e-46   Nicotiana tomentosiformis
gb|EEE61621.1|  hypothetical protein OsJ_16047                          172   2e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009612075.1|  PREDICTED: uncharacterized protein LOC104105...    164   3e-46   Nicotiana tomentosiformis
ref|XP_009408703.1|  PREDICTED: protein notum homolog                   168   3e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG26188.1|  Protein notum                                           168   3e-46   Gossypium arboreum [tree cotton]
dbj|BAJ97261.1|  predicted protein                                      167   3e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010914803.1|  PREDICTED: protein notum homolog isoform X1        167   5e-46   Elaeis guineensis
gb|AGT17273.1|  hypothetical protein SHCRBa_020_L15_F_100               166   6e-46   Saccharum hybrid cultivar R570
tpg|DAA36173.1|  TPA: hypothetical protein ZEAMMB73_990456              166   7e-46   
ref|XP_009407792.1|  PREDICTED: protein notum homolog                   167   7e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004495819.1|  PREDICTED: uncharacterized protein LOC101503...    166   9e-46   
ref|XP_008807933.1|  PREDICTED: protein notum homolog                   166   1e-45   Phoenix dactylifera
gb|EMT00101.1|  hypothetical protein F775_14945                         163   1e-45   
gb|KJB81154.1|  hypothetical protein B456_013G131600                    165   2e-45   Gossypium raimondii
ref|XP_010914805.1|  PREDICTED: protein notum homolog                   166   2e-45   Elaeis guineensis
ref|XP_004246220.1|  PREDICTED: uncharacterized protein LOC101249672    169   2e-45   
ref|XP_009591733.1|  PREDICTED: protein notum homolog                   165   2e-45   
ref|XP_008667853.1|  PREDICTED: hypothetical protein isoform X1         166   2e-45   Zea mays [maize]
ref|XP_007051327.1|  Pectinacetylesterase family protein                167   2e-45   
ref|XP_004958440.1|  PREDICTED: protein notum homolog                   166   2e-45   Setaria italica
ref|XP_003562611.1|  PREDICTED: protein notum homolog                   166   3e-45   Brachypodium distachyon [annual false brome]
gb|KCW85008.1|  hypothetical protein EUGRSUZ_B01829                     164   3e-45   Eucalyptus grandis [rose gum]
gb|KJB81155.1|  hypothetical protein B456_013G131600                    165   3e-45   Gossypium raimondii
gb|ADE77373.1|  unknown                                                 165   4e-45   Picea sitchensis
ref|XP_006302294.1|  hypothetical protein CARUB_v10020343mg             163   5e-45   
ref|NP_001060382.1|  Os07g0634600                                       165   5e-45   
gb|KJB81156.1|  hypothetical protein B456_013G131600                    164   6e-45   
ref|XP_009759657.1|  PREDICTED: uncharacterized protein LOC104212153    164   9e-45   
ref|XP_006340065.1|  PREDICTED: protein notum homolog                   163   9e-45   
ref|XP_010914809.1|  PREDICTED: uncharacterized protein LOC105040...    162   1e-44   
gb|KJB81153.1|  hypothetical protein B456_013G131600                    164   1e-44   
ref|XP_004288665.1|  PREDICTED: pectin acetylesterase 3 isoform X2      165   1e-44   
ref|XP_011470038.1|  PREDICTED: pectin acetylesterase 3 isoform X1      165   1e-44   
ref|XP_003518126.1|  PREDICTED: protein notum homolog                   164   1e-44   
ref|XP_002461086.1|  hypothetical protein SORBIDRAFT_02g040470          163   2e-44   
tpg|DAA36176.1|  TPA: pectinacetylesterase                              165   2e-44   
ref|XP_010914808.1|  PREDICTED: uncharacterized protein LOC105040...    162   2e-44   
ref|XP_010042497.1|  PREDICTED: protein notum homolog isoform X1        163   2e-44   
ref|XP_010914807.1|  PREDICTED: protein notum homolog isoform X1        162   3e-44   
ref|XP_008369575.1|  PREDICTED: protein notum homolog isoform X2        163   3e-44   
ref|XP_009359821.1|  PREDICTED: protein notum homolog                   163   3e-44   
dbj|BAJ88825.1|  predicted protein                                      158   3e-44   
ref|XP_006658006.1|  PREDICTED: protein notum homolog                   162   3e-44   
ref|XP_006589089.1|  PREDICTED: protein notum homolog isoform X2        161   3e-44   
ref|XP_009776988.1|  PREDICTED: uncharacterized protein LOC104226...    162   4e-44   
ref|XP_002512590.1|  pectin acetylesterase, putative                    162   4e-44   
ref|XP_009797875.1|  PREDICTED: protein notum homolog isoform X1        162   5e-44   
ref|XP_002318919.2|  hypothetical protein POPTR_0013s00280g             162   6e-44   
ref|XP_009797876.1|  PREDICTED: protein notum homolog isoform X2        161   6e-44   
ref|XP_006302295.1|  hypothetical protein CARUB_v10020343mg             162   6e-44   
ref|XP_006361594.1|  PREDICTED: protein notum homolog                   164   7e-44   
gb|EYU37450.1|  hypothetical protein MIMGU_mgv1a012163mg                158   7e-44   
gb|KHN14241.1|  Protein notum like                                      162   8e-44   
ref|NP_001141895.1|  uncharacterized protein LOC100274042 precursor     162   8e-44   
ref|XP_006423958.1|  hypothetical protein CICLE_v10028674mg             160   9e-44   
emb|CBI39680.3|  unnamed protein product                                160   1e-43   
ref|XP_002464971.1|  hypothetical protein SORBIDRAFT_01g029710          156   1e-43   
ref|XP_009619780.1|  PREDICTED: uncharacterized protein LOC104111729    161   1e-43   
gb|AFK38038.1|  unknown                                                 161   1e-43   
ref|XP_009794027.1|  PREDICTED: uncharacterized protein LOC104240572    161   1e-43   
ref|XP_008807936.1|  PREDICTED: protein notum homolog isoform X2        161   1e-43   
ref|XP_006480336.1|  PREDICTED: protein notum homolog                   161   1e-43   
ref|XP_010920599.1|  PREDICTED: protein notum homolog isoform X1        161   2e-43   
ref|XP_010920600.1|  PREDICTED: protein notum homolog isoform X2        161   2e-43   
ref|XP_003536008.1|  PREDICTED: protein notum homolog isoform X1        161   2e-43   
ref|XP_009778395.1|  PREDICTED: protein notum homolog                   160   2e-43   
ref|XP_007145083.1|  hypothetical protein PHAVU_007G208200g             160   2e-43   
gb|KDO86755.1|  hypothetical protein CISIN_1g014548mg                   158   2e-43   
ref|XP_009600038.1|  PREDICTED: protein notum homolog                   159   2e-43   
ref|XP_002279030.1|  PREDICTED: protein notum homolog                   160   2e-43   
gb|KJB82698.1|  hypothetical protein B456_013G211000                    160   2e-43   
ref|XP_006444638.1|  hypothetical protein CICLE_v10020385mg             158   3e-43   
emb|CAN62190.1|  hypothetical protein VITISV_020113                     160   3e-43   
ref|XP_009799834.1|  PREDICTED: protein notum homolog                   160   3e-43   
gb|KDP23324.1|  hypothetical protein JCGZ_23157                         160   3e-43   
gb|KJB82697.1|  hypothetical protein B456_013G211000                    160   3e-43   
ref|XP_009607289.1|  PREDICTED: protein notum homolog                   159   4e-43   
ref|XP_002892509.1|  hypothetical protein ARALYDRAFT_311997             159   4e-43   
ref|XP_003521640.1|  PREDICTED: protein notum homolog                   160   4e-43   
ref|XP_006604776.1|  PREDICTED: protein notum homolog isoform X1        160   4e-43   
gb|AAC33215.1|  Similar to pectinacetylesterase                         158   5e-43   
ref|XP_011023896.1|  PREDICTED: protein notum homolog                   159   6e-43   
ref|XP_004494501.1|  PREDICTED: uncharacterized protein LOC101497...    159   6e-43   
gb|KJB82695.1|  hypothetical protein B456_013G211000                    159   6e-43   
gb|EMS59699.1|  hypothetical protein TRIUR3_12152                       159   7e-43   
emb|CAA18629.1|  putative pectinacetylesterase                          155   7e-43   
ref|NP_172426.2|  pectinacetylesterase family protein                   159   7e-43   
ref|XP_007031285.1|  Pectinacetylesterase family protein                159   9e-43   
gb|EYU37449.1|  hypothetical protein MIMGU_mgv1a011392mg                155   1e-42   
ref|XP_008784716.1|  PREDICTED: uncharacterized protein LOC103703587    158   1e-42   
gb|AFN53693.1|  pectinacetylesterase                                    161   1e-42   
ref|XP_010524828.1|  PREDICTED: protein notum homolog                   158   1e-42   
ref|XP_009148769.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    154   1e-42   
ref|XP_009335553.1|  PREDICTED: uncharacterized protein LOC103928...    158   1e-42   
ref|XP_009366012.1|  PREDICTED: protein notum homolog                   158   2e-42   
gb|KHN14201.1|  Protein notum like                                      158   2e-42   
emb|CDX93503.1|  BnaA06g05450D                                          152   2e-42   
ref|XP_008363955.1|  PREDICTED: protein notum homolog                   158   2e-42   
ref|XP_002894676.1|  hypothetical protein ARALYDRAFT_474842             158   2e-42   
gb|EYU19372.1|  hypothetical protein MIMGU_mgv1a006907mg                157   2e-42   
dbj|BAJ90066.1|  predicted protein                                      157   2e-42   
gb|AAG50747.1|AC079733_15  pectinacetylesterase precursor, putative     158   2e-42   
gb|KJB41749.1|  hypothetical protein B456_007G118400                    158   2e-42   
ref|XP_003536006.1|  PREDICTED: uncharacterized protein LOC100810716    158   2e-42   
gb|AAM74495.1|  At1g57590/T8L23_6                                       158   2e-42   
ref|XP_004244767.2|  PREDICTED: protein notum homolog                   157   2e-42   
ref|XP_010070108.1|  PREDICTED: protein notum homolog                   158   2e-42   
ref|XP_004494487.1|  PREDICTED: protein notum homolog isoform X3        158   2e-42   
ref|XP_004248530.1|  PREDICTED: protein notum homolog isoform X2        157   3e-42   
gb|EMS47505.1|  hypothetical protein TRIUR3_18301                       157   3e-42   
ref|XP_009805042.1|  PREDICTED: protein notum homolog                   157   3e-42   
gb|KHN04710.1|  Protein notum like                                      152   3e-42   
ref|XP_006306028.1|  hypothetical protein CARUB_v10011324mg             157   3e-42   
emb|CBI37039.3|  unnamed protein product                                157   3e-42   
ref|XP_009626490.1|  PREDICTED: protein notum homolog isoform X2        157   3e-42   
ref|XP_009110820.1|  PREDICTED: uncharacterized protein LOC103836327    157   3e-42   
ref|XP_008807935.1|  PREDICTED: protein notum homolog isoform X1        157   3e-42   
ref|XP_007163281.1|  hypothetical protein PHAVU_001G221400g             157   3e-42   
gb|ABG33770.1|  pectin acetylesterase precursor                         152   3e-42   
ref|XP_003535610.2|  PREDICTED: protein notum homolog isoform X1        157   3e-42   
ref|XP_003626089.1|  Pectin acetylesterase                              157   3e-42   
ref|XP_006589537.1|  PREDICTED: protein notum homolog isoform X2        157   3e-42   
gb|KJB49686.1|  hypothetical protein B456_008G133500                    155   3e-42   
ref|XP_002447050.1|  hypothetical protein SORBIDRAFT_06g027560          157   3e-42   
ref|NP_176072.3|  pectinacetylesterase family protein                   158   3e-42   
ref|XP_006444639.1|  hypothetical protein CICLE_v10020385mg             157   3e-42   
gb|EYU19373.1|  hypothetical protein MIMGU_mgv1a006907mg                157   3e-42   
emb|CDY31081.1|  BnaA08g26310D                                          157   4e-42   
gb|KDO86754.1|  hypothetical protein CISIN_1g014548mg                   157   4e-42   
ref|XP_004495849.1|  PREDICTED: protein notum homolog isoform X1        157   4e-42   
ref|XP_003555771.1|  PREDICTED: uncharacterized protein LOC100793403    157   4e-42   
gb|KJB49688.1|  hypothetical protein B456_008G133500                    155   4e-42   
ref|XP_004494486.1|  PREDICTED: protein notum homolog isoform X2        158   4e-42   
gb|KJB41748.1|  hypothetical protein B456_007G118400                    158   4e-42   
gb|KHN26210.1|  Protein notum like                                      155   4e-42   
ref|XP_004983743.1|  PREDICTED: protein notum homolog isoform X3        156   4e-42   
gb|KEH43170.1|  pectinacetylesterase family protein                     157   4e-42   
ref|XP_004494485.1|  PREDICTED: protein notum homolog isoform X1        158   5e-42   
ref|XP_010094916.1|  hypothetical protein L484_022666                   157   5e-42   
ref|XP_003626088.1|  Pectin acetylesterase                              157   5e-42   
ref|XP_009138739.1|  PREDICTED: protein notum homolog isoform X2        157   5e-42   
ref|XP_002280816.3|  PREDICTED: protein notum homolog                   157   5e-42   
ref|XP_006363882.1|  PREDICTED: uncharacterized protein LOC102588866    156   6e-42   
ref|XP_006492439.1|  PREDICTED: protein notum homolog                   157   6e-42   
emb|CDP15161.1|  unnamed protein product                                155   6e-42   
gb|AFK35535.1|  unknown                                                 157   6e-42   
ref|XP_009776987.1|  PREDICTED: uncharacterized protein LOC104226...    156   6e-42   
ref|XP_009335552.1|  PREDICTED: protein notum homolog isoform X1        156   6e-42   
gb|EMT00867.1|  hypothetical protein F775_21765                         158   7e-42   
ref|XP_010475792.1|  PREDICTED: uncharacterized protein LOC104755150    156   7e-42   
gb|KEH32394.1|  pectinacetylesterase family protein                     155   7e-42   
ref|XP_010255386.1|  PREDICTED: uncharacterized protein LOC104596068    156   7e-42   
gb|KHG13045.1|  Protein notum                                           157   8e-42   
ref|XP_006382250.1|  hypothetical protein POPTR_0005s00330g             156   8e-42   
ref|XP_010511331.1|  PREDICTED: protein notum homolog                   157   8e-42   
ref|XP_010327277.1|  PREDICTED: protein notum homolog isoform X1        156   8e-42   
ref|XP_009600844.1|  PREDICTED: protein notum homolog                   156   9e-42   
ref|XP_011039058.1|  PREDICTED: protein notum homolog isoform X1        156   9e-42   
gb|KHG30410.1|  Protein notum                                           156   9e-42   
ref|XP_011087572.1|  PREDICTED: protein notum homolog isoform X1        156   1e-41   
emb|CDY58759.1|  BnaA04g27440D                                          157   1e-41   
gb|ABR16604.1|  unknown                                                 156   1e-41   
ref|XP_009138738.1|  PREDICTED: protein notum homolog isoform X1        157   1e-41   
ref|XP_010458242.1|  PREDICTED: uncharacterized protein LOC104739548    156   1e-41   
ref|XP_004983742.1|  PREDICTED: protein notum homolog isoform X2        156   1e-41   
ref|XP_006359967.1|  PREDICTED: protein notum homolog                   155   1e-41   
ref|XP_010674458.1|  PREDICTED: protein notum homolog                   155   1e-41   
ref|XP_006338904.1|  PREDICTED: protein notum homolog isoform X1        155   1e-41   
gb|KHN14181.1|  Protein notum like                                      155   1e-41   
gb|KFK43264.1|  hypothetical protein AALP_AA1G101100                    159   1e-41   
ref|XP_004983741.1|  PREDICTED: protein notum homolog isoform X1        156   1e-41   
ref|XP_010490120.1|  PREDICTED: uncharacterized protein LOC104767848    155   1e-41   
ref|XP_009382365.1|  PREDICTED: uncharacterized protein LOC103970...    155   1e-41   
ref|XP_002515160.1|  pectin acetylesterase, putative                    155   2e-41   
ref|XP_006293476.1|  hypothetical protein CARUB_v10023292mg             155   2e-41   
ref|XP_009363058.1|  PREDICTED: LOW QUALITY PROTEIN: protein notu...    156   2e-41   
ref|XP_009382364.1|  PREDICTED: uncharacterized protein LOC103970...    155   2e-41   
ref|XP_004234401.1|  PREDICTED: uncharacterized protein LOC101253061    155   2e-41   
ref|XP_010091439.1|  hypothetical protein L484_013894                   153   2e-41   
ref|XP_006840405.1|  hypothetical protein AMTR_s00045p00148030          155   2e-41   
gb|KHG08983.1|  Protein notum                                           155   2e-41   
ref|XP_009344788.1|  PREDICTED: protein notum homolog                   156   2e-41   
ref|XP_010493505.1|  PREDICTED: protein notum homolog isoform X2        155   2e-41   
ref|XP_008381630.1|  PREDICTED: uncharacterized protein LOC103444483    156   2e-41   
ref|XP_009382362.1|  PREDICTED: uncharacterized protein LOC103970...    155   2e-41   
ref|XP_008388417.1|  PREDICTED: uncharacterized protein LOC103450...    155   3e-41   
ref|XP_004302322.1|  PREDICTED: pectin acetylesterase 12-like           155   3e-41   
gb|KJB52758.1|  hypothetical protein B456_008G276500                    155   3e-41   
gb|KJB52757.1|  hypothetical protein B456_008G276500                    155   3e-41   
ref|XP_006358515.1|  PREDICTED: protein notum homolog                   155   3e-41   
gb|EPS64449.1|  hypothetical protein M569_10332                         150   3e-41   
gb|KJB49685.1|  hypothetical protein B456_008G133500                    155   3e-41   
ref|XP_011092213.1|  PREDICTED: protein notum homolog                   155   3e-41   
ref|XP_009382363.1|  PREDICTED: protein notum homolog isoform X3        155   3e-41   
ref|XP_007143429.1|  hypothetical protein PHAVU_007G071700g             154   3e-41   
ref|XP_007145058.1|  hypothetical protein PHAVU_007G206300g             155   3e-41   
ref|XP_010493504.1|  PREDICTED: protein notum homolog isoform X1        155   3e-41   
ref|XP_007205243.1|  hypothetical protein PRUPE_ppa006114mg             155   3e-41   
emb|CDY11398.1|  BnaA09g39640D                                          155   3e-41   
ref|XP_009382361.1|  PREDICTED: uncharacterized protein LOC103970...    155   3e-41   
ref|XP_007038710.1|  Pectinacetylesterase family protein isoform 2      154   3e-41   
ref|XP_010421192.1|  PREDICTED: protein notum homolog isoform X2        155   3e-41   
ref|XP_010421191.1|  PREDICTED: protein notum homolog isoform X1        155   3e-41   
ref|XP_010649712.1|  PREDICTED: protein notum homolog isoform X2        153   4e-41   
ref|XP_008388415.1|  PREDICTED: uncharacterized protein LOC103450...    155   4e-41   
ref|XP_006402417.1|  hypothetical protein EUTSA_v10005997mg             155   4e-41   
ref|XP_009784099.1|  PREDICTED: protein notum homolog                   154   4e-41   
ref|XP_008227765.1|  PREDICTED: protein notum homolog isoform X2        155   4e-41   
gb|EMT30528.1|  hypothetical protein F775_25893                         154   4e-41   
ref|XP_004230372.1|  PREDICTED: protein notum homolog                   154   4e-41   
ref|XP_009388076.1|  PREDICTED: protein notum homolog                   154   4e-41   
ref|XP_007221559.1|  hypothetical protein PRUPE_ppa006038mg             154   5e-41   
ref|XP_006606122.1|  PREDICTED: protein notum homolog isoform X1        154   5e-41   
ref|XP_003521625.1|  PREDICTED: protein notum homolog isoformX1         154   5e-41   
gb|KHN12141.1|  Protein notum like                                      154   5e-41   
gb|KFK27676.1|  hypothetical protein AALP_AA8G414200                    154   5e-41   
ref|XP_009399871.1|  PREDICTED: uncharacterized protein LOC103984154    154   5e-41   
ref|XP_006287831.1|  hypothetical protein CARUB_v10001048mg             154   5e-41   
ref|XP_010454669.1|  PREDICTED: protein notum homolog                   154   5e-41   
ref|XP_008227764.1|  PREDICTED: protein notum homolog isoform X1        155   6e-41   
gb|KDO52023.1|  hypothetical protein CISIN_1g015955mg                   152   6e-41   
ref|XP_006846159.1|  hypothetical protein AMTR_s00012p00191170          154   6e-41   
ref|XP_006490407.1|  PREDICTED: protein notum homolog isoform X3        152   6e-41   
ref|XP_006480814.1|  PREDICTED: protein notum homolog isoform X6        152   6e-41   
ref|XP_009401969.1|  PREDICTED: uncharacterized protein LOC103985...    154   6e-41   
ref|XP_010318089.1|  PREDICTED: protein notum homolog                   154   6e-41   
ref|XP_010240825.1|  PREDICTED: protein notum homolog                   154   6e-41   
ref|XP_008450496.1|  PREDICTED: protein notum homolog                   154   6e-41   
gb|EPS62193.1|  hypothetical protein M569_12601                         148   7e-41   
ref|XP_010244217.1|  PREDICTED: protein notum homolog                   152   7e-41   
ref|XP_006490408.1|  PREDICTED: protein notum homolog isoform X4        152   7e-41   
ref|XP_006577186.1|  PREDICTED: protein notum homolog isoform X2        154   7e-41   
ref|XP_008360208.1|  PREDICTED: protein notum homolog isoform X3        154   7e-41   
ref|XP_010060906.1|  PREDICTED: uncharacterized protein LOC104448...    154   7e-41   
ref|XP_010546781.1|  PREDICTED: protein notum homolog                   154   7e-41   
ref|XP_006429076.1|  hypothetical protein CICLE_v10011803mg             154   8e-41   
ref|XP_004135578.1|  PREDICTED: protein notum homolog                   154   8e-41   
ref|XP_006421942.1|  hypothetical protein CICLE_v10005117mg             153   8e-41   
ref|XP_010468989.1|  PREDICTED: protein notum homolog                   154   8e-41   
ref|XP_002513692.1|  pectin acetylesterase, putative                    154   8e-41   
ref|XP_008360207.1|  PREDICTED: protein notum homolog isoform X2        154   8e-41   
ref|XP_009401967.1|  PREDICTED: uncharacterized protein LOC103985...    154   8e-41   
ref|XP_008388414.1|  PREDICTED: protein notum homolog                   154   8e-41   
ref|XP_003609911.1|  Pectin acetylesterase                              154   8e-41   
ref|XP_010694126.1|  PREDICTED: protein notum homolog                   154   8e-41   



>emb|CDP15690.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   244 bits (624),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +3

Query  174  LAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAW  353
            L   +ILLRTE FFVDITYV+SAVAKGAVCLDGSPPAYH DRG G GIN+WL+H EGG W
Sbjct  13   LVNVLILLRTEAFFVDITYVESAVAKGAVCLDGSPPAYHLDRGFGAGINSWLVHIEGGGW  72

Query  354  CNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGD  533
            CNNVTTCL RK+TRLGSS +M KQ+AFSG+L N PK NPDFY WNR+KVRYCDGSSFTGD
Sbjct  73   CNNVTTCLDRKNTRLGSSKQMAKQLAFSGILANKPKFNPDFYNWNRVKVRYCDGSSFTGD  132

Query  534  VEAVNPKTNLHFRGARVFVA  593
            VEAVNP TNLH+RGARVFVA
Sbjct  133  VEAVNPATNLHYRGARVFVA  152



>ref|XP_010644665.1| PREDICTED: uncharacterized protein LOC100245856 [Vitis vinifera]
 emb|CBI29219.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  174  LAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAW  353
            LAF +ILL+TEGF+V ITYV SAVAKGAVCLDGSPPAYH D+G G GINNWL+H EGG W
Sbjct  13   LAFSLILLKTEGFYVGITYVDSAVAKGAVCLDGSPPAYHMDKGFGAGINNWLVHIEGGGW  72

Query  354  CNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGD  533
            CNN +TCLAR+D RLGSS +MVKQ+AFSG+L N  K NPDFY WN+IKVRYCDG+SFTGD
Sbjct  73   CNNASTCLARRDNRLGSSKQMVKQIAFSGILSNKQKFNPDFYNWNKIKVRYCDGASFTGD  132

Query  534  VEAVNPKTNLHFRGARVFVA  593
            VEAV+PKTNLH+RGARVF+A
Sbjct  133  VEAVDPKTNLHYRGARVFLA  152



>ref|XP_011073252.1| PREDICTED: protein notum homolog isoform X2 [Sesamum indicum]
Length=398

 Score =   240 bits (613),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 125/148 (84%), Gaps = 1/148 (1%)
 Frame = +3

Query  150  VQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWL  329
            +Q+W V+ +   MI+LRTE FFVDITYVQSAVAKGAVCLDGSPPAYH D+GSG GINNWL
Sbjct  5    LQQWSVF-VVCLMIVLRTESFFVDITYVQSAVAKGAVCLDGSPPAYHIDKGSGAGINNWL  63

Query  330  IHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYC  509
            +H EGG WCNNVTTCLAR  TRLGSS  M KQ+AFSG+  N P+ NPDFY WNRIKVRYC
Sbjct  64   VHVEGGGWCNNVTTCLARTKTRLGSSKLMAKQIAFSGIFSNKPQFNPDFYNWNRIKVRYC  123

Query  510  DGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            DG+SFTGDVE V+P T L++RGARVFVA
Sbjct  124  DGASFTGDVEVVDPATKLYYRGARVFVA  151



>ref|XP_011073171.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
Length=422

 Score =   240 bits (612),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 125/148 (84%), Gaps = 1/148 (1%)
 Frame = +3

Query  150  VQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWL  329
            +Q+W V+ +   MI+LRTE FFVDITYVQSAVAKGAVCLDGSPPAYH D+GSG GINNWL
Sbjct  29   LQQWSVF-VVCLMIVLRTESFFVDITYVQSAVAKGAVCLDGSPPAYHIDKGSGAGINNWL  87

Query  330  IHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYC  509
            +H EGG WCNNVTTCLAR  TRLGSS  M KQ+AFSG+  N P+ NPDFY WNRIKVRYC
Sbjct  88   VHVEGGGWCNNVTTCLARTKTRLGSSKLMAKQIAFSGIFSNKPQFNPDFYNWNRIKVRYC  147

Query  510  DGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            DG+SFTGDVE V+P T L++RGARVFVA
Sbjct  148  DGASFTGDVEVVDPATKLYYRGARVFVA  175



>ref|XP_011082149.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
 ref|XP_011082150.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
 ref|XP_011082151.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
Length=398

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +3

Query  174  LAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAW  353
            L F MI+LRTE F+VDITYV+SAVAKGAVCLDGSPPAYH DRG G GINNWL+H EGG W
Sbjct  12   LVFMMIVLRTESFYVDITYVRSAVAKGAVCLDGSPPAYHLDRGYGTGINNWLVHIEGGGW  71

Query  354  CNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGD  533
            CNNVTTCLARK+ RLGSS  MVKQ+AFSG+L N    NPDFY WNR+KVRYCDG+SFTGD
Sbjct  72   CNNVTTCLARKNNRLGSSKYMVKQLAFSGILNNKANFNPDFYNWNRVKVRYCDGASFTGD  131

Query  534  VEAVNPKTNLHFRGARVFVA  593
            VEAVNP T LH+RGARVF+A
Sbjct  132  VEAVNPVTKLHYRGARVFLA  151



>gb|KCW72726.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=373

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 128/153 (84%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M +  ++ W+   L+   IL+++E F V ITYVQ+AVAKGAVCLDGSPPAYHFD+G G G
Sbjct  1    MADARLRTWLCVILSI-QILIKSEAFNVGITYVQNAVAKGAVCLDGSPPAYHFDKGVGAG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
             NNWLI FEGGAWCNNVTTCLAR+DTRLGSS +MVK+++FSG+L N  K NPDFY WN+I
Sbjct  60   ANNWLILFEGGAWCNNVTTCLARRDTRLGSSKQMVKELSFSGILSNKQKFNPDFYNWNKI  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDG+SFTGDVEAVNP TNLHFRGAR FVA
Sbjct  120  KVRYCDGASFTGDVEAVNPATNLHFRGARAFVA  152



>gb|ACF05806.1| PAE [Litchi chinensis]
Length=399

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = +3

Query  186  MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  365
            +ILL+TEGF V ITYV++AVAKGAVCLDGSPPAYH D+G G GINNWL+H EGG WCNNV
Sbjct  17   LILLKTEGFDVGITYVENAVAKGAVCLDGSPPAYHLDKGFGAGINNWLVHIEGGGWCNNV  76

Query  366  TTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAV  545
            TTCL+RK+TRLGSS KMVK VAFSG+L N  K NPDFY WNRIKVRYCDG+SFTGDVEAV
Sbjct  77   TTCLSRKNTRLGSSKKMVKVVAFSGMLSNKQKFNPDFYNWNRIKVRYCDGASFTGDVEAV  136

Query  546  NPKTNLHFRGARVFVA  593
            NP TNLHFRGARVF+A
Sbjct  137  NPATNLHFRGARVFLA  152



>gb|KCW72723.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   235 bits (600),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 128/153 (84%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M +  ++ W+   L+   IL+++E F V ITYVQ+AVAKGAVCLDGSPPAYHFD+G G G
Sbjct  1    MADARLRTWLCVILSI-QILIKSEAFNVGITYVQNAVAKGAVCLDGSPPAYHFDKGVGAG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
             NNWLI FEGGAWCNNVTTCLAR+DTRLGSS +MVK+++FSG+L N  K NPDFY WN+I
Sbjct  60   ANNWLILFEGGAWCNNVTTCLARRDTRLGSSKQMVKELSFSGILSNKQKFNPDFYNWNKI  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDG+SFTGDVEAVNP TNLHFRGAR FVA
Sbjct  120  KVRYCDGASFTGDVEAVNPATNLHFRGARAFVA  152



>gb|KCW72722.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   235 bits (599),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 128/153 (84%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M +  ++ W+   L+   IL+++E F V ITYVQ+AVAKGAVCLDGSPPAYHFD+G G G
Sbjct  1    MADARLRTWLCVILSI-QILIKSEAFNVGITYVQNAVAKGAVCLDGSPPAYHFDKGVGAG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
             NNWLI FEGGAWCNNVTTCLAR+DTRLGSS +MVK+++FSG+L N  K NPDFY WN+I
Sbjct  60   ANNWLILFEGGAWCNNVTTCLARRDTRLGSSKQMVKELSFSGILSNKQKFNPDFYNWNKI  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDG+SFTGDVEAVNP TNLHFRGAR FVA
Sbjct  120  KVRYCDGASFTGDVEAVNPATNLHFRGARAFVA  152



>gb|KCW72721.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   235 bits (599),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 128/153 (84%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M +  ++ W+   L+   IL+++E F V ITYVQ+AVAKGAVCLDGSPPAYHFD+G G G
Sbjct  1    MADARLRTWLCVILSI-QILIKSEAFNVGITYVQNAVAKGAVCLDGSPPAYHFDKGVGAG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
             NNWLI FEGGAWCNNVTTCLAR+DTRLGSS +MVK+++FSG+L N  K NPDFY WN+I
Sbjct  60   ANNWLILFEGGAWCNNVTTCLARRDTRLGSSKQMVKELSFSGILSNKQKFNPDFYNWNKI  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDG+SFTGDVEAVNP TNLHFRGAR FVA
Sbjct  120  KVRYCDGASFTGDVEAVNPATNLHFRGARAFVA  152



>ref|XP_010056136.1| PREDICTED: protein notum homolog [Eucalyptus grandis]
 gb|KCW72724.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
 gb|KCW72725.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=399

 Score =   235 bits (599),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 128/153 (84%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M +  ++ W+   L+   IL+++E F V ITYVQ+AVAKGAVCLDGSPPAYHFD+G G G
Sbjct  1    MADARLRTWLCVILSI-QILIKSEAFNVGITYVQNAVAKGAVCLDGSPPAYHFDKGVGAG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
             NNWLI FEGGAWCNNVTTCLAR+DTRLGSS +MVK+++FSG+L N  K NPDFY WN+I
Sbjct  60   ANNWLILFEGGAWCNNVTTCLARRDTRLGSSKQMVKELSFSGILSNKQKFNPDFYNWNKI  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDG+SFTGDVEAVNP TNLHFRGAR FVA
Sbjct  120  KVRYCDGASFTGDVEAVNPATNLHFRGARAFVA  152



>gb|KDO40418.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
 gb|KDO40419.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=264

 Score =   230 bits (586),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  186  MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  365
            +ILL+ +GF V ITYV++AV KGAVCLDGSPPAYHFD+G G GINNWL+H EGG WCNNV
Sbjct  17   LILLKADGFNVGITYVENAVVKGAVCLDGSPPAYHFDKGFGAGINNWLVHIEGGGWCNNV  76

Query  366  TTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAV  545
            TTCL RK TRLGSS +MVK VAFSG+L N  K NPDFY WNRIKVRYCDG+SFTGDVEAV
Sbjct  77   TTCLERKKTRLGSSKQMVKVVAFSGMLSNKQKFNPDFYNWNRIKVRYCDGASFTGDVEAV  136

Query  546  NPKTNLHFRGARVFVA  593
            NP  NLHFRGARVF A
Sbjct  137  NPANNLHFRGARVFQA  152



>ref|XP_006432878.1| hypothetical protein CICLE_v100013712mg, partial [Citrus clementina]
 gb|ESR46118.1| hypothetical protein CICLE_v100013712mg, partial [Citrus clementina]
Length=276

 Score =   229 bits (584),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  186  MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  365
            +ILL+ +GF V ITYV++AV KGAVCLDGSPPAYHFD+G G GINNWL+H EGG WCNNV
Sbjct  17   LILLKADGFNVGITYVENAVVKGAVCLDGSPPAYHFDKGFGAGINNWLVHIEGGGWCNNV  76

Query  366  TTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAV  545
            TTCL RK TRLGSS +MVK VAFSG+L N  K NPDFY WNRIKVRYCDG+SFTGDVEAV
Sbjct  77   TTCLERKKTRLGSSKQMVKVVAFSGMLSNKQKFNPDFYNWNRIKVRYCDGASFTGDVEAV  136

Query  546  NPKTNLHFRGARVFVA  593
            NP  NLHFRGARVF A
Sbjct  137  NPANNLHFRGARVFQA  152



>ref|XP_008808358.1| PREDICTED: protein notum homolog [Phoenix dactylifera]
Length=397

 Score =   233 bits (593),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 125/153 (82%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M +  ++ W+ Y L   +I L+ EG+FVDITYV+SAVAKGAVCLDGSPPAYH   G G G
Sbjct  1    MVDAKLRTWI-YALICLLIFLKAEGYFVDITYVESAVAKGAVCLDGSPPAYHLSPGFGSG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            +NNWL+H EGG WCNNVTTCLARK TRLGSS +MVKQ+AFSG+L N    NPDFY WN++
Sbjct  60   VNNWLVHIEGGGWCNNVTTCLARKSTRLGSSRQMVKQIAFSGILNNRQTFNPDFYNWNKV  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDGSSFTGDV+ VNP TNLH+RGARV++A
Sbjct  120  KVRYCDGSSFTGDVKRVNPTTNLHYRGARVWLA  152



>ref|XP_006878664.1| hypothetical protein AMTR_s00011p00266820 [Amborella trichopoda]
 gb|ERM94809.1| hypothetical protein AMTR_s00011p00266820 [Amborella trichopoda]
Length=398

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +3

Query  174  LAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAW  353
            L F +I L+ +GFFVDITYV +AVAKGAVCLDGSPPAYH D+GSG GINNWL+H EGG W
Sbjct  12   LVFLVISLKADGFFVDITYVTTAVAKGAVCLDGSPPAYHLDKGSGSGINNWLVHVEGGGW  71

Query  354  CNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGD  533
            C+NVTTC +RK+TRLGSS +MVKQ+AFSGLLGN    NPDFY WNR+KVRYCDG+SFTGD
Sbjct  72   CSNVTTCFSRKNTRLGSSNQMVKQLAFSGLLGNKASMNPDFYNWNRVKVRYCDGASFTGD  131

Query  534  VEAVNPKTNLHFRGARVFVA  593
            VE V+P T LHFRG R+++A
Sbjct  132  VEEVDPATKLHFRGGRIWLA  151



>gb|KDO40416.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
 gb|KDO40417.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=324

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  186  MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  365
            +ILL+ +GF V ITYV++AV KGAVCLDGSPPAYHFD+G G GINNWL+H EGG WCNNV
Sbjct  17   LILLKADGFNVGITYVENAVVKGAVCLDGSPPAYHFDKGFGAGINNWLVHIEGGGWCNNV  76

Query  366  TTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAV  545
            TTCL RK TRLGSS +MVK VAFSG+L N  K NPDFY WNRIKVRYCDG+SFTGDVEAV
Sbjct  77   TTCLERKKTRLGSSKQMVKVVAFSGMLSNKQKFNPDFYNWNRIKVRYCDGASFTGDVEAV  136

Query  546  NPKTNLHFRGARVFVA  593
            NP  NLHFRGARVF A
Sbjct  137  NPANNLHFRGARVFQA  152



>ref|XP_010942978.1| PREDICTED: uncharacterized protein LOC105060830 isoform X2 [Elaeis 
guineensis]
Length=371

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M +  ++ W+ Y L   +I L+ EG+FVDITYV+SA+AKGAVCLDGSPPAYH   G G G
Sbjct  1    MVDAELRTWI-YALICLLIFLKAEGYFVDITYVESALAKGAVCLDGSPPAYHLSPGFGSG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            +NNWL+H EGG WCNNVTTCLARK++RLGSS  M KQ+AFSG+L N    NPDFY WN++
Sbjct  60   VNNWLVHIEGGGWCNNVTTCLARKNSRLGSSRHMAKQIAFSGILNNRQTFNPDFYNWNKV  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDGSSFTGDVE VNP TNLH+RGARV++A
Sbjct  120  KVRYCDGSSFTGDVERVNPATNLHYRGARVWLA  152



>ref|XP_010942979.1| PREDICTED: uncharacterized protein LOC105060830 isoform X3 [Elaeis 
guineensis]
Length=353

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M +  ++ W+ Y L   +I L+ EG+FVDITYV+SA+AKGAVCLDGSPPAYH   G G G
Sbjct  1    MVDAELRTWI-YALICLLIFLKAEGYFVDITYVESALAKGAVCLDGSPPAYHLSPGFGSG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            +NNWL+H EGG WCNNVTTCLARK++RLGSS  M KQ+AFSG+L N    NPDFY WN++
Sbjct  60   VNNWLVHIEGGGWCNNVTTCLARKNSRLGSSRHMAKQIAFSGILNNRQTFNPDFYNWNKV  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDGSSFTGDVE VNP TNLH+RGARV++A
Sbjct  120  KVRYCDGSSFTGDVERVNPATNLHYRGARVWLA  152



>ref|XP_009794297.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=402

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 126/153 (82%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M N  V++W+ Y L    ++ R EG FV+ITY+ S VAK AVCLDGSPPAYH D+G G G
Sbjct  1    MVNGSVRQWI-YSLLTMSMIFRNEGLFVNITYLLSGVAKEAVCLDGSPPAYHHDKGFGTG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            +N+WLI  EGG WCNNVTTCL+RK+TRLGSS +MVKQ+AFSG+L N P+ NPDFY WNR+
Sbjct  60   VNSWLIQMEGGGWCNNVTTCLSRKNTRLGSSKQMVKQLAFSGILSNKPQFNPDFYNWNRV  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDGSSFTGDV+AVNP TNLHFRGARVF+A
Sbjct  120  KVRYCDGSSFTGDVQAVNPITNLHFRGARVFLA  152



>ref|XP_010942975.1| PREDICTED: protein notum homolog isoform X1 [Elaeis guineensis]
 ref|XP_010942976.1| PREDICTED: protein notum homolog isoform X1 [Elaeis guineensis]
Length=397

 Score =   229 bits (585),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M +  ++ W+ Y L   +I L+ EG+FVDITYV+SA+AKGAVCLDGSPPAYH   G G G
Sbjct  1    MVDAELRTWI-YALICLLIFLKAEGYFVDITYVESALAKGAVCLDGSPPAYHLSPGFGSG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            +NNWL+H EGG WCNNVTTCLARK++RLGSS  M KQ+AFSG+L N    NPDFY WN++
Sbjct  60   VNNWLVHIEGGGWCNNVTTCLARKNSRLGSSRHMAKQIAFSGILNNRQTFNPDFYNWNKV  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDGSSFTGDVE VNP TNLH+RGARV++A
Sbjct  120  KVRYCDGSSFTGDVERVNPATNLHYRGARVWLA  152



>ref|XP_010056135.1| PREDICTED: protein notum homolog [Eucalyptus grandis]
Length=392

 Score =   229 bits (585),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 125/153 (82%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M +  ++ W+   L+   ILL++E   V ITYVQ+AVAKGAVCLDGSPPAYHFD+G G G
Sbjct  1    MADARLRTWLCVILSI-QILLKSEAINVSITYVQNAVAKGAVCLDGSPPAYHFDKGVGAG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
             NNWLI  EGG WCNNVTTCLAR+DTR+GSS +MVK+++FSG+L N  K NPDFY WN+I
Sbjct  60   ANNWLIFVEGGGWCNNVTTCLARRDTRVGSSKQMVKELSFSGILSNKQKFNPDFYNWNKI  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDG+SFTGDVEAVNP TNLHFRGAR FVA
Sbjct  120  KVRYCDGASFTGDVEAVNPATNLHFRGARAFVA  152



>ref|XP_009616254.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=404

 Score =   229 bits (585),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 127/151 (84%), Gaps = 1/151 (1%)
 Frame = +3

Query  141  NLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGIN  320
            ++ V++W+ Y L    ++ RTEG FV+ITY+ S +AKGAVCLDGS PAYH D+G G G+N
Sbjct  5    SVKVKQWI-YSLLTLSMIFRTEGLFVNITYLLSGMAKGAVCLDGSSPAYHHDKGFGTGVN  63

Query  321  NWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKV  500
            +WLI  EGG WCNNVTTCL+RK+TRLGSS +MVKQ+AFSG+L N P+ NPDFY WNR+KV
Sbjct  64   SWLIQMEGGGWCNNVTTCLSRKNTRLGSSKQMVKQLAFSGILSNKPQFNPDFYNWNRVKV  123

Query  501  RYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            RYCDGSSFTGDV+AVNP TNLHFRGARVF+A
Sbjct  124  RYCDGSSFTGDVQAVNPITNLHFRGARVFLA  154



>gb|EYU37455.1| hypothetical protein MIMGU_mgv1a007934mg [Erythranthe guttata]
Length=390

 Score =   229 bits (584),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = +3

Query  183  FMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNN  362
             +ILLRTEG +V+ITYVQ+AVAKGAVCLDGSPPAYH DRG G G+NNWL+  EGG WCNN
Sbjct  10   LVILLRTEGLYVNITYVQTAVAKGAVCLDGSPPAYHLDRGFGAGVNNWLVQIEGGGWCNN  69

Query  363  VTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEA  542
            VTTCLARK  RLGSS +M+KQ+AFS +L + P+ NPDFY WNR+K+RYCDGSSFTGDVEA
Sbjct  70   VTTCLARKTNRLGSSKQMIKQLAFSAILSDKPQFNPDFYNWNRVKIRYCDGSSFTGDVEA  129

Query  543  VNPKTNLHFRGARVFVA  593
            V+P T L++RGARVFVA
Sbjct  130  VDPVTKLYYRGARVFVA  146



>gb|KDO40412.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=373

 Score =   228 bits (582),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = +3

Query  174  LAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAW  353
            L   +ILL+ +GF V ITYV++AV KGAVCLDGSPPAYHFD+G G GINNWL+H EGG W
Sbjct  13   LVCALILLKADGFNVGITYVENAVVKGAVCLDGSPPAYHFDKGFGAGINNWLVHIEGGGW  72

Query  354  CNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGD  533
            CNNVTTCL RK TRLGSS +MVK VAFSG+L N  K NPDFY WNRIKVRYCDG+SFTGD
Sbjct  73   CNNVTTCLERKKTRLGSSKQMVKVVAFSGMLSNKQKFNPDFYNWNRIKVRYCDGASFTGD  132

Query  534  VEAVNPKTNLHFRGARVFVA  593
            VEAVNP  NLHFRGARVF A
Sbjct  133  VEAVNPANNLHFRGARVFQA  152



>ref|XP_006363875.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=402

 Score =   229 bits (584),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 125/153 (82%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M N  VQ+W+ Y      I+ RTEG FV+ITYV S VAKGAVCLDGSPPAYH D+G G G
Sbjct  1    MSNGTVQQWI-YSFVTLSIVFRTEGLFVNITYVLSGVAKGAVCLDGSPPAYHHDKGFGTG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            +N+WLI  EGG WCNN++TCL+RK+TRLGSS +MV+ +AFSG+L N P+ NPDFY WNR+
Sbjct  60   VNSWLIQMEGGGWCNNISTCLSRKNTRLGSSKQMVENLAFSGILSNLPQFNPDFYNWNRV  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KV YCDGSSFTGDV+AVNP TNLHFRGARVF+A
Sbjct  120  KVGYCDGSSFTGDVQAVNPITNLHFRGARVFLA  152



>gb|EYU29130.1| hypothetical protein MIMGU_mgv1a007782mg [Erythranthe guttata]
Length=395

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 121/142 (85%), Gaps = 2/142 (1%)
 Frame = +3

Query  174  LAFFMILL--RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGG  347
            L  +M+++  R E FFVDITYV+SAVAKGAVCLDGS PAYHFD+GSG GINNWL+H EGG
Sbjct  6    LLIYMVIIVGRGESFFVDITYVESAVAKGAVCLDGSAPAYHFDKGSGAGINNWLVHIEGG  65

Query  348  AWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFT  527
             WCNN TTCLAR++ RLGSS +M KQ+AFSG+  N P+ NPDFY WNR+KVRYCDG+SFT
Sbjct  66   GWCNNATTCLARRNGRLGSSKQMAKQIAFSGIFSNKPQFNPDFYNWNRLKVRYCDGASFT  125

Query  528  GDVEAVNPKTNLHFRGARVFVA  593
            GDVEAV+P T L++RGARVFVA
Sbjct  126  GDVEAVDPATKLYYRGARVFVA  147



>gb|EYU29131.1| hypothetical protein MIMGU_mgv1a007782mg [Erythranthe guttata]
Length=394

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 121/142 (85%), Gaps = 2/142 (1%)
 Frame = +3

Query  174  LAFFMILL--RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGG  347
            L  +M+++  R E FFVDITYV+SAVAKGAVCLDGS PAYHFD+GSG GINNWL+H EGG
Sbjct  6    LLIYMVIIVGRGESFFVDITYVESAVAKGAVCLDGSAPAYHFDKGSGAGINNWLVHIEGG  65

Query  348  AWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFT  527
             WCNN TTCLAR++ RLGSS +M KQ+AFSG+  N P+ NPDFY WNR+KVRYCDG+SFT
Sbjct  66   GWCNNATTCLARRNGRLGSSKQMAKQIAFSGIFSNKPQFNPDFYNWNRLKVRYCDGASFT  125

Query  528  GDVEAVNPKTNLHFRGARVFVA  593
            GDVEAV+P T L++RGARVFVA
Sbjct  126  GDVEAVDPATKLYYRGARVFVA  147



>gb|AFK37998.1| unknown [Lotus japonicus]
Length=269

 Score =   224 bits (572),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            + EG  V IT+VQSAVAKGAVCLDGSPPAYHF +G G GINNW++HFEGGAWCNNVTTCL
Sbjct  21   KAEGVAVPITFVQSAVAKGAVCLDGSPPAYHFHKGFGAGINNWIVHFEGGAWCNNVTTCL  80

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
            AR+DTRLGSS KM + ++FSG   N  K NPDFY WNRIKVRYCDGSSFTGDVEAV+PKT
Sbjct  81   ARRDTRLGSSKKMSQTLSFSGFFSNGQKFNPDFYNWNRIKVRYCDGSSFTGDVEAVDPKT  140

Query  558  NLHFRGARVFVA  593
            NLHFRG R+FVA
Sbjct  141  NLHFRGGRIFVA  152



>ref|XP_004509524.1| PREDICTED: uncharacterized protein LOC101493258 isoform X3 [Cicer 
arietinum]
Length=303

 Score =   225 bits (574),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            + EG  V ITYVQSAVAKGAVCLDGSPPAYHFD+G G GI+NW++HFEGG WCNNV+TCL
Sbjct  22   KAEGVAVPITYVQSAVAKGAVCLDGSPPAYHFDKGVGAGIDNWIVHFEGGGWCNNVSTCL  81

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
             R+DTRLGSS KM KQ++FSG   N  K NPDFY WNRIKVRYCDG+SFTGDVEAV+P T
Sbjct  82   DRRDTRLGSSKKMDKQLSFSGFFSNGKKFNPDFYDWNRIKVRYCDGASFTGDVEAVDPAT  141

Query  558  NLHFRGARVFVA  593
            NLHFRGAR+FVA
Sbjct  142  NLHFRGARIFVA  153



>ref|XP_006471634.1| PREDICTED: uncharacterized protein LOC102628021 [Citrus sinensis]
 gb|KDO40413.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=399

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = +3

Query  174  LAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAW  353
            L   +ILL+ +GF V ITYV++AV KGAVCLDGSPPAYHFD+G G GINNWL+H EGG W
Sbjct  13   LVCALILLKADGFNVGITYVENAVVKGAVCLDGSPPAYHFDKGFGAGINNWLVHIEGGGW  72

Query  354  CNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGD  533
            CNNVTTCL RK TRLGSS +MVK VAFSG+L N  K NPDFY WNRIKVRYCDG+SFTGD
Sbjct  73   CNNVTTCLERKKTRLGSSKQMVKVVAFSGMLSNKQKFNPDFYNWNRIKVRYCDGASFTGD  132

Query  534  VEAVNPKTNLHFRGARVFVA  593
            VEAVNP  NLHFRGARVF A
Sbjct  133  VEAVNPANNLHFRGARVFQA  152



>gb|KDO40410.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=437

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  186  MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  365
            +ILL+ +GF V ITYV++AV KGAVCLDGSPPAYHFD+G G GINNWL+H EGG WCNNV
Sbjct  55   LILLKADGFNVGITYVENAVVKGAVCLDGSPPAYHFDKGFGAGINNWLVHIEGGGWCNNV  114

Query  366  TTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAV  545
            TTCL RK TRLGSS +MVK VAFSG+L N  K NPDFY WNRIKVRYCDG+SFTGDVEAV
Sbjct  115  TTCLERKKTRLGSSKQMVKVVAFSGMLSNKQKFNPDFYNWNRIKVRYCDGASFTGDVEAV  174

Query  546  NPKTNLHFRGARVFVA  593
            NP  NLHFRGARVF A
Sbjct  175  NPANNLHFRGARVFQA  190



>gb|KCW72720.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=420

 Score =   228 bits (580),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 121/145 (83%), Gaps = 3/145 (2%)
 Frame = +3

Query  159  WVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHF  338
            WVV  +    ILL++E   V ITYVQ+AVAKGAVCLDGSPPAYHF++G G G NNWL+ F
Sbjct  20   WVVLSI---QILLKSEATNVSITYVQNAVAKGAVCLDGSPPAYHFNKGLGTGANNWLVQF  76

Query  339  EGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGS  518
            EGG WCNNVTTCLAR+DTRLGSS +MVK+VAFSG+L N+   NPDFY WNRIKVRYCDG+
Sbjct  77   EGGGWCNNVTTCLARRDTRLGSSKEMVKEVAFSGILSNNHSFNPDFYNWNRIKVRYCDGA  136

Query  519  SFTGDVEAVNPKTNLHFRGARVFVA  593
            SFTGDVEAV+P T LHFRGAR FVA
Sbjct  137  SFTGDVEAVDPATKLHFRGARAFVA  161



>ref|XP_010434420.1| PREDICTED: protein notum homolog [Camelina sativa]
 ref|XP_010434421.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = +3

Query  153  QKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLI  332
            ++W+V  L   +++++TEG FV+ITYV++AVAKGAVCLDGSPPAYH DRGSG GIN+WLI
Sbjct  5    KQWLVL-LVCSLVMMKTEGLFVNITYVRNAVAKGAVCLDGSPPAYHLDRGSGTGINSWLI  63

Query  333  HFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCD  512
              EGG WCNNVT CL+R  TRLGSS KMV+ +AFS +L N  + NPDFY WNR+KVRYCD
Sbjct  64   QLEGGGWCNNVTNCLSRMHTRLGSSKKMVENLAFSAILSNKKQYNPDFYNWNRVKVRYCD  123

Query  513  GSSFTGDVEAVNPKTNLHFRGARVFVA  593
            GSSFTGDV+AVNP TNLHFRGAR+++A
Sbjct  124  GSSFTGDVQAVNPATNLHFRGARIWLA  150



>ref|XP_010325633.1| PREDICTED: uncharacterized protein LOC101257588 isoform X2 [Solanum 
lycopersicum]
Length=397

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M N  VQ+W+ Y L  F I+  TE  FV+ITYV S VAKGAVCLDGSPPAYH D+G G G
Sbjct  1    MVNGTVQQWI-YSLVTFSIIFGTEALFVNITYVLSGVAKGAVCLDGSPPAYHHDKGFGTG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            +N+WLI  EGG WCNNVTTCL+RK+TRLGSS +MV+ +AFSG+L N P+ NPDFY WNR+
Sbjct  60   VNSWLIQMEGGGWCNNVTTCLSRKNTRLGSSKQMVENLAFSGILSNKPQFNPDFYNWNRV  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KV YCDGSSFTGDV+ VNP T LHFRGARVF+A
Sbjct  120  KVGYCDGSSFTGDVQEVNPITKLHFRGARVFLA  152



>ref|XP_010056129.1| PREDICTED: protein notum homolog isoform X1 [Eucalyptus grandis]
 ref|XP_010056130.1| PREDICTED: protein notum homolog isoform X1 [Eucalyptus grandis]
Length=445

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 121/145 (83%), Gaps = 3/145 (2%)
 Frame = +3

Query  159  WVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHF  338
            WVV  +    ILL++E   V ITYVQ+AVAKGAVCLDGSPPAYHF++G G G NNWL+ F
Sbjct  17   WVVLSI---QILLKSEATNVSITYVQNAVAKGAVCLDGSPPAYHFNKGLGTGANNWLVQF  73

Query  339  EGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGS  518
            EGG WCNNVTTCLAR+DTRLGSS +MVK+VAFSG+L N+   NPDFY WNRIKVRYCDG+
Sbjct  74   EGGGWCNNVTTCLARRDTRLGSSKEMVKEVAFSGILSNNHSFNPDFYNWNRIKVRYCDGA  133

Query  519  SFTGDVEAVNPKTNLHFRGARVFVA  593
            SFTGDVEAV+P T LHFRGAR FVA
Sbjct  134  SFTGDVEAVDPATKLHFRGARAFVA  158



>ref|XP_010056132.1| PREDICTED: protein notum homolog isoform X3 [Eucalyptus grandis]
 gb|KCW72716.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
 gb|KCW72717.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=439

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 121/145 (83%), Gaps = 3/145 (2%)
 Frame = +3

Query  159  WVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHF  338
            WVV  +    ILL++E   V ITYVQ+AVAKGAVCLDGSPPAYHF++G G G NNWL+ F
Sbjct  11   WVVLSI---QILLKSEATNVSITYVQNAVAKGAVCLDGSPPAYHFNKGLGTGANNWLVQF  67

Query  339  EGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGS  518
            EGG WCNNVTTCLAR+DTRLGSS +MVK+VAFSG+L N+   NPDFY WNRIKVRYCDG+
Sbjct  68   EGGGWCNNVTTCLARRDTRLGSSKEMVKEVAFSGILSNNHSFNPDFYNWNRIKVRYCDGA  127

Query  519  SFTGDVEAVNPKTNLHFRGARVFVA  593
            SFTGDVEAV+P T LHFRGAR FVA
Sbjct  128  SFTGDVEAVDPATKLHFRGARAFVA  152



>ref|XP_010325632.1| PREDICTED: protein notum homolog isoform X1 [Solanum lycopersicum]
Length=402

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M N  VQ+W+ Y L  F I+  TE  FV+ITYV S VAKGAVCLDGSPPAYH D+G G G
Sbjct  1    MVNGTVQQWI-YSLVTFSIIFGTEALFVNITYVLSGVAKGAVCLDGSPPAYHHDKGFGTG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            +N+WLI  EGG WCNNVTTCL+RK+TRLGSS +MV+ +AFSG+L N P+ NPDFY WNR+
Sbjct  60   VNSWLIQMEGGGWCNNVTTCLSRKNTRLGSSKQMVENLAFSGILSNKPQFNPDFYNWNRV  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KV YCDGSSFTGDV+ VNP T LHFRGARVF+A
Sbjct  120  KVGYCDGSSFTGDVQEVNPITKLHFRGARVFLA  152



>ref|XP_010056131.1| PREDICTED: protein notum homolog isoform X2 [Eucalyptus grandis]
Length=448

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 121/145 (83%), Gaps = 3/145 (2%)
 Frame = +3

Query  159  WVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHF  338
            WVV  +    ILL++E   V ITYVQ+AVAKGAVCLDGSPPAYHF++G G G NNWL+ F
Sbjct  20   WVVLSI---QILLKSEATNVSITYVQNAVAKGAVCLDGSPPAYHFNKGLGTGANNWLVQF  76

Query  339  EGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGS  518
            EGG WCNNVTTCLAR+DTRLGSS +MVK+VAFSG+L N+   NPDFY WNRIKVRYCDG+
Sbjct  77   EGGGWCNNVTTCLARRDTRLGSSKEMVKEVAFSGILSNNHSFNPDFYNWNRIKVRYCDGA  136

Query  519  SFTGDVEAVNPKTNLHFRGARVFVA  593
            SFTGDVEAV+P T LHFRGAR FVA
Sbjct  137  SFTGDVEAVDPATKLHFRGARAFVA  161



>ref|XP_010439718.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = +3

Query  153  QKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLI  332
            ++W+V  L   +++++TEG FV+ITYV++AVAKGAVCLDGSPPAYH DRGSG G+N+WLI
Sbjct  5    KQWLVL-LVCSLVIMKTEGLFVNITYVRNAVAKGAVCLDGSPPAYHLDRGSGTGVNSWLI  63

Query  333  HFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCD  512
              EGG WCNNVT CL+R  TRLGSS KMV+ +AFS +L N  + NPDFY WNR+KVRYCD
Sbjct  64   QLEGGGWCNNVTNCLSRMHTRLGSSKKMVENLAFSAILSNKKQYNPDFYNWNRVKVRYCD  123

Query  513  GSSFTGDVEAVNPKTNLHFRGARVFVA  593
            GSSFTGDV+AVNP TNLHFRGAR+++A
Sbjct  124  GSSFTGDVQAVNPATNLHFRGARIWLA  150



>ref|NP_193677.2| putative pectinacetylesterase [Arabidopsis thaliana]
 sp|Q6DBP4.1|PAE8_ARATH RecName: Full=Pectin acetylesterase 8; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAT70429.1| At4g19420 [Arabidopsis thaliana]
 gb|AAU45212.1| At4g19420 [Arabidopsis thaliana]
 gb|AEE84180.1| putative pectinacetylesterase [Arabidopsis thaliana]
Length=397

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 125/148 (84%), Gaps = 1/148 (1%)
 Frame = +3

Query  150  VQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWL  329
            +++W++Y L   ++++ TEG FV+IT+V++AVAKGAVCLDGSPPAYH DRGSG GIN+WL
Sbjct  4    LKQWLIY-LVCSLVIMNTEGLFVNITFVRNAVAKGAVCLDGSPPAYHLDRGSGTGINSWL  62

Query  330  IHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYC  509
            I  EGG WCNNVT C++R  TRLGSS KMV+ +AFS +L N  + NPDFY WNR+KVRYC
Sbjct  63   IQLEGGGWCNNVTNCVSRMHTRLGSSKKMVENLAFSAILSNKKQYNPDFYNWNRVKVRYC  122

Query  510  DGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            DG+SFTGDVEAVNP TNLHFRGARV++A
Sbjct  123  DGASFTGDVEAVNPATNLHFRGARVWLA  150



>ref|XP_007158098.1| hypothetical protein PHAVU_002G123900g [Phaseolus vulgaris]
 gb|ESW30092.1| hypothetical protein PHAVU_002G123900g [Phaseolus vulgaris]
Length=400

 Score =   225 bits (573),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 121/153 (79%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            ME   +++W+   L   ++ L  E  +V ITY+Q+AVAKGAVCLDGSPP YHFDRGSG G
Sbjct  1    MEGGRIRQWLNL-LVCALLSLMAEASYVPITYLQNAVAKGAVCLDGSPPGYHFDRGSGTG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            INNWL+ FEGG WCNNVTTCL+RK   LGSS +M KQ+AFSG++ N P  NPDFY WNRI
Sbjct  60   INNWLVAFEGGGWCNNVTTCLSRKTNHLGSSKQMAKQIAFSGIMSNRPMFNPDFYNWNRI  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDGSSFTGDVEAVNP T LHFRGAR+F A
Sbjct  120  KVRYCDGSSFTGDVEAVNPVTKLHFRGARIFAA  152



>ref|XP_010529277.1| PREDICTED: protein notum homolog [Tarenaya hassleriana]
Length=401

 Score =   224 bits (572),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +3

Query  186  MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  365
            ++LLRTEG FV+ITYV++A+AKGAVCLDGSPPAYH D+GSG GINNWLI  EGG WCNNV
Sbjct  17   VVLLRTEGLFVNITYVKTAMAKGAVCLDGSPPAYHLDKGSGTGINNWLIQLEGGGWCNNV  76

Query  366  TTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAV  545
            T C+AR  TRLGSS +M KQ+AFS +L N  + NPDFY WNR+K+RYCDGSSFTGDV+ V
Sbjct  77   TNCIARMHTRLGSSKQMAKQIAFSAILSNRKQYNPDFYNWNRVKIRYCDGSSFTGDVQTV  136

Query  546  NPKTNLHFRGARVFVA  593
            +P TNLHFRGARV++A
Sbjct  137  DPATNLHFRGARVWLA  152



>ref|XP_004509522.1| PREDICTED: uncharacterized protein LOC101493258 isoform X1 [Cicer 
arietinum]
 ref|XP_004509523.1| PREDICTED: uncharacterized protein LOC101493258 isoform X2 [Cicer 
arietinum]
Length=400

 Score =   224 bits (571),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            + EG  V ITYVQSAVAKGAVCLDGSPPAYHFD+G G GI+NW++HFEGG WCNNV+TCL
Sbjct  22   KAEGVAVPITYVQSAVAKGAVCLDGSPPAYHFDKGVGAGIDNWIVHFEGGGWCNNVSTCL  81

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
             R+DTRLGSS KM KQ++FSG   N  K NPDFY WNRIKVRYCDG+SFTGDVEAV+P T
Sbjct  82   DRRDTRLGSSKKMDKQLSFSGFFSNGKKFNPDFYDWNRIKVRYCDGASFTGDVEAVDPAT  141

Query  558  NLHFRGARVFVA  593
            NLHFRGAR+FVA
Sbjct  142  NLHFRGARIFVA  153



>emb|CAA67728.1| pectinacetylesterase precursor [Vigna radiata var. radiata]
Length=399

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            ME     +W+   L   ++LL+ EG  V IT+V++AVAKGAVCLDGSPPAYHF +GSG G
Sbjct  1    METSRKGQWLSV-LICVVLLLKAEGVPVGITFVENAVAKGAVCLDGSPPAYHFHKGSGAG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            INNW++HFEGG WCNNVT+CL+R+DTRLGSS KM  Q++FSG   N  K NPDFY WNRI
Sbjct  60   INNWIVHFEGGGWCNNVTSCLSRRDTRLGSSKKMDTQLSFSGFFSNSKKFNPDFYDWNRI  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDGSSFTGDVEAV+P TNLHFRG+RVF A
Sbjct  120  KVRYCDGSSFTGDVEAVDPATNLHFRGSRVFAA  152



>gb|KDP28068.1| hypothetical protein JCGZ_19476 [Jatropha curcas]
Length=400

 Score =   223 bits (568),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 123/153 (80%), Gaps = 0/153 (0%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M +  + KW+       + + + EG +V ITYV++AVAKGAVCLDGSPPAYH D+G G G
Sbjct  1    MLDPKLSKWLNLLACLLLFVSKIEGLYVGITYVRNAVAKGAVCLDGSPPAYHLDKGFGTG  60

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            INNWL+HFEGG WCNNVTTCL+RK+TRLGSS +M  Q+AFSG+L N  + NPDFY WNR+
Sbjct  61   INNWLVHFEGGGWCNNVTTCLSRKNTRLGSSKQMATQIAFSGILNNRRQFNPDFYNWNRV  120

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            K+RYCDGSSFTGDV+ VNP TNLHFRGAR+++A
Sbjct  121  KIRYCDGSSFTGDVQKVNPATNLHFRGARIWLA  153



>gb|AFK45147.1| unknown [Lotus japonicus]
Length=394

 Score =   222 bits (566),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            + EG  V  T+VQSAVAKGAVCLDGSPPAYHF +G G GINNW++HFEGGAWCNNVTTCL
Sbjct  21   KAEGVAVPTTFVQSAVAKGAVCLDGSPPAYHFHKGFGAGINNWIVHFEGGAWCNNVTTCL  80

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
            AR+DTRLGSS KM + ++FSG   N  K NPDFY WNRIKVRYCDGSSFTGDVEAV+PKT
Sbjct  81   ARRDTRLGSSKKMSQTLSFSGFFSNGQKFNPDFYNWNRIKVRYCDGSSFTGDVEAVDPKT  140

Query  558  NLHFRGARVFVA  593
            NLHFRG R+FVA
Sbjct  141  NLHFRGGRIFVA  152



>ref|XP_002519911.1| pectin acetylesterase, putative [Ricinus communis]
 gb|EEF42515.1| pectin acetylesterase, putative [Ricinus communis]
Length=399

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +3

Query  201  TEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLA  380
            TEG FV+ITYV++AVAKGAVCLDGSPPAYH D+G G GIN+WL+HFEGG WCNN+TTCL+
Sbjct  22   TEGLFVEITYVKNAVAKGAVCLDGSPPAYHLDKGFGTGINSWLVHFEGGGWCNNITTCLS  81

Query  381  RKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTN  560
            RK+TRLGSS +M  Q+AFSG++ N  + NPDFY WNR+K+RYCDGSSFTGDV+AVNP TN
Sbjct  82   RKNTRLGSSKQMGPQIAFSGIMSNRRRYNPDFYNWNRVKIRYCDGSSFTGDVQAVNPATN  141

Query  561  LHFRGARVFVA  593
            LHFRGAR+++A
Sbjct  142  LHFRGARIWLA  152



>ref|XP_010449357.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   222 bits (566),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = +3

Query  153  QKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLI  332
            ++W+V  L   +++++TEG FV+ITYV++AVAKGAVCLDGSPPAYH  RGSG G+N+WLI
Sbjct  5    KQWLVL-LVCSLVIMKTEGLFVNITYVRNAVAKGAVCLDGSPPAYHLHRGSGTGVNSWLI  63

Query  333  HFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCD  512
              EGG WCNNVT CL+R  TRLGSS KMV+ +AFS +L N  + NPDFY WNR+KVRYCD
Sbjct  64   QLEGGGWCNNVTNCLSRMHTRLGSSKKMVENLAFSAILSNKKQYNPDFYNWNRVKVRYCD  123

Query  513  GSSFTGDVEAVNPKTNLHFRGARVFVA  593
            GSSFTGDV+AVNP TNLHFRGAR+++A
Sbjct  124  GSSFTGDVQAVNPATNLHFRGARIWLA  150



>ref|XP_010244169.1| PREDICTED: protein notum homolog [Nelumbo nucifera]
Length=401

 Score =   221 bits (564),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEG  344
            +Y L + ++ L   GF V ITY+QSAVAKGAVCLDGSPPAYH   G G G+NNWL+ FEG
Sbjct  13   LYFLIWTLVTLGANGFNVGITYLQSAVAKGAVCLDGSPPAYHMSPGFGAGVNNWLVFFEG  72

Query  345  GAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSF  524
            G+WCNNVT+CLARK+TRLGSS +M K+V+FSG+L N  K NPDFY WN+IKVRYCDGSSF
Sbjct  73   GSWCNNVTSCLARKNTRLGSSKQMTKEVSFSGILSNKEKFNPDFYNWNKIKVRYCDGSSF  132

Query  525  TGDVEAVNPKTNLHFRGARVFVA  593
            TGDVEAVNP TNLHFRG R+F+A
Sbjct  133  TGDVEAVNPATNLHFRGQRIFLA  155



>ref|XP_008451860.1| PREDICTED: protein notum homolog isoform X1 [Cucumis melo]
Length=401

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 120/156 (77%), Gaps = 4/156 (3%)
 Frame = +3

Query  135  MENLGVQK---WVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGS  305
            M+ +G +K   W+ + +A     L+ +   V ITYVQ A  KGAVCLDGSPPAYHF  G 
Sbjct  1    MKKMGCEKFGLWLFF-VASVQFFLKAQCINVGITYVQDAGIKGAVCLDGSPPAYHFSDGF  59

Query  306  GEGINNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTW  485
            G GINNWLI  EGG WCNNVTTCL R+DTRLGSS KMV Q+AFSG+L N P+ NPDFY W
Sbjct  60   GSGINNWLIQLEGGGWCNNVTTCLQRRDTRLGSSKKMVTQLAFSGILSNKPQFNPDFYNW  119

Query  486  NRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            NRIKVRYCDGSSFTGDVEAV+P TNLHFRGARVF A
Sbjct  120  NRIKVRYCDGSSFTGDVEAVDPATNLHFRGARVFRA  155



>ref|XP_006573492.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=400

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            MEN+ +++W+   +   ++L+ +E  +V IT VQ+AVAKGAVCLDGSPPAYHFD+G G G
Sbjct  1    MENVRIRQWLNLLVCALLLLI-SEASYVPITIVQNAVAKGAVCLDGSPPAYHFDKGFGSG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            INNWL+ FEGG WCNNVTTCLARK  RLGSS +M KQ+AFSG+L N    NPDFY WNRI
Sbjct  60   INNWLVAFEGGGWCNNVTTCLARKTNRLGSSKQMAKQIAFSGILNNRAMFNPDFYNWNRI  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDGSSFTGDVEAVNP T LHFRGAR+F A
Sbjct  120  KVRYCDGSSFTGDVEAVNPVTKLHFRGARIFNA  152



>gb|EEC73846.1| hypothetical protein OsI_08601 [Oryza sativa Indica Group]
Length=291

 Score =   217 bits (553),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = +3

Query  171  GLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGA  350
             L   ++ L  +G FVDITYV SAVAKGAVCLDGSPPAYH  RG G G+N+WL+HFEGG 
Sbjct  12   ALVCALVFLTVDGDFVDITYVASAVAKGAVCLDGSPPAYHLARGFGSGVNSWLVHFEGGG  71

Query  351  WCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTG  530
            WC+NVTTCL RK TRLGSS +M KQ+AFSG+L N P  NPDFY WN++KVRYCDGSSFTG
Sbjct  72   WCSNVTTCLQRKRTRLGSSKQMAKQIAFSGILSNTPDYNPDFYNWNKVKVRYCDGSSFTG  131

Query  531  DVEAVNPKTNLHFRGARVFVA  593
            DVE V+P T LH+RGARV+ A
Sbjct  132  DVEKVDPATKLHYRGARVWQA  152



>gb|KHN41567.1| Protein notum like [Glycine soja]
Length=399

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            +TEG  V IT+V++AVAKGAVCLDGSPPAYHF++GSG GINNW++HFEGG WCNNVTTCL
Sbjct  21   QTEGVPVGITFVENAVAKGAVCLDGSPPAYHFNKGSGAGINNWIVHFEGGGWCNNVTTCL  80

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
            +R+DTRLGSS KM   ++FSG   N  K NPDFY WNRIKVRYCDGSSFTGDVEAV+PKT
Sbjct  81   SRRDTRLGSSKKMDTSLSFSGFFSNSKKFNPDFYDWNRIKVRYCDGSSFTGDVEAVDPKT  140

Query  558  NLHFRGARVFV  590
            NLHFRGARVF 
Sbjct  141  NLHFRGARVFA  151



>ref|XP_002867938.1| pectinacetylesterase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44197.1| pectinacetylesterase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=380

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  195  LRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTC  374
            ++TEG FV+ITYV++AVAKGAVCLDGSPPAYH DRGSG GIN+WLI  EGG WCNNVT C
Sbjct  1    MKTEGLFVNITYVRNAVAKGAVCLDGSPPAYHLDRGSGTGINSWLIQLEGGGWCNNVTNC  60

Query  375  LARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPK  554
            ++R  TRLGSS KMV+ +AFS +L N  + NPDFY WNR+KVRYCDGSSFTGDV+AVNP 
Sbjct  61   VSRMHTRLGSSKKMVENLAFSAILSNKKQYNPDFYNWNRVKVRYCDGSSFTGDVQAVNPA  120

Query  555  TNLHFRGARVFVA  593
            TNLHFRGARV++A
Sbjct  121  TNLHFRGARVWLA  133



>ref|XP_006573491.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
Length=447

 Score =   221 bits (563),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            MEN+ +++W+   +   ++L+ +E  +V IT VQ+AVAKGAVCLDGSPPAYHFD+G G G
Sbjct  1    MENVRIRQWLNLLVCALLLLI-SEASYVPITIVQNAVAKGAVCLDGSPPAYHFDKGFGSG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            INNWL+ FEGG WCNNVTTCLARK  RLGSS +M KQ+AFSG+L N    NPDFY WNRI
Sbjct  60   INNWLVAFEGGGWCNNVTTCLARKTNRLGSSKQMAKQIAFSGILNNRAMFNPDFYNWNRI  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDGSSFTGDVEAVNP T LHFRGAR+F A
Sbjct  120  KVRYCDGSSFTGDVEAVNPVTKLHFRGARIFNA  152



>gb|KHN41756.1| Protein notum like [Glycine soja]
Length=449

 Score =   221 bits (563),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            MEN+ +++W+   +   ++L+ +E  +V IT VQ+AVAKGAVCLDGSPPAYHFD+G G G
Sbjct  1    MENVRIRQWLNLLVCALLLLI-SEASYVPITIVQNAVAKGAVCLDGSPPAYHFDKGFGSG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            INNWL+ FEGG WCNNVTTCLARK  RLGSS +M KQ+AFSG+L N    NPDFY WNRI
Sbjct  60   INNWLVAFEGGGWCNNVTTCLARKTNRLGSSKQMAKQIAFSGILNNRAMFNPDFYNWNRI  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDGSSFTGDVEAVNP T LHFRGAR+F A
Sbjct  120  KVRYCDGSSFTGDVEAVNPVTKLHFRGARIFNA  152



>ref|XP_008451861.1| PREDICTED: protein notum homolog isoform X2 [Cucumis melo]
Length=398

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 117/152 (77%), Gaps = 3/152 (2%)
 Frame = +3

Query  138  ENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGI  317
            E  G+  + V  + FF   L+ +   V ITYVQ A  KGAVCLDGSPPAYHF  G G GI
Sbjct  4    EKFGLWLFFVASVQFF---LKAQCINVGITYVQDAGIKGAVCLDGSPPAYHFSDGFGSGI  60

Query  318  NNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIK  497
            NNWLI  EGG WCNNVTTCL R+DTRLGSS KMV Q+AFSG+L N P+ NPDFY WNRIK
Sbjct  61   NNWLIQLEGGGWCNNVTTCLQRRDTRLGSSKKMVTQLAFSGILSNKPQFNPDFYNWNRIK  120

Query  498  VRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            VRYCDGSSFTGDVEAV+P TNLHFRGARVF A
Sbjct  121  VRYCDGSSFTGDVEAVDPATNLHFRGARVFRA  152



>ref|XP_006599203.1| PREDICTED: uncharacterized protein LOC100781246 isoform X1 [Glycine 
max]
 ref|XP_006599204.1| PREDICTED: uncharacterized protein LOC100781246 isoform X2 [Glycine 
max]
 ref|XP_006599205.1| PREDICTED: uncharacterized protein LOC100781246 isoform X3 [Glycine 
max]
Length=399

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            +TEG  V IT+V++AVAKGAVCLDGSPPAYHF +GSG GINNW++HFEGG WCNNVTTCL
Sbjct  21   QTEGVPVGITFVENAVAKGAVCLDGSPPAYHFHKGSGAGINNWIVHFEGGGWCNNVTTCL  80

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
            +R+DTRLGSS KM   ++FSG   N  K NPDFY WNRIKVRYCDGSSFTGDVEAV+PKT
Sbjct  81   SRRDTRLGSSKKMDTSLSFSGFFSNSKKFNPDFYDWNRIKVRYCDGSSFTGDVEAVDPKT  140

Query  558  NLHFRGARVFV  590
            NLHFRGARVF 
Sbjct  141  NLHFRGARVFA  151



>ref|XP_004172255.1| PREDICTED: protein notum homolog [Cucumis sativus]
 gb|KGN53459.1| hypothetical protein Csa_4G056500 [Cucumis sativus]
Length=398

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 117/152 (77%), Gaps = 3/152 (2%)
 Frame = +3

Query  138  ENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGI  317
            E  G+  + V  + FF   L+ +   V ITYVQ AV KGAVCLDGSPPAYHF  G G GI
Sbjct  4    EKFGLWLFFVASVQFF---LKAQCINVGITYVQDAVIKGAVCLDGSPPAYHFSDGFGSGI  60

Query  318  NNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIK  497
            NNWLI  EGG WCNNVTTCL R+DTRLGSS KMV Q+AFSG+L N P+ NPDFY WNRIK
Sbjct  61   NNWLIQLEGGGWCNNVTTCLQRRDTRLGSSKKMVTQLAFSGILSNKPQFNPDFYNWNRIK  120

Query  498  VRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            VRYCDGSSFTGDVEAV+  TNLHFRGARVF A
Sbjct  121  VRYCDGSSFTGDVEAVDSATNLHFRGARVFRA  152



>ref|XP_010054028.1| PREDICTED: uncharacterized protein LOC104442333 isoform X2 [Eucalyptus 
grandis]
 gb|KCW78411.1| hypothetical protein EUGRSUZ_D02577 [Eucalyptus grandis]
Length=400

 Score =   219 bits (558),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 117/141 (83%), Gaps = 1/141 (1%)
 Frame = +3

Query  174  LAFFMILLRTEGFFVDITYVQ-SAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGA  350
            L F + LL+  G  V ITYV+ SAVA+GAVCLDGSPPAYH DRG G GINNWL+H EGG 
Sbjct  13   LLFLVALLQARGVPVRITYVRNSAVARGAVCLDGSPPAYHLDRGFGTGINNWLVHIEGGG  72

Query  351  WCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTG  530
            WCNNVTTCLARK+TRLGSS +M K++ FSG+L N  + NPDFY WNRIKVRYCDG+SFTG
Sbjct  73   WCNNVTTCLARKNTRLGSSKQMAKEIPFSGILSNKRRYNPDFYNWNRIKVRYCDGASFTG  132

Query  531  DVEAVNPKTNLHFRGARVFVA  593
            D+EAVNP TNLHFRGARV+ A
Sbjct  133  DIEAVNPATNLHFRGARVWQA  153



>ref|XP_010244170.1| PREDICTED: uncharacterized protein LOC104588061 [Nelumbo nucifera]
Length=399

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M N+    W+   L   ++ L+  G  V ITYV++AVAKGAVCLDGSPPAYH D+G G G
Sbjct  1    MINVRAVAWINI-LLCALVALKVNGVNVGITYVETAVAKGAVCLDGSPPAYHLDKGFGSG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            INNWL+H EGG WCNNVTTCLARK+TRLGSS +M+ ++AFSG+L N  + NPDFY WNR+
Sbjct  60   INNWLVHIEGGGWCNNVTTCLARKNTRLGSSKQMLTEIAFSGILSNKQQFNPDFYNWNRV  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDG+SFTGDVEAV+P TNLH+RGARV++A
Sbjct  120  KVRYCDGASFTGDVEAVDPTTNLHYRGARVWLA  152



>ref|XP_007156330.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
 gb|ESW28324.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
Length=397

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = +3

Query  174  LAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAW  353
            L   ++LL+ EG  V IT+V++AVAKGAVCLDGS PAYHF +GSG GINNW++HFEGG W
Sbjct  11   LICVVLLLKAEGVPVGITFVENAVAKGAVCLDGSAPAYHFHKGSGAGINNWIVHFEGGGW  70

Query  354  CNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGD  533
            CNNVT+CL+R+DTRLGSS KM  Q++FSG   N  K N DFY WNRIKVRYCDGSSFTGD
Sbjct  71   CNNVTSCLSRRDTRLGSSKKMDTQLSFSGFFSNSKKFNQDFYDWNRIKVRYCDGSSFTGD  130

Query  534  VEAVNPKTNLHFRGARVFVA  593
            VEAV+P+TNLHFRGARVF A
Sbjct  131  VEAVDPRTNLHFRGARVFAA  150



>ref|XP_007040902.1| Pectinacetylesterase family protein [Theobroma cacao]
 gb|EOY25403.1| Pectinacetylesterase family protein [Theobroma cacao]
Length=401

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  195  LRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTC  374
             +T+G +V ITYVQSAVAKGAVCLDGSPPAYH+DRG G GIN+WLI  EGG WCNNVT+C
Sbjct  20   FKTQGVYVPITYVQSAVAKGAVCLDGSPPAYHWDRGYGTGINSWLIQLEGGGWCNNVTSC  79

Query  375  LARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPK  554
            L RK+T LGSS +MVKQ+ FSG+L N  + NPDFY WNR+KVRYCDGSSFTGDV AVNP 
Sbjct  80   LVRKNTHLGSSKRMVKQIPFSGILNNKHQFNPDFYNWNRVKVRYCDGSSFTGDVAAVNPV  139

Query  555  TNLHFRGARVFVA  593
            TNLHFRGARV++A
Sbjct  140  TNLHFRGARVWLA  152



>ref|XP_006385140.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62937.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=325

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            +T+G +V ITYV+SAVAKGAVCLDGSPPAYH+D+G G GIN+WLIHFEGG WCNNVT+CL
Sbjct  24   KTQGLYVGITYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNNVTSCL  83

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
            +RK T LGSS  M +Q+AFSG++ N    NPDFY WNR+K+RYCDGSSFTGDV+AVNP T
Sbjct  84   SRKKTHLGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPAT  143

Query  558  NLHFRGARVFVA  593
            NLHFRGAR+++A
Sbjct  144  NLHFRGARIWLA  155



>ref|NP_001151183.1| LOC100284816 precursor [Zea mays]
 gb|ACG41900.1| carboxylic ester hydrolase [Zea mays]
Length=398

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M +  +  W    L + + L+  +GF VDITYV+SAVAKGAVCLDGS PAYH  RGSG G
Sbjct  1    MADGSLYAWWCCALGWALALVAADGFLVDITYVESAVAKGAVCLDGSAPAYHLARGSGSG  60

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
             N+WL+HFEGG WCNNVTTCL RK TRLGSS +M  Q+AFSG+L + P  NPDFY WN++
Sbjct  61   ENSWLVHFEGGGWCNNVTTCLQRKRTRLGSSKEMATQIAFSGILSDTPDDNPDFYNWNKV  120

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDGSSFTGDVE V+P T LH+RGAR++ A
Sbjct  121  KVRYCDGSSFTGDVEEVDPATKLHYRGARIWQA  153



>ref|XP_011028483.1| PREDICTED: uncharacterized protein LOC105128479 isoform X3 [Populus 
euphratica]
 ref|XP_011028484.1| PREDICTED: uncharacterized protein LOC105128479 isoform X3 [Populus 
euphratica]
Length=427

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            +T+G +V ITYV+SAVAKGAVCLDGSPPAYH+D+GSG GIN+WLIHFEGG WCNNVT+CL
Sbjct  21   KTQGLYVGITYVKSAVAKGAVCLDGSPPAYHWDKGSGTGINSWLIHFEGGGWCNNVTSCL  80

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
            +RK T LGSS  M +Q+AFSG++ N    NPDFY WNR+K+RYCDGSSFTGDV+AVNP T
Sbjct  81   SRKKTHLGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPAT  140

Query  558  NLHFRGARVFVA  593
            NLHFRGAR+++A
Sbjct  141  NLHFRGARIWLA  152



>ref|XP_007156331.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
 gb|ESW28325.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
Length=417

 Score =   218 bits (554),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = +3

Query  174  LAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAW  353
            L   ++LL+ EG  V IT+V++AVAKGAVCLDGS PAYHF +GSG GINNW++HFEGG W
Sbjct  31   LICVVLLLKAEGVPVGITFVENAVAKGAVCLDGSAPAYHFHKGSGAGINNWIVHFEGGGW  90

Query  354  CNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGD  533
            CNNVT+CL+R+DTRLGSS KM  Q++FSG   N  K N DFY WNRIKVRYCDGSSFTGD
Sbjct  91   CNNVTSCLSRRDTRLGSSKKMDTQLSFSGFFSNSKKFNQDFYDWNRIKVRYCDGSSFTGD  150

Query  534  VEAVNPKTNLHFRGARVFVA  593
            VEAV+P+TNLHFRGARVF A
Sbjct  151  VEAVDPRTNLHFRGARVFAA  170



>ref|NP_001047850.1| Os02g0702400 [Oryza sativa Japonica Group]
 dbj|BAD07550.1| putative pectin acetylesterase [Oryza sativa Japonica Group]
 dbj|BAD08059.1| putative pectin acetylesterase [Oryza sativa Japonica Group]
 dbj|BAF09764.1| Os02g0702400 [Oryza sativa Japonica Group]
 dbj|BAG91018.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57637.1| hypothetical protein OsJ_08062 [Oryza sativa Japonica Group]
Length=397

 Score =   217 bits (553),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = +3

Query  171  GLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGA  350
             L   ++ L  +G FVDITYV SAVAKGAVCLDGSPPAYH  RG G G+N+WL+HFEGG 
Sbjct  12   ALVCALVFLTVDGDFVDITYVASAVAKGAVCLDGSPPAYHLARGFGSGVNSWLVHFEGGG  71

Query  351  WCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTG  530
            WC+NVTTCL RK TRLGSS +M KQ+AFSG+L N P  NPDFY WN++KVRYCDGSSFTG
Sbjct  72   WCSNVTTCLQRKRTRLGSSKQMAKQIAFSGILSNTPDYNPDFYNWNKVKVRYCDGSSFTG  131

Query  531  DVEAVNPKTNLHFRGARVFVA  593
            DVE V+P T LH+RGARV+ A
Sbjct  132  DVEKVDPATKLHYRGARVWQA  152



>ref|XP_009132797.1| PREDICTED: protein notum homolog [Brassica rapa]
Length=397

 Score =   217 bits (552),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 120/147 (82%), Gaps = 1/147 (1%)
 Frame = +3

Query  153  QKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLI  332
            ++W+V  +    IL + EG FV+IT+V++AVA+GAVCLDGSPPAYH  RGSG GIN+WLI
Sbjct  5    KQWLVLVVCSLAIL-KAEGLFVNITFVRNAVARGAVCLDGSPPAYHLHRGSGTGINSWLI  63

Query  333  HFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCD  512
              EGG WCNNVT CL+R  TRLGSS KMV+ +AFS +L N  + NPDFY WNR+KVRYCD
Sbjct  64   QLEGGGWCNNVTNCLSRMHTRLGSSKKMVENLAFSAILSNKKQYNPDFYNWNRVKVRYCD  123

Query  513  GSSFTGDVEAVNPKTNLHFRGARVFVA  593
            GSSFTGDV+AVNP TNLHFRGARV++A
Sbjct  124  GSSFTGDVQAVNPATNLHFRGARVWLA  150



>emb|CDX99377.1| BnaC01g11750D [Brassica napus]
Length=452

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 120/147 (82%), Gaps = 1/147 (1%)
 Frame = +3

Query  153  QKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLI  332
            ++WV+  +    IL + EG FV+IT+V++AVA+GAVCLDGSPPAYH  RGSG GIN+WLI
Sbjct  60   KQWVILVVCSLAIL-KAEGLFVNITFVRNAVARGAVCLDGSPPAYHLHRGSGTGINSWLI  118

Query  333  HFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCD  512
              EGG WCNNVT CL+R  TRLGSS KMV+ +AFS +L N  + NPDFY WNR+KVRYCD
Sbjct  119  QLEGGGWCNNVTNCLSRMHTRLGSSKKMVENLAFSAILSNKKQYNPDFYNWNRVKVRYCD  178

Query  513  GSSFTGDVEAVNPKTNLHFRGARVFVA  593
            GSSFTGDV+AVNP TNLHFRGARV++A
Sbjct  179  GSSFTGDVQAVNPATNLHFRGARVWLA  205



>ref|XP_008238012.1| PREDICTED: protein notum homolog isoform X2 [Prunus mume]
Length=400

 Score =   217 bits (552),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 121/153 (79%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M +  + +W+ + LA  + LL+  G  V+ITYV SA+AKGAVCLDGSPPAYH D+G G G
Sbjct  1    MADAKLGQWL-FLLACAVTLLKAAGVPVEITYVHSAIAKGAVCLDGSPPAYHHDKGFGSG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            INNWL+H EGG WCNNVTTCL RK+TRLGSS +M+K +AFSG+L N    NPDFY WNRI
Sbjct  60   INNWLVHIEGGGWCNNVTTCLGRKNTRLGSSKQMLKAIAFSGILSNRKMFNPDFYNWNRI  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDG+SFTGDV AVNP T L+FRGAR+F A
Sbjct  120  KVRYCDGASFTGDVAAVNPATGLYFRGARIFRA  152



>ref|XP_006413980.1| hypothetical protein EUTSA_v10025385mg [Eutrema salsugineum]
 gb|ESQ55433.1| hypothetical protein EUTSA_v10025385mg [Eutrema salsugineum]
Length=397

 Score =   216 bits (551),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = +3

Query  156  KWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIH  335
            KWV + L   +++L TE  +V+IT+V++AVAKGAVCLDGSPPAYH DRG G GIN+WLI 
Sbjct  6    KWV-FLLVCSLVILETEALYVNITFVRNAVAKGAVCLDGSPPAYHLDRGFGTGINSWLIQ  64

Query  336  FEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDG  515
             EGG WCNNVT C++R  TRLGSS +MV+++AFS +L N  + NPDFY WNR+KVRYCDG
Sbjct  65   LEGGGWCNNVTNCVSRMHTRLGSSKRMVEKLAFSAILSNKRQYNPDFYNWNRVKVRYCDG  124

Query  516  SSFTGDVEAVNPKTNLHFRGARVFVA  593
            SSFTGDV+AVNP TNLHFRGARV++A
Sbjct  125  SSFTGDVQAVNPATNLHFRGARVWLA  150



>ref|XP_010266386.1| PREDICTED: uncharacterized protein LOC104603916 isoform X3 [Nelumbo 
nucifera]
Length=361

 Score =   216 bits (549),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = +3

Query  183  FMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNN  362
             +I L+  G +V ITY++S+VAKGAVCLDGSPPAYH D+G G GINNWL+H EGG WC N
Sbjct  57   ILITLKVNGLYVQITYIKSSVAKGAVCLDGSPPAYHLDKGFGSGINNWLVHIEGGGWCTN  116

Query  363  VTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEA  542
            VTTCL RK+T LGSS KMV ++AFSG+L N+ + NPDFY WNRIKVRYCDG+SFTGD+E 
Sbjct  117  VTTCLFRKNTHLGSSKKMVTEIAFSGILSNNKQFNPDFYNWNRIKVRYCDGASFTGDLEK  176

Query  543  VNPKTNLHFRGARVFVA  593
            V+P TNLH+RGAR+++A
Sbjct  177  VDPVTNLHYRGARIWLA  193



>emb|CDX78933.1| BnaA01g10000D [Brassica napus]
Length=452

 Score =   218 bits (555),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 120/147 (82%), Gaps = 1/147 (1%)
 Frame = +3

Query  153  QKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLI  332
            ++W+V  +    IL + EG FV+IT+V++AVA+GAVCLDGSPPAYH  RGSG GIN+WLI
Sbjct  60   KQWLVLVVCSLAIL-KAEGLFVNITFVRNAVARGAVCLDGSPPAYHLHRGSGTGINSWLI  118

Query  333  HFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCD  512
              EGG WCNNVT CL+R  TRLGSS KMV+ +AFS +L N  + NPDFY WNR+KVRYCD
Sbjct  119  QLEGGGWCNNVTNCLSRMHTRLGSSKKMVENLAFSAILSNKKQYNPDFYNWNRVKVRYCD  178

Query  513  GSSFTGDVEAVNPKTNLHFRGARVFVA  593
            GSSFTGDV+AVNP TNLHFRGARV++A
Sbjct  179  GSSFTGDVQAVNPATNLHFRGARVWLA  205



>ref|XP_008238015.1| PREDICTED: protein notum homolog isoform X5 [Prunus mume]
Length=311

 Score =   214 bits (544),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 122/154 (79%), Gaps = 2/154 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M +  + +W+ + LA  + LL+  G  V+ITYV SA+AKGAVCLDGSPPAYH D+G G G
Sbjct  1    MADAKLGQWL-FLLACAVTLLKAAGVPVEITYVHSAIAKGAVCLDGSPPAYHHDKGFGSG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            INNWL+H EGG WCNNVTTCL RK+TRLGSS +M+K +AFSG+L N    NPDFY WNRI
Sbjct  60   INNWLVHIEGGGWCNNVTTCLGRKNTRLGSSKQMLKAIAFSGILSNRKMFNPDFYNWNRI  119

Query  495  KVRYCDGSSFTGDVEAVNPK-TNLHFRGARVFVA  593
            KVRYCDG+SFTGDV AVNP+ T L+FRGAR+F A
Sbjct  120  KVRYCDGASFTGDVAAVNPQATGLYFRGARIFRA  153



>ref|XP_004150551.1| PREDICTED: protein notum homolog [Cucumis sativus]
Length=539

 Score =   219 bits (559),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 117/152 (77%), Gaps = 3/152 (2%)
 Frame = +3

Query  138  ENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGI  317
            E  G+  + V  + FF   L+ +   V ITYVQ AV KGAVCLDGSPPAYHF  G G GI
Sbjct  4    EKFGLWLFFVASVQFF---LKAQCINVGITYVQDAVIKGAVCLDGSPPAYHFSDGFGSGI  60

Query  318  NNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIK  497
            NNWLI  EGG WCNNVTTCL R+DTRLGSS KMV Q+AFSG+L N P+ NPDFY WNRIK
Sbjct  61   NNWLIQLEGGGWCNNVTTCLQRRDTRLGSSKKMVTQLAFSGILSNKPQFNPDFYNWNRIK  120

Query  498  VRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            VRYCDGSSFTGDVEAV+  TNLHFRGARVF A
Sbjct  121  VRYCDGSSFTGDVEAVDSATNLHFRGARVFRA  152



>ref|XP_008238014.1| PREDICTED: protein notum homolog isoform X4 [Prunus mume]
Length=315

 Score =   214 bits (544),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 122/154 (79%), Gaps = 2/154 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M +  + +W+ + LA  + LL+  G  V+ITYV SA+AKGAVCLDGSPPAYH D+G G G
Sbjct  1    MADAKLGQWL-FLLACAVTLLKAAGVPVEITYVHSAIAKGAVCLDGSPPAYHHDKGFGSG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            INNWL+H EGG WCNNVTTCL RK+TRLGSS +M+K +AFSG+L N    NPDFY WNRI
Sbjct  60   INNWLVHIEGGGWCNNVTTCLGRKNTRLGSSKQMLKAIAFSGILSNRKMFNPDFYNWNRI  119

Query  495  KVRYCDGSSFTGDVEAVNPK-TNLHFRGARVFVA  593
            KVRYCDG+SFTGDV AVNP+ T L+FRGAR+F A
Sbjct  120  KVRYCDGASFTGDVAAVNPQATGLYFRGARIFRA  153



>ref|XP_006385136.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62933.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=391

 Score =   216 bits (550),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            +T+G +V ITYV+SAVAKGAVCLDGSPPAYH+D+G G GIN+WLIHFEGG WCNNVT+CL
Sbjct  24   KTQGLYVGITYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNNVTSCL  83

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
            +RK T LGSS  M +Q+AFSG++ N    NPDFY WNR+K+RYCDGSSFTGDV+AVNP T
Sbjct  84   SRKKTHLGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPAT  143

Query  558  NLHFRGARVFVA  593
            NLHFRGAR+++A
Sbjct  144  NLHFRGARIWLA  155



>ref|XP_011028482.1| PREDICTED: uncharacterized protein LOC105128479 isoform X2 [Populus 
euphratica]
Length=481

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            +T+G +V ITYV+SAVAKGAVCLDGSPPAYH+D+GSG GIN+WLIHFEGG WCNNVT+CL
Sbjct  103  KTQGLYVGITYVKSAVAKGAVCLDGSPPAYHWDKGSGTGINSWLIHFEGGGWCNNVTSCL  162

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
            +RK T LGSS  M +Q+AFSG++ N    NPDFY WNR+K+RYCDGSSFTGDV+AVNP T
Sbjct  163  SRKKTHLGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPAT  222

Query  558  NLHFRGARVFVA  593
            NLHFRGAR+++A
Sbjct  223  NLHFRGARIWLA  234



>gb|KEH20327.1| pectinacetylesterase family protein [Medicago truncatula]
Length=393

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +3

Query  183  FMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNN  362
             ++L   EG  V IT+VQSAVAKGAVCLDGSPPAYHFD+G   GI+NW++HFEGG WCNN
Sbjct  17   LLLLKAAEGVTVPITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDNWIVHFEGGGWCNN  76

Query  363  VTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEA  542
             TTCL R DTRLGSS KM K ++FSG   +  K NPDFY WNRIKVRYCDGSSFTGDVEA
Sbjct  77   ATTCLDRIDTRLGSSKKMDKTLSFSGFFSSGKKFNPDFYNWNRIKVRYCDGSSFTGDVEA  136

Query  543  VNPKTNLHFRGARVFVA  593
            V+PKTNLH+RG R+FVA
Sbjct  137  VDPKTNLHYRGGRIFVA  153



>ref|XP_011028479.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
 ref|XP_011028480.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
 ref|XP_011028481.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
Length=509

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            +T+G +V ITYV+SAVAKGAVCLDGSPPAYH+D+GSG GIN+WLIHFEGG WCNNVT+CL
Sbjct  103  KTQGLYVGITYVKSAVAKGAVCLDGSPPAYHWDKGSGTGINSWLIHFEGGGWCNNVTSCL  162

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
            +RK T LGSS  M +Q+AFSG++ N    NPDFY WNR+K+RYCDGSSFTGDV+AVNP T
Sbjct  163  SRKKTHLGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPAT  222

Query  558  NLHFRGARVFVA  593
            NLHFRGAR+++A
Sbjct  223  NLHFRGARIWLA  234



>gb|ACJ85294.1| unknown [Medicago truncatula]
 gb|AFK37076.1| unknown [Medicago truncatula]
Length=393

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +3

Query  183  FMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNN  362
             ++L  TEG  V IT+VQSAVAKGAVCLDGSPPAYHFD+G   GI+NW++HFEGG WCNN
Sbjct  17   LLLLKATEGVTVPITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDNWIVHFEGGGWCNN  76

Query  363  VTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEA  542
             TTCL R DTRLG S KM K ++FSG   +  K NPDFY WNRIKVRYCDGSSFTGDVEA
Sbjct  77   ATTCLDRIDTRLGPSKKMDKTLSFSGFFSSGKKFNPDFYNWNRIKVRYCDGSSFTGDVEA  136

Query  543  VNPKTNLHFRGARVFVA  593
            V+PKTNLH+RG R+FVA
Sbjct  137  VDPKTNLHYRGGRIFVA  153



>ref|XP_003628995.1| Notum-like protein [Medicago truncatula]
Length=396

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +3

Query  183  FMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNN  362
             ++L   EG  V IT+VQSAVAKGAVCLDGSPPAYHFD+G   GI+NW++HFEGG WCNN
Sbjct  20   LLLLKAAEGVTVPITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDNWIVHFEGGGWCNN  79

Query  363  VTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEA  542
             TTCL R DTRLGSS KM K ++FSG   +  K NPDFY WNRIKVRYCDGSSFTGDVEA
Sbjct  80   ATTCLDRIDTRLGSSKKMDKTLSFSGFFSSGKKFNPDFYNWNRIKVRYCDGSSFTGDVEA  139

Query  543  VNPKTNLHFRGARVFVA  593
            V+PKTNLH+RG R+FVA
Sbjct  140  VDPKTNLHYRGGRIFVA  156



>ref|XP_008238013.1| PREDICTED: protein notum homolog isoform X3 [Prunus mume]
Length=316

 Score =   213 bits (543),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 122/154 (79%), Gaps = 2/154 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M +  + +W+ + LA  + LL+  G  V+ITYV SA+AKGAVCLDGSPPAYH D+G G G
Sbjct  1    MADAKLGQWL-FLLACAVTLLKAAGVPVEITYVHSAIAKGAVCLDGSPPAYHHDKGFGSG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            INNWL+H EGG WCNNVTTCL RK+TRLGSS +M+K +AFSG+L N    NPDFY WNRI
Sbjct  60   INNWLVHIEGGGWCNNVTTCLGRKNTRLGSSKQMLKAIAFSGILSNRKMFNPDFYNWNRI  119

Query  495  KVRYCDGSSFTGDVEAVNPK-TNLHFRGARVFVA  593
            KVRYCDG+SFTGDV AVNP+ T L+FRGAR+F A
Sbjct  120  KVRYCDGASFTGDVAAVNPQATGLYFRGARIFRA  153



>gb|ACG39759.1| carboxylic ester hydrolase [Zea mays]
Length=398

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 117/153 (76%), Gaps = 0/153 (0%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M +  +  W    L + + L+  +GF VDITYV+SAVAKGAVCLDGS PAYH  RGSG G
Sbjct  1    MADGSLYAWWCCALGWALALVAADGFLVDITYVESAVAKGAVCLDGSAPAYHLARGSGSG  60

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
              +WL+HFEGG WCNNVTTCL RK TRLGSS +M  Q+AFSG+L + P  NPDFY WN++
Sbjct  61   EKSWLVHFEGGGWCNNVTTCLQRKRTRLGSSKEMATQIAFSGILSDTPDDNPDFYNWNKV  120

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDGSSFTGDVE V+P T LH+RGAR++ A
Sbjct  121  KVRYCDGSSFTGDVEEVDPATKLHYRGARIWQA  153



>ref|XP_006587657.1| PREDICTED: protein notum homolog isoform X3 [Glycine max]
 gb|KHN11801.1| Protein notum like [Glycine soja]
Length=400

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 121/153 (79%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            MEN  + +W++  +   ++L+ +E  +V IT VQ+AVAKGAVCLDGSPPAYHFDRG G G
Sbjct  1    MENARISQWLILLVCALLLLI-SEASYVPITIVQNAVAKGAVCLDGSPPAYHFDRGFGSG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            INNWL+ FEGG WCNNVTTCLARK  RLGSS +M K +AFSG+L N    NPDFY WNRI
Sbjct  60   INNWLVAFEGGGWCNNVTTCLARKTNRLGSSKQMAKLIAFSGILNNREMFNPDFYNWNRI  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDGSSFTGDVEAVNP T LHFRG R+F A
Sbjct  120  KVRYCDGSSFTGDVEAVNPVTKLHFRGGRIFNA  152



>ref|XP_009108427.1| PREDICTED: protein notum homolog [Brassica rapa]
Length=397

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 120/147 (82%), Gaps = 1/147 (1%)
 Frame = +3

Query  153  QKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLI  332
            ++W+V  +    IL + EG  V+IT+V++AVAKGAVCLDGSPPAYH DRGSG GIN+WLI
Sbjct  5    KQWLVLVVCSLAIL-KAEGLLVNITFVRNAVAKGAVCLDGSPPAYHIDRGSGTGINSWLI  63

Query  333  HFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCD  512
              EGG WC+NVT C++R  T+LGSS KMV+ +AFS +L N  +RNPDFY WNR+KVRYCD
Sbjct  64   QLEGGGWCHNVTNCISRMHTKLGSSKKMVENLAFSAILSNKEQRNPDFYNWNRVKVRYCD  123

Query  513  GSSFTGDVEAVNPKTNLHFRGARVFVA  593
            GSSFTGDV+ VNP TNLHFRGARV++A
Sbjct  124  GSSFTGDVKTVNPATNLHFRGARVWLA  150



>emb|CDY09289.1| BnaC03g63190D [Brassica napus]
Length=397

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 120/150 (80%), Gaps = 1/150 (1%)
 Frame = +3

Query  144  LGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINN  323
            +   +W+V  +    IL + EG  V+IT+V++AVAKGAVCLDGSPPAYH DRGSG GIN+
Sbjct  2    INFNQWLVLVVCSLAIL-KAEGLLVNITFVRNAVAKGAVCLDGSPPAYHLDRGSGTGINS  60

Query  324  WLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVR  503
            WLI  EGG WC+NVT C++R  T+LGSS KMV+ +AFS +L N  +RNPDFY WNR+KVR
Sbjct  61   WLIQLEGGGWCHNVTNCISRMHTKLGSSKKMVENLAFSAILSNKEQRNPDFYNWNRVKVR  120

Query  504  YCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            YCDGSSFTGDV+ VNP TNLHFRGARV++A
Sbjct  121  YCDGSSFTGDVKTVNPATNLHFRGARVWLA  150



>ref|XP_006385138.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62935.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=402

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            +T+G +V ITYV+SAVAKGAVCLDGSPPAYH+D+G G GIN+WLIHFEGG WCNNVT+CL
Sbjct  24   KTQGLYVGITYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNNVTSCL  83

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
            +RK T LGSS  M +Q+AFSG++ N    NPDFY WNR+K+RYCDGSSFTGDV+AVNP T
Sbjct  84   SRKKTHLGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPAT  143

Query  558  NLHFRGARVFVA  593
            NLHFRGAR+++A
Sbjct  144  NLHFRGARIWLA  155



>ref|XP_010266384.1| PREDICTED: uncharacterized protein LOC104603916 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010266385.1| PREDICTED: uncharacterized protein LOC104603916 isoform X2 [Nelumbo 
nucifera]
Length=391

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = +3

Query  183  FMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNN  362
             +I L+  G +V ITY++S+VAKGAVCLDGSPPAYH D+G G GINNWL+H EGG WC N
Sbjct  14   ILITLKVNGLYVQITYIKSSVAKGAVCLDGSPPAYHLDKGFGSGINNWLVHIEGGGWCTN  73

Query  363  VTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEA  542
            VTTCL RK+T LGSS KMV ++AFSG+L N+ + NPDFY WNRIKVRYCDG+SFTGD+E 
Sbjct  74   VTTCLFRKNTHLGSSKKMVTEIAFSGILSNNKQFNPDFYNWNRIKVRYCDGASFTGDLEK  133

Query  543  VNPKTNLHFRGARVFVA  593
            V+P TNLH+RGAR+++A
Sbjct  134  VDPVTNLHYRGARIWLA  150



>ref|XP_006385137.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 ref|XP_006385139.1| pectinacetylesterase family protein [Populus trichocarpa]
 gb|ERP62934.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62936.1| pectinacetylesterase family protein [Populus trichocarpa]
Length=399

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            +T+G +V ITYV+SAVAKGAVCLDGSPPAYH+D+G G GIN+WLIHFEGG WCNNVT+CL
Sbjct  21   KTQGLYVGITYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNNVTSCL  80

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
            +RK T LGSS  M +Q+AFSG++ N    NPDFY WNR+K+RYCDGSSFTGDV+AVNP T
Sbjct  81   SRKKTHLGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPAT  140

Query  558  NLHFRGARVFVA  593
            NLHFRGAR+++A
Sbjct  141  NLHFRGARIWLA  152



>ref|XP_009398466.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398467.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398468.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398469.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=395

 Score =   214 bits (546),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            + E  FVDITYV+SA+ KGAVCLDGSPPAYH   G G G+NNWL+H EGG WCNN+TTCL
Sbjct  20   KAEANFVDITYVESAIPKGAVCLDGSPPAYHLSPGFGSGVNNWLVHLEGGGWCNNITTCL  79

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
            ARK+TRLGSS +M KQ+AFSG+L N    NPDFY WN++KVRYCDGSSFTGDVE V+P T
Sbjct  80   ARKNTRLGSSGQMAKQLAFSGILSNTQSFNPDFYNWNKVKVRYCDGSSFTGDVERVDPAT  139

Query  558  NLHFRGARVFVA  593
            NLH+RGARV++A
Sbjct  140  NLHYRGARVWLA  151



>ref|XP_006587655.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
Length=453

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 121/153 (79%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            MEN  + +W++  +   ++L+ +E  +V IT VQ+AVAKGAVCLDGSPPAYHFDRG G G
Sbjct  1    MENARISQWLILLVCALLLLI-SEASYVPITIVQNAVAKGAVCLDGSPPAYHFDRGFGSG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            INNWL+ FEGG WCNNVTTCLARK  RLGSS +M K +AFSG+L N    NPDFY WNRI
Sbjct  60   INNWLVAFEGGGWCNNVTTCLARKTNRLGSSKQMAKLIAFSGILNNREMFNPDFYNWNRI  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDGSSFTGDVEAVNP T LHFRG R+F A
Sbjct  120  KVRYCDGSSFTGDVEAVNPVTKLHFRGGRIFNA  152



>gb|AET03471.2| pectinacetylesterase family protein [Medicago truncatula]
Length=424

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +3

Query  183  FMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNN  362
             ++L   EG  V IT+VQSAVAKGAVCLDGSPPAYHFD+G   GI+NW++HFEGG WCNN
Sbjct  48   LLLLKAAEGVTVPITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDNWIVHFEGGGWCNN  107

Query  363  VTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEA  542
             TTCL R DTRLGSS KM K ++FSG   +  K NPDFY WNRIKVRYCDGSSFTGDVEA
Sbjct  108  ATTCLDRIDTRLGSSKKMDKTLSFSGFFSSGKKFNPDFYNWNRIKVRYCDGSSFTGDVEA  167

Query  543  VNPKTNLHFRGARVFVA  593
            V+PKTNLH+RG R+FVA
Sbjct  168  VDPKTNLHYRGGRIFVA  184



>ref|XP_006587656.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=450

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 121/153 (79%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            MEN  + +W++  +   ++L+ +E  +V IT VQ+AVAKGAVCLDGSPPAYHFDRG G G
Sbjct  1    MENARISQWLILLVCALLLLI-SEASYVPITIVQNAVAKGAVCLDGSPPAYHFDRGFGSG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            INNWL+ FEGG WCNNVTTCLARK  RLGSS +M K +AFSG+L N    NPDFY WNRI
Sbjct  60   INNWLVAFEGGGWCNNVTTCLARKTNRLGSSKQMAKLIAFSGILNNREMFNPDFYNWNRI  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDGSSFTGDVEAVNP T LHFRG R+F A
Sbjct  120  KVRYCDGSSFTGDVEAVNPVTKLHFRGGRIFNA  152



>ref|XP_007209211.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
 ref|XP_007209212.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
 gb|EMJ10410.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
 gb|EMJ10411.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
Length=400

 Score =   214 bits (546),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 120/153 (78%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M +  + +W+ + LA  + LL+  G  V+ITYV SA+AKGAVCLDGSPPAYH D+G G G
Sbjct  1    MADARLGQWL-FLLACAVTLLKAAGVPVEITYVHSAIAKGAVCLDGSPPAYHHDKGFGSG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            INNWL+H EGG WCNNVT CL RK+TRLGSS +M+K +AFSG+L N    NPDFY WNRI
Sbjct  60   INNWLVHIEGGGWCNNVTNCLGRKNTRLGSSKQMLKAIAFSGILSNRKMFNPDFYNWNRI  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDG+SFTGDV AVNP T L+FRGAR+F A
Sbjct  120  KVRYCDGASFTGDVAAVNPATGLYFRGARIFRA  152



>ref|XP_006385134.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62931.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=430

 Score =   215 bits (548),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            +T+G +V ITYV+SAVAKGAVCLDGSPPAYH+D+G G GIN+WLIHFEGG WCNNVT+CL
Sbjct  24   KTQGLYVGITYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNNVTSCL  83

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
            +RK T LGSS  M +Q+AFSG++ N    NPDFY WNR+K+RYCDGSSFTGDV+AVNP T
Sbjct  84   SRKKTHLGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPAT  143

Query  558  NLHFRGARVFVA  593
            NLHFRGAR+++A
Sbjct  144  NLHFRGARIWLA  155



>ref|XP_004953591.1| PREDICTED: protein notum homolog isoform X2 [Setaria italica]
Length=315

 Score =   212 bits (539),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = +3

Query  159  WVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHF  338
            W     +    L++ +   VDITYV+SAVAKGAVCLDGS PAYH  RGSG G+N+WL+HF
Sbjct  12   WCCALASALSALVKVDALLVDITYVESAVAKGAVCLDGSAPAYHLARGSGSGVNSWLVHF  71

Query  339  EGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGS  518
            EGG WC+NVTTCL RK TRLGSS +M  Q+AFSG+L + P  NPDFY WN++KVRYCDGS
Sbjct  72   EGGGWCSNVTTCLQRKRTRLGSSKEMATQIAFSGILSDTPDYNPDFYNWNKVKVRYCDGS  131

Query  519  SFTGDVEAVNPKTNLHFRGARVFVA  593
            SFTGDVE V+P T LH+RGAR++ A
Sbjct  132  SFTGDVEEVDPTTKLHYRGARIWQA  156



>gb|EMT14315.1| hypothetical protein F775_08483 [Aegilops tauschii]
Length=400

 Score =   214 bits (546),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +3

Query  171  GLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGA  350
              A  + +L  +G+FVDITYV+SAVAKGAVCLDGSPPAYH  RGSG G ++WL+HFEGG 
Sbjct  13   AFACALAVLEADGYFVDITYVESAVAKGAVCLDGSPPAYHLARGSGSGASSWLVHFEGGG  72

Query  351  WCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNP-DFYTWNRIKVRYCDGSSFT  527
            WCNNVTTCL R  TRLGSS +M KQVAFSG+L N P+ NP DFY WN+++VRYCDGSSFT
Sbjct  73   WCNNVTTCLQRSHTRLGSSKEMAKQVAFSGILSNAPEYNPVDFYNWNKVRVRYCDGSSFT  132

Query  528  GDVEAVNPKTNLHFRGARVFVA  593
            G+ E V+P+TNLH+RGARV+ A
Sbjct  133  GNKEEVDPRTNLHYRGARVWQA  154



>ref|XP_010266381.1| PREDICTED: uncharacterized protein LOC104603915 isoform X2 [Nelumbo 
nucifera]
Length=399

 Score =   214 bits (546),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 115/144 (80%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  VVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFE  341
            ++Y L   +I ++  GFFV ITYV++++AKGAVCLDGSPPAYH D+G G GINNWL+H E
Sbjct  9    LLYLLICTLITMKANGFFVGITYVENSIAKGAVCLDGSPPAYHMDKGFGSGINNWLVHLE  68

Query  342  GGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSS  521
            GG WC+NVT CLA KDTR GSS KM KQ+AFSG+L N    NPDFY WN+IKVRYCDGSS
Sbjct  69   GGGWCSNVTICLAHKDTRHGSSKKMAKQIAFSGILSNKENFNPDFYNWNKIKVRYCDGSS  128

Query  522  FTGDVEAVNPKTNLHFRGARVFVA  593
            FTGDVEA++P  NL+ RG RV+ A
Sbjct  129  FTGDVEAIDPANNLYLRGERVWQA  152



>gb|AGT16732.1| carboxylic ester hydrolase [Saccharum hybrid cultivar R570]
Length=398

 Score =   214 bits (545),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 116/153 (76%), Gaps = 0/153 (0%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M +  V  W    L   + L+  +G  VDITYV+SAVAKGAVCLDGS PAYH  RGSG G
Sbjct  1    MADASVCAWWCCALVCALALVAADGLLVDITYVESAVAKGAVCLDGSAPAYHLARGSGSG  60

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
             N+WL+HFEGG WCNNVTTCL RK TRLGSS +MV Q+AFSG+L + P  NPDFY WN++
Sbjct  61   ENSWLVHFEGGGWCNNVTTCLQRKRTRLGSSKEMVTQIAFSGILSDTPDGNPDFYNWNKV  120

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDGSSFTGDVE V+  T LH+RGAR++ A
Sbjct  121  KVRYCDGSSFTGDVEEVDLTTKLHYRGARIWQA  153



>ref|XP_010536220.1| PREDICTED: protein notum homolog isoform X1 [Tarenaya hassleriana]
Length=399

 Score =   214 bits (545),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  201  TEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLA  380
             E  FVDITYVQ AVAKGAVCLDGSPPAYH DRGSG GINNWLI  EGG WCNNVT C+A
Sbjct  22   AEALFVDITYVQKAVAKGAVCLDGSPPAYHLDRGSGTGINNWLIQLEGGGWCNNVTNCVA  81

Query  381  RKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTN  560
            R  T LGSS +M KQ+AFS +L N  + NPDFY WNR+K+RYCDGSSFTGDV+ V+P TN
Sbjct  82   RMRTHLGSSKQMAKQIAFSAILSNRRQYNPDFYNWNRVKIRYCDGSSFTGDVQTVDPDTN  141

Query  561  LHFRGARVFVA  593
            LHFRG RV++A
Sbjct  142  LHFRGGRVWLA  152



>ref|XP_010266380.1| PREDICTED: uncharacterized protein LOC104603915 isoform X1 [Nelumbo 
nucifera]
Length=412

 Score =   214 bits (546),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 115/144 (80%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  VVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFE  341
            ++Y L   +I ++  GFFV ITYV++++AKGAVCLDGSPPAYH D+G G GINNWL+H E
Sbjct  22   LLYLLICTLITMKANGFFVGITYVENSIAKGAVCLDGSPPAYHMDKGFGSGINNWLVHLE  81

Query  342  GGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSS  521
            GG WC+NVT CLA KDTR GSS KM KQ+AFSG+L N    NPDFY WN+IKVRYCDGSS
Sbjct  82   GGGWCSNVTICLAHKDTRHGSSKKMAKQIAFSGILSNKENFNPDFYNWNKIKVRYCDGSS  141

Query  522  FTGDVEAVNPKTNLHFRGARVFVA  593
            FTGDVEA++P  NL+ RG RV+ A
Sbjct  142  FTGDVEAIDPANNLYLRGERVWQA  165



>ref|XP_010266383.1| PREDICTED: uncharacterized protein LOC104603916 isoform X1 [Nelumbo 
nucifera]
Length=434

 Score =   215 bits (547),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = +3

Query  183  FMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNN  362
             +I L+  G +V ITY++S+VAKGAVCLDGSPPAYH D+G G GINNWL+H EGG WC N
Sbjct  57   ILITLKVNGLYVQITYIKSSVAKGAVCLDGSPPAYHLDKGFGSGINNWLVHIEGGGWCTN  116

Query  363  VTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEA  542
            VTTCL RK+T LGSS KMV ++AFSG+L N+ + NPDFY WNRIKVRYCDG+SFTGD+E 
Sbjct  117  VTTCLFRKNTHLGSSKKMVTEIAFSGILSNNKQFNPDFYNWNRIKVRYCDGASFTGDLEK  176

Query  543  VNPKTNLHFRGARVFVA  593
            V+P TNLH+RGAR+++A
Sbjct  177  VDPVTNLHYRGARIWLA  193



>gb|EYU29129.1| hypothetical protein MIMGU_mgv1a023759mg [Erythranthe guttata]
Length=384

 Score =   213 bits (542),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = +3

Query  183  FMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNN  362
             +I+LRTE  +VDITYV+SAVAKGAVCLDGSPPAYH D+GSG+G NNWLIH EGG WCNN
Sbjct  1    MIIVLRTESSYVDITYVESAVAKGAVCLDGSPPAYHLDKGSGDGTNNWLIHLEGGGWCNN  60

Query  363  VTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEA  542
            VTTC++R +  LGSS  M  +  F G+  N P+ NPDFY WNR+ VRYCDG+SFTGD+EA
Sbjct  61   VTTCISRANGHLGSSKHMSNRTMFFGIANNDPQFNPDFYNWNRVVVRYCDGASFTGDIEA  120

Query  543  VNPKTNLHFRGARVFVA  593
            V+P TNL++RGARVFVA
Sbjct  121  VDPATNLYYRGARVFVA  137



>ref|XP_009627060.1| PREDICTED: uncharacterized protein LOC104117690 [Nicotiana tomentosiformis]
 ref|XP_009627061.1| PREDICTED: uncharacterized protein LOC104117690 [Nicotiana tomentosiformis]
Length=402

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +3

Query  204  EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  383
            EG  VDITY+QSAVAKGAVCLDGSPPAYHFD+G G G+NNW I  EGGAWCNN TTCL+R
Sbjct  23   EGHPVDITYLQSAVAKGAVCLDGSPPAYHFDKGFGAGVNNWFIQLEGGAWCNNATTCLSR  82

Query  384  KDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNL  563
              TRLGSS  MVK V+FSG+L N  K NPDFY WNRI++RYCDGSSFTGDVEAV+PKT +
Sbjct  83   TKTRLGSSKLMVKTVSFSGILSNKAKFNPDFYNWNRIRIRYCDGSSFTGDVEAVDPKTKV  142

Query  564  HFRGARVFVA  593
            ++RGAR+F A
Sbjct  143  YYRGARIFSA  152



>ref|XP_010235850.1| PREDICTED: protein notum homolog isoform X1 [Brachypodium distachyon]
 ref|XP_010235851.1| PREDICTED: protein notum homolog isoform X1 [Brachypodium distachyon]
Length=395

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 113/141 (80%), Gaps = 0/141 (0%)
 Frame = +3

Query  171  GLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGA  350
              A  +  L  +GFFVDITYV SAVAKGAVCLDGS PAYH  RG G G+++WL+HFEGG 
Sbjct  14   AFACALAFLGADGFFVDITYVDSAVAKGAVCLDGSAPAYHLARGFGSGVDSWLVHFEGGG  73

Query  351  WCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTG  530
            WC+NVTTCL RK+TRLGSS +M KQVAFSG+L N P  NPDFY WN+++VRYCDGSSFTG
Sbjct  74   WCSNVTTCLERKNTRLGSSKEMAKQVAFSGILSNTPDHNPDFYNWNKVRVRYCDGSSFTG  133

Query  531  DVEAVNPKTNLHFRGARVFVA  593
            D E V+P T LH+RGARV+ A
Sbjct  134  DKEEVDPTTKLHYRGARVWQA  154



>ref|XP_008238011.1| PREDICTED: protein notum homolog isoform X1 [Prunus mume]
Length=401

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 122/154 (79%), Gaps = 2/154 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M +  + +W+ + LA  + LL+  G  V+ITYV SA+AKGAVCLDGSPPAYH D+G G G
Sbjct  1    MADAKLGQWL-FLLACAVTLLKAAGVPVEITYVHSAIAKGAVCLDGSPPAYHHDKGFGSG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            INNWL+H EGG WCNNVTTCL RK+TRLGSS +M+K +AFSG+L N    NPDFY WNRI
Sbjct  60   INNWLVHIEGGGWCNNVTTCLGRKNTRLGSSKQMLKAIAFSGILSNRKMFNPDFYNWNRI  119

Query  495  KVRYCDGSSFTGDVEAVNPK-TNLHFRGARVFVA  593
            KVRYCDG+SFTGDV AVNP+ T L+FRGAR+F A
Sbjct  120  KVRYCDGASFTGDVAAVNPQATGLYFRGARIFRA  153



>ref|XP_006361581.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=387

 Score =   212 bits (540),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +3

Query  183  FMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNN  362
             +I+  TEG  VDITY+QSAVAKGAVCLDGSPPAYHFD+G G G+NNWLI  EGGAWCNN
Sbjct  16   LLIVFITEGHPVDITYLQSAVAKGAVCLDGSPPAYHFDKGFGAGVNNWLIQLEGGAWCNN  75

Query  363  VTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEA  542
             TTCLAR  TRLGSS  M+K V+FSG+L N  + NPDFY WNRI+++YCDGSSFTGDV A
Sbjct  76   ATTCLARTKTRLGSSKLMLKTVSFSGILSNKAEFNPDFYNWNRIRIKYCDGSSFTGDVAA  135

Query  543  VNPKTNLHFRGARVFVA  593
             +PKT + +RGAR+F A
Sbjct  136  ADPKTKVFYRGARIFSA  152



>gb|EPS71696.1| hypothetical protein M569_03061, partial [Genlisea aurea]
Length=395

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 114/142 (80%), Gaps = 4/142 (3%)
 Frame = +3

Query  180  FFMILL----RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGG  347
             F++L+    ++EG FV ITYV  AV KGAVCLDGSPPAYH D GSG G N+WL+H EGG
Sbjct  2    LFLVLITVSGKSEGSFVGITYVDGAVEKGAVCLDGSPPAYHLDLGSGAGANSWLVHVEGG  61

Query  348  AWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFT  527
             WCNNVTTCLAR+DTRLGSS +M  Q+AFSG+  N P+ NPDFY WNR+KVRYCDG+SFT
Sbjct  62   GWCNNVTTCLARRDTRLGSSRRMATQIAFSGIFSNRPQFNPDFYNWNRVKVRYCDGASFT  121

Query  528  GDVEAVNPKTNLHFRGARVFVA  593
            GDVEAV+P T L++RGARV  A
Sbjct  122  GDVEAVDPATKLYYRGARVLGA  143



>ref|XP_009771151.1| PREDICTED: uncharacterized protein LOC104221730 [Nicotiana sylvestris]
Length=402

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +3

Query  204  EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  383
            EG  VDITY+QSAVAKGAVCLDGSPPAYHFD+G G G+NNW I  EGGAWCNN TTCL+R
Sbjct  23   EGHPVDITYLQSAVAKGAVCLDGSPPAYHFDKGFGAGVNNWFIQLEGGAWCNNATTCLSR  82

Query  384  KDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNL  563
              TRLGSS  MVK V+FSG+L N  K NPDFY WNRI++RYCDGSSFTGDVEAV+P+T +
Sbjct  83   TKTRLGSSKLMVKTVSFSGILSNKAKFNPDFYNWNRIRIRYCDGSSFTGDVEAVDPRTKV  142

Query  564  HFRGARVFVA  593
            ++RGAR+F A
Sbjct  143  YYRGARIFSA  152



>ref|XP_004244443.1| PREDICTED: uncharacterized protein LOC101251798 [Solanum lycopersicum]
Length=392

 Score =   212 bits (540),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 116/149 (78%), Gaps = 0/149 (0%)
 Frame = +3

Query  147  GVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNW  326
            G  + ++  +   +I+L +EG  V+ITY+QSAVAKGAVCLDGSPPAYHFD+G G G+NNW
Sbjct  4    GTMQLLLRAIFTLLIVLISEGHPVEITYLQSAVAKGAVCLDGSPPAYHFDKGFGAGVNNW  63

Query  327  LIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRY  506
             I  EGGAWCNN TTCL R  TRLGSS  MVK V+FSG+L N  K NPDFY WNRI++RY
Sbjct  64   FIQLEGGAWCNNATTCLERTKTRLGSSKLMVKTVSFSGILSNKAKFNPDFYNWNRIRIRY  123

Query  507  CDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            CDGSSFTGDV A +P+T + +RGAR+F A
Sbjct  124  CDGSSFTGDVAAADPRTKVFYRGARIFSA  152



>gb|KJB24941.1| hypothetical protein B456_004G175900 [Gossypium raimondii]
Length=400

 Score =   212 bits (539),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +3

Query  201  TEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLA  380
            T G +V ITYVQSAVAKGAVCLDGSPPAYH+D+G G GIN+WLI  EGG WCNNV++CL 
Sbjct  23   TNGAYVPITYVQSAVAKGAVCLDGSPPAYHWDKGYGTGINSWLIQLEGGGWCNNVSSCLV  82

Query  381  RKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTN  560
            RK+T LGSS +MVKQ+ FSG+L N    NPDFY WNRIKVRYCDGSSFTGDV AVNP TN
Sbjct  83   RKNTHLGSSKRMVKQIPFSGILNNKRIFNPDFYNWNRIKVRYCDGSSFTGDVAAVNPVTN  142

Query  561  LHFRGARVFVA  593
            LHFRGARV++A
Sbjct  143  LHFRGARVWLA  153



>ref|XP_006432880.1| hypothetical protein CICLE_v10001467mg [Citrus clementina]
 ref|XP_006471635.1| PREDICTED: protein notum homolog isoform X1 [Citrus sinensis]
 ref|XP_006471636.1| PREDICTED: protein notum homolog isoform X2 [Citrus sinensis]
 gb|ESR46120.1| hypothetical protein CICLE_v10001467mg [Citrus clementina]
 gb|KDO40407.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
 gb|KDO40408.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
Length=386

 Score =   211 bits (538),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = +3

Query  156  KWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIH  335
            +W    +   ++L    GF V ITYV++AVAKGAVCLDGSPPAYHFD+G G GINNWL+H
Sbjct  3    QWFNLLVCALIVLKAQAGFNVSITYVENAVAKGAVCLDGSPPAYHFDKGFGAGINNWLVH  62

Query  336  FEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDG  515
             +GGAWCNNV  C  R+D+  GSS  MVK+  F+G+L N  K NPDFY WNR++VRYCDG
Sbjct  63   IDGGAWCNNVEDCSKRRDSSYGSSKHMVKEANFTGILSNEQKFNPDFYDWNRVRVRYCDG  122

Query  516  SSFTGDVEAVNPKTNLHFRGARVFVA  593
            +SFTGDVEAVNP+TNLHFRGARVF A
Sbjct  123  ASFTGDVEAVNPETNLHFRGARVFEA  148



>gb|ACS68714.1| pectinacetylesterase precursor [Sonneratia alba]
 gb|ACS68785.1| pectinacetylesterase precursor, partial [Sonneratia alba]
Length=128

 Score =   203 bits (516),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  204  EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  383
            EGF V ITY+  AVAKGAVCLDGSPPAYHF  G G GINNWL+ FEGG WCN+VT CLAR
Sbjct  2    EGFPVKITYLTEAVAKGAVCLDGSPPAYHFSEGFGAGINNWLVFFEGGGWCNDVTNCLAR  61

Query  384  KDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNL  563
            +DTRLGSS  M K+++FSG+  N  K NPDFY WNR+K+RYCDG+S+TGDVEAV+PKT L
Sbjct  62   RDTRLGSSKHMTKELSFSGIFSNKQKFNPDFYNWNRVKIRYCDGASYTGDVEAVDPKTKL  121

Query  564  HFRGARV  584
            +FRGAR+
Sbjct  122  YFRGARI  128



>gb|ABK24433.1| unknown [Picea sitchensis]
Length=399

 Score =   211 bits (538),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = +3

Query  207  GFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARK  386
             F VD+T V+ AVAKGAVCLDGSPP YH  RG G G+NNWL+HFEGG+WCNNVTTC AR 
Sbjct  28   AFLVDLTLVEDAVAKGAVCLDGSPPGYHLSRGFGSGVNNWLVHFEGGSWCNNVTTCSART  87

Query  387  DTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLH  566
             TRLGSS  M+KQV FSGLLGN+  RNPDFY WNRIKVRYCDG+SFTGDVEAVNP   L+
Sbjct  88   KTRLGSSKYMIKQVDFSGLLGNNKARNPDFYNWNRIKVRYCDGASFTGDVEAVNPVDKLY  147

Query  567  FRGARVFVA  593
            FRG RVF A
Sbjct  148  FRGQRVFKA  156



>ref|XP_004953590.1| PREDICTED: protein notum homolog isoform X1 [Setaria italica]
Length=401

 Score =   211 bits (538),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = +3

Query  159  WVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHF  338
            W     +    L++ +   VDITYV+SAVAKGAVCLDGS PAYH  RGSG G+N+WL+HF
Sbjct  12   WCCALASALSALVKVDALLVDITYVESAVAKGAVCLDGSAPAYHLARGSGSGVNSWLVHF  71

Query  339  EGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGS  518
            EGG WC+NVTTCL RK TRLGSS +M  Q+AFSG+L + P  NPDFY WN++KVRYCDGS
Sbjct  72   EGGGWCSNVTTCLQRKRTRLGSSKEMATQIAFSGILSDTPDYNPDFYNWNKVKVRYCDGS  131

Query  519  SFTGDVEAVNPKTNLHFRGARVFVA  593
            SFTGDVE V+P T LH+RGAR++ A
Sbjct  132  SFTGDVEEVDPTTKLHYRGARIWQA  156



>gb|ABK24994.1| unknown [Picea sitchensis]
Length=399

 Score =   211 bits (537),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = +3

Query  207  GFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARK  386
             F VD+T V+ AVAKGAVCLDGSPP YH  RG G G+NNWL+HFEGG+WCNNVTTC AR 
Sbjct  28   AFLVDLTLVEDAVAKGAVCLDGSPPGYHLSRGFGSGVNNWLVHFEGGSWCNNVTTCSART  87

Query  387  DTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLH  566
             TRLGSS  M+KQV FSGLLGN+  RNPDFY WNRIKVRYCDG+SFTGDVEAVNP   L+
Sbjct  88   KTRLGSSKYMIKQVDFSGLLGNNKARNPDFYNWNRIKVRYCDGASFTGDVEAVNPVDKLY  147

Query  567  FRGARVFVA  593
            FRG RVF A
Sbjct  148  FRGQRVFKA  156



>ref|XP_009797415.1| PREDICTED: uncharacterized protein LOC104243851 [Nicotiana sylvestris]
Length=388

 Score =   211 bits (536),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 116/147 (79%), Gaps = 3/147 (2%)
 Frame = +3

Query  162  VVYGLAFF---MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLI  332
            V + L FF   +I+ RTE   V+IT ++SAVAKG VCLDG+PPAYH DRGSG G++NW+I
Sbjct  2    VTHCLFFFISLLIICRTESLLVNITILESAVAKGGVCLDGTPPAYHLDRGSGTGLDNWVI  61

Query  333  HFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCD  512
              EGG WC N+T CL RK++RLGSS KM KQVAFSG++ N PK NP+FY WNR+ VRYCD
Sbjct  62   SIEGGGWCQNITHCLQRKNSRLGSSAKMGKQVAFSGIMSNDPKFNPEFYNWNRVSVRYCD  121

Query  513  GSSFTGDVEAVNPKTNLHFRGARVFVA  593
            G SFTGDVEAV+P T LH+RGAR+F A
Sbjct  122  GGSFTGDVEAVDPATGLHYRGARIFEA  148



>ref|XP_010676220.1| PREDICTED: uncharacterized protein LOC104892094 [Beta vulgaris 
subsp. vulgaris]
Length=439

 Score =   212 bits (540),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 120/153 (78%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M    +Q+W+   L F ++  ++EG +V IT V+SAVAKGAVCLDGS PAYH  RG G G
Sbjct  1    MTYRAIQQWMKL-LVFMVVFQKSEGLYVGITKVRSAVAKGAVCLDGSAPAYHLHRGHGTG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            IN+WL+H EGG WCNN+TTCL RK + LGSS KM KQ+AFSG+L N+P  NPDFY WNR+
Sbjct  60   INSWLVHVEGGGWCNNITTCLERKYSHLGSSWKMDKQLAFSGILSNNPMFNPDFYNWNRV  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            K+RYCDG+SFTG+VEAVNP T LHFRGAR++ A
Sbjct  120  KIRYCDGASFTGNVEAVNPITKLHFRGARIWHA  152



>ref|XP_007156332.1| hypothetical protein PHAVU_003G277600g [Phaseolus vulgaris]
 gb|ESW28326.1| hypothetical protein PHAVU_003G277600g [Phaseolus vulgaris]
Length=399

 Score =   211 bits (537),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 121/153 (79%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            ME++ + +W+   +A  ++LL+ EG  V +T V++A++KGAVCLDGSPPAYHFD+G GEG
Sbjct  1    MESVRIIQWLNL-VACVLLLLKAEGSLVPLTLVENALSKGAVCLDGSPPAYHFDKGDGEG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            INNW++H EGG WC +   CL RKDTRLGSS +MV+ + FSG+L N  + NPDFY W+R+
Sbjct  60   INNWIVHMEGGGWCKDADDCLGRKDTRLGSSKQMVEDLYFSGILSNEREYNPDFYNWDRV  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            K+RYCDGSSFTGDVE V+P  NL+FRGAR+F A
Sbjct  120  KIRYCDGSSFTGDVEEVDPTNNLYFRGARIFSA  152



>ref|XP_006368062.1| PREDICTED: protein notum homolog, partial [Solanum tuberosum]
Length=329

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 112/143 (78%), Gaps = 3/143 (2%)
 Frame = +3

Query  174  LAFFMILL---RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEG  344
            L FF+ LL   RTE   V+IT ++SAVAKGAVCLDG+PPAYH DRGSG G+NNW+I  EG
Sbjct  6    LLFFVCLLIFVRTESLLVNITILESAVAKGAVCLDGTPPAYHLDRGSGPGVNNWVISLEG  65

Query  345  GAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSF  524
            G WC NVT CL RK+TRLGSS KM  Q+ FSG++ N P  NP+FY WNR+ VRYCDG SF
Sbjct  66   GGWCQNVTLCLTRKNTRLGSSAKMDHQLPFSGMMSNDPNFNPEFYNWNRVSVRYCDGGSF  125

Query  525  TGDVEAVNPKTNLHFRGARVFVA  593
            TGDVEA++P T LH+RGAR+F A
Sbjct  126  TGDVEAIDPGTGLHYRGARIFKA  148



>ref|XP_010677538.1| PREDICTED: protein notum homolog isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=389

 Score =   210 bits (535),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 116/150 (77%), Gaps = 1/150 (1%)
 Frame = +3

Query  144  LGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINN  323
            +   +W+ + ++  M+L+   GF V ITYVQ AVAKG VCLDGSPPAYHFD+G G GI+N
Sbjct  1    MHCSQWLQFLVSVLMLLI-VNGFQVPITYVQDAVAKGGVCLDGSPPAYHFDKGFGAGIHN  59

Query  324  WLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVR  503
            WLIH EGGAWCNN TTCL R  TRLGSS  M KQ  FSG+L N  K +PDFY WNRIKVR
Sbjct  60   WLIHMEGGAWCNNATTCLERTKTRLGSSKLMTKQYTFSGILSNQAKYSPDFYNWNRIKVR  119

Query  504  YCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            YCDGSSFTGDVEAV+PK  +++RGAR++ A
Sbjct  120  YCDGSSFTGDVEAVDPKAKVYYRGARLWRA  149



>ref|XP_010327577.1| PREDICTED: uncharacterized protein LOC101244626 [Solanum lycopersicum]
Length=398

 Score =   210 bits (535),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = +3

Query  183  FMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNN  362
            F+I + TEG  V+IT ++SAVAKGAVCLDG+PPAYH DRGSG G+N+W+I  EGG WC N
Sbjct  12   FLIFVTTEGLLVNITILESAVAKGAVCLDGTPPAYHLDRGSGSGVNSWVISLEGGGWCQN  71

Query  363  VTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEA  542
            VT+CL RK+TRLGSS KM  Q+ FSG++ N PK NP+F++WNR+ VRYCDG SFTGDVEA
Sbjct  72   VTSCLTRKNTRLGSSAKMDHQLPFSGMMSNDPKFNPEFHSWNRVSVRYCDGGSFTGDVEA  131

Query  543  VNPKTNLHFRGARVFVA  593
            ++P T LH+RGAR+F A
Sbjct  132  IDPATRLHYRGARIFKA  148



>ref|XP_010248193.1| PREDICTED: uncharacterized protein LOC104591101 [Nelumbo nucifera]
Length=394

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEG  344
            ++ L + ++++   G+FV ITYV +AVAKGAVCLDGSPPAYH   G G G+NNWLI  EG
Sbjct  10   LFLLIWTLVIVGANGYFVGITYVDNAVAKGAVCLDGSPPAYHMAPGFGSGVNNWLILLEG  69

Query  345  GAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSF  524
            GAWCNN TTCLARK+TRLGSS +MVKQ++FSG L +  K NPDF+ WN++KVRYCDGSSF
Sbjct  70   GAWCNNATTCLARKNTRLGSSKEMVKQLSFSGFLSDKEKFNPDFFNWNKVKVRYCDGSSF  129

Query  525  TGDVEAVNPKTNLHFRGARVFVA  593
            TGDVEAV+P TNL++RG R+F A
Sbjct  130  TGDVEAVDPATNLYYRGQRIFNA  152



>ref|XP_002454426.1| hypothetical protein SORBIDRAFT_04g030720 [Sorghum bicolor]
 gb|EES07402.1| hypothetical protein SORBIDRAFT_04g030720 [Sorghum bicolor]
Length=398

 Score =   209 bits (533),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = +3

Query  204  EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  383
            +G  VDITYV+SAVAKGAVCLDGS PAYH  RGSG G N+WL+HFEGG WCNNVTTCL R
Sbjct  24   DGVLVDITYVESAVAKGAVCLDGSAPAYHLARGSGSGENSWLVHFEGGGWCNNVTTCLQR  83

Query  384  KDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNL  563
            K TRLGSS +M  Q+AFSG+L + P  NPDFY WN++KVRYCDGSSFTGDVE V+P T L
Sbjct  84   KRTRLGSSKEMATQIAFSGILSDTPDGNPDFYNWNKVKVRYCDGSSFTGDVEEVDPTTKL  143

Query  564  HFRGARVFVA  593
            HFRGAR++ A
Sbjct  144  HFRGARIWQA  153



>ref|XP_008238076.1| PREDICTED: uncharacterized protein LOC103336755 [Prunus mume]
Length=289

 Score =   206 bits (524),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            + E   V IT V++AVAKGAVCLDGS PAYHFD+G G GINNWL+H EGG WCN+V TCL
Sbjct  21   KAESHPVGITLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVHVEGGGWCNSVETCL  80

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
             RK+T  GSS KM K ++FSG+L N  K NPDFY WNRIKVRYCDG+SFTGDVEAVNP T
Sbjct  81   DRKNTHYGSSNKMEKSMSFSGVLSNKQKFNPDFYNWNRIKVRYCDGASFTGDVEAVNPAT  140

Query  558  NLHFRGARVFVA  593
            NLHFRGARVF A
Sbjct  141  NLHFRGARVFRA  152



>ref|XP_006432881.1| hypothetical protein CICLE_v10001426mg [Citrus clementina]
 gb|ESR46121.1| hypothetical protein CICLE_v10001426mg [Citrus clementina]
Length=392

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = +3

Query  156  KWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIH  335
            +W    +   +IL     F V ITYV+ AVAKGAVCLDGSPPAYHFD+G G GINNWL+H
Sbjct  9    QWFNLLVCALLILKAQACFNVSITYVEDAVAKGAVCLDGSPPAYHFDKGFGAGINNWLVH  68

Query  336  FEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDG  515
             +GGAWCNNV  C  R+D+  GSS  MVK+  F+G+L N  K NPDFY WNR+KVRYCDG
Sbjct  69   IDGGAWCNNVADCSNRRDSSHGSSKYMVKEANFTGILSNEQKFNPDFYDWNRVKVRYCDG  128

Query  516  SSFTGDVEAVNPKTNLHFRGARVFVA  593
            +SFTGDVEAVNP+TNLHFRGARVF A
Sbjct  129  ASFTGDVEAVNPETNLHFRGARVFEA  154



>ref|XP_006494119.1| PREDICTED: protein notum homolog isoform X1 [Citrus sinensis]
 ref|XP_006494120.1| PREDICTED: protein notum homolog isoform X2 [Citrus sinensis]
Length=392

 Score =   208 bits (530),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 111/146 (76%), Gaps = 0/146 (0%)
 Frame = +3

Query  156  KWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIH  335
            +W    +   +IL     F V ITYV+ AVAKGAVCLDGSPPAYHFD+G G GINNWL+H
Sbjct  9    QWFNLLVCALLILKAQACFNVSITYVEDAVAKGAVCLDGSPPAYHFDKGFGAGINNWLVH  68

Query  336  FEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDG  515
             +GGAWCNNV  C  R+D+  GSS  MVK+  F+G+L N    NPDFY WNR+KVRYCDG
Sbjct  69   IDGGAWCNNVADCSNRRDSSYGSSKYMVKEANFTGILSNEQNFNPDFYDWNRVKVRYCDG  128

Query  516  SSFTGDVEAVNPKTNLHFRGARVFVA  593
            +SFTGDVEAVNP+TNLHFRGARVF A
Sbjct  129  ASFTGDVEAVNPETNLHFRGARVFEA  154



>ref|XP_008365238.1| PREDICTED: uncharacterized protein LOC103428882 [Malus domestica]
Length=311

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            + E   V +T V++AVAKGAVCLDGS PAYHFD+G G GINNWL+H EGG WCN V  CL
Sbjct  21   KAESHPVALTLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVHVEGGGWCNTVEDCL  80

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
             RK    GSSTKM K ++FSG+LGN PK NPDFY WNRIKVRYCDGSSFTGDVEAV+P T
Sbjct  81   DRKSNYRGSSTKMEKTMSFSGVLGNKPKTNPDFYNWNRIKVRYCDGSSFTGDVEAVDPAT  140

Query  558  NLHFRGARVFVA  593
            NLHFRGARVF A
Sbjct  141  NLHFRGARVFRA  152



>ref|XP_002303225.2| pectinacetylesterase family protein [Populus trichocarpa]
 gb|ABK93778.1| unknown [Populus trichocarpa]
 gb|ABK95483.1| unknown [Populus trichocarpa]
 gb|EEE78204.2| pectinacetylesterase family protein [Populus trichocarpa]
Length=394

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 119/153 (78%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M+   + KW+   + + + LL+TEG  + +T VQ+AVA+GAVCLDGSPP YHF++GSG G
Sbjct  1    MDGSSLGKWLCL-IVYILTLLKTEGASIPMTIVQAAVARGAVCLDGSPPGYHFEKGSGSG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            INNWL+H EGG WC +V +C++R+DT  GSS KM K + FSG+LG+    NPDFY WNRI
Sbjct  60   INNWLVHMEGGGWCESVESCVSRRDTYKGSSLKMEKTMGFSGILGSKQAANPDFYNWNRI  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            K+RYCDGSSFTGDVEAV+PKT L+FRG R++ A
Sbjct  120  KIRYCDGSSFTGDVEAVDPKTKLYFRGERIWQA  152



>ref|XP_009592441.1| PREDICTED: uncharacterized protein LOC104089292 [Nicotiana tomentosiformis]
Length=394

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 108/132 (82%), Gaps = 0/132 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            RTE   V+IT ++SAVA GAVCLDG+PPAYH DRGSG G+NNW+I  EGG WC N+T CL
Sbjct  19   RTESLLVNITILESAVATGAVCLDGTPPAYHLDRGSGTGLNNWVISIEGGGWCQNITHCL  78

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
             RK++RLGSS KM KQVAFSG++ N PK NP+FY WNR+ VRYCDG SFTGDVEAV+P T
Sbjct  79   ERKNSRLGSSAKMGKQVAFSGIMSNDPKFNPEFYNWNRVSVRYCDGGSFTGDVEAVDPAT  138

Query  558  NLHFRGARVFVA  593
             LH+RGAR+F A
Sbjct  139  GLHYRGARIFKA  150



>ref|XP_011012520.1| PREDICTED: protein notum homolog [Populus euphratica]
Length=394

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 119/153 (78%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M+   + KW+   + + + LL+TEG  + +T VQ+AVA+GAVCLDGSPP YHF++GSG G
Sbjct  1    MDGSSLGKWLCL-IVYTLTLLKTEGASIPMTIVQTAVARGAVCLDGSPPGYHFEKGSGSG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            INNWL+H EGG WC +V +C++R+DT  GSS KM K + FSG+LG+    NPDFY WNRI
Sbjct  60   INNWLVHMEGGGWCESVESCVSRRDTYKGSSLKMEKTMGFSGILGSKQAANPDFYNWNRI  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            K+RYCDGSSFTGDVEAV+PKT L+FRG R++ A
Sbjct  120  KIRYCDGSSFTGDVEAVDPKTKLYFRGERIWQA  152



>ref|XP_004300392.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011465292.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011465293.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. 
vesca]
Length=394

 Score =   207 bits (526),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 114/153 (75%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            M +  + +W+   L   +ILL+ E   V++T VQSAVAKGAVCLDGSPPAYHFD+G G G
Sbjct  1    MASARIGQWL-SPLVCLLILLKAESHPVELTLVQSAVAKGAVCLDGSPPAYHFDKGFGAG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            INNWL+H EGG WC +V +C+ R     GSS  M K ++FSG+LG     NPDFY WNRI
Sbjct  60   INNWLVHIEGGGWCKDVESCVERTKNFRGSSKHMEKTISFSGVLGKKETLNPDFYNWNRI  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDGSSFTGDVEAVNP TNLHFRG RVF+A
Sbjct  120  KVRYCDGSSFTGDVEAVNPATNLHFRGGRVFLA  152



>ref|XP_007209217.1| hypothetical protein PRUPE_ppa006718mg [Prunus persica]
 gb|EMJ10416.1| hypothetical protein PRUPE_ppa006718mg [Prunus persica]
 gb|AIA21744.1| pectin acetylesterase [Prunus persica]
Length=398

 Score =   207 bits (526),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 108/132 (82%), Gaps = 0/132 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            + E   V IT V++AVAKGAVCLDGS PAYHFD+G G GINNWL+H EGG WCN+V TCL
Sbjct  21   KAESHPVGITLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVHVEGGGWCNSVETCL  80

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
             RK+T  GSS KM K ++FSG+LGN  K NPDFY WNRIKVRYCDGSSFTGDVEAVNP T
Sbjct  81   DRKNTYRGSSNKMEKSMSFSGVLGNKQKFNPDFYNWNRIKVRYCDGSSFTGDVEAVNPAT  140

Query  558  NLHFRGARVFVA  593
            NLHFRGARVF A
Sbjct  141  NLHFRGARVFRA  152



>ref|XP_004512351.1| PREDICTED: protein notum homolog isoform X3 [Cicer arietinum]
Length=448

 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            + E  +V I+YV +AV KGAVCLDGSPPAYHFD+G G GIN+WL+ FEGG WCNN+TTCL
Sbjct  23   KAEAAYVPISYVHNAVIKGAVCLDGSPPAYHFDKGFGTGINSWLVQFEGGGWCNNITTCL  82

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
             RK  RLGSS +M KQ+AFSG+L N    NPDFY WNRIKVRYCDGSSFTGDVE VNP T
Sbjct  83   GRKMNRLGSSKQMAKQIAFSGILNNRRLFNPDFYNWNRIKVRYCDGSSFTGDVEIVNPVT  142

Query  558  NLHFRGARVFVA  593
             LHFRGARVF A
Sbjct  143  KLHFRGARVFNA  154



>ref|XP_004512349.1| PREDICTED: protein notum homolog isoform X1 [Cicer arietinum]
 ref|XP_004512350.1| PREDICTED: protein notum homolog isoform X2 [Cicer arietinum]
Length=487

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            + E  +V I+YV +AV KGAVCLDGSPPAYHFD+G G GIN+WL+ FEGG WCNN+TTCL
Sbjct  62   KAEAAYVPISYVHNAVIKGAVCLDGSPPAYHFDKGFGTGINSWLVQFEGGGWCNNITTCL  121

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
             RK  RLGSS +M KQ+AFSG+L N    NPDFY WNRIKVRYCDGSSFTGDVE VNP T
Sbjct  122  GRKMNRLGSSKQMAKQIAFSGILNNRRLFNPDFYNWNRIKVRYCDGSSFTGDVEIVNPVT  181

Query  558  NLHFRGARVFVA  593
             LHFRGARVF A
Sbjct  182  KLHFRGARVFNA  193



>ref|XP_003628996.1| Carboxylic ester hydrolase [Medicago truncatula]
 gb|AET03472.1| pectinacetylesterase family protein [Medicago truncatula]
Length=406

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 120/153 (78%), Gaps = 1/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            ME+  + KW+   L   ++ L+T+G +V +T ++SAV+KGAVCLDGSPPAYHFD+G  EG
Sbjct  1    MESSRIIKWLS-TLLCALLFLKTQGQYVPLTRLESAVSKGAVCLDGSPPAYHFDQGHDEG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
             NNW++H EGG WC+NVT CL R+D+RLGSS +M +Q  FSG L ++ + NPDFY WNR+
Sbjct  60   ANNWIVHIEGGGWCHNVTYCLYRRDSRLGSSHEMEEQTYFSGYLSDNQQYNPDFYNWNRV  119

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDGSSFTGDVE V+P T L++RGAR+F A
Sbjct  120  KVRYCDGSSFTGDVEEVDPTTKLYYRGARIFSA  152



>ref|XP_009350399.1| PREDICTED: protein notum homolog [Pyrus x bretschneideri]
Length=398

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 108/132 (82%), Gaps = 0/132 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            + E   V IT V++AVAKGAVCLDGS PAYHFD+G G GINNWL+H EGG WCN+V TCL
Sbjct  21   KAESHPVGITLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVHIEGGGWCNSVATCL  80

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
             RK+   GSSTKM K ++FSG+LGN  + NPDFY WNRIKVRYCDGSSFTGDVEAV+P T
Sbjct  81   DRKNNYRGSSTKMEKTMSFSGVLGNKQQTNPDFYNWNRIKVRYCDGSSFTGDVEAVDPAT  140

Query  558  NLHFRGARVFVA  593
            NLHFRGARVF A
Sbjct  141  NLHFRGARVFRA  152



>ref|XP_008355284.1| PREDICTED: uncharacterized protein LOC103418943 [Malus domestica]
Length=398

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 108/132 (82%), Gaps = 0/132 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            + E   V IT V++AVAKGAVCLDGS PAYHFD+G G GINNWL+H EGG WCN+V TCL
Sbjct  21   KAESHPVGITLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVHVEGGGWCNSVATCL  80

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
             RK+   GSSTKM K ++FSG+LGN  + NPDFY WNRIKVRYCDGSSFTGDVEAV+P T
Sbjct  81   DRKNNYRGSSTKMEKTMSFSGVLGNKQQTNPDFYNWNRIKVRYCDGSSFTGDVEAVDPAT  140

Query  558  NLHFRGARVFVA  593
            NLHFRGARVF A
Sbjct  141  NLHFRGARVFRA  152



>ref|XP_004300391.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011465290.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011465291.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. 
vesca]
Length=399

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = +3

Query  189  ILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVT  368
            +LL+  G  V IT +Q+AVAKGAVCLDGSPPAYH+D+G G G+NNWL+H EGG WC+NVT
Sbjct  18   LLLKATGVPVGITILQTAVAKGAVCLDGSPPAYHWDKGFGSGLNNWLVHIEGGGWCHNVT  77

Query  369  TCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVN  548
             CL RK+TRLGSS KM+K++ FSG+L N    NP FY WNRIKVRYCDGSSFTGDV AV+
Sbjct  78   NCLGRKNTRLGSSKKMLKEIPFSGILSNRQSLNPGFYNWNRIKVRYCDGSSFTGDVAAVD  137

Query  549  PKTNLHFRGARVFVA  593
            P T L+FRGARVF A
Sbjct  138  PATGLYFRGARVFRA  152



>ref|XP_010677539.1| PREDICTED: protein notum homolog isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=388

 Score =   204 bits (519),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 115/150 (77%), Gaps = 2/150 (1%)
 Frame = +3

Query  144  LGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINN  323
            +   +W+ + ++  M+L+   GF V ITYVQ AVAKG VCLDGSPPAYHFD+G G GI+N
Sbjct  1    MHCSQWLQFLVSVLMLLI-VNGFQVPITYVQDAVAKGGVCLDGSPPAYHFDKGFGAGIHN  59

Query  324  WLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVR  503
            WLIH EGGAWCNN TTCL R  TRLGSS  M KQ  FSG+L N  K +PDFY WNRIKVR
Sbjct  60   WLIHMEGGAWCNNATTCLERTKTRLGSSKLMTKQYTFSGILSNQAKYSPDFYNWNRIKVR  119

Query  504  YCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            YCDGSSFTGDVEAV+P   +++RGAR++ A
Sbjct  120  YCDGSSFTGDVEAVDP-AKVYYRGARLWRA  148



>ref|XP_008373439.1| PREDICTED: protein notum homolog isoform X2 [Malus domestica]
 ref|XP_008373440.1| PREDICTED: protein notum homolog isoform X2 [Malus domestica]
Length=438

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 109/136 (80%), Gaps = 0/136 (0%)
 Frame = +3

Query  186  MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  365
            ++LL+     V ITYV SAVAKGAVCLDGSPPAYH D+G G GINNWL+H EGG WCNN+
Sbjct  17   VMLLKAAALPVGITYVHSAVAKGAVCLDGSPPAYHLDKGYGSGINNWLVHIEGGGWCNNI  76

Query  366  TTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAV  545
            TTCL RK+ RLGSS KM+K++AFSG+L +    NPDFY WNR+KVRYCDG+SFTGDV AV
Sbjct  77   TTCLVRKNNRLGSSKKMLKEIAFSGILNSRHIFNPDFYNWNRVKVRYCDGASFTGDVAAV  136

Query  546  NPKTNLHFRGARVFVA  593
            N  T L FRGAR+F A
Sbjct  137  NLATGLFFRGARIFRA  152



>gb|AAP72959.1| pectin acetylesterase [Lactuca sativa]
Length=395

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +3

Query  153  QKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLI  332
             +W+   L   + LL TE + V +T++ SAVAKGAVCLDGS PAYH D+G G GI+NWL+
Sbjct  7    DRWLCIFLVCTLSLLCTEAYDVGLTFLNSAVAKGAVCLDGSAPAYHIDKGFGAGIDNWLV  66

Query  333  HFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCD  512
             FEGG WCNN T CL R+DTRLGSS KM+    FSG+  N  K NPDFY WNRIKVRYCD
Sbjct  67   FFEGGGWCNNATNCLTRRDTRLGSSKKMLTTETFSGMFHNKAKYNPDFYDWNRIKVRYCD  126

Query  513  GSSFTGDVEAVNPKTNLHFRGARVFVA  593
            G+SFTGDVEAV+P T L++RGAR+F A
Sbjct  127  GASFTGDVEAVDPNTKLYYRGARIFRA  153



>ref|XP_006385133.1| pectinacetylesterase family protein [Populus trichocarpa]
 gb|ERP62930.1| pectinacetylesterase family protein [Populus trichocarpa]
Length=394

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = +3

Query  183  FMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNN  362
             +ILL+ EG  + IT V++AV+ GAVCLDGSPP YHFD+GSG GI+NWL+H EGG WC +
Sbjct  16   ILILLKAEGASIPITIVETAVSSGAVCLDGSPPGYHFDKGSGSGIDNWLVHMEGGGWCES  75

Query  363  VTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEA  542
            V +C++R+DT  GSS+KM K + FSG+LG+    NPDFY WNRIKVRYCDGSSFTGDVEA
Sbjct  76   VESCVSRRDTFRGSSSKMEKTMGFSGILGSKQAANPDFYNWNRIKVRYCDGSSFTGDVEA  135

Query  543  VNPKTNLHFRGARVFVA  593
            V+P+T L+FRG RV+ A
Sbjct  136  VDPETKLYFRGERVWQA  152



>ref|XP_008378614.1| PREDICTED: uncharacterized protein LOC103441693 [Malus domestica]
 ref|XP_008347801.1| PREDICTED: uncharacterized protein LOC103410927 [Malus domestica]
Length=393

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            + E   V IT V++AVAKGAVCLDGS PAYHFD+G G GINNWL++FEGG WCN V TCL
Sbjct  21   KAEXHPVGITLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVYFEGGGWCNTVATCL  80

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
             R +  LGSSTKM K + FSG+L N  K NPDFY WNRIKVRYCDGSSFTGDVEAV+P T
Sbjct  81   DRSNYSLGSSTKMEKTMLFSGVLSNKQKTNPDFYNWNRIKVRYCDGSSFTGDVEAVDPAT  140

Query  558  NLHFRGARVFVA  593
            NLHFRGARVF A
Sbjct  141  NLHFRGARVFRA  152



>ref|XP_008373438.1| PREDICTED: protein notum homolog isoform X1 [Malus domestica]
Length=466

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 109/136 (80%), Gaps = 0/136 (0%)
 Frame = +3

Query  186  MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  365
            ++LL+     V ITYV SAVAKGAVCLDGSPPAYH D+G G GINNWL+H EGG WCNN+
Sbjct  45   VMLLKAAALPVGITYVHSAVAKGAVCLDGSPPAYHLDKGYGSGINNWLVHIEGGGWCNNI  104

Query  366  TTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAV  545
            TTCL RK+ RLGSS KM+K++AFSG+L +    NPDFY WNR+KVRYCDG+SFTGDV AV
Sbjct  105  TTCLVRKNNRLGSSKKMLKEIAFSGILNSRHIFNPDFYNWNRVKVRYCDGASFTGDVAAV  164

Query  546  NPKTNLHFRGARVFVA  593
            N  T L FRGAR+F A
Sbjct  165  NLATGLFFRGARIFRA  180



>gb|KDP28067.1| hypothetical protein JCGZ_19475 [Jatropha curcas]
Length=394

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 116/148 (78%), Gaps = 1/148 (1%)
 Frame = +3

Query  150  VQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWL  329
            + +W  Y LAF +IL +TEG  + I  +++A AKGAVCLDGS PAYHF +G G GINNW+
Sbjct  6    LSQWC-YLLAFMLILFKTEGGSIPIVLIENAKAKGAVCLDGSAPAYHFQKGEGTGINNWI  64

Query  330  IHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYC  509
            +H EGG WC+++ +CLAR++T  GSS+KM K + FSG+LG+    NPDFY WNRIK+RYC
Sbjct  65   VHMEGGGWCDDIESCLARRNTYKGSSSKMNKTMGFSGILGSKQVSNPDFYNWNRIKIRYC  124

Query  510  DGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            DGSSFTGDVE V+PKTNL+FRG RV+ A
Sbjct  125  DGSSFTGDVEEVDPKTNLYFRGERVWQA  152



>ref|XP_003547821.1| PREDICTED: protein notum homolog [Glycine max]
 gb|KHN26083.1| Protein notum like [Glycine soja]
Length=398

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 120/153 (78%), Gaps = 2/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            ME+  + +W+   +   ++LL+ EG  V +  V++A +KGAVCLDGSPPAYHFD+G GEG
Sbjct  1    MESARISQWLNLLVCV-LLLLKAEGSLVPLILVENAESKGAVCLDGSPPAYHFDKGFGEG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            IN+W++H EGG WCNN+ +CL RKDTRLGSS +M + + FSG+L N  + NPDFY WNR+
Sbjct  60   INSWIVHIEGGGWCNNIESCLDRKDTRLGSSKQM-EDIYFSGILSNEQQFNPDFYNWNRV  118

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDGSSFTGDVE V+P TNLHFRGAR+F A
Sbjct  119  KVRYCDGSSFTGDVEEVDPTTNLHFRGARIFSA  151



>ref|XP_008347803.1| PREDICTED: uncharacterized protein LOC103410929 [Malus domestica]
Length=401

 Score =   201 bits (512),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            + E   V +T V++AVAKGAVCLDGS  AYHFD+G G GINNWL+H EGG WCN V  CL
Sbjct  24   KAESHPVALTLVENAVAKGAVCLDGSAXAYHFDKGFGAGINNWLVHVEGGGWCNTVEDCL  83

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
             RK    GSSTKM K ++FSG+LGN PK NPDFY WNRIKVRYCDGSSFTGDVEAV+P T
Sbjct  84   DRKSNYRGSSTKMEKTMSFSGVLGNKPKTNPDFYNWNRIKVRYCDGSSFTGDVEAVDPAT  143

Query  558  NLHFRGARVFVA  593
            NLHFRGARVF A
Sbjct  144  NLHFRGARVFRA  155



>gb|KHN27509.1| Protein notum like [Glycine soja]
Length=398

 Score =   201 bits (510),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 120/153 (78%), Gaps = 2/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            ME+  + +W+   +   ++LL+ EG  V +T V++A +KGAVCLDGSPPAYHFD+G GEG
Sbjct  1    MESARISQWLNLLVCV-LLLLKAEGSSVPLTLVENAESKGAVCLDGSPPAYHFDKGFGEG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            I+NW++H EGG WCNNV +CL RK+TRLGSS +M K + FS +L N  + NPDFY WNR+
Sbjct  60   IDNWIVHIEGGGWCNNVESCLERKNTRLGSSKQM-KDIYFSAILSNEQQFNPDFYNWNRV  118

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDGSSFTGDVE V+P TNLHFRGAR+F A
Sbjct  119  KVRYCDGSSFTGDVEEVDPTTNLHFRGARIFSA  151



>ref|XP_003547731.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
 ref|XP_006599118.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=398

 Score =   201 bits (510),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 120/153 (78%), Gaps = 2/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            ME+  + +W+   +   ++LL+ EG  V +T V++A +KGAVCLDGSPPAYHFD+G GEG
Sbjct  1    MESARISQWLNLLVCV-LLLLKAEGSSVPLTLVENAESKGAVCLDGSPPAYHFDKGFGEG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            I+NW++H EGG WCNNV +CL RK+TRLGSS +M K + FS +L N  + NPDFY WNR+
Sbjct  60   IDNWIVHIEGGGWCNNVESCLERKNTRLGSSKQM-KDIYFSAILSNEQQFNPDFYNWNRV  118

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDGSSFTGDVE V+P TNLHFRGAR+F A
Sbjct  119  KVRYCDGSSFTGDVEEVDPTTNLHFRGARIFSA  151



>ref|XP_011028476.1| PREDICTED: protein notum homolog [Populus euphratica]
 ref|XP_011028477.1| PREDICTED: protein notum homolog [Populus euphratica]
Length=394

 Score =   201 bits (510),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = +3

Query  183  FMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNN  362
             +IL + EG  + IT V++AV++GAVCLDGSPP YHFD+GSG GI+NWL+H EGG WC +
Sbjct  16   ILILFKAEGASIPITIVETAVSRGAVCLDGSPPGYHFDKGSGSGIDNWLVHMEGGGWCES  75

Query  363  VTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEA  542
            V +C++R+DT  GSS+KM K + FSG+LG+    NPDFY WNRIKVRYCDGSSFTGDVEA
Sbjct  76   VESCVSRRDTFRGSSSKMEKTMGFSGILGSKQAANPDFYNWNRIKVRYCDGSSFTGDVEA  135

Query  543  VNPKTNLHFRGARVFVA  593
            V+P+T L+FRG RV+ A
Sbjct  136  VDPETKLYFRGERVWQA  152



>ref|XP_010054026.1| PREDICTED: uncharacterized protein LOC104442333 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010054027.1| PREDICTED: uncharacterized protein LOC104442333 isoform X1 [Eucalyptus 
grandis]
Length=434

 Score =   201 bits (512),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 117/175 (67%), Gaps = 35/175 (20%)
 Frame = +3

Query  174  LAFFMILLRTEGFFVDITYVQ-SAVAKGA-------------------------------  257
            L F + LL+  G  V ITYV+ SAVA+GA                               
Sbjct  13   LLFLVALLQARGVPVRITYVRNSAVARGAGKGLIVWGQKMNASLHIRGLRVSFYVLVLDS  72

Query  258  ---VCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQV  428
               VCLDGSPPAYH DRG G GINNWL+H EGG WCNNVTTCLARK+TRLGSS +M K++
Sbjct  73   CDVVCLDGSPPAYHLDRGFGTGINNWLVHIEGGGWCNNVTTCLARKNTRLGSSKQMAKEI  132

Query  429  AFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
             FSG+L N  + NPDFY WNRIKVRYCDG+SFTGD+EAVNP TNLHFRGARV+ A
Sbjct  133  PFSGILSNKRRYNPDFYNWNRIKVRYCDGASFTGDIEAVNPATNLHFRGARVWQA  187



>ref|XP_004509558.1| PREDICTED: protein notum homolog [Cicer arietinum]
Length=397

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 116/153 (76%), Gaps = 3/153 (2%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            ME+  + +W+V      ++ L  EG FV +T +++AV+KGAVCLDGSPP +HFD G G+G
Sbjct  1    MESARIIQWLVLCA---LLSLHAEGNFVPMTRLENAVSKGAVCLDGSPPTFHFDEGHGDG  57

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            +NNW++H EGG WC+NV  CL RK++RLGSS  M ++  FSG L N+ + NPDFY WNR+
Sbjct  58   VNNWIVHIEGGGWCHNVQDCLGRKNSRLGSSDHMKEKSYFSGYLSNNQQFNPDFYNWNRV  117

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDGSSFTGDVE V+P T LHFRGAR+F A
Sbjct  118  KVRYCDGSSFTGDVEEVDPTTKLHFRGARIFSA  150



>gb|EMT15342.1| hypothetical protein F775_17167 [Aegilops tauschii]
Length=403

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +3

Query  204  EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  383
            +   VDITYV+SAVAKGAVCLDGSPPAYH   GSG G+++WL+HFEGGAWCNN TTCL R
Sbjct  27   DDHLVDITYVESAVAKGAVCLDGSPPAYHLAPGSGSGVSSWLVHFEGGAWCNNATTCLHR  86

Query  384  KDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNL  563
              T LGSS +M +Q AF+G+L N    NPDFY WN++KVRYCDGSSFTGD E V+P TN+
Sbjct  87   SRTPLGSSKEMARQAAFTGILSNASDYNPDFYNWNKVKVRYCDGSSFTGDKEEVDPSTNV  146

Query  564  HFRGARVFVA  593
            H+RGARV+ A
Sbjct  147  HYRGARVWQA  156



>gb|KHG23648.1| Notum [Gossypium arboreum]
Length=395

 Score =   198 bits (504),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 107/131 (82%), Gaps = 5/131 (4%)
 Frame = +3

Query  201  TEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLA  380
            T G +V ITYVQSAVAKGAVCLDG+PPAYH+D+G G GIN+WLI  EGG WCNNV++CL 
Sbjct  23   TNGAYVPITYVQSAVAKGAVCLDGTPPAYHWDKGYGTGINSWLIQLEGGGWCNNVSSCLV  82

Query  381  RKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTN  560
            RK+T LGSS +MVKQ+ FSG+L N       FY WNRIKVRYCDGSSFTGDV AVNP  N
Sbjct  83   RKNTHLGSSKRMVKQIPFSGILNNK-----HFYNWNRIKVRYCDGSSFTGDVAAVNPVAN  137

Query  561  LHFRGARVFVA  593
            LHFRGARV++A
Sbjct  138  LHFRGARVWLA  148



>gb|ADR82372.1| pectin acetylesterase [Populus trichocarpa]
Length=394

 Score =   198 bits (503),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = +3

Query  183  FMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNN  362
             +ILL+ EG  + IT +++AV+ GAVCLDGS P YHFD+GSG GI+NWL+H EGG WC +
Sbjct  16   ILILLKAEGASIPITIIETAVSSGAVCLDGSQPGYHFDKGSGSGIDNWLVHMEGGGWCES  75

Query  363  VTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEA  542
            V +C++R+DT  GSS+KM K + FSG+LG+    NPDFY WNRIKVRYCDGSSFTGDVEA
Sbjct  76   VESCVSRRDTFRGSSSKMEKTMGFSGILGSKQAANPDFYNWNRIKVRYCDGSSFTGDVEA  135

Query  543  VNPKTNLHFRGARVFVA  593
            V+P+T L+FRG RV+ A
Sbjct  136  VDPETKLYFRGERVWQA  152



>gb|AFK37852.1| unknown [Lotus japonicus]
Length=399

 Score =   198 bits (503),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            +TEG  V +  ++ AV+KGAVCLDG+PPAYHFD GSGEG+NNW++  EGG WCNNVT CL
Sbjct  21   KTEGGIVPLIRLEKAVSKGAVCLDGTPPAYHFDEGSGEGVNNWIVFLEGGGWCNNVTDCL  80

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
             RKDTR GSS +M +   F+G L  + K NPDFY WNRI VRYCDG+SFTGDVE V+P T
Sbjct  81   LRKDTRRGSSDQMTEPRFFNGFLSENQKFNPDFYNWNRILVRYCDGASFTGDVEEVDPAT  140

Query  558  NLHFRGARVFVA  593
            NLHFRGARVFVA
Sbjct  141  NLHFRGARVFVA  152



>ref|XP_003613922.1| Notum-like protein [Medicago truncatula]
 gb|AES96880.1| pectinacetylesterase family protein [Medicago truncatula]
Length=394

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +3

Query  204  EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  383
            E  FV  T VQ+AVAKGAVCLDGSPPAY+FD+G G+G N+WL+H EGG WC+NVT CL R
Sbjct  25   EADFVPTTIVQNAVAKGAVCLDGSPPAYNFDKGYGKGSNSWLVHMEGGGWCHNVTNCLGR  84

Query  384  KDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNL  563
              TRLGSS +M K +AFSG+L +  + NPDFY WNRIK+RYCDGSSFTGDVEAV+P T L
Sbjct  85   MTTRLGSSKQMNKTLAFSGILNDKKQFNPDFYNWNRIKIRYCDGSSFTGDVEAVDPVTKL  144

Query  564  HFRGARVFVA  593
            HFRGAR+F A
Sbjct  145  HFRGARIFEA  154



>ref|XP_007040900.1| Pectinacetylesterase family protein [Theobroma cacao]
 gb|EOY25401.1| Pectinacetylesterase family protein [Theobroma cacao]
Length=399

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 113/146 (77%), Gaps = 2/146 (1%)
 Frame = +3

Query  156  KWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIH  335
            +W+   +   +ILL+ EG  V ITY+QSAVAKGAVCLDGSPPAYHFD GSG G+NNWL+H
Sbjct  8    QWLSLLVCCLLILLKAEGGSVGITYLQSAVAKGAVCLDGSPPAYHFDPGSGAGVNNWLVH  67

Query  336  FEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDG  515
             EGG WC +V  CL+R++T LGSS +MVKQ  FSGLL +  K NPDFY WNRIKVRYCDG
Sbjct  68   MEGGGWCEDVERCLSRRNTDLGSSEQMVKQFGFSGLLSSQQKSNPDFYNWNRIKVRYCDG  127

Query  516  SSFTGDVEAVNPKTNLHFRGARVFVA  593
            SSFTGDVEA  P  NL FRG R++ A
Sbjct  128  SSFTGDVEA--PVNNLFFRGNRIWEA  151



>gb|KCW72718.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
 gb|KCW72719.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=403

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = +3

Query  249  KGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQV  428
            + AVCLDGSPPAYHF++G G G NNWL+ FEGG WCNNVTTCLAR+DTRLGSS +MVK+V
Sbjct  2    RPAVCLDGSPPAYHFNKGLGTGANNWLVQFEGGGWCNNVTTCLARRDTRLGSSKEMVKEV  61

Query  429  AFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            AFSG+L N+   NPDFY WNRIKVRYCDG+SFTGDVEAV+P T LHFRGAR FVA
Sbjct  62   AFSGILSNNHSFNPDFYNWNRIKVRYCDGASFTGDVEAVDPATKLHFRGARAFVA  116



>ref|XP_010111521.1| hypothetical protein L484_021346 [Morus notabilis]
 gb|EXC31044.1| hypothetical protein L484_021346 [Morus notabilis]
Length=386

 Score =   196 bits (498),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +3

Query  249  KGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQV  428
            + + CLDGSPPAYHF  G G G+NNWL+  EGG WCNNVTTCLARK+TRLGSS  MVK++
Sbjct  26   QDSFCLDGSPPAYHFSHGFGSGVNNWLVQIEGGGWCNNVTTCLARKNTRLGSSKAMVKEL  85

Query  429  AFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            +FSG+L N  K NPDFY WNRIKVRYCDGSSFTGDVEAVNP TNLHFRGARVF+A
Sbjct  86   SFSGILSNKQKFNPDFYDWNRIKVRYCDGSSFTGDVEAVNPATNLHFRGARVFLA  140



>ref|XP_010536210.1| PREDICTED: uncharacterized protein LOC104811251 [Tarenaya hassleriana]
Length=391

 Score =   196 bits (497),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 109/149 (73%), Gaps = 6/149 (4%)
 Frame = +3

Query  153  QKW--VVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNW  326
            Q+W  +V  LA  MI        V ITY+ SAVAKGAVCLDGSPPAYHFD+GSG G+NNW
Sbjct  5    QQWRSIVVVLALLMIGAGA----VPITYLDSAVAKGAVCLDGSPPAYHFDKGSGSGVNNW  60

Query  327  LIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRY  506
            ++H EGG WCN++ +C  RK+T  GSS  M K   FSG+LG+    NPDFY WNRIKVRY
Sbjct  61   IVHMEGGGWCNDIASCSERKNTMKGSSKFMNKDFGFSGILGSKQSSNPDFYNWNRIKVRY  120

Query  507  CDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            CDGSSFTGDVEAVNP   L FRGARV+ A
Sbjct  121  CDGSSFTGDVEAVNPSNKLFFRGARVWRA  149



>ref|XP_009397056.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009397057.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=393

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 110/147 (75%), Gaps = 3/147 (2%)
 Frame = +3

Query  159  WVVYGLAFFMIL--LRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLI  332
            W+   + F+ +L  L  + + V +T + SAVAKGAVCLDGSPPAYHF  GSG G NNWL+
Sbjct  9    WIYPFICFYFLLASLEVDAYDVPMTLLHSAVAKGAVCLDGSPPAYHFSPGSGSGANNWLV  68

Query  333  HFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCD  512
            H EGG WC NV  CL RK+   GSS  M K ++FSG+LGN  K NPDFY WNRIK+RYCD
Sbjct  69   HMEGGGWCRNVEECLERKNNFRGSSNHM-KPLSFSGILGNSKKSNPDFYNWNRIKIRYCD  127

Query  513  GSSFTGDVEAVNPKTNLHFRGARVFVA  593
            GSSFTGDVE V+P TNLH+RGARV++A
Sbjct  128  GSSFTGDVERVDPATNLHYRGARVWLA  154



>ref|XP_011082152.1| PREDICTED: protein notum homolog isoform X2 [Sesamum indicum]
Length=378

 Score =   194 bits (494),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +3

Query  258  VCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFS  437
            VCLDGSPPAYH DRG G GINNWL+H EGG WCNNVTTCLARK+ RLGSS  MVKQ+AFS
Sbjct  20   VCLDGSPPAYHLDRGYGTGINNWLVHIEGGGWCNNVTTCLARKNNRLGSSKYMVKQLAFS  79

Query  438  GLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            G+L N    NPDFY WNR+KVRYCDG+SFTGDVEAVNP T LH+RGARVF+A
Sbjct  80   GILNNKANFNPDFYNWNRVKVRYCDGASFTGDVEAVNPVTKLHYRGARVFLA  131



>ref|XP_002519912.1| pectin acetylesterase, putative [Ricinus communis]
 gb|EEF42516.1| pectin acetylesterase, putative [Ricinus communis]
Length=452

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = +3

Query  168  YGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGG  347
            Y L + ++LL+ EG  + IT V++A A+GAVCLDGSPPAYH+D+G G G NNW++H EGG
Sbjct  69   YFLVYMLLLLKIEGASIPITIVETAKARGAVCLDGSPPAYHYDKGYGTGANNWIVHMEGG  128

Query  348  AWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFT  527
             WC+++ +C  RKDT  GSS KM K + FSG+LG     NPDFY WNRIK++YCDGSSFT
Sbjct  129  GWCDDLESCSQRKDTYKGSSLKMEKTMGFSGILGGKQSANPDFYNWNRIKIKYCDGSSFT  188

Query  528  GDVEAVNPKTNLHFRGARVFVA  593
            GDVE V+ KTNLHFRG R++ A
Sbjct  189  GDVEVVDAKTNLHFRGERIWQA  210



>gb|KHG09455.1| Protein notum [Gossypium arboreum]
Length=397

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 107/134 (80%), Gaps = 2/134 (1%)
 Frame = +3

Query  186  MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  365
            +ILL++EG  V ITY+Q AVAKGAVCLDGSPPAYHFD+GSG G++NW++H EGG WC +V
Sbjct  19   VILLKSEGASVGITYLQDAVAKGAVCLDGSPPAYHFDKGSGTGVDNWIVHMEGGGWCEDV  78

Query  366  TTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAV  545
             TCL+RK+T LGSS +MVKQ  FSGLL    K NPDFY WNRIKVRYCDGSSFTGD  AV
Sbjct  79   PTCLSRKNTDLGSSKQMVKQFGFSGLLSGQQKSNPDFYNWNRIKVRYCDGSSFTGD--AV  136

Query  546  NPKTNLHFRGARVF  587
            +   NL F+G  ++
Sbjct  137  DRANNLFFKGNSIW  150



>gb|KJB25075.1| hypothetical protein B456_004G176200 [Gossypium raimondii]
 gb|KJB25076.1| hypothetical protein B456_004G176200 [Gossypium raimondii]
 gb|KJB25077.1| hypothetical protein B456_004G176200 [Gossypium raimondii]
 gb|KJB25079.1| hypothetical protein B456_004G176200 [Gossypium raimondii]
 gb|KJB25080.1| hypothetical protein B456_004G176200 [Gossypium raimondii]
Length=397

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 107/134 (80%), Gaps = 2/134 (1%)
 Frame = +3

Query  186  MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  365
            +ILL++EG  V ITY+Q AVAKGAVCLDGSPPAYHFD+GSG G++NW++H EGG WC +V
Sbjct  19   VILLKSEGASVGITYLQDAVAKGAVCLDGSPPAYHFDKGSGAGVDNWIVHMEGGGWCEDV  78

Query  366  TTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAV  545
             TCL+RK+T LGSS +MVKQ  FSGLL    K NPDFY WNRIKVRYCDGSSFTGD  AV
Sbjct  79   PTCLSRKNTDLGSSKQMVKQFGFSGLLSGQQKSNPDFYNWNRIKVRYCDGSSFTGD--AV  136

Query  546  NPKTNLHFRGARVF  587
            +   NL F+G  ++
Sbjct  137  DRANNLFFKGNSIW  150



>gb|KDP28066.1| hypothetical protein JCGZ_19474 [Jatropha curcas]
Length=395

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = +3

Query  147  GVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNW  326
            G  +W  Y L F ++LL+TEG  + IT V++A  +GAVCLDGSPPAYHFD+G G G NNW
Sbjct  5    GSVQWFSYLLVFMLLLLKTEGGSIPITIVETAKTRGAVCLDGSPPAYHFDKGYGSGANNW  64

Query  327  LIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRY  506
            ++H EGG WC+++ +CL R+DT  GSS KM K + FSG+LG+    NPDFY WNRIK++Y
Sbjct  65   IVHMEGGGWCDDIESCLERRDTYKGSSLKMEKTMGFSGILGSKQAANPDFYNWNRIKIKY  124

Query  507  CDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            CDGSSFTGDVEAV+PKT L+FRG R++ A
Sbjct  125  CDGSSFTGDVEAVDPKTKLYFRGERIWRA  153



>ref|XP_006424455.1| hypothetical protein CICLE_v10030247mg [Citrus clementina]
 gb|ESR37695.1| hypothetical protein CICLE_v10030247mg [Citrus clementina]
Length=292

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 107/136 (79%), Gaps = 4/136 (3%)
 Frame = +3

Query  186  MILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNV  365
            ++LL+ +GF V ITYV++    G  CLDG PPAYHFD+G G GINNWL+  EGG WCN+V
Sbjct  17   LMLLKAQGFSVPITYVEN----GVFCLDGRPPAYHFDKGFGAGINNWLVFIEGGGWCNDV  72

Query  366  TTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAV  545
            TTC  R +T  GSS KM ++V F+G+L N  K NPDFY WNRI+V+YCDG+SFTGD+EAV
Sbjct  73   TTCHVRANTGFGSSKKMGEEVNFTGILSNEQKYNPDFYNWNRIEVKYCDGASFTGDLEAV  132

Query  546  NPKTNLHFRGARVFVA  593
            +P TNLHFRGARVF+A
Sbjct  133  DPATNLHFRGARVFLA  148



>ref|XP_006359968.1| PREDICTED: protein notum homolog, partial [Solanum tuberosum]
Length=369

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 104/134 (78%), Gaps = 0/134 (0%)
 Frame = +3

Query  192  LLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTT  371
             + TE   V++T +Q+AVAKGAVCLDGSPPAYH DRGSG G+NNW+I  EGG WC NV  
Sbjct  1    FVTTESSLVNLTILQTAVAKGAVCLDGSPPAYHLDRGSGTGVNNWVISVEGGGWCQNVAQ  60

Query  372  CLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNP  551
            CL RK+++ GSS KM  QV FSG+L N  K NP+FY WNR+ VRYCDG SFTGDVEA++P
Sbjct  61   CLLRKNSKYGSSAKMENQVFFSGMLSNEQKFNPEFYNWNRVFVRYCDGGSFTGDVEAIDP  120

Query  552  KTNLHFRGARVFVA  593
             T LH+RGAR+F A
Sbjct  121  GTGLHYRGARIFKA  134



>ref|XP_008808367.1| PREDICTED: uncharacterized protein LOC103720446 isoform X1 [Phoenix 
dactylifera]
Length=399

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 110/146 (75%), Gaps = 2/146 (1%)
 Frame = +3

Query  159  WV-VYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIH  335
            W+ ++ L   +I ++ EGF V +T VQSAVAKGAVCLDGSPPAYHF  G G G+NNWL+H
Sbjct  12   WIYLFILLELLISMKVEGFDVPLTLVQSAVAKGAVCLDGSPPAYHFAPGFGSGVNNWLVH  71

Query  336  FEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDG  515
             EGG WC NV  C  R     GSS K +KQ++FSG+LG     NPDFY WN++K+RYCDG
Sbjct  72   MEGGGWCRNVEECKERTKNFRGSS-KYMKQLSFSGILGKKQNLNPDFYNWNKVKIRYCDG  130

Query  516  SSFTGDVEAVNPKTNLHFRGARVFVA  593
            SSFTGD+EAVNP TNLHFRGARV+ A
Sbjct  131  SSFTGDIEAVNPATNLHFRGARVWRA  156



>ref|XP_003547822.1| PREDICTED: protein notum homolog [Glycine max]
 gb|KHN26082.1| Protein notum like [Glycine soja]
Length=398

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 116/153 (76%), Gaps = 2/153 (1%)
 Frame = +3

Query  135  MENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEG  314
            ME+  + KW+   +   ++LL+ EG  V +T V++A +KGAVCLDGSPPAYHFD G  EG
Sbjct  1    MESARISKWLNLLVCV-LLLLKAEGSLVPLTLVKNAESKGAVCLDGSPPAYHFDNGFEEG  59

Query  315  INNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRI  494
            I NW++H EGG WCNNV +CL RKD+RLGSS +M + + FS +L N  + NPDFY WNR+
Sbjct  60   IKNWIVHIEGGGWCNNVESCLYRKDSRLGSSKQM-EDLYFSAILSNEQEYNPDFYNWNRV  118

Query  495  KVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            KVRYCDGSSFTGDVE V+  TNLHFRGAR+F A
Sbjct  119  KVRYCDGSSFTGDVEEVDQTTNLHFRGARIFSA  151



>ref|XP_008808370.1| PREDICTED: uncharacterized protein LOC103720446 isoform X3 [Phoenix 
dactylifera]
Length=401

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 110/146 (75%), Gaps = 2/146 (1%)
 Frame = +3

Query  159  WV-VYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIH  335
            W+ ++ L   +I ++ EGF V +T VQSAVAKGAVCLDGSPPAYHF  G G G+NNWL+H
Sbjct  12   WIYLFILLELLISMKVEGFDVPLTLVQSAVAKGAVCLDGSPPAYHFAPGFGSGVNNWLVH  71

Query  336  FEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDG  515
             EGG WC NV  C  R     GSS K +KQ++FSG+LG     NPDFY WN++K+RYCDG
Sbjct  72   MEGGGWCRNVEECKERTKNFRGSS-KYMKQLSFSGILGKKQNLNPDFYNWNKVKIRYCDG  130

Query  516  SSFTGDVEAVNPKTNLHFRGARVFVA  593
            SSFTGD+EAVNP TNLHFRGARV+ A
Sbjct  131  SSFTGDIEAVNPATNLHFRGARVWRA  156



>ref|XP_008808368.1| PREDICTED: uncharacterized protein LOC103720446 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008808369.1| PREDICTED: uncharacterized protein LOC103720446 isoform X2 [Phoenix 
dactylifera]
Length=396

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 110/146 (75%), Gaps = 2/146 (1%)
 Frame = +3

Query  159  WV-VYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIH  335
            W+ ++ L   +I ++ EGF V +T VQSAVAKGAVCLDGSPPAYHF  G G G+NNWL+H
Sbjct  9    WIYLFILLELLISMKVEGFDVPLTLVQSAVAKGAVCLDGSPPAYHFAPGFGSGVNNWLVH  68

Query  336  FEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDG  515
             EGG WC NV  C  R     GSS K +KQ++FSG+LG     NPDFY WN++K+RYCDG
Sbjct  69   MEGGGWCRNVEECKERTKNFRGSS-KYMKQLSFSGILGKKQNLNPDFYNWNKVKIRYCDG  127

Query  516  SSFTGDVEAVNPKTNLHFRGARVFVA  593
            SSFTGD+EAVNP TNLHFRGARV+ A
Sbjct  128  SSFTGDIEAVNPATNLHFRGARVWRA  153



>gb|KHN27511.1| Protein notum like [Glycine soja]
Length=398

 Score =   193 bits (491),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 105/132 (80%), Gaps = 1/132 (1%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            + EG  V +T V+++  KGAVCLDGSPPAYHFD+G G+GINNW++H EGG WCNNVT+CL
Sbjct  21   KAEGSSVPLTLVKNSETKGAVCLDGSPPAYHFDKGFGKGINNWIVHIEGGGWCNNVTSCL  80

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
             RK+T LGSS  M   ++F  +L N  + NPDFY WNR+KVRYCDGSSFTGDVE V+P T
Sbjct  81   DRKNTTLGSSNHM-SDISFYAILSNQQQFNPDFYNWNRVKVRYCDGSSFTGDVEEVDPTT  139

Query  558  NLHFRGARVFVA  593
            NLHFRGAR+F A
Sbjct  140  NLHFRGARIFSA  151



>ref|XP_003548585.1| PREDICTED: protein notum homolog [Glycine max]
Length=398

 Score =   193 bits (490),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 105/132 (80%), Gaps = 1/132 (1%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            + EG  V +T V+++  KGAVCLDGSPPAYHFD+G G+GINNW++H EGG WCNNVT+CL
Sbjct  21   KAEGSSVPLTLVKNSETKGAVCLDGSPPAYHFDKGFGKGINNWIVHIEGGGWCNNVTSCL  80

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
             RK+T LGSS  M   ++F  +L N  + NPDFY WNR+KVRYCDGSSFTGDVE V+P T
Sbjct  81   DRKNTTLGSSNHM-SDISFYAILSNQQQFNPDFYNWNRVKVRYCDGSSFTGDVEEVDPTT  139

Query  558  NLHFRGARVFVA  593
            NLHFRGAR+F A
Sbjct  140  NLHFRGARIFSA  151



>ref|XP_010911666.1| PREDICTED: protein notum homolog [Elaeis guineensis]
Length=388

 Score =   192 bits (489),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 111/150 (74%), Gaps = 1/150 (1%)
 Frame = +3

Query  144  LGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINN  323
            +GV++     L   +I L  EGF V +T VQ AVAKGAVCLDGSPPAYHF  G G G++N
Sbjct  2    IGVKRGAWIYLIVLLISLTVEGFDVPLTLVQDAVAKGAVCLDGSPPAYHFAPGFGSGVDN  61

Query  324  WLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVR  503
            WL+H EGG WC+NV  C  R     GSS K ++Q++FSG+LGN    +PDFY WN++K+R
Sbjct  62   WLVHMEGGGWCSNVEECKQRTKNFRGSS-KYMEQLSFSGILGNKQTSSPDFYNWNKVKIR  120

Query  504  YCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            YCDGSSFTGD+EAVNP TNLHFRGARV+ A
Sbjct  121  YCDGSSFTGDIEAVNPATNLHFRGARVWRA  150



>ref|XP_009388128.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=393

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 108/147 (73%), Gaps = 3/147 (2%)
 Frame = +3

Query  159  WVVYGLAFFMIL--LRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLI  332
            W+   + FF +L  L  +   V +T + SAVAKGAVCLDGSPPAYHF  GSG G NNWL+
Sbjct  9    WIYPVICFFFLLASLEVDALGVPMTLLHSAVAKGAVCLDGSPPAYHFSPGSGSGANNWLV  68

Query  333  HFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCD  512
            H EGG WC NV  CL RK+   GSS  M K ++FSG+LG   K NPDFY WNR+K+RYCD
Sbjct  69   HMEGGGWCRNVEECLERKNNFRGSSNHM-KPLSFSGILGKSKKYNPDFYNWNRVKIRYCD  127

Query  513  GSSFTGDVEAVNPKTNLHFRGARVFVA  593
            GSSFTGDVE V+P TNLH+RGARV++A
Sbjct  128  GSSFTGDVERVDPATNLHYRGARVWLA  154



>ref|XP_010942974.1| PREDICTED: protein notum homolog [Elaeis guineensis]
Length=391

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 103/130 (79%), Gaps = 1/130 (1%)
 Frame = +3

Query  204  EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  383
            EGF V +T VQSAVAKGAVCLDGSPPAYHF  G G G+NNWL+H EGG WC NV  C  R
Sbjct  25   EGFDVPLTLVQSAVAKGAVCLDGSPPAYHFTPGFGSGVNNWLVHMEGGGWCRNVEECKER  84

Query  384  KDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNL  563
                 GSS K +KQ++FSG+LGN  K NPDFY WN++K+RYCDGSSFTGDVEAV+P TNL
Sbjct  85   TKNFRGSS-KYMKQLSFSGILGNKQKLNPDFYNWNKVKIRYCDGSSFTGDVEAVDPATNL  143

Query  564  HFRGARVFVA  593
            HFRGARV+ A
Sbjct  144  HFRGARVWRA  153



>ref|XP_008797987.1| PREDICTED: protein notum homolog isoform X1 [Phoenix dactylifera]
Length=391

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 104/132 (79%), Gaps = 1/132 (1%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            + EGF V +T VQ+AVAKGAVCLDGSPPAYHF  G G G+NNWL+H EGG WC+NV  C 
Sbjct  23   KVEGFDVPLTLVQAAVAKGAVCLDGSPPAYHFAPGFGSGVNNWLVHMEGGGWCSNVEECK  82

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
             R     GSS K +KQ++FSG+LGN    NPDFY WN++K+RYCDGSSFTGD+EAVNP T
Sbjct  83   ERTGNFRGSS-KYMKQLSFSGILGNQQNLNPDFYNWNKVKIRYCDGSSFTGDIEAVNPAT  141

Query  558  NLHFRGARVFVA  593
            NLHFRGARV+ A
Sbjct  142  NLHFRGARVWRA  153



>ref|NP_974575.2| putative pectinacetylesterase [Arabidopsis thaliana]
 gb|AEE84179.1| putative pectinacetylesterase [Arabidopsis thaliana]
Length=365

 Score =   190 bits (482),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = +3

Query  255  AVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAF  434
            AVCLDGSPPAYH DRGSG GIN+WLI  EGG WCNNVT C++R  TRLGSS KMV+ +AF
Sbjct  6    AVCLDGSPPAYHLDRGSGTGINSWLIQLEGGGWCNNVTNCVSRMHTRLGSSKKMVENLAF  65

Query  435  SGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            S +L N  + NPDFY WNR+KVRYCDG+SFTGDVEAVNP TNLHFRGARV++A
Sbjct  66   SAILSNKKQYNPDFYNWNRVKVRYCDGASFTGDVEAVNPATNLHFRGARVWLA  118



>gb|AAM65412.1| pectin acetylesterase [Arabidopsis thaliana]
Length=391

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V ITY++SAVAKGAVCLDGS PAYHFD+GSG G+NNW++H EGG WC ++ TC+ RK T 
Sbjct  24   VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRKSTM  83

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTGD+EAV+P   L FRG
Sbjct  84   KGSSKLMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVDPANKLFFRG  143

Query  576  ARVFVA  593
            ARV+ A
Sbjct  144  ARVWRA  149



>ref|XP_010536189.1| PREDICTED: uncharacterized protein LOC104811235 isoform X1 [Tarenaya 
hassleriana]
Length=391

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V ITY+ SAVA+GAVCLDGSPPAYHFD+G G G+NNW++H EGG WCN++ +C  RK+T 
Sbjct  24   VPITYLNSAVARGAVCLDGSPPAYHFDKGFGSGVNNWIVHMEGGGWCNDIASCSERKNTM  83

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS  M K   FSG+LG+    NPDFY WNRIKVRYCDGSSFTGDVEAVNP   L FRG
Sbjct  84   KGSSKLMNKDFGFSGILGSQQSTNPDFYNWNRIKVRYCDGSSFTGDVEAVNPSNKLFFRG  143

Query  576  ARVFVA  593
            ARV+ A
Sbjct  144  ARVWRA  149



>ref|XP_010494620.1| PREDICTED: uncharacterized protein LOC104771742 [Camelina sativa]
Length=391

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V ITY++SAVAKGAVCLDGS PAYHFD+GSG G+NNW++H EGG WC ++ TC+ RK T 
Sbjct  24   VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRKSTM  83

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTGD+EAV+P   L FRG
Sbjct  84   KGSSKLMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVDPANKLFFRG  143

Query  576  ARVFVA  593
            ARV+ A
Sbjct  144  ARVWRA  149



>gb|EMS35701.1| hypothetical protein TRIUR3_33758 [Triticum urartu]
Length=146

 Score =   181 bits (460),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +3

Query  213  FVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDT  392
             VDITYV+SAVAKGAVCLDGSPPAYH   GSG G+N+WL+HFEGGAWCNN  TCL R  T
Sbjct  30   LVDITYVESAVAKGAVCLDGSPPAYHLAPGSGSGVNSWLVHFEGGAWCNNAATCLQRSRT  89

Query  393  RLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPK  554
             LGSS +M ++VAF+G+L N    NPDFY WNR+KVRYCDGSSFTGD E V+P+
Sbjct  90   PLGSSKEMARRVAFTGILSNASDYNPDFYNWNRVKVRYCDGSSFTGDKEEVDPR  143



>ref|XP_006280604.1| hypothetical protein CARUB_v10026563mg [Capsella rubella]
 gb|EOA13502.1| hypothetical protein CARUB_v10026563mg [Capsella rubella]
Length=391

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V ITY++SAVAKGAVCLDGS PAYHFD+GSG G+NNW++H EGG WC ++ TC+ RK T 
Sbjct  24   VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRKSTM  83

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTGD+EAV+P   L FRG
Sbjct  84   KGSSKLMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVDPTNKLFFRG  143

Query  576  ARVFVA  593
            ARV+ A
Sbjct  144  ARVWRA  149



>ref|NP_851135.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 gb|AAL07047.1| putative pectin acetylesterase [Arabidopsis thaliana]
 gb|AAN12894.1| putative pectin acetylesterase [Arabidopsis thaliana]
 gb|AED95225.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=370

 Score =   188 bits (477),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V ITY++SAVAKGAVCLDGS PAYHFD+GSG G+NNW++H EGG WC ++ TC+ RK T 
Sbjct  24   VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRKSTM  83

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTGD+EAV+P   L FRG
Sbjct  84   KGSSKLMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVDPTHKLFFRG  143

Query  576  ARVFVA  593
            ARV+ A
Sbjct  144  ARVWRA  149



>ref|XP_010441760.1| PREDICTED: uncharacterized protein LOC104724893 [Camelina sativa]
Length=391

 Score =   188 bits (478),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V ITY++SAVAKGAVCLDGS PAYHFD+GSG G+NNW++H EGG WC ++ TC+ RK T 
Sbjct  24   VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRKSTM  83

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTGD+EAV+P   L FRG
Sbjct  84   KGSSKLMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVDPANKLFFRG  143

Query  576  ARVFVA  593
            ARV+ A
Sbjct  144  ARVWRA  149



>ref|NP_199341.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 sp|Q9FH82.1|PAE11_ARATH RecName: Full=Pectin acetylesterase 11; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10249.1| pectin acetylesterase [Arabidopsis thaliana]
 gb|AAL15296.1| AT5g45280/K9E15_6 [Arabidopsis thaliana]
 gb|AED95226.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=391

 Score =   188 bits (477),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V ITY++SAVAKGAVCLDGS PAYHFD+GSG G+NNW++H EGG WC ++ TC+ RK T 
Sbjct  24   VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRKSTM  83

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTGD+EAV+P   L FRG
Sbjct  84   KGSSKLMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVDPTHKLFFRG  143

Query  576  ARVFVA  593
            ARV+ A
Sbjct  144  ARVWRA  149



>emb|CDY67801.1| BnaAnng25210D, partial [Brassica napus]
Length=383

 Score =   188 bits (477),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = +3

Query  255  AVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAF  434
            AVCLDGSPPAYH DRGSG GIN+WLI  EGG WC+NVT C++R  T+LGSS KMV+ +AF
Sbjct  24   AVCLDGSPPAYHIDRGSGTGINSWLIQLEGGGWCHNVTNCISRMHTKLGSSKKMVENLAF  83

Query  435  SGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            S +L N  +RNPDFY WNR+KVRYCDGSSFTGDV+ VNP TNLHFRGARV++A
Sbjct  84   SAILSNKEQRNPDFYNWNRVKVRYCDGSSFTGDVKTVNPATNLHFRGARVWLA  136



>ref|XP_006398195.1| hypothetical protein EUTSA_v10000914mg [Eutrema salsugineum]
 gb|ESQ39648.1| hypothetical protein EUTSA_v10000914mg [Eutrema salsugineum]
Length=391

 Score =   188 bits (477),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V ITY++SAVAKGAVCLDGS PAYHFD+GSG G+NNW++H EGG WC ++ TC+ RK T 
Sbjct  24   VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVKRKSTM  83

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTGD+EAV+P   L FRG
Sbjct  84   KGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVDPTNKLFFRG  143

Query  576  ARVFVA  593
            ARV+ A
Sbjct  144  ARVWRA  149



>ref|XP_009128780.1| PREDICTED: uncharacterized protein LOC103853624 [Brassica rapa]
Length=391

 Score =   187 bits (476),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V ITY++SAVAKGAVCLDGS PAYHFD+GSG G+NNW++H EGG WC ++ TC+ RK T 
Sbjct  24   VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVKRKTTM  83

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTGD+EAV+P   L FRG
Sbjct  84   KGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVDPTNKLFFRG  143

Query  576  ARVFVA  593
            ARV+ A
Sbjct  144  ARVWRA  149



>ref|XP_010481611.1| PREDICTED: uncharacterized protein LOC104760390 [Camelina sativa]
Length=391

 Score =   187 bits (476),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = +3

Query  222  ITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTRLG  401
            ITY++SAVAKGAVCLDGS PAYHFD+GSG G+NNW++H EGG WC ++ TC+ RK T  G
Sbjct  26   ITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRKSTMKG  85

Query  402  SSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGAR  581
            SS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTGD+EAV+P   L FRGAR
Sbjct  86   SSKLMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVDPANKLFFRGAR  145

Query  582  VFVA  593
            V+ A
Sbjct  146  VWRA  149



>emb|CDX87799.1| BnaC02g31500D [Brassica napus]
Length=391

 Score =   187 bits (476),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V ITY++SAVAKGAVCLDGS PAYHFD+GSG G+NNW++H EGG WC ++ TC+ RK T 
Sbjct  24   VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVKRKTTM  83

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTGD+EAV+P   L FRG
Sbjct  84   KGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVDPTNKLFFRG  143

Query  576  ARVFVA  593
            ARV+ A
Sbjct  144  ARVWRA  149



>emb|CDY26383.1| BnaA02g23870D [Brassica napus]
Length=391

 Score =   187 bits (475),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V ITY++SAVAKGAVCLDGS PAYHFD+GSG G+NNW++H EGG WC ++ TC+ RK T 
Sbjct  24   VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVKRKTTM  83

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTGD+EAV+P   L FRG
Sbjct  84   KGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVDPTNKLFFRG  143

Query  576  ARVFVA  593
            ARV+ A
Sbjct  144  ARVWRA  149



>ref|XP_002865253.1| pectin acetylesterase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41512.1| pectin acetylesterase [Arabidopsis lyrata subsp. lyrata]
Length=391

 Score =   187 bits (475),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V ITY++SAVAKGAVCLDGS PAYHFD+GSG G NNW++H EGG WC ++ TC+ RK T 
Sbjct  24   VPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGANNWIVHMEGGGWCTDIATCVQRKSTM  83

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTGD+EAV+P   L FRG
Sbjct  84   KGSSKLMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVDPTNKLFFRG  143

Query  576  ARVFVA  593
            ARV+ A
Sbjct  144  ARVWRA  149



>gb|KDO40409.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
Length=372

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +3

Query  255  AVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAF  434
            AVCLDGSPPAYHFD+G G GINNWL+H +GGAWCNNV  C  R+D+  GSS  MVK+  F
Sbjct  22   AVCLDGSPPAYHFDKGFGAGINNWLVHIDGGAWCNNVEDCSKRRDSSYGSSKHMVKEANF  81

Query  435  SGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            +G+L N  K NPDFY WNR++VRYCDG+SFTGDVEAVNP+TNLHFRGARVF A
Sbjct  82   TGILSNEQKFNPDFYDWNRVRVRYCDGASFTGDVEAVNPETNLHFRGARVFEA  134



>ref|XP_006283887.1| hypothetical protein CARUB_v10005004mg [Capsella rubella]
 gb|EOA16785.1| hypothetical protein CARUB_v10005004mg [Capsella rubella]
Length=391

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG WC +V +CLARK+T 
Sbjct  24   VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCLARKNTM  83

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTG+V AVNP   L FRG
Sbjct  84   KGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVAAVNPSNKLFFRG  143

Query  576  ARVFVA  593
            ARV+ A
Sbjct  144  ARVWRA  149



>dbj|BAD94756.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
Length=285

 Score =   183 bits (465),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG WC +V +C  RK T 
Sbjct  24   VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCNERKGTM  83

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTG+VEAVNP   L FRG
Sbjct  84   KGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVEAVNPANKLFFRG  143

Query  576  ARVFVA  593
            ARV+ A
Sbjct  144  ARVWRA  149



>ref|XP_009108426.1| PREDICTED: protein notum homolog [Brassica rapa]
 emb|CDX76482.1| BnaA08g09180D [Brassica napus]
Length=391

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG WC +V +C ARK+T 
Sbjct  24   VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCSARKNTM  83

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTG+VEAVNP   L FRG
Sbjct  84   KGSSKFMNKDFGFSGILGGKQNTNPDFYNWNRIKVRYCDGSSFTGNVEAVNPANKLFFRG  143

Query  576  ARVFVA  593
            ARV+ A
Sbjct  144  ARVWRA  149



>emb|CDY09287.1| BnaC03g63170D [Brassica napus]
Length=391

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG WC +V +C ARK+T 
Sbjct  24   VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCSARKNTM  83

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTG+VEAVNP   L FRG
Sbjct  84   KGSSKFMNKDFGFSGILGGKQNTNPDFYNWNRIKVRYCDGSSFTGNVEAVNPANKLFFRG  143

Query  576  ARVFVA  593
            ARV+ A
Sbjct  144  ARVWRA  149



>emb|CDX99378.1| BnaC01g11740D [Brassica napus]
Length=391

 Score =   186 bits (471),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 103/140 (74%), Gaps = 2/140 (1%)
 Frame = +3

Query  174  LAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAW  353
            L   M+++ T    V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG W
Sbjct  12   LVLSMVVIGTGA--VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGW  69

Query  354  CNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGD  533
            C +V +C+ RK T  GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTG+
Sbjct  70   CTDVASCIKRKGTMKGSSKFMNKDFGFSGILGGKQNTNPDFYNWNRIKVRYCDGSSFTGN  129

Query  534  VEAVNPKTNLHFRGARVFVA  593
            VEAVNP   L FRGARV+ A
Sbjct  130  VEAVNPANKLFFRGARVWRA  149



>ref|XP_009132784.1| PREDICTED: uncharacterized protein LOC103857370 [Brassica rapa]
Length=391

 Score =   186 bits (471),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 103/140 (74%), Gaps = 2/140 (1%)
 Frame = +3

Query  174  LAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAW  353
            L   M+++ T    V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG W
Sbjct  12   LVLSMVVIGTGA--VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGW  69

Query  354  CNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGD  533
            C +V +C+ RK T  GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTG+
Sbjct  70   CTDVASCIKRKGTMKGSSKFMNKDFGFSGILGGKQNTNPDFYNWNRIKVRYCDGSSFTGN  129

Query  534  VEAVNPKTNLHFRGARVFVA  593
            VEAVNP   L FRGARV+ A
Sbjct  130  VEAVNPANKLFFRGARVWRA  149



>emb|CDX78932.1| BnaA01g09990D [Brassica napus]
Length=391

 Score =   185 bits (470),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 103/140 (74%), Gaps = 2/140 (1%)
 Frame = +3

Query  174  LAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAW  353
            L   M+++ T    V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG W
Sbjct  12   LVLSMVVIGTGA--VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGW  69

Query  354  CNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGD  533
            C +V +C+ RK T  GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTG+
Sbjct  70   CTDVASCIKRKGTMKGSSKFMNKDFGFSGILGGKQNTNPDFYNWNRIKVRYCDGSSFTGN  129

Query  534  VEAVNPKTNLHFRGARVFVA  593
            VEAVNP   L FRGARV+ A
Sbjct  130  VEAVNPANKLFFRGARVWRA  149



>ref|XP_009413211.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=397

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 110/152 (72%), Gaps = 1/152 (1%)
 Frame = +3

Query  138  ENLGVQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGI  317
            + LG +   +  +   +  L   GF V +T ++ AV +GAVCLDGSPPAYHF  G G G+
Sbjct  7    DKLGARICPLVCVCCLLAALVVNGFDVPMTLLEGAVDEGAVCLDGSPPAYHFSPGFGSGM  66

Query  318  NNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIK  497
            NNWL+H EGG WC NV  CLAR+DT  GSS K +K ++FSG+LGN    NPDFY WN++K
Sbjct  67   NNWLVHMEGGGWCTNVQDCLARRDTFRGSS-KYMKPLSFSGILGNSQNSNPDFYNWNKVK  125

Query  498  VRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            +RYCDGSSFTGDV+ V+P T L+FRGA++++A
Sbjct  126  IRYCDGSSFTGDVDEVDPATKLYFRGAKIWLA  157



>ref|XP_010434425.1| PREDICTED: uncharacterized protein LOC104718381 isoform X2 [Camelina 
sativa]
Length=379

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG WC +V +C+ RK T 
Sbjct  24   VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCIERKGTM  83

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTG+V AVNP   L FRG
Sbjct  84   KGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVAAVNPANKLFFRG  143

Query  576  ARVFVA  593
            ARV+ A
Sbjct  144  ARVWRA  149



>ref|XP_006413981.1| hypothetical protein EUTSA_v10024796mg [Eutrema salsugineum]
 gb|ESQ55434.1| hypothetical protein EUTSA_v10024796mg [Eutrema salsugineum]
Length=564

 Score =   186 bits (472),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V ITY+QSAVAKGAVCLDGS PAYHFD+G G GINNW++H EGG WC +V +C+ RK T 
Sbjct  24   VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGINNWIVHMEGGGWCTDVASCIKRKGTM  83

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTG+VEAVNP   L FRG
Sbjct  84   KGSSKFMNKDFGFSGILGGKQNTNPDFYNWNRIKVRYCDGSSFTGNVEAVNPANKLFFRG  143

Query  576  ARVFVA  593
            ARV+ A
Sbjct  144  ARVWRA  149



>ref|XP_002867940.1| hypothetical protein ARALYDRAFT_492921 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44199.1| hypothetical protein ARALYDRAFT_492921 [Arabidopsis lyrata subsp. 
lyrata]
Length=391

 Score =   182 bits (463),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG WC +V +C  RK T 
Sbjct  24   VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCNERKGTM  83

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTG+VEAVNP   L FRG
Sbjct  84   KGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVEAVNPANKLFFRG  143

Query  576  ARVFVA  593
            ARV+ A
Sbjct  144  ARVWRA  149



>ref|NP_567585.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 sp|Q940J8.1|PAE7_ARATH RecName: Full=Pectin acetylesterase 7; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK96722.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 gb|AAL47339.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 gb|AAM64921.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 dbj|BAF00825.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 gb|AEE84177.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=391

 Score =   182 bits (463),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG WC +V +C  RK T 
Sbjct  24   VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCNERKGTM  83

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTG+VEAVNP   L FRG
Sbjct  84   KGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVEAVNPANKLFFRG  143

Query  576  ARVFVA  593
            ARV+ A
Sbjct  144  ARVWRA  149



>ref|XP_009589854.1| PREDICTED: uncharacterized protein LOC104087156 isoform X2 [Nicotiana 
tomentosiformis]
Length=300

 Score =   180 bits (456),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 102/143 (71%), Gaps = 6/143 (4%)
 Frame = +3

Query  183  FMILLRT------EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEG  344
            F++LL T      +   V+ T + +A+ KGAVCLDGS PAY  DRGSG G+NNWL+H EG
Sbjct  5    FIVLLLTVSQVSADFLIVNTTILHNAIGKGAVCLDGSAPAYLIDRGSGYGVNNWLVHIEG  64

Query  345  GAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSF  524
            G WC+ ++ C+ R  TR GSS  M  Q  F G+L N P  NPDF+ WNR+KV+YCDG+SF
Sbjct  65   GGWCSTISECIERTGTRYGSSIHMEDQYYFQGILSNKPNENPDFFNWNRVKVKYCDGASF  124

Query  525  TGDVEAVNPKTNLHFRGARVFVA  593
            TGDV+ V+P T LHFRGARVF+A
Sbjct  125  TGDVQEVDPVTGLHFRGARVFLA  147



>ref|XP_009803843.1| PREDICTED: uncharacterized protein LOC104249167 [Nicotiana sylvestris]
 ref|XP_009803844.1| PREDICTED: uncharacterized protein LOC104249167 [Nicotiana sylvestris]
Length=396

 Score =   182 bits (463),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +3

Query  213  FVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDT  392
             VDIT ++SAV+KGAVCLDGSPPA+++D+G GEG NNW+I+F GG WC NV  CL R  T
Sbjct  37   MVDITILESAVSKGAVCLDGSPPAFYYDKGHGEGANNWIIYFRGGEWCYNVLDCLNRTKT  96

Query  393  RLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFR  572
              GSS    KQ +F G+LGN+   NPDFY WNR+ V YCDGSSFTGDVE V+P TNLHFR
Sbjct  97   EKGSSKLAPKQRSFYGILGNNKTENPDFYNWNRVMVIYCDGSSFTGDVEIVDPVTNLHFR  156

Query  573  GARVFVA  593
            GARVF A
Sbjct  157  GARVFHA  163



>ref|XP_010439720.1| PREDICTED: uncharacterized protein LOC104723107 [Camelina sativa]
Length=391

 Score =   182 bits (462),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG WC +V +C+ RK T 
Sbjct  24   VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCIERKGTM  83

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTG+V AVNP   L FRG
Sbjct  84   KGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVAAVNPANKLFFRG  143

Query  576  ARVFVA  593
            ARV+ A
Sbjct  144  ARVWRA  149



>ref|XP_010449359.1| PREDICTED: uncharacterized protein LOC104731629 [Camelina sativa]
Length=391

 Score =   182 bits (462),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG WC +V +C+ RK T 
Sbjct  24   VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCIERKGTM  83

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTG+V AVNP   L FRG
Sbjct  84   KGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVAAVNPANKLFFRG  143

Query  576  ARVFVA  593
            ARV+ A
Sbjct  144  ARVWRA  149



>ref|XP_010434424.1| PREDICTED: uncharacterized protein LOC104718381 isoform X1 [Camelina 
sativa]
Length=391

 Score =   182 bits (462),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG WC +V +C+ RK T 
Sbjct  24   VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCIERKGTM  83

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTG+V AVNP   L FRG
Sbjct  84   KGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVAAVNPANKLFFRG  143

Query  576  ARVFVA  593
            ARV+ A
Sbjct  144  ARVWRA  149



>ref|NP_001190770.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 gb|AEE84178.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=517

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG WC +V +C  RK T 
Sbjct  24   VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCNERKGTM  83

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTG+VEAVNP   L FRG
Sbjct  84   KGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVEAVNPANKLFFRG  143

Query  576  ARVFVA  593
            ARV+ A
Sbjct  144  ARVWRA  149



>ref|XP_009763243.1| PREDICTED: protein notum homolog isoform X2 [Nicotiana sylvestris]
Length=308

 Score =   179 bits (453),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 103/148 (70%), Gaps = 1/148 (1%)
 Frame = +3

Query  150  VQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWL  329
            V   V + L         +  +V+ITY+++A+ KGAVCLDGS PA+HF  G+G GIN+WL
Sbjct  4    VMATVFFSLLCLWTTTEAKDLYVNITYLETAITKGAVCLDGSAPAFHFHPGTGSGINSWL  63

Query  330  IHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYC  509
            IH +GG WC   + CLAR  T L SS  M K   F+G+L + P+ NPDFY WNR+K+RYC
Sbjct  64   IHLQGGGWCETTSDCLARATTDL-SSKNMSKIAYFTGVLSSDPQFNPDFYNWNRVKIRYC  122

Query  510  DGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            DGSS+ GD+E V+P TNLHFRGAR+F A
Sbjct  123  DGSSYIGDIEEVDPDTNLHFRGARIFEA  150



>ref|XP_010235852.1| PREDICTED: protein notum homolog isoform X2 [Brachypodium distachyon]
Length=353

 Score =   179 bits (455),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +3

Query  258  VCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFS  437
            +CLDGS PAYH  RG G G+++WL+HFEGG WC+NVTTCL RK+TRLGSS +M KQVAFS
Sbjct  1    MCLDGSAPAYHLARGFGSGVDSWLVHFEGGGWCSNVTTCLERKNTRLGSSKEMAKQVAFS  60

Query  438  GLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            G+L N P  NPDFY WN+++VRYCDGSSFTGD E V+P T LH+RGARV+ A
Sbjct  61   GILSNTPDHNPDFYNWNKVRVRYCDGSSFTGDKEEVDPTTKLHYRGARVWQA  112



>ref|XP_009589853.1| PREDICTED: uncharacterized protein LOC104087156 isoform X1 [Nicotiana 
tomentosiformis]
Length=381

 Score =   179 bits (455),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 102/143 (71%), Gaps = 6/143 (4%)
 Frame = +3

Query  183  FMILLRT------EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEG  344
            F++LL T      +   V+ T + +A+ KGAVCLDGS PAY  DRGSG G+NNWL+H EG
Sbjct  5    FIVLLLTVSQVSADFLIVNTTILHNAIGKGAVCLDGSAPAYLIDRGSGYGVNNWLVHIEG  64

Query  345  GAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSF  524
            G WC+ ++ C+ R  TR GSS  M  Q  F G+L N P  NPDF+ WNR+KV+YCDG+SF
Sbjct  65   GGWCSTISECIERTGTRYGSSIHMEDQYYFQGILSNKPNENPDFFNWNRVKVKYCDGASF  124

Query  525  TGDVEAVNPKTNLHFRGARVFVA  593
            TGDV+ V+P T LHFRGARVF+A
Sbjct  125  TGDVQEVDPVTGLHFRGARVFLA  147



>ref|XP_009763242.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana sylvestris]
Length=386

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 103/148 (70%), Gaps = 1/148 (1%)
 Frame = +3

Query  150  VQKWVVYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWL  329
            V   V + L         +  +V+ITY+++A+ KGAVCLDGS PA+HF  G+G GIN+WL
Sbjct  4    VMATVFFSLLCLWTTTEAKDLYVNITYLETAITKGAVCLDGSAPAFHFHPGTGSGINSWL  63

Query  330  IHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYC  509
            IH +GG WC   + CLAR  T L SS  M K   F+G+L + P+ NPDFY WNR+K+RYC
Sbjct  64   IHLQGGGWCETTSDCLARATTDL-SSKNMSKIAYFTGVLSSDPQFNPDFYNWNRVKIRYC  122

Query  510  DGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            DGSS+ GD+E V+P TNLHFRGAR+F A
Sbjct  123  DGSSYIGDIEEVDPDTNLHFRGARIFEA  150



>ref|XP_009589914.1| PREDICTED: uncharacterized protein LOC104087209 isoform X1 [Nicotiana 
tomentosiformis]
Length=400

 Score =   177 bits (450),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +3

Query  213  FVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDT  392
             VD+T ++SAV+KGAVCLDGSPPA+++D+G GEG NNW+I+F GG WC NV  CL R  T
Sbjct  41   MVDLTILESAVSKGAVCLDGSPPAFYYDKGHGEGANNWIIYFRGGEWCYNVIDCLNRTKT  100

Query  393  RLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFR  572
              GSS    KQ +F G+L N+   NPDFY WNR+ V YCDG+SFTGDVE V+P TNLHFR
Sbjct  101  EKGSSKLAPKQRSFYGILSNNKTLNPDFYNWNRVMVIYCDGASFTGDVEIVDPVTNLHFR  160

Query  573  GARVFVA  593
            GAR+F A
Sbjct  161  GARIFHA  167



>ref|XP_009589915.1| PREDICTED: uncharacterized protein LOC104087209 isoform X2 [Nicotiana 
tomentosiformis]
Length=399

 Score =   177 bits (450),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +3

Query  213  FVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDT  392
             VD+T ++SAV+KGAVCLDGSPPA+++D+G GEG NNW+I+F GG WC NV  CL R  T
Sbjct  40   MVDLTILESAVSKGAVCLDGSPPAFYYDKGHGEGANNWIIYFRGGEWCYNVIDCLNRTKT  99

Query  393  RLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFR  572
              GSS    KQ +F G+L N+   NPDFY WNR+ V YCDG+SFTGDVE V+P TNLHFR
Sbjct  100  EKGSSKLAPKQRSFYGILSNNKTLNPDFYNWNRVMVIYCDGASFTGDVEIVDPVTNLHFR  159

Query  573  GARVFVA  593
            GAR+F A
Sbjct  160  GARIFHA  166



>ref|XP_009771487.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=387

 Score =   177 bits (449),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 102/135 (76%), Gaps = 0/135 (0%)
 Frame = +3

Query  189  ILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVT  368
            IL   +  +++IT + SA+A+GAVCLDGSPPAYH DRG G G+ +W+I  +GGAWC +++
Sbjct  18   ILSADDNQYINITILNSAIAQGAVCLDGSPPAYHLDRGYGSGLRSWIIVMDGGAWCQSIS  77

Query  369  TCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVN  548
             CL+R  T LGSS +M     F+G+L N+P+ NPDFY WNR++V+YCDGSSFTGD+E V+
Sbjct  78   DCLSRSTTELGSSKQMKNGSRFAGILYNNPQNNPDFYNWNRVRVKYCDGSSFTGDIEQVD  137

Query  549  PKTNLHFRGARVFVA  593
            P   L FRGAR+F A
Sbjct  138  PDNKLFFRGARIFKA  152



>ref|XP_009771153.1| PREDICTED: uncharacterized protein LOC104221731 [Nicotiana sylvestris]
Length=532

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 98/143 (69%), Gaps = 3/143 (2%)
 Frame = +3

Query  165  VYGLAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEG  344
            +YG  F     +     V+ T + SA+ KGAVCLDGSPPAY  DRGSG G+NNWLIH EG
Sbjct  159  IYGTPFDYFSSQCTILIVNTTILHSAIEKGAVCLDGSPPAYLIDRGSGYGVNNWLIHIEG  218

Query  345  GAWCNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSF  524
            G WC+ ++ C+ R  TR GSS  M  Q  F G+L N P  NPDF  WNR+KV+YCDG+SF
Sbjct  219  GGWCSTISECIKRTGTRYGSSIHMEDQYYFQGILSNKPNENPDFLNWNRVKVKYCDGASF  278

Query  525  TGDVEAVNPKTNLHFRGARVFVA  593
            TGDVE V   T LHFRGARVF+A
Sbjct  279  TGDVEEV---TGLHFRGARVFLA  298



>ref|XP_006363883.1| PREDICTED: uncharacterized protein LOC102589191 [Solanum tuberosum]
Length=476

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +3

Query  195  LRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTC  374
            ++T+   V+IT ++SA A+GAVCLDGSPPAYH  RG G G++NW+I+ +GG WC ++  C
Sbjct  1    MKTDDLNVNITILESATAQGAVCLDGSPPAYHLHRGHGTGLDNWIIYLDGGGWCESIPEC  60

Query  375  LARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPK  554
            L R  T LGS+ KM +Q  FSG+L N  K+NP+F+ WNR++V+YCDGSSFTGDVE V+P+
Sbjct  61   LYRTTTYLGSTKKMGQQAFFSGILHNTSKQNPEFHNWNRVRVKYCDGSSFTGDVEQVHPE  120

Query  555  TNLHFRGARVFVA  593
              L+FRGAR+F A
Sbjct  121  NKLYFRGARIFKA  133



>gb|KJB25078.1| hypothetical protein B456_004G176200 [Gossypium raimondii]
Length=433

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 107/170 (63%), Gaps = 38/170 (22%)
 Frame = +3

Query  186  MILLRTEGFFVDITYVQSAVAKGA------------------------------------  257
            +ILL++EG  V ITY+Q AVAKGA                                    
Sbjct  19   VILLKSEGASVGITYLQDAVAKGAGRDLFFFLSMFYYMFMYIIYLRHSFFSFFWFGWWCV  78

Query  258  VCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFS  437
            VCLDGSPPAYHFD+GSG G++NW++H EGG WC +V TCL+RK+T LGSS +MVKQ  FS
Sbjct  79   VCLDGSPPAYHFDKGSGAGVDNWIVHMEGGGWCEDVPTCLSRKNTDLGSSKQMVKQFGFS  138

Query  438  GLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVF  587
            GLL    K NPDFY WNRIKVRYCDGSSFTGD  AV+   NL F+G  ++
Sbjct  139  GLLSGQQKSNPDFYNWNRIKVRYCDGSSFTGD--AVDRANNLFFKGNSIW  186



>ref|XP_009603755.1| PREDICTED: protein notum homolog isoform X2 [Nicotiana tomentosiformis]
Length=314

 Score =   173 bits (438),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 100/132 (76%), Gaps = 2/132 (2%)
 Frame = +3

Query  201  TEG-FFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            TEG   V+ITY+++A++KGAVCLDGS PA+HFD G+G GI +WLIH +GG WC  ++ C 
Sbjct  26   TEGDLIVNITYLETAISKGAVCLDGSAPAFHFDPGTGSGIYSWLIHLQGGGWCETISNCQ  85

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
             R  T L SS  M     F+G+L + P+ NPDFY WNR+KV+YCDGSS+TGD+E V+P T
Sbjct  86   YRALTDL-SSKNMQNISYFTGVLSSDPQLNPDFYNWNRVKVKYCDGSSYTGDIEEVDPDT  144

Query  558  NLHFRGARVFVA  593
            NLHFRGAR+F A
Sbjct  145  NLHFRGARIFEA  156



>ref|XP_004244682.2| PREDICTED: uncharacterized protein LOC101248898 [Solanum lycopersicum]
Length=390

 Score =   174 bits (442),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V++T ++SAV+KGAVCLDG+PPAY++++G GEG NNW+I+F GG WC NV  C+AR  T 
Sbjct  33   VNLTILESAVSKGAVCLDGTPPAYYYEKGYGEGANNWIIYFRGGEWCYNVIDCVARTTTE  92

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS   +KQ +F G+L N+   NPDFY WNR+ V YCDGSSFTGDVE V+P   LHFRG
Sbjct  93   KGSSKYALKQRSFYGILSNNKTINPDFYNWNRVMVIYCDGSSFTGDVELVDPINKLHFRG  152

Query  576  ARVFVA  593
            AR+F+A
Sbjct  153  ARIFLA  158



>ref|XP_009612887.1| PREDICTED: uncharacterized protein LOC104106115 [Nicotiana tomentosiformis]
Length=389

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 102/135 (76%), Gaps = 0/135 (0%)
 Frame = +3

Query  189  ILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVT  368
            IL   +  +++IT + SA+A+GAVCLDGSPPAYH D+G G G+++W+I  +GGAWC ++ 
Sbjct  19   ILGADDNQYINITILNSAIAEGAVCLDGSPPAYHLDKGYGSGLSSWIIVMDGGAWCQSIP  78

Query  369  TCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVN  548
             CL+R  T LGSS +M     F+G+L N+P+ NPDFY WNR++V+YCDGSSFTGD+E V+
Sbjct  79   DCLSRSTTELGSSKQMKNGSRFAGILYNNPQNNPDFYNWNRVRVKYCDGSSFTGDIEQVD  138

Query  549  PKTNLHFRGARVFVA  593
            P   L FRGAR+F A
Sbjct  139  PDNKLFFRGARIFKA  153



>ref|XP_009590665.1| PREDICTED: uncharacterized protein LOC104087809 isoform X3 [Nicotiana 
tomentosiformis]
Length=339

 Score =   173 bits (438),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 93/129 (72%), Gaps = 1/129 (1%)
 Frame = +3

Query  207  GFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARK  386
             +FVD T VQ+A++KGAVCLDGSPPAYH DRG G G+ NW+I   GGAWC N+T CL R 
Sbjct  39   AYFVDTTIVQNALSKGAVCLDGSPPAYHLDRGFGHGVRNWIILLSGGAWCRNITDCLNRS  98

Query  387  DTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLH  566
             T LGSS  M   + F G+       NPDFY WN++ VRYCDG  FTGD+E+++P TNLH
Sbjct  99   KTDLGSSKHMTPFI-FLGIFSKSKSENPDFYNWNKVFVRYCDGGGFTGDIESIDPATNLH  157

Query  567  FRGARVFVA  593
            FRGAR+F A
Sbjct  158  FRGARIFDA  166



>ref|XP_010325697.1| PREDICTED: uncharacterized protein LOC101260962 [Solanum lycopersicum]
Length=608

 Score =   178 bits (451),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +3

Query  213  FVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDT  392
            +++IT + SA A+GAVCLDGSPPAYH DRG G G+++W+I+ +GG WCNN++ CL R   
Sbjct  248  YINITVLHSATAQGAVCLDGSPPAYHLDRGHGTGLHSWVIYLDGGGWCNNISDCLNRSTK  307

Query  393  RLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFR  572
             LGSSTKM +Q  F G+L N  K NP+F+ WNR++V+YCDG+SFTGDVE +NP+  L+FR
Sbjct  308  FLGSSTKMKRQSFFGGILHNTSKENPEFHNWNRVRVKYCDGASFTGDVEQINPENKLYFR  367

Query  573  GARVFVA  593
            GAR+F A
Sbjct  368  GARIFKA  374



>ref|XP_010314003.1| PREDICTED: protein notum homolog isoform X1 [Solanum lycopersicum]
Length=404

 Score =   174 bits (442),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 94/130 (72%), Gaps = 1/130 (1%)
 Frame = +3

Query  204  EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  383
              +FVDIT VQ+AV+KGAVCLDGSPPAYH D G G G+ NW+I   GGAWC N T CL R
Sbjct  41   HAYFVDITIVQNAVSKGAVCLDGSPPAYHLDPGFGHGVRNWIILLSGGAWCRNTTDCLNR  100

Query  384  KDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNL  563
              T LGSST M+  + F G+       NPDFY WN++ VRYCDG +FTGD+E V+P TNL
Sbjct  101  SKTDLGSSTLMLPFI-FLGIFSKSKTENPDFYNWNKVFVRYCDGGAFTGDIENVDPATNL  159

Query  564  HFRGARVFVA  593
            HFRGAR+F A
Sbjct  160  HFRGARIFDA  169



>ref|XP_006365947.1| PREDICTED: uncharacterized protein LOC102601254 [Solanum tuberosum]
Length=401

 Score =   174 bits (442),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = +3

Query  204  EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  383
              +FVD T VQ++V+KGAVCLDGSPPAYH DRG G G+ NW+I   GGAWC N T CL R
Sbjct  38   HAYFVDKTIVQNSVSKGAVCLDGSPPAYHLDRGFGHGLRNWIILLSGGAWCRNTTDCLNR  97

Query  384  KDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNL  563
              T LGSST M+  + F G+     + NPDFY WN++ VRYCDG +FTGD+E V+P TNL
Sbjct  98   SKTDLGSSTLMLPFI-FLGIFSKSKRENPDFYNWNKVFVRYCDGGAFTGDIENVDPATNL  156

Query  564  HFRGARVFVA  593
            HFRGAR+F A
Sbjct  157  HFRGARIFDA  166



>ref|XP_006652763.1| PREDICTED: protein notum homolog [Oryza brachyantha]
Length=383

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 95/126 (75%), Gaps = 1/126 (1%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            VD+ +++SAV+KGAVCLDGSPP YHF  GSG G NNWL+H EGG WC N   C  RK   
Sbjct  18   VDMVFLKSAVSKGAVCLDGSPPVYHFSPGSGPGANNWLVHMEGGGWCRNSQECSVRKGNF  77

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS K ++ ++FSG+LG   K NPDFY WNR+K+RYCDGSSFTGDVE V   TNLH+RG
Sbjct  78   RGSS-KFMRPLSFSGILGGSQKYNPDFYNWNRVKIRYCDGSSFTGDVETVETSTNLHYRG  136

Query  576  ARVFVA  593
            ARV+ A
Sbjct  137  ARVWNA  142



>ref|XP_010314004.1| PREDICTED: protein notum homolog isoform X2 [Solanum lycopersicum]
Length=401

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 94/130 (72%), Gaps = 1/130 (1%)
 Frame = +3

Query  204  EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  383
              +FVDIT VQ+AV+KGAVCLDGSPPAYH D G G G+ NW+I   GGAWC N T CL R
Sbjct  38   HAYFVDITIVQNAVSKGAVCLDGSPPAYHLDPGFGHGVRNWIILLSGGAWCRNTTDCLNR  97

Query  384  KDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNL  563
              T LGSST M+  + F G+       NPDFY WN++ VRYCDG +FTGD+E V+P TNL
Sbjct  98   SKTDLGSSTLMLPFI-FLGIFSKSKTENPDFYNWNKVFVRYCDGGAFTGDIENVDPATNL  156

Query  564  HFRGARVFVA  593
            HFRGAR+F A
Sbjct  157  HFRGARIFDA  166



>ref|XP_006367726.1| PREDICTED: uncharacterized protein LOC102600035, partial [Solanum 
tuberosum]
Length=377

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = +3

Query  189  ILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVT  368
            +L   +  +++IT +QSA A+GAVCLDGSPPAYH DRG G G+++W+I+ +GG WC+++ 
Sbjct  18   VLGAEDDLYINITILQSATAQGAVCLDGSPPAYHLDRGHGSGVSSWIIYLDGGGWCDSIP  77

Query  369  TCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVN  548
             CL R    LGS+ +M +Q  F+ LL N  K+NP FY WNR++V+YCDGSSFTGDVE V+
Sbjct  78   DCLDRSTKALGSTKQMKQQGFFAALLHNSSKQNPQFYNWNRVRVKYCDGSSFTGDVEQVD  137

Query  549  PKTNLHFRGARVFVA  593
            P+  L FRGAR+F A
Sbjct  138  PENKLFFRGARIFKA  152



>ref|XP_009590664.1| PREDICTED: uncharacterized protein LOC104087809 isoform X2 [Nicotiana 
tomentosiformis]
Length=375

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 93/130 (72%), Gaps = 1/130 (1%)
 Frame = +3

Query  204  EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  383
              +FVD T VQ+A++KGAVCLDGSPPAYH DRG G G+ NW+I   GGAWC N+T CL R
Sbjct  38   HAYFVDTTIVQNALSKGAVCLDGSPPAYHLDRGFGHGVRNWIILLSGGAWCRNITDCLNR  97

Query  384  KDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNL  563
              T LGSS  M   + F G+       NPDFY WN++ VRYCDG  FTGD+E+++P TNL
Sbjct  98   SKTDLGSSKHMTPFI-FLGIFSKSKSENPDFYNWNKVFVRYCDGGGFTGDIESIDPATNL  156

Query  564  HFRGARVFVA  593
            HFRGAR+F A
Sbjct  157  HFRGARIFDA  166



>ref|XP_009590663.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana tomentosiformis]
Length=401

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 93/130 (72%), Gaps = 1/130 (1%)
 Frame = +3

Query  204  EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  383
              +FVD T VQ+A++KGAVCLDGSPPAYH DRG G G+ NW+I   GGAWC N+T CL R
Sbjct  38   HAYFVDTTIVQNALSKGAVCLDGSPPAYHLDRGFGHGVRNWIILLSGGAWCRNITDCLNR  97

Query  384  KDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNL  563
              T LGSS  M   + F G+       NPDFY WN++ VRYCDG  FTGD+E+++P TNL
Sbjct  98   SKTDLGSSKHMTPFI-FLGIFSKSKSENPDFYNWNKVFVRYCDGGGFTGDIESIDPATNL  156

Query  564  HFRGARVFVA  593
            HFRGAR+F A
Sbjct  157  HFRGARIFDA  166



>ref|XP_009603747.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana tomentosiformis]
Length=392

 Score =   172 bits (436),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 100/132 (76%), Gaps = 2/132 (2%)
 Frame = +3

Query  201  TEG-FFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            TEG   V+ITY+++A++KGAVCLDGS PA+HFD G+G GI +WLIH +GG WC  ++ C 
Sbjct  26   TEGDLIVNITYLETAISKGAVCLDGSAPAFHFDPGTGSGIYSWLIHLQGGGWCETISNCQ  85

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
             R  T L SS  M     F+G+L + P+ NPDFY WNR+KV+YCDGSS+TGD+E V+P T
Sbjct  86   YRALTDL-SSKNMQNISYFTGVLSSDPQLNPDFYNWNRVKVKYCDGSSYTGDIEEVDPDT  144

Query  558  NLHFRGARVFVA  593
            NLHFRGAR+F A
Sbjct  145  NLHFRGARIFEA  156



>emb|CAD41867.2| OSJNBa0041A02.14 [Oryza sativa Japonica Group]
 emb|CAH67867.1| B0403H10-OSIGBa0105A11.19 [Oryza sativa Indica Group]
Length=396

 Score =   172 bits (436),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 95/126 (75%), Gaps = 1/126 (1%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            VD+ +++SAV+ GAVCLDGSPP YHF  GSG G NNWL+H EGG WC N   C  R+   
Sbjct  31   VDMVFLKSAVSTGAVCLDGSPPVYHFSPGSGSGANNWLVHMEGGGWCRNAQECSVRQGNF  90

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS K ++ ++FSG++G + + NPDFY WNRIKVRYCDGSSFTGDVE V   TNLHFRG
Sbjct  91   RGSS-KFMRPLSFSGIIGGNQRNNPDFYNWNRIKVRYCDGSSFTGDVETVETSTNLHFRG  149

Query  576  ARVFVA  593
            ARV+ A
Sbjct  150  ARVWNA  155



>ref|XP_009407790.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=431

 Score =   172 bits (437),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 102/140 (73%), Gaps = 1/140 (1%)
 Frame = +3

Query  174  LAFFMILLRTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAW  353
            L + +  L+ EG  V +T ++ AVA+GAVCLDGS PAY+   GSG G NNWL+  EGG W
Sbjct  49   LLYLLAFLQVEGDNVPMTVLKGAVAEGAVCLDGSAPAYNLAPGSGSGANNWLVFVEGGGW  108

Query  354  CNNVTTCLARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGD  533
            C+ V  CLARK+T  GSS  M  Q +FSG+LG   + NPDFY WNR+K+RYCDG+SFTGD
Sbjct  109  CSTVEECLARKNTFRGSSDHMPPQ-SFSGMLGGVQQSNPDFYNWNRVKIRYCDGASFTGD  167

Query  534  VEAVNPKTNLHFRGARVFVA  593
            +E V+P T LHFRGARV+ A
Sbjct  168  IEKVDPATGLHFRGARVWRA  187



>ref|XP_004246219.1| PREDICTED: protein notum homolog [Solanum lycopersicum]
Length=390

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = +3

Query  198  RTEGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCL  377
            + +  +V+IT +QSA A+GAVCLDGSPPAYH  RG G G  +W+I+ EGG+WC ++  CL
Sbjct  24   KDDFLYVNITILQSATAQGAVCLDGSPPAYHLHRGYGTGFRSWIIYLEGGSWCESIPDCL  83

Query  378  ARKDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKT  557
             R  T LGSS  M +   F+G+L N  K+NPDF+ WNR+KV+YCDGSSFT DVE V+P+ 
Sbjct  84   DRSTTSLGSSNHMKQHDFFAGVLHNTSKQNPDFHNWNRVKVKYCDGSSFTSDVEQVHPEN  143

Query  558  NLHFRGARVFVA  593
             L+FRGAR+F A
Sbjct  144  KLYFRGARIFKA  155



>ref|NP_001053773.1| Os04g0602500 [Oryza sativa Japonica Group]
 dbj|BAF15687.1| Os04g0602500 [Oryza sativa Japonica Group]
 dbj|BAG93730.1| unnamed protein product [Oryza sativa Japonica Group]
Length=466

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 95/126 (75%), Gaps = 1/126 (1%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            VD+ +++SAV+ GAVCLDGSPP YHF  GSG G NNWL+H EGG WC N   C  R+   
Sbjct  101  VDMVFLKSAVSTGAVCLDGSPPVYHFSPGSGSGANNWLVHMEGGGWCRNAQECSVRQGNF  160

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS K ++ ++FSG++G + + NPDFY WNRIKVRYCDGSSFTGDVE V   TNLHFRG
Sbjct  161  RGSS-KFMRPLSFSGIIGGNQRNNPDFYNWNRIKVRYCDGSSFTGDVETVETSTNLHFRG  219

Query  576  ARVFVA  593
            ARV+ A
Sbjct  220  ARVWNA  225



>ref|XP_009621957.1| PREDICTED: uncharacterized protein LOC104113486 isoform X2 [Nicotiana 
tomentosiformis]
Length=249

 Score =   167 bits (422),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 97/130 (75%), Gaps = 0/130 (0%)
 Frame = +3

Query  204  EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  383
            +G  ++IT +++A A+GAVCLDGSPPAY+ D+G   G++NW+I  +GG WC+ +  C  R
Sbjct  19   DGLNINITILENATAQGAVCLDGSPPAYYLDKGFDSGLSNWIIMLDGGGWCSTIIQCQNR  78

Query  384  KDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNL  563
              + +GSSTKM  Q  F G+L N P++NPDFY WNR++V YCDGSSFTGDV+ V+P+  L
Sbjct  79   SSSIVGSSTKMKNQSMFGGILHNTPQQNPDFYNWNRVRVGYCDGSSFTGDVQEVDPENKL  138

Query  564  HFRGARVFVA  593
             +RGAR+F A
Sbjct  139  FYRGARIFKA  148



>ref|XP_009621956.1| PREDICTED: uncharacterized protein LOC104113486 isoform X1 [Nicotiana 
tomentosiformis]
Length=261

 Score =   166 bits (421),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 97/130 (75%), Gaps = 0/130 (0%)
 Frame = +3

Query  204  EGFFVDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLAR  383
            +G  ++IT +++A A+GAVCLDGSPPAY+ D+G   G++NW+I  +GG WC+ +  C  R
Sbjct  19   DGLNINITILENATAQGAVCLDGSPPAYYLDKGFDSGLSNWIIMLDGGGWCSTIIQCQNR  78

Query  384  KDTRLGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNL  563
              + +GSSTKM  Q  F G+L N P++NPDFY WNR++V YCDGSSFTGDV+ V+P+  L
Sbjct  79   SSSIVGSSTKMKNQSMFGGILHNTPQQNPDFYNWNRVRVGYCDGSSFTGDVQEVDPENKL  138

Query  564  HFRGARVFVA  593
             +RGAR+F A
Sbjct  139  FYRGARIFKA  148



>gb|KHG23649.1| Notum [Gossypium arboreum]
Length=381

 Score =   169 bits (429),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 90/111 (81%), Gaps = 5/111 (5%)
 Frame = +3

Query  261  CLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTRLGSSTKMVKQVAFSG  440
            CLDG+PPAYH+D+G G GIN+WLI  EGG WCNNV++CL RK+T LGSS +MVKQ+ FSG
Sbjct  29   CLDGTPPAYHWDKGYGTGINSWLIQLEGGGWCNNVSSCLVRKNTHLGSSKRMVKQIPFSG  88

Query  441  LLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRGARVFVA  593
            +L N       FY WNRIKVRYCDGSSFTGDV AVNP  NLHFRGARV++A
Sbjct  89   ILNNK-----HFYNWNRIKVRYCDGSSFTGDVAAVNPVANLHFRGARVWLA  134



>emb|CAA18628.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 emb|CAB78943.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
Length=362

 Score =   169 bits (428),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V ITY+QSAVAKGAVCLDGS PAYHFD+G G G+NNW++H EGG WC +V +C  RK T 
Sbjct  24   VPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCNERKGTM  83

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNP  551
             GSS  M K   FSG+LG     NPDFY WNRIKVRYCDGSSFTG+VEAVNP
Sbjct  84   KGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGNVEAVNP  135



>gb|EEC77932.1| hypothetical protein OsI_17271 [Oryza sativa Indica Group]
Length=530

 Score =   172 bits (436),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 95/126 (75%), Gaps = 1/126 (1%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            VD+ +++SAV+ GAVCLDGSPP YHF  GSG G NNWL+H EGG WC N   C  R+   
Sbjct  165  VDMVFLKSAVSTGAVCLDGSPPVYHFSPGSGSGANNWLVHMEGGGWCRNAQECSVRQGNF  224

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS K ++ ++FSG++G + + NPDFY WNRIKVRYCDGSSFTGDVE V   TNLHFRG
Sbjct  225  RGSS-KFMRPLSFSGIIGGNQRNNPDFYNWNRIKVRYCDGSSFTGDVETVETSTNLHFRG  283

Query  576  ARVFVA  593
            ARV+ A
Sbjct  284  ARVWNA  289



>ref|XP_003580427.1| PREDICTED: uncharacterized protein LOC100827238 isoform X2 [Brachypodium 
distachyon]
Length=391

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 94/126 (75%), Gaps = 1/126 (1%)
 Frame = +3

Query  216  VDITYVQSAVAKGAVCLDGSPPAYHFDRGSGEGINNWLIHFEGGAWCNNVTTCLARKDTR  395
            V++ +++SAVAKGAVCLDGSPP YHF  GSG G NNW++H EGG WC     C  RK   
Sbjct  27   VEMVFLKSAVAKGAVCLDGSPPVYHFSPGSGSGANNWVVHMEGGGWCKTSEECSIRKGNF  86

Query  396  LGSSTKMVKQVAFSGLLGNHPKRNPDFYTWNRIKVRYCDGSSFTGDVEAVNPKTNLHFRG  575
             GSS K +K ++FSG+LG   K NPDFY WNR+KVRYCDGSSFTGDVEAV   TNLH+RG
Sbjct  87   RGSS-KYMKPLSFSGILGGSDKFNPDFYNWNRVKVRYCDGSSFTGDVEAVETSTNLHYRG  145

Query  576  ARVFVA  593
             RV+ A
Sbjct  146  NRVWQA  151



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160