BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF010D23

Length=417
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006476478.1|  PREDICTED: reticulon-like protein B2-like          102   1e-23   Citrus sinensis [apfelsine]
ref|XP_006439447.1|  hypothetical protein CICLE_v10021801mg             102   2e-23   Citrus clementina [clementine]
ref|XP_010925814.1|  PREDICTED: reticulon-like protein B2               101   3e-23   Elaeis guineensis
ref|XP_002511930.1|  conserved hypothetical protein                     101   3e-23   Ricinus communis
gb|KJB24636.1|  hypothetical protein B456_004G154600                  98.2    5e-23   Gossypium raimondii
ref|XP_010112604.1|  Reticulon-like protein                             100   7e-23   Morus notabilis
ref|XP_010915765.1|  PREDICTED: reticulon-like protein B2               100   1e-22   Elaeis guineensis
gb|KJB24635.1|  hypothetical protein B456_004G154600                  98.6    1e-22   Gossypium raimondii
ref|XP_002299504.1|  reticulon family protein                         99.0    3e-22   Populus trichocarpa [western balsam poplar]
ref|XP_010105716.1|  Reticulon-like protein                           99.0    3e-22   
gb|KJB24634.1|  hypothetical protein B456_004G154600                  98.6    4e-22   Gossypium raimondii
gb|KJB06452.1|  hypothetical protein B456_001G157900                  96.3    9e-22   Gossypium raimondii
ref|XP_006397801.1|  hypothetical protein EUTSA_v10001599mg           97.8    9e-22   Eutrema salsugineum [saltwater cress]
ref|XP_007051689.1|  Reticulon family protein                         97.8    1e-21   
ref|XP_011022600.1|  PREDICTED: reticulon-like protein B1             97.4    1e-21   Populus euphratica
ref|XP_002880222.1|  reticulon family protein                         97.4    1e-21   Arabidopsis lyrata subsp. lyrata
ref|XP_010462752.1|  PREDICTED: reticulon-like protein B5 isoform X2  94.4    2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_006358652.1|  PREDICTED: reticulon-like protein B1-like        97.1    2e-21   Solanum tuberosum [potatoes]
ref|XP_006391670.1|  hypothetical protein EUTSA_v10023649mg           97.1    2e-21   Eutrema salsugineum [saltwater cress]
ref|NP_001056102.1|  Os05g0526400                                     96.7    2e-21   
gb|KJB06451.1|  hypothetical protein B456_001G157900                  96.7    2e-21   Gossypium raimondii
gb|KJB06453.1|  hypothetical protein B456_001G157900                  97.1    2e-21   Gossypium raimondii
gb|EAY98759.1|  hypothetical protein OsI_20691                        96.3    3e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_004961431.1|  PREDICTED: reticulon-like protein B1-like        96.3    3e-21   Setaria italica
ref|XP_010518282.1|  PREDICTED: reticulon-like protein B5             96.3    3e-21   Camelina sativa [gold-of-pleasure]
ref|XP_006302727.1|  hypothetical protein CARUB_v10020840mg           96.3    3e-21   Capsella rubella
ref|XP_010418453.1|  PREDICTED: reticulon-like protein B3             96.3    3e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010430525.1|  PREDICTED: reticulon-like protein B3             96.3    3e-21   Camelina sativa [gold-of-pleasure]
gb|ABC69764.1|  unknown                                               95.5    3e-21   Vitis pseudoreticulata
ref|NP_001118533.1|  reticulon-like protein B5                        94.7    4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010462746.1|  PREDICTED: reticulon-like protein B5 isoform X1  94.4    4e-21   
ref|XP_003633964.1|  PREDICTED: reticulon-like protein B1             95.5    6e-21   Vitis vinifera
ref|XP_010506615.1|  PREDICTED: reticulon-like protein B5             95.5    6e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010529625.1|  PREDICTED: reticulon-like protein B1             95.5    7e-21   Tarenaya hassleriana [spider flower]
gb|KJB24286.1|  hypothetical protein B456_004G137000                  93.2    7e-21   Gossypium raimondii
gb|KHG04885.1|  Reticulon-like protein B5                             95.1    7e-21   Gossypium arboreum [tree cotton]
gb|KDO56851.1|  hypothetical protein CISIN_1g023137mg                 95.1    8e-21   Citrus sinensis [apfelsine]
gb|KDO56850.1|  hypothetical protein CISIN_1g023137mg                 95.5    8e-21   Citrus sinensis [apfelsine]
ref|XP_010508058.1|  PREDICTED: reticulon-like protein B5             95.1    8e-21   Camelina sativa [gold-of-pleasure]
ref|XP_009388111.1|  PREDICTED: reticulon-like protein B1             95.1    9e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006294850.1|  hypothetical protein CARUB_v10023902mg           95.1    9e-21   Capsella rubella
ref|XP_008805646.1|  PREDICTED: reticulon-like protein B3             94.7    1e-20   Phoenix dactylifera
ref|XP_006422079.1|  hypothetical protein CICLE_v10005564mg           94.7    1e-20   Citrus clementina [clementine]
ref|XP_002441411.1|  hypothetical protein SORBIDRAFT_09g026210        94.7    1e-20   Sorghum bicolor [broomcorn]
gb|KDP25363.1|  hypothetical protein JCGZ_20519                       94.7    1e-20   Jatropha curcas
ref|XP_006422078.1|  hypothetical protein CICLE_v10005564mg           95.1    1e-20   
ref|XP_011026963.1|  PREDICTED: reticulon-like protein B2             94.7    1e-20   Populus euphratica
ref|XP_010541290.1|  PREDICTED: reticulon-like protein B1             94.7    1e-20   Tarenaya hassleriana [spider flower]
ref|NP_566065.1|  reticulon-like protein B5                           94.7    1e-20   Arabidopsis thaliana [mouse-ear cress]
emb|CDY42012.1|  BnaC04g00900D                                        94.4    1e-20   Brassica napus [oilseed rape]
ref|XP_009142682.1|  PREDICTED: reticulon-like protein B5             94.4    1e-20   Brassica rapa
emb|CDY25557.1|  BnaC09g11820D                                        94.4    1e-20   Brassica napus [oilseed rape]
emb|CDY08353.1|  BnaC09g12430D                                        94.4    2e-20   Brassica napus [oilseed rape]
ref|XP_009763461.1|  PREDICTED: reticulon-like protein B6 isoform X1  94.4    2e-20   Nicotiana sylvestris
ref|XP_010658515.1|  PREDICTED: reticulon-like protein B2             94.0    2e-20   Vitis vinifera
gb|KJB24287.1|  hypothetical protein B456_004G137000                  93.2    2e-20   Gossypium raimondii
ref|XP_010261408.1|  PREDICTED: reticulon-like protein B2             94.0    2e-20   Nelumbo nucifera [Indian lotus]
ref|XP_009763462.1|  PREDICTED: reticulon-like protein B1 isoform X2  94.0    2e-20   Nicotiana sylvestris
emb|CDY34396.1|  BnaA09g11380D                                        93.6    3e-20   Brassica napus [oilseed rape]
gb|KFK40472.1|  hypothetical protein AALP_AA2G000200                  93.6    3e-20   Arabis alpina [alpine rockcress]
ref|XP_009112901.1|  PREDICTED: reticulon-like protein B3             93.6    3e-20   Brassica rapa
ref|XP_006654676.1|  PREDICTED: reticulon-like protein B1-like        93.6    3e-20   Oryza brachyantha
ref|NP_176592.1|  reticulon-like protein B3                           93.6    3e-20   Arabidopsis thaliana [mouse-ear cress]
gb|KHG29253.1|  Reticulon-like protein B5                             93.2    4e-20   Gossypium arboreum [tree cotton]
ref|XP_006374287.1|  hypothetical protein POPTR_0015s05710g           92.0    5e-20   
gb|KJB19086.1|  hypothetical protein B456_003G084400                  92.4    5e-20   Gossypium raimondii
gb|KJB24285.1|  hypothetical protein B456_004G137000                  92.8    5e-20   Gossypium raimondii
gb|KJB19088.1|  hypothetical protein B456_003G084400                  92.8    6e-20   Gossypium raimondii
ref|XP_006374288.1|  hypothetical protein POPTR_0015s05710g           92.0    6e-20   
gb|KJB19089.1|  hypothetical protein B456_003G084400                  92.0    6e-20   Gossypium raimondii
ref|XP_011037168.1|  PREDICTED: reticulon-like protein B5             92.8    6e-20   Populus euphratica
ref|NP_198975.1|  reticulon-like protein B4                           92.8    6e-20   Arabidopsis thaliana [mouse-ear cress]
gb|KJB19091.1|  hypothetical protein B456_003G084400                  92.4    7e-20   Gossypium raimondii
ref|XP_006374290.1|  hypothetical protein POPTR_0015s05710g           92.4    7e-20   
ref|XP_010473658.1|  PREDICTED: reticulon-like protein B3 isoform X3  92.4    8e-20   Camelina sativa [gold-of-pleasure]
ref|XP_004248066.1|  PREDICTED: reticulon-like protein B1             92.4    8e-20   Solanum lycopersicum
dbj|BAJ98297.1|  predicted protein                                    92.4    8e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFK39432.1|  unknown                                               90.1    9e-20   Lotus japonicus
gb|KDO86332.1|  hypothetical protein CISIN_1g025719mg                 91.7    1e-19   Citrus sinensis [apfelsine]
ref|XP_006374289.1|  hypothetical protein POPTR_0015s05710g           92.0    1e-19   
ref|XP_010545343.1|  PREDICTED: reticulon-like protein B3             92.0    1e-19   Tarenaya hassleriana [spider flower]
ref|XP_010538815.1|  PREDICTED: reticulon-like protein B1             92.0    1e-19   Tarenaya hassleriana [spider flower]
gb|KJB19087.1|  hypothetical protein B456_003G084400                  91.7    1e-19   Gossypium raimondii
ref|XP_009603968.1|  PREDICTED: reticulon-like protein B1             92.0    1e-19   Nicotiana tomentosiformis
gb|KJB37517.1|  hypothetical protein B456_006G208500                  90.9    1e-19   Gossypium raimondii
ref|XP_010533622.1|  PREDICTED: reticulon-like protein B4             91.7    2e-19   Tarenaya hassleriana [spider flower]
ref|XP_011080892.1|  PREDICTED: reticulon-like protein B2             91.7    2e-19   Sesamum indicum [beniseed]
ref|XP_007218267.1|  hypothetical protein PRUPE_ppa008259mg           91.7    2e-19   
gb|KDO86331.1|  hypothetical protein CISIN_1g025719mg                 91.3    2e-19   Citrus sinensis [apfelsine]
ref|XP_006444935.1|  hypothetical protein CICLE_v10021860mg           91.3    2e-19   Citrus clementina [clementine]
ref|XP_002870630.1|  VIRB2-interacting protein 3                      91.3    2e-19   
ref|XP_007040378.1|  Reticulan like protein B3, putative isoform 3    91.7    2e-19   
ref|XP_007040377.1|  Reticulan like protein B3, putative isoform 2    91.7    2e-19   
ref|XP_011003673.1|  PREDICTED: reticulon-like protein B1             91.3    2e-19   Populus euphratica
ref|XP_009345612.1|  PREDICTED: reticulon-like protein B1             91.3    2e-19   Pyrus x bretschneideri [bai li]
ref|XP_002303615.1|  reticulon family protein                         90.9    2e-19   Populus trichocarpa [western balsam poplar]
gb|KHG20258.1|  Reticulon-like protein B3                             90.9    2e-19   Gossypium arboreum [tree cotton]
ref|NP_001130478.1|  Seed maturation protein                          90.9    3e-19   Zea mays [maize]
gb|AEZ00899.1|  putative 24 kDa seed maturation protein               90.9    3e-19   Elaeis guineensis
ref|NP_191715.2|  reticulon-like protein B6                           90.9    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007040376.1|  Reticulan like protein B3, putative isoform 1    90.9    3e-19   
ref|NP_001030913.1|  reticulon-like protein B6                        90.9    3e-19   
emb|CDP12094.1|  unnamed protein product                              90.9    3e-19   Coffea canephora [robusta coffee]
ref|XP_010916969.1|  PREDICTED: reticulon-like protein B3             91.3    3e-19   Elaeis guineensis
gb|KDP28552.1|  hypothetical protein JCGZ_14323                       90.9    3e-19   Jatropha curcas
ref|XP_002317731.1|  hypothetical protein POPTR_0012s00980g           90.5    3e-19   
ref|XP_007218268.1|  hypothetical protein PRUPE_ppa008259mg           91.3    3e-19   
ref|XP_009341126.1|  PREDICTED: reticulon-like protein B1             90.9    3e-19   Pyrus x bretschneideri [bai li]
ref|XP_002320163.1|  reticulon family protein                         90.5    3e-19   Populus trichocarpa [western balsam poplar]
gb|KHN40449.1|  Reticulon-like protein B5                             90.5    4e-19   Glycine soja [wild soybean]
ref|XP_009793558.1|  PREDICTED: reticulon-like protein B4             90.9    4e-19   Nicotiana sylvestris
ref|XP_010436110.1|  PREDICTED: reticulon-like protein B4             90.5    4e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010447719.1|  PREDICTED: reticulon-like protein B4             90.5    4e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010441324.1|  PREDICTED: reticulon-like protein B4             90.5    4e-19   Camelina sativa [gold-of-pleasure]
ref|XP_008232963.1|  PREDICTED: reticulon-like protein B6             90.5    5e-19   Prunus mume [ume]
ref|XP_011047748.1|  PREDICTED: reticulon-like protein B1             90.1    5e-19   Populus euphratica
gb|KHG15548.1|  Reticulon-like protein B3                             90.1    5e-19   Gossypium arboreum [tree cotton]
ref|XP_010251601.1|  PREDICTED: reticulon-like protein B2             90.1    5e-19   Nelumbo nucifera [Indian lotus]
ref|XP_004245560.1|  PREDICTED: reticulon-like protein B4             90.1    6e-19   Solanum lycopersicum
gb|EAY75742.1|  hypothetical protein OsI_03655                        90.1    6e-19   Oryza sativa Indica Group [Indian rice]
gb|ABK94480.1|  unknown                                               90.1    6e-19   Populus trichocarpa [western balsam poplar]
ref|NP_001240231.1|  uncharacterized protein LOC100778096             90.1    6e-19   Glycine max [soybeans]
emb|CDY52012.1|  BnaC06g42920D                                        90.1    6e-19   Brassica napus [oilseed rape]
ref|XP_009104316.1|  PREDICTED: reticulon-like protein B6             89.7    6e-19   Brassica rapa
ref|XP_002887921.1|  reticulon family protein                         89.7    8e-19   Arabidopsis lyrata subsp. lyrata
gb|KCW46474.1|  hypothetical protein EUGRSUZ_K00300                   89.0    9e-19   Eucalyptus grandis [rose gum]
ref|XP_011093062.1|  PREDICTED: reticulon-like protein B1             89.4    1e-18   Sesamum indicum [beniseed]
ref|XP_006343915.1|  PREDICTED: reticulon-like protein B1-like        89.4    1e-18   Solanum tuberosum [potatoes]
ref|XP_007139766.1|  hypothetical protein PHAVU_008G057300g           88.2    1e-18   Phaseolus vulgaris [French bean]
ref|XP_009416410.1|  PREDICTED: reticulon-like protein B2             89.0    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU23406.1|  hypothetical protein MIMGU_mgv1a012325mg              89.0    1e-18   Erythranthe guttata [common monkey flower]
emb|CDP08746.1|  unnamed protein product                              89.0    1e-18   Coffea canephora [robusta coffee]
ref|XP_006339640.1|  PREDICTED: reticulon-like protein B1-like        89.0    1e-18   Solanum tuberosum [potatoes]
ref|XP_009137373.1|  PREDICTED: reticulon-like protein B1             89.0    1e-18   Brassica rapa
dbj|BAJ89699.1|  predicted protein                                    89.0    2e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010035177.1|  PREDICTED: reticulon-like protein B1             88.6    2e-18   Eucalyptus grandis [rose gum]
ref|XP_007139767.1|  hypothetical protein PHAVU_008G057300g           88.6    2e-18   Phaseolus vulgaris [French bean]
ref|XP_009626481.1|  PREDICTED: reticulon-like protein B5 isoform X2  87.8    2e-18   
ref|XP_003568063.1|  PREDICTED: reticulon-like protein B1             88.6    2e-18   Brachypodium distachyon [annual false brome]
ref|XP_006847055.1|  hypothetical protein AMTR_s00017p00194840        88.6    2e-18   
ref|XP_002509881.1|  conserved hypothetical protein                   88.2    2e-18   Ricinus communis
ref|XP_009395750.1|  PREDICTED: reticulon-like protein B2             88.2    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006842617.1|  hypothetical protein AMTR_s00077p00178230        88.2    3e-18   Amborella trichopoda
gb|KFK33000.1|  hypothetical protein AALP_AA6G316900                  88.2    3e-18   Arabis alpina [alpine rockcress]
ref|XP_009349323.1|  PREDICTED: reticulon-like protein B1             88.2    3e-18   Pyrus x bretschneideri [bai li]
ref|XP_006402470.1|  hypothetical protein EUTSA_v10006190mg           88.2    3e-18   Eutrema salsugineum [saltwater cress]
ref|XP_009338786.1|  PREDICTED: reticulon-like protein B1             88.2    3e-18   Pyrus x bretschneideri [bai li]
ref|XP_004229935.1|  PREDICTED: reticulon-like protein B1             88.2    3e-18   
ref|XP_010509305.1|  PREDICTED: reticulon-like protein B1             88.2    3e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009112802.1|  PREDICTED: reticulon-like protein B3             87.8    3e-18   Brassica rapa
ref|XP_006284372.1|  hypothetical protein CARUB_v10005543mg           87.8    3e-18   Capsella rubella
ref|XP_010439153.1|  PREDICTED: reticulon-like protein B1 isoform X2  87.0    3e-18   Camelina sativa [gold-of-pleasure]
gb|AFW78798.1|  hypothetical protein ZEAMMB73_677867                  85.5    3e-18   
emb|CDY38194.1|  BnaA09g11950D                                        87.8    3e-18   Brassica napus [oilseed rape]
ref|XP_010433883.1|  PREDICTED: reticulon-like protein B1             87.8    4e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010439152.1|  PREDICTED: reticulon-like protein B1 isoform X1  87.8    4e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009765582.1|  PREDICTED: reticulon-like protein B2             87.4    5e-18   Nicotiana sylvestris
ref|XP_003528823.2|  PREDICTED: reticulon-like protein B1-like        87.8    5e-18   Glycine max [soybeans]
ref|XP_003565836.1|  PREDICTED: reticulon-like protein B1             87.4    6e-18   Brachypodium distachyon [annual false brome]
gb|EMS62606.1|  Reticulon-like protein B1                             87.0    6e-18   Triticum urartu
gb|AFW80460.1|  hypothetical protein ZEAMMB73_353444                  85.5    6e-18   
ref|XP_010924771.1|  PREDICTED: reticulon-like protein B2             87.0    6e-18   Elaeis guineensis
ref|XP_008810936.1|  PREDICTED: reticulon-like protein B5             87.0    6e-18   Phoenix dactylifera
ref|NP_001239653.1|  uncharacterized protein LOC100793862             87.0    7e-18   Glycine max [soybeans]
ref|XP_009766982.1|  PREDICTED: reticulon-like protein B5             87.0    8e-18   Nicotiana sylvestris
ref|XP_006645662.1|  PREDICTED: reticulon-like protein B1-like        86.7    8e-18   Oryza brachyantha
emb|CDY57657.1|  BnaC01g15350D                                        87.0    8e-18   Brassica napus [oilseed rape]
ref|XP_002301382.1|  hypothetical protein POPTR_0002s16690g           86.7    9e-18   Populus trichocarpa [western balsam poplar]
ref|XP_006284300.1|  hypothetical protein CARUB_v10005469mg           87.0    9e-18   
ref|XP_006396933.1|  hypothetical protein EUTSA_v10028886mg           86.7    9e-18   Eutrema salsugineum [saltwater cress]
ref|XP_009626480.1|  PREDICTED: reticulon-like protein B2 isoform X1  86.7    9e-18   Nicotiana tomentosiformis
ref|XP_004234204.1|  PREDICTED: reticulon-like protein B2             86.7    9e-18   Solanum lycopersicum
ref|XP_010676393.1|  PREDICTED: reticulon-like protein B2             86.7    1e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008437352.1|  PREDICTED: reticulon-like protein B2             86.7    1e-17   Cucumis melo [Oriental melon]
tpg|DAA52789.1|  TPA: seed maturation protein                         86.7    1e-17   
ref|XP_004143883.1|  PREDICTED: reticulon-like protein B2-like        86.3    1e-17   Cucumis sativus [cucumbers]
ref|XP_007038874.1|  VIRB2-interacting protein 2                      86.3    1e-17   Theobroma cacao [chocolate]
gb|EMS62854.1|  Reticulon-like protein B1                             86.3    1e-17   Triticum urartu
ref|XP_011084470.1|  PREDICTED: reticulon-like protein B2             86.3    1e-17   Sesamum indicum [beniseed]
gb|EMT19773.1|  Reticulon-like protein B1                             86.3    1e-17   
gb|EAY73097.1|  hypothetical protein OsI_00974                        86.3    2e-17   Oryza sativa Indica Group [Indian rice]
dbj|BAB32723.1|  unknown protein                                      86.3    2e-17   Oryza sativa Japonica Group [Japonica rice]
gb|KFK37395.1|  hypothetical protein AALP_AA4G251600                  85.9    2e-17   Arabis alpina [alpine rockcress]
ref|NP_001150474.1|  seed maturation protein                          86.3    2e-17   
ref|XP_009597328.1|  PREDICTED: reticulon-like protein B5             85.9    2e-17   Nicotiana tomentosiformis
gb|EYU19605.1|  hypothetical protein MIMGU_mgv1a012182mg              85.9    2e-17   Erythranthe guttata [common monkey flower]
gb|ACG32549.1|  seed maturation protein                               85.9    2e-17   Zea mays [maize]
ref|NP_001130268.1|  uncharacterized protein LOC100191362             85.9    2e-17   Zea mays [maize]
emb|CDY44123.1|  BnaA01g13310D                                        85.9    2e-17   Brassica napus [oilseed rape]
ref|XP_006413534.1|  hypothetical protein EUTSA_v10025959mg           85.5    2e-17   
ref|XP_008655792.1|  PREDICTED: reticulon-like protein B1             85.9    2e-17   
emb|CDJ26559.1|  unnamed protein product                              85.9    2e-17   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008792381.1|  PREDICTED: reticulon-like protein B2 isoform X2  85.5    2e-17   
ref|NP_001149653.1|  LOC100283279                                     85.5    3e-17   Zea mays [maize]
ref|NP_001241367.1|  uncharacterized protein LOC100796111             85.5    3e-17   Glycine max [soybeans]
emb|CDY05135.1|  BnaC03g29330D                                        85.5    3e-17   
ref|XP_004967455.1|  PREDICTED: reticulon-like protein B1-like        85.5    3e-17   Setaria italica
ref|XP_008796064.1|  PREDICTED: reticulon-like protein B2             85.1    3e-17   Phoenix dactylifera
ref|XP_008792378.1|  PREDICTED: reticulon-like protein B3 isoform X1  85.5    3e-17   
ref|XP_006413535.1|  hypothetical protein EUTSA_v10025959mg           85.5    3e-17   Eutrema salsugineum [saltwater cress]
ref|XP_009137263.1|  PREDICTED: reticulon-like protein B1             85.5    3e-17   Brassica rapa
gb|KHN15986.1|  Reticulon-like protein B5                             85.1    3e-17   Glycine soja [wild soybean]
emb|CDM81762.1|  unnamed protein product                              85.1    3e-17   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010422067.1|  PREDICTED: reticulon-like protein B2             85.1    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006644671.1|  PREDICTED: reticulon-like protein B1-like        85.1    4e-17   Oryza brachyantha
ref|NP_001239711.1|  uncharacterized protein LOC100811024             84.7    4e-17   Glycine max [soybeans]
ref|XP_011023265.1|  PREDICTED: reticulon-like protein B5             84.7    4e-17   Populus euphratica
emb|CDY10954.1|  BnaA03g46130D                                        85.1    4e-17   Brassica napus [oilseed rape]
ref|XP_010669728.1|  PREDICTED: reticulon-like protein B4             85.1    4e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_194094.1|  VIRB2-interacting protein 1                         84.7    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008437980.1|  PREDICTED: reticulon-like protein B5             84.7    5e-17   Cucumis melo [Oriental melon]
ref|XP_010523772.1|  PREDICTED: reticulon-like protein B5             84.7    5e-17   Tarenaya hassleriana [spider flower]
ref|NP_001044177.1|  Os01g0736900                                     84.7    5e-17   
gb|EPS71452.1|  hypothetical protein M569_03311                       84.3    5e-17   Genlisea aurea
ref|XP_002876621.1|  reticulon family protein                         84.3    5e-17   
ref|XP_006485002.1|  PREDICTED: reticulon-like protein B8-like is...  84.3    6e-17   Citrus sinensis [apfelsine]
ref|XP_006437080.1|  hypothetical protein CICLE_v10032550mg           84.3    6e-17   Citrus clementina [clementine]
ref|XP_003525365.1|  PREDICTED: reticulon-like protein B2-like is...  84.3    6e-17   Glycine max [soybeans]
ref|XP_004133840.1|  PREDICTED: reticulon-like protein B5-like        84.0    7e-17   Cucumis sativus [cucumbers]
gb|KDO44767.1|  hypothetical protein CISIN_1g025770mg                 84.0    8e-17   Citrus sinensis [apfelsine]
ref|XP_002302126.2|  reticulon family protein                         84.0    8e-17   Populus trichocarpa [western balsam poplar]
ref|XP_009415169.1|  PREDICTED: reticulon-like protein B2             84.0    8e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002275520.1|  PREDICTED: reticulon-like protein B5             84.0    8e-17   Vitis vinifera
gb|ACF87936.1|  unknown                                               83.6    8e-17   Zea mays [maize]
ref|XP_004306726.1|  PREDICTED: reticulon-like protein B5             84.0    9e-17   Fragaria vesca subsp. vesca
ref|XP_008344578.1|  PREDICTED: reticulon-like protein B1             84.0    9e-17   
ref|XP_010247587.1|  PREDICTED: reticulon-like protein B8             84.0    9e-17   Nelumbo nucifera [Indian lotus]
ref|XP_007160119.1|  hypothetical protein PHAVU_002G294100g           84.0    1e-16   Phaseolus vulgaris [French bean]
dbj|BAJ33905.1|  unnamed protein product                              84.0    1e-16   Eutrema halophilum
ref|XP_010688858.1|  PREDICTED: reticulon-like protein B8             83.6    1e-16   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW72351.1|  hypothetical protein EUGRSUZ_E00805                   83.6    1e-16   Eucalyptus grandis [rose gum]
ref|XP_010544774.1|  PREDICTED: reticulon-like protein B6             83.6    1e-16   Tarenaya hassleriana [spider flower]
ref|XP_006366629.1|  PREDICTED: reticulon-like protein B8-like is...  83.6    1e-16   Solanum tuberosum [potatoes]
ref|XP_002874678.1|  VIRB2-interacting protein 2                      84.0    1e-16   Arabidopsis lyrata subsp. lyrata
gb|EMT06999.1|  Reticulon-like protein B1                             83.6    1e-16   
ref|XP_006366628.1|  PREDICTED: reticulon-like protein B8-like is...  83.6    1e-16   Solanum tuberosum [potatoes]
emb|CAN77759.1|  hypothetical protein VITISV_034907                   83.6    1e-16   Vitis vinifera
gb|KCW72350.1|  hypothetical protein EUGRSUZ_E00805                   83.2    1e-16   Eucalyptus grandis [rose gum]
gb|EMS49910.1|  Reticulon-like protein B3                             84.0    1e-16   Triticum urartu
ref|XP_004298843.1|  PREDICTED: reticulon-like protein B2             83.2    1e-16   Fragaria vesca subsp. vesca
gb|KHG24129.1|  Reticulon-like protein B3                             83.2    1e-16   Gossypium arboreum [tree cotton]
ref|NP_001185307.1|  reticulon-like protein B3                        83.6    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288443.1|  hypothetical protein CARUB_v10001704mg           83.6    1e-16   Capsella rubella
ref|XP_010055800.1|  PREDICTED: reticulon-like protein B1             83.2    1e-16   Eucalyptus grandis [rose gum]
gb|KJB52211.1|  hypothetical protein B456_008G250900                  82.4    1e-16   Gossypium raimondii
ref|XP_002869770.1|  VIRB2-interacting protein 1                      83.2    2e-16   Arabidopsis lyrata subsp. lyrata
gb|KCW72347.1|  hypothetical protein EUGRSUZ_E00805                   83.2    2e-16   Eucalyptus grandis [rose gum]
gb|KCW72348.1|  hypothetical protein EUGRSUZ_E00805                   83.2    2e-16   Eucalyptus grandis [rose gum]
ref|XP_007135152.1|  hypothetical protein PHAVU_010G105400g           83.2    2e-16   Phaseolus vulgaris [French bean]
ref|XP_011026205.1|  PREDICTED: reticulon-like protein B8             83.2    2e-16   Populus euphratica
ref|XP_009777726.1|  PREDICTED: reticulon-like protein B8             83.2    2e-16   Nicotiana sylvestris
ref|XP_004243617.1|  PREDICTED: reticulon-like protein B8             83.2    2e-16   Solanum lycopersicum
ref|XP_002521590.1|  conserved hypothetical protein                   82.8    2e-16   Ricinus communis
ref|XP_009406784.1|  PREDICTED: reticulon-like protein B1 isoform X1  82.8    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406786.1|  PREDICTED: reticulon-like protein B1 isoform X2  82.8    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004510697.1|  PREDICTED: reticulon-like protein B1-like        82.8    2e-16   Cicer arietinum [garbanzo]
gb|KDP22201.1|  hypothetical protein JCGZ_26032                       82.8    2e-16   Jatropha curcas
ref|XP_010512508.1|  PREDICTED: reticulon-like protein B6             82.8    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010469092.1|  PREDICTED: reticulon-like protein B6             82.8    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_008375931.1|  PREDICTED: reticulon-like protein B1             82.8    2e-16   Malus domestica [apple tree]
gb|ABC01908.1|  putative 24 kDa seed maturation protein-like protein  82.8    2e-16   Solanum tuberosum [potatoes]
ref|XP_004503660.1|  PREDICTED: reticulon-like protein B2-like        82.8    2e-16   Cicer arietinum [garbanzo]
ref|XP_010435260.1|  PREDICTED: reticulon-like protein B2             82.8    2e-16   Camelina sativa [gold-of-pleasure]
gb|KJB52210.1|  hypothetical protein B456_008G250900                  82.8    2e-16   Gossypium raimondii
ref|XP_010455527.1|  PREDICTED: reticulon-like protein B2             82.8    3e-16   Camelina sativa [gold-of-pleasure]
ref|XP_006291739.1|  hypothetical protein CARUB_v10017909mg           82.4    3e-16   Capsella rubella
gb|AFK48295.1|  unknown                                               81.6    3e-16   Lotus japonicus
ref|XP_004149448.1|  PREDICTED: reticulon-like protein B1-like        82.4    3e-16   Cucumis sativus [cucumbers]
emb|CDY24806.1|  BnaA08g15040D                                        82.4    3e-16   Brassica napus [oilseed rape]
ref|XP_008239009.1|  PREDICTED: reticulon-like protein B2             82.4    3e-16   Prunus mume [ume]
gb|KJB52212.1|  hypothetical protein B456_008G250900                  82.0    3e-16   Gossypium raimondii
gb|EPS73616.1|  hypothetical protein M569_01145                       82.4    3e-16   Genlisea aurea
ref|XP_008367699.1|  PREDICTED: reticulon-like protein B2             82.0    4e-16   Malus domestica [apple tree]
ref|XP_003569752.1|  PREDICTED: reticulon-like protein B1             82.0    4e-16   Brachypodium distachyon [annual false brome]
gb|EYU32181.1|  hypothetical protein MIMGU_mgv1a012219mg              82.0    4e-16   Erythranthe guttata [common monkey flower]
ref|XP_006366650.1|  PREDICTED: putative 24 kDa seed maturation p...  83.6    4e-16   
ref|XP_009134231.1|  PREDICTED: reticulon-like protein B2             82.0    4e-16   Brassica rapa
emb|CDX90792.1|  BnaA03g24720D                                        82.0    5e-16   
gb|EAZ13460.1|  hypothetical protein OsJ_03377                        81.6    5e-16   Oryza sativa Japonica Group [Japonica rice]
gb|KHG09260.1|  Reticulon-like protein B3                             81.6    5e-16   
ref|XP_006298417.1|  hypothetical protein CARUB_v10014488mg           81.6    5e-16   
ref|XP_009596514.1|  PREDICTED: reticulon-like protein B8             81.6    5e-16   
gb|EYU25170.1|  hypothetical protein MIMGU_mgv1a012274mg              81.6    5e-16   
ref|XP_010413382.1|  PREDICTED: reticulon-like protein B6             81.6    6e-16   
emb|CDP18758.1|  unnamed protein product                              81.3    8e-16   
ref|XP_009375555.1|  PREDICTED: reticulon-like protein B1             81.3    8e-16   
gb|ACU15028.1|  unknown                                               79.0    8e-16   
ref|XP_010278922.1|  PREDICTED: reticulon-like protein B5             80.9    8e-16   
gb|ACU23452.1|  unknown                                               80.9    9e-16   
ref|NP_192861.1|  reticulon-like protein B2                           80.9    1e-15   
ref|XP_002306759.1|  reticulon family protein                         80.5    1e-15   
gb|AFK34557.1|  unknown                                               80.9    1e-15   
emb|CDY41666.1|  BnaC03g62180D                                        80.9    1e-15   
gb|KHN29299.1|  Reticulon-like protein B5                             80.5    1e-15   
ref|XP_008234814.1|  PREDICTED: reticulon-like protein B1             80.5    1e-15   
ref|XP_007218819.1|  hypothetical protein PRUPE_ppa010065mg           80.5    1e-15   
ref|XP_004240710.1|  PREDICTED: reticulon-like protein B6             80.5    1e-15   
gb|AFK42129.1|  unknown                                               79.7    1e-15   
ref|XP_007048924.1|  Reticulon family protein                         80.5    1e-15   
ref|XP_008376662.1|  PREDICTED: reticulon-like protein B1             80.5    2e-15   
ref|XP_009368711.1|  PREDICTED: reticulon-like protein B1             80.1    2e-15   
ref|XP_007209494.1|  hypothetical protein PRUPE_ppa010244mg           80.1    2e-15   
ref|XP_011032748.1|  PREDICTED: reticulon-like protein B8 isoform X1  80.1    2e-15   
ref|XP_006836413.1|  hypothetical protein AMTR_s00092p00151450        80.1    2e-15   
dbj|BAH57206.1|  AT1G64090                                            80.1    2e-15   
ref|XP_009380544.1|  PREDICTED: reticulon-like protein B2             80.1    2e-15   
gb|AFK34561.1|  unknown                                               80.1    2e-15   
gb|ACJ84486.1|  unknown                                               80.1    2e-15   
ref|XP_011032749.1|  PREDICTED: reticulon-like protein B8 isoform X2  80.1    2e-15   
gb|KJB52681.1|  hypothetical protein B456_008G272900                  78.2    2e-15   
ref|XP_007141449.1|  hypothetical protein PHAVU_008G196600g           79.7    2e-15   
ref|XP_010904667.1|  PREDICTED: reticulon-like protein B8             79.7    2e-15   
gb|KHF99856.1|  Reticulon-like protein B1                             78.6    3e-15   
ref|XP_009416753.1|  PREDICTED: reticulon-like protein B8 isoform X2  79.0    3e-15   
ref|XP_004980276.1|  PREDICTED: uncharacterized protein LOC101782657  80.1    3e-15   
ref|XP_011073415.1|  PREDICTED: reticulon-like protein B1 isoform X2  78.6    3e-15   
ref|XP_009772131.1|  PREDICTED: reticulon-like protein B2             79.3    4e-15   
gb|KJB52680.1|  hypothetical protein B456_008G272900                  77.8    4e-15   
ref|XP_011073407.1|  PREDICTED: reticulon-like protein B2 isoform X1  79.3    4e-15   
gb|KJB52682.1|  hypothetical protein B456_008G272900                  78.6    4e-15   
ref|XP_010464699.1|  PREDICTED: reticulon-like protein B8             79.3    4e-15   
ref|XP_010482050.1|  PREDICTED: reticulon-like protein B8             79.0    4e-15   
ref|XP_010486627.1|  PREDICTED: reticulon-like protein B8             79.0    4e-15   
ref|XP_011085435.1|  PREDICTED: reticulon-like protein B8             79.0    4e-15   
ref|XP_002884786.1|  reticulon family protein                         79.0    4e-15   
gb|KJB52679.1|  hypothetical protein B456_008G272900                  79.0    5e-15   
ref|XP_008809740.1|  PREDICTED: reticulon-like protein B8 isoform X2  78.2    5e-15   
gb|KCW89794.1|  hypothetical protein EUGRSUZ_A02040                   78.6    5e-15   
ref|NP_001241930.1|  uncharacterized protein LOC100787981             79.0    5e-15   
ref|XP_008809739.1|  PREDICTED: reticulon-like protein B8 isoform X1  78.2    5e-15   
gb|KHN11998.1|  Reticulon-like protein B8                             79.0    5e-15   
ref|XP_009601019.1|  PREDICTED: reticulon-like protein B8             78.6    5e-15   
ref|XP_010671578.1|  PREDICTED: reticulon-like protein B4             79.0    6e-15   
gb|AFK41983.1|  unknown                                               78.6    6e-15   
emb|CDP05124.1|  unnamed protein product                              78.6    6e-15   
gb|KCW89791.1|  hypothetical protein EUGRSUZ_A02040                   79.0    6e-15   
ref|XP_003519525.1|  PREDICTED: uncharacterized LOC100500122 isof...  78.6    6e-15   
ref|XP_010054092.1|  PREDICTED: reticulon-like protein B8 isoform X1  78.6    6e-15   
gb|KHN38355.1|  Reticulon-like protein B8                             78.6    6e-15   
gb|KDP36280.1|  hypothetical protein JCGZ_10290                       78.6    6e-15   
ref|XP_008343772.1|  PREDICTED: reticulon-like protein B1             78.6    7e-15   
ref|XP_008354289.1|  PREDICTED: reticulon-like protein B1             78.6    7e-15   
ref|XP_006360189.1|  PREDICTED: reticulon-like protein B2-like        78.6    7e-15   
ref|XP_010054120.1|  PREDICTED: reticulon-like protein B8 isoform X2  78.6    7e-15   
ref|XP_009416749.1|  PREDICTED: reticulon-like protein B8 isoform X1  78.2    8e-15   
ref|XP_004491276.1|  PREDICTED: reticulon-like protein B8-like is...  78.6    8e-15   
ref|XP_009403393.1|  PREDICTED: reticulon-like protein B8             78.2    8e-15   
ref|XP_006602275.1|  PREDICTED: reticulon-like protein B8-like is...  78.2    9e-15   
gb|KHN28537.1|  Reticulon-like protein B8                             78.2    1e-14   
ref|XP_009334492.1|  PREDICTED: reticulon-like protein B2             77.8    1e-14   
ref|XP_006351999.1|  PREDICTED: reticulon-like protein B8-like        77.8    1e-14   
ref|XP_004491277.1|  PREDICTED: reticulon-like protein B8-like is...  77.8    1e-14   
ref|XP_011467618.1|  PREDICTED: reticulon-like protein B8 isoform X1  77.8    1e-14   
ref|XP_011467620.1|  PREDICTED: reticulon-like protein B8 isoform X2  77.8    1e-14   
ref|XP_008229593.1|  PREDICTED: reticulon-like protein B8             77.8    1e-14   
ref|XP_006602273.1|  PREDICTED: reticulon-like protein B8-like is...  77.8    1e-14   
ref|XP_009399837.1|  PREDICTED: reticulon-like protein B5             77.4    1e-14   
ref|XP_011100485.1|  PREDICTED: reticulon-like protein B8             77.4    1e-14   
gb|ACN40158.1|  unknown                                               77.4    2e-14   
ref|XP_009783850.1|  PREDICTED: reticulon-like protein B8             77.4    2e-14   
gb|ABR17571.1|  unknown                                               77.4    2e-14   
emb|CDY41331.1|  BnaA01g31880D                                        77.4    2e-14   
gb|KFK31901.1|  hypothetical protein AALP_AA6G173800                  77.4    2e-14   
ref|XP_009123032.1|  PREDICTED: reticulon-like protein B8             77.4    2e-14   
emb|CDY56712.1|  BnaC01g38700D                                        78.2    2e-14   
ref|XP_008377768.1|  PREDICTED: reticulon-like protein B2             77.0    3e-14   
ref|XP_010053196.1|  PREDICTED: reticulon-like protein B1             77.0    3e-14   
ref|NP_850552.1|  reticulon-like protein B8                           77.0    3e-14   
ref|XP_004161550.1|  PREDICTED: reticulon-like protein B8-like        76.6    3e-14   
ref|NP_566371.1|  reticulon-like protein B8                           76.6    3e-14   
ref|XP_004147776.1|  PREDICTED: reticulon-like protein B8-like        76.6    3e-14   
ref|XP_007146289.1|  hypothetical protein PHAVU_006G028000g           76.6    3e-14   
ref|XP_008451843.1|  PREDICTED: reticulon-like protein B8 isoform X2  76.6    3e-14   
ref|XP_007215866.1|  hypothetical protein PRUPE_ppa010481mg           76.6    3e-14   
ref|XP_010313685.1|  PREDICTED: reticulon-like protein B8 isoform X1  76.6    3e-14   
ref|XP_010552962.1|  PREDICTED: reticulon-like protein B8             76.6    3e-14   
ref|XP_003532073.1|  PREDICTED: reticulon-like protein B8-like is...  76.3    3e-14   
ref|XP_004251554.1|  PREDICTED: reticulon-like protein B8 isoform X2  76.3    4e-14   
ref|XP_008380160.1|  PREDICTED: reticulon-like protein B8 isoform X2  76.3    4e-14   
ref|XP_010921231.1|  PREDICTED: reticulon-like protein B1 isoform X1  76.3    4e-14   
gb|AFK42059.1|  unknown                                               76.3    4e-14   
ref|XP_008380166.1|  PREDICTED: reticulon-like protein B8 isoform X4  76.3    4e-14   
ref|XP_008380159.1|  PREDICTED: reticulon-like protein B8 isoform X1  76.3    4e-14   
ref|XP_010023623.1|  PREDICTED: reticulon-like protein B8 isoform X1  76.6    4e-14   
ref|XP_010023631.1|  PREDICTED: reticulon-like protein B8 isoform X2  76.6    5e-14   
ref|XP_008380161.1|  PREDICTED: reticulon-like protein B8 isoform X3  75.9    5e-14   
ref|XP_009376960.1|  PREDICTED: reticulon-like protein B8             75.9    5e-14   
gb|EYU42855.1|  hypothetical protein MIMGU_mgv1a012522mg              75.9    5e-14   
ref|XP_010938076.1|  PREDICTED: reticulon-like protein B1             75.9    6e-14   
ref|XP_009356582.1|  PREDICTED: reticulon-like protein B8 isoform X2  75.9    6e-14   
ref|XP_008451841.1|  PREDICTED: reticulon-like protein B8 isoform X1  75.9    6e-14   
ref|XP_009356580.1|  PREDICTED: reticulon-like protein B8 isoform X1  75.5    7e-14   
ref|XP_006407589.1|  hypothetical protein EUTSA_v10021400mg           75.5    7e-14   
ref|XP_008342327.1|  PREDICTED: reticulon-like protein B8             75.5    7e-14   
ref|XP_004969875.1|  PREDICTED: reticulon-like protein B1-like        75.5    9e-14   
gb|KJB71178.1|  hypothetical protein B456_011G126300                  74.7    1e-13   
gb|KHG28741.1|  Reticulon-like protein B8                             75.1    1e-13   
ref|XP_010092876.1|  Reticulon-like protein                           75.1    1e-13   
ref|XP_008793405.1|  PREDICTED: reticulon-like protein B1             75.1    1e-13   
ref|XP_009146855.1|  PREDICTED: reticulon-like protein B8 isoform X2  75.1    1e-13   
emb|CDY00916.1|  BnaC05g42840D                                        74.7    1e-13   
ref|XP_004499535.1|  PREDICTED: reticulon-like protein B8-like is...  74.7    1e-13   
gb|KJB71177.1|  hypothetical protein B456_011G126300                  74.3    1e-13   
ref|XP_009146854.1|  PREDICTED: reticulon-like protein B8 isoform X1  74.7    1e-13   
gb|KJB71176.1|  hypothetical protein B456_011G126300                  74.3    2e-13   
ref|XP_007143486.1|  hypothetical protein PHAVU_007G075900g           74.3    2e-13   
ref|XP_010228928.1|  PREDICTED: reticulon-like protein B8             74.3    2e-13   
ref|XP_003617324.1|  Reticulon-like protein B8                        74.7    2e-13   
ref|XP_003617323.1|  Reticulon-like protein B8                        74.7    2e-13   
ref|XP_010543528.1|  PREDICTED: reticulon-like protein B8             74.3    2e-13   
ref|XP_003617322.1|  Reticulon-like protein B8                        74.3    2e-13   
gb|AFK45152.1|  unknown                                               73.9    2e-13   
gb|KJB71174.1|  hypothetical protein B456_011G126300                  73.9    2e-13   
gb|KJB71173.1|  hypothetical protein B456_011G126300                  74.3    2e-13   
gb|KJB39437.1|  hypothetical protein B456_007G013600                  73.9    2e-13   
gb|KEH33647.1|  reticulon-like protein B2                             73.9    2e-13   
ref|XP_010093192.1|  Reticulon-like protein                           73.9    3e-13   
ref|XP_008811812.1|  PREDICTED: reticulon-like protein B8             73.6    3e-13   
ref|NP_001055164.1|  Os05g0312500                                     73.6    4e-13   
gb|EAY97489.1|  hypothetical protein OsI_19418                        73.6    4e-13   
ref|XP_006654252.1|  PREDICTED: reticulon-like protein B1-like        73.2    4e-13   
ref|XP_004308034.1|  PREDICTED: reticulon-like protein B2             73.6    5e-13   
gb|EPS69502.1|  hypothetical protein M569_05265                       73.2    5e-13   
ref|NP_001051461.1|  Os03g0781700                                     73.2    5e-13   
gb|KHG24796.1|  Reticulon-like protein B5                             72.8    5e-13   
ref|XP_010931411.1|  PREDICTED: reticulon-like protein B6             72.8    7e-13   
gb|EAY92056.1|  hypothetical protein OsI_13754                        72.8    7e-13   
emb|CDY07184.1|  BnaCnng01990D                                        72.8    7e-13   
ref|XP_009111430.1|  PREDICTED: reticulon-like protein B7 isoform X1  72.8    7e-13   
ref|XP_011080610.1|  PREDICTED: reticulon-like protein B5             72.4    8e-13   
ref|XP_008782788.1|  PREDICTED: reticulon-like protein B1             72.4    8e-13   
ref|XP_006432015.1|  hypothetical protein CICLE_v10002112mg           72.8    9e-13   
ref|XP_010036176.1|  PREDICTED: reticulon-like protein B8             72.4    1e-12   
ref|XP_006491909.1|  PREDICTED: reticulon-like protein B5-like is...  72.4    1e-12   
ref|XP_009109295.1|  PREDICTED: reticulon-like protein B1             72.4    1e-12   
emb|CDP04019.1|  unnamed protein product                              72.0    1e-12   
ref|XP_004247011.1|  PREDICTED: reticulon-like protein B5             72.0    1e-12   
gb|KFK30707.1|  hypothetical protein AALP_AA6G017300                  72.0    1e-12   
ref|XP_010456226.1|  PREDICTED: reticulon-like protein B7 isoform X1  72.0    1e-12   
ref|XP_006339395.1|  PREDICTED: reticulon-like protein B5-like        72.0    1e-12   
ref|XP_009400146.1|  PREDICTED: reticulon-like protein B1             72.0    1e-12   
ref|XP_010422782.1|  PREDICTED: reticulon-like protein B7 isoform X1  72.0    1e-12   
sp|Q9M145.2|RTNLG_ARATH  RecName: Full=Reticulon-like protein B7;...  71.6    1e-12   
ref|XP_010427652.1|  PREDICTED: reticulon-like protein B7 isoform X1  71.6    1e-12   
ref|XP_009787619.1|  PREDICTED: reticulon-like protein B5             71.6    2e-12   
ref|XP_003592173.1|  Reticulon family protein                         71.6    2e-12   
gb|EYU36885.1|  hypothetical protein MIMGU_mgv1a013116mg              71.6    2e-12   
ref|XP_009621222.1|  PREDICTED: reticulon-like protein B5             71.6    2e-12   
ref|XP_008788043.1|  PREDICTED: reticulon-like protein B5             71.6    2e-12   
gb|EEE63204.1|  hypothetical protein OsJ_18014                        73.2    2e-12   
ref|XP_006589518.1|  PREDICTED: reticulon-like protein B1-like        71.6    2e-12   
gb|KHN21799.1|  Reticulon-like protein B1                             71.2    2e-12   
ref|XP_006491907.1|  PREDICTED: reticulon-like protein B5-like is...  72.4    2e-12   
ref|XP_006491906.1|  PREDICTED: reticulon-like protein B5-like is...  72.4    2e-12   
gb|EPS67049.1|  hypothetical protein M569_07727                       71.2    2e-12   
gb|EMT17810.1|  Reticulon-like protein B8                             71.6    2e-12   
gb|ACG31942.1|  seed maturation protein                               70.5    4e-12   
tpg|DAA51729.1|  TPA: seed maturation protein                         70.5    4e-12   
ref|XP_006650682.1|  PREDICTED: reticulon-like protein B8-like        70.5    4e-12   
ref|XP_002463790.1|  hypothetical protein SORBIDRAFT_01g006220        70.5    4e-12   
ref|NP_001137021.1|  seed maturation protein isoform 1                70.5    4e-12   
gb|ACG26944.1|  seed maturation protein                               70.5    4e-12   
ref|XP_010253410.1|  PREDICTED: reticulon-like protein B9             70.1    5e-12   
ref|XP_004299572.1|  PREDICTED: reticulon-like protein B9             70.1    5e-12   
ref|XP_004496510.1|  PREDICTED: reticulon-like protein B1-like        70.1    5e-12   
ref|XP_004962474.1|  PREDICTED: reticulon-like protein B1-like        70.1    6e-12   
ref|NP_001058867.1|  Os07g0142000                                     70.1    6e-12   
dbj|BAK07483.1|  predicted protein                                    70.1    7e-12   
ref|XP_002283026.1|  PREDICTED: reticulon-like protein B8             69.7    8e-12   
gb|AFW82132.1|  hypothetical protein ZEAMMB73_565764                  69.3    9e-12   
gb|EPS64109.1|  hypothetical protein M569_10676                       69.7    9e-12   
ref|XP_011078306.1|  PREDICTED: reticulon-like protein B9             69.3    9e-12   
gb|KJB34313.1|  hypothetical protein B456_006G059000                  69.3    1e-11   
ref|NP_001150935.1|  seed maturation protein                          69.3    1e-11   
ref|XP_006654743.1|  PREDICTED: reticulon-like protein B9-like        68.9    1e-11   
ref|XP_003555396.1|  PREDICTED: reticulon-like protein B1-like        69.3    1e-11   
gb|KHN12926.1|  Reticulon-like protein B1                             69.3    1e-11   
gb|EPS73228.1|  hypothetical protein M569_01531                       68.9    1e-11   
ref|XP_010094942.1|  Reticulon-like protein                           69.7    1e-11   
ref|XP_009609834.1|  PREDICTED: reticulon-like protein B9             68.6    1e-11   
ref|XP_008809164.1|  PREDICTED: reticulon-like protein B4             68.9    1e-11   
gb|EAY98925.1|  hypothetical protein OsI_20880                        68.6    2e-11   
gb|EMT10142.1|  Reticulon-like protein B1                             68.9    2e-11   
dbj|BAK06264.1|  predicted protein                                    68.6    2e-11   
ref|XP_011461529.1|  PREDICTED: reticulon-like protein B4             68.2    3e-11   
ref|XP_003568686.1|  PREDICTED: reticulon-like protein B1             68.2    3e-11   
ref|XP_002526383.1|  conserved hypothetical protein                   67.4    3e-11   
ref|XP_010906857.1|  PREDICTED: reticulon-like protein B8 isoform X1  68.2    3e-11   
ref|XP_011071252.1|  PREDICTED: reticulon-like protein B9             67.8    3e-11   
ref|XP_010906868.1|  PREDICTED: reticulon-like protein B8 isoform X2  68.2    3e-11   
gb|KHF99098.1|  Reticulon-like protein B9                             67.8    3e-11   
ref|XP_007152723.1|  hypothetical protein PHAVU_004G154000g           67.8    4e-11   
ref|XP_010279360.1|  PREDICTED: reticulon-like protein B9             67.4    4e-11   
ref|XP_007209013.1|  hypothetical protein PRUPE_ppa023407mg           67.4    5e-11   
gb|EYU40793.1|  hypothetical protein MIMGU_mgv1a013488mg              67.0    6e-11   
gb|KJB08302.1|  hypothetical protein B456_001G075400                  66.6    7e-11   
ref|XP_004981542.1|  PREDICTED: reticulon-like protein B8-like        67.8    7e-11   
ref|XP_003557631.1|  PREDICTED: reticulon-like protein B8             67.0    7e-11   
ref|XP_006366828.1|  PREDICTED: reticulon-like protein B2-like        67.4    8e-11   
ref|XP_008218214.1|  PREDICTED: reticulon-like protein B2             67.0    8e-11   



>ref|XP_006476478.1| PREDICTED: reticulon-like protein B2-like [Citrus sinensis]
 gb|KDO76366.1| hypothetical protein CISIN_1g039009mg [Citrus sinensis]
Length=256

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 80/98 (82%), Gaps = 3/98 (3%)
 Frame = +2

Query  131  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MA+E + EE   ES++EKI +KIH HDSSSSS S   +++KK +TSS+   V RLFGR++
Sbjct  1    MADEHKHEEPAGESVMEKITEKIHGHDSSSSSSSSDTDDDKKSSTSSLKTKVFRLFGREK  60

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVHKVLGGGK ADVFLWRNKKIS GVLGGATAIW+LF+
Sbjct  61   PVHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFQ  98



>ref|XP_006439447.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
 gb|ESR52687.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
Length=256

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 78/98 (80%), Gaps = 3/98 (3%)
 Frame = +2

Query  131  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MA+E + EE   ES+ EKI +KIH HDSSSSS S   +++KK + SS+   V RLFGR++
Sbjct  1    MADEHKHEEPAGESVKEKITEKIHGHDSSSSSSSSDSDDDKKSSASSLKTKVFRLFGREK  60

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVHKVLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE
Sbjct  61   PVHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFE  98



>ref|XP_010925814.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=253

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 68/94 (72%), Gaps = 3/94 (3%)
 Frame = +2

Query  134  AEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHK  313
            +EE   +  SL+EKI DK+H HD SSS     + E    +   + A + RLFGR++PVHK
Sbjct  5    SEESSSKPVSLMEKIVDKLHGHDDSSSDSDNEKSEPSASS---IKANIYRLFGRERPVHK  61

Query  314  VLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VLGGGK ADVFLWRNKKIS GVLGGATA+W+LFE
Sbjct  62   VLGGGKPADVFLWRNKKISAGVLGGATAVWVLFE  95



>ref|XP_002511930.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50599.1| conserved hypothetical protein [Ricinus communis]
Length=253

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAE      ES++EKI++KIH HDSSSSSDSE + E+K  + SS+ A + RLFGR++PVH
Sbjct  1    MAEHPESPIESVMEKISEKIHAHDSSSSSDSESDSEKKPTSPSSVKAKIFRLFGRERPVH  60

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
             VLGGGK ADVFLWRNKKIS  VLG ATAIWILFE
Sbjct  61   HVLGGGKPADVFLWRNKKISASVLGTATAIWILFE  95



>gb|KJB24636.1| hypothetical protein B456_004G154600 [Gossypium raimondii]
Length=130

 Score = 98.2 bits (243),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 77/98 (79%), Gaps = 4/98 (4%)
 Frame = +2

Query  131  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAEE   ++   ES++EKI+ KIH HDSSSSSDS+ + E+    +S + A + RLFGR++
Sbjct  1    MAEESESKQSAVESMMEKISQKIHGHDSSSSSDSDSDHEKPASPSS-VKAKIYRLFGRER  59

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVH VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE
Sbjct  60   PVHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFE  97



>ref|XP_010112604.1| Reticulon-like protein [Morus notabilis]
 gb|EXC34329.1| Reticulon-like protein [Morus notabilis]
Length=254

 Score =   100 bits (250),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 76/98 (78%), Gaps = 3/98 (3%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeek---kkttssMDAXVRRLFGRQQ  301
            MAE     EESL+EKI DKIH HDSSSSS S   +++K    +++SS+ + + RLFGR++
Sbjct  1    MAETQHHHEESLLEKITDKIHGHDSSSSSSSSDSDDDKKSEAQSSSSLKSKIYRLFGREK  60

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVHKVLGGGK AD+FLWRNKK+S GVLG AT IWILFE
Sbjct  61   PVHKVLGGGKPADIFLWRNKKVSAGVLGVATVIWILFE  98



>ref|XP_010915765.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=254

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 74/94 (79%), Gaps = 2/94 (2%)
 Frame = +2

Query  134  AEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHK  313
            +EE   + ESL+EKIA+K+H     SSS S+ + E+ + + SS+ A + RLFGR++PVHK
Sbjct  5    SEEASSKPESLMEKIAEKLH--GDDSSSSSDSDNEKSESSASSVKAKIYRLFGREEPVHK  62

Query  314  VLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VLGGGK ADVFLWRNKKIS GVLGGATA+W+LFE
Sbjct  63   VLGGGKPADVFLWRNKKISAGVLGGATAVWVLFE  96



>gb|KJB24635.1| hypothetical protein B456_004G154600 [Gossypium raimondii]
Length=179

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 77/98 (79%), Gaps = 4/98 (4%)
 Frame = +2

Query  131  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAEE   ++   ES++EKI+ KIH HDSSSSSDS+ + E+    +S + A + RLFGR++
Sbjct  1    MAEESESKQSAVESMMEKISQKIHGHDSSSSSDSDSDHEKPASPSS-VKAKIYRLFGRER  59

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVH VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE
Sbjct  60   PVHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFE  97



>ref|XP_002299504.1| reticulon family protein [Populus trichocarpa]
 gb|ABK93406.1| unknown [Populus trichocarpa]
 gb|EEE84309.1| reticulon family protein [Populus trichocarpa]
Length=254

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 75/97 (77%), Gaps = 4/97 (4%)
 Frame = +2

Query  131  MAEEDRKEE--ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQP  304
            MAE D+ +   ES+ EKI++K H HDSSS SDS+ E+ +    +  + + + RLFGR++P
Sbjct  1    MAEHDKDDSVVESVTEKISEKTHGHDSSSVSDSDHEKSKSNPDS--LKSKIYRLFGREKP  58

Query  305  VHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VHKVLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE
Sbjct  59   VHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFE  95



>ref|XP_010105716.1| Reticulon-like protein [Morus notabilis]
 gb|EXC05936.1| Reticulon-like protein [Morus notabilis]
Length=264

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 73/92 (79%), Gaps = 3/92 (3%)
 Frame = +2

Query  140  EDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVL  319
            E   E ESL+EKIADKIH HDSSSSSDS+ ++  K +    + A + RLFGR++P+HKVL
Sbjct  3    EHAGEPESLIEKIADKIHGHDSSSSSDSDDDKPSKVEE---VQAKIFRLFGREKPIHKVL  59

Query  320  GGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            GGGK ADVFLWRNKK+S GVLGGAT +W+LFE
Sbjct  60   GGGKPADVFLWRNKKLSAGVLGGATILWVLFE  91



>gb|KJB24634.1| hypothetical protein B456_004G154600 [Gossypium raimondii]
Length=255

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 77/98 (79%), Gaps = 4/98 (4%)
 Frame = +2

Query  131  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAEE   ++   ES++EKI+ KIH HDSSSSSDS+ + E+    +S + A + RLFGR++
Sbjct  1    MAEESESKQSAVESMMEKISQKIHGHDSSSSSDSDSDHEKPASPSS-VKAKIYRLFGRER  59

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVH VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE
Sbjct  60   PVHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFE  97



>gb|KJB06452.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=186

 Score = 96.3 bits (238),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 79/99 (80%), Gaps = 4/99 (4%)
 Frame = +2

Query  131  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsexeee-ekkkttssMDAXVRRLFGRQ  298
            MAEE    +   ES++EKI++KIH HDSSSSSDS+ + + EK  + SS+ A + RLFGR+
Sbjct  1    MAEETESMQSAVESVMEKISEKIHGHDSSSSSDSDSDSDHEKPASPSSVKAKIYRLFGRE  60

Query  299  QPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            +P+H VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE
Sbjct  61   RPLHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFE  99



>ref|XP_006397801.1| hypothetical protein EUTSA_v10001599mg [Eutrema salsugineum]
 gb|ESQ39254.1| hypothetical protein EUTSA_v10001599mg [Eutrema salsugineum]
Length=253

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 75/98 (77%), Gaps = 6/98 (6%)
 Frame = +2

Query  131  MAEEDRKE---EESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAEE  K    EESL+EKIA+KIH HDSSSSS+SE E+ +       + A + RLFGR++
Sbjct  1    MAEEIEKSVPAEESLMEKIAEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRLFGREK  57

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFE  95



>ref|XP_007051689.1| Reticulon family protein [Theobroma cacao]
 gb|EOX95846.1| Reticulon family protein [Theobroma cacao]
Length=255

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 76/98 (78%), Gaps = 4/98 (4%)
 Frame = +2

Query  131  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAEE   ++   ES++EKI+ KIH HDSSSSSDS+ + E+    +  + A + RLFGR++
Sbjct  1    MAEESESKQSTVESVMEKISGKIHGHDSSSSSDSDSDHEKPASPSP-VKAKIYRLFGRER  59

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVH VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE
Sbjct  60   PVHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFE  97



>ref|XP_011022600.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=250

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 75/95 (79%), Gaps = 4/95 (4%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAE D+  E+S++E + +K+H H++SS SDS+  + + +  +  + + + RLFGR++PVH
Sbjct  1    MAEHDK--EDSVIESVMEKVHDHETSSDSDSDHGKPKSESDS--LKSKIYRLFGREKPVH  56

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            KVLGGGK AD+FLWRNKKIS G+LGGATAIW+LFE
Sbjct  57   KVLGGGKPADIFLWRNKKISAGLLGGATAIWVLFE  91



>ref|XP_002880222.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56481.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=255

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 75/98 (77%), Gaps = 6/98 (6%)
 Frame = +2

Query  131  MAEEDRKE---EESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAEE  K    EESL+EKIA+KIH HDSSSSS+SE E+ +       + A + RLFGR++
Sbjct  1    MAEEIEKSVPAEESLMEKIAEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRLFGREK  57

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFE  95



>ref|XP_010462752.1| PREDICTED: reticulon-like protein B5 isoform X2 [Camelina sativa]
Length=130

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 75/99 (76%), Gaps = 7/99 (7%)
 Frame = +2

Query  131  MAEEDRK----EEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQ  298
            MAEE  K    EE SL+EKI++KIH HDSSSSS+SE E+ +       + A + R+FGR+
Sbjct  1    MAEEIEKSVPVEEPSLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGRE  57

Query  299  QPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            +PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE
Sbjct  58   KPVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFE  96



>ref|XP_006358652.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=255

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 64/93 (69%), Gaps = 2/93 (2%)
 Frame = +2

Query  137  EEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKV  316
            E    +EESL+EKIADKIH     SSS     +       SS+ A + RLFGR++PVH V
Sbjct  6    EHSEHKEESLMEKIADKIH--FDRSSSSDSEVKPAAAPEASSVKAKIWRLFGREKPVHHV  63

Query  317  LGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
             GGGK ADVFLWRNKKIS  VLGGATAIW+LFE
Sbjct  64   FGGGKPADVFLWRNKKISASVLGGATAIWVLFE  96



>ref|XP_006391670.1| hypothetical protein EUTSA_v10023649mg [Eutrema salsugineum]
 gb|ESQ28956.1| hypothetical protein EUTSA_v10023649mg [Eutrema salsugineum]
Length=256

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +2

Query  140  EDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVL  319
            E+ K EES++EKIA+KIH HD SSSS S+ ++E+K  + SSM   + RLFGR++PVHKV 
Sbjct  3    EEHKHEESIMEKIAEKIHGHDGSSSSSSDSDDEKKSASPSSMKKKIYRLFGREKPVHKVF  62

Query  320  GGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            GGGK AD+FLWRNKK+S GVLG AT  W+LFE
Sbjct  63   GGGKPADIFLWRNKKVSGGVLGVATISWVLFE  94



>ref|NP_001056102.1| Os05g0526400 [Oryza sativa Japonica Group]
 gb|AAU44062.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18016.1| Os05g0526400 [Oryza sativa Japonica Group]
 dbj|BAG96540.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00639.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64429.1| hypothetical protein OsJ_19273 [Oryza sativa Japonica Group]
Length=251

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 64/95 (67%), Gaps = 2/95 (2%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAE   KEEESLVE + DKI          S    +   + T+ + A + RLFGR++PVH
Sbjct  1    MAE--HKEEESLVESVMDKISDKLHGRGGSSSSSSDSDGERTADLKAKIYRLFGREKPVH  58

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
             VLGGGK AD+FLWRNKKIS GVL GATAIW+LFE
Sbjct  59   SVLGGGKPADLFLWRNKKISVGVLAGATAIWLLFE  93



>gb|KJB06451.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=257

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 79/99 (80%), Gaps = 4/99 (4%)
 Frame = +2

Query  131  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsexeee-ekkkttssMDAXVRRLFGRQ  298
            MAEE    +   ES++EKI++KIH HDSSSSSDS+ + + EK  + SS+ A + RLFGR+
Sbjct  1    MAEETESMQSAVESVMEKISEKIHGHDSSSSSDSDSDSDHEKPASPSSVKAKIYRLFGRE  60

Query  299  QPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            +P+H VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE
Sbjct  61   RPLHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFE  99



>gb|KJB06453.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=288

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 79/99 (80%), Gaps = 4/99 (4%)
 Frame = +2

Query  131  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsexeee-ekkkttssMDAXVRRLFGRQ  298
            MAEE    +   ES++EKI++KIH HDSSSSSDS+ + + EK  + SS+ A + RLFGR+
Sbjct  1    MAEETESMQSAVESVMEKISEKIHGHDSSSSSDSDSDSDHEKPASPSSVKAKIYRLFGRE  60

Query  299  QPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            +P+H VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE
Sbjct  61   RPLHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFE  99



>gb|EAY98759.1| hypothetical protein OsI_20691 [Oryza sativa Indica Group]
Length=251

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 64/95 (67%), Gaps = 2/95 (2%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAE   KEEESLVE + DKI          S    +   + T+ + A + RLFGR++PVH
Sbjct  1    MAE--HKEEESLVESVMDKISDKLHGRGGSSSSSSDSDGERTADLKAKIYRLFGREKPVH  58

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
             VLGGGK AD+FLWRNKKIS GVL GATAIW+LFE
Sbjct  59   SVLGGGKPADLFLWRNKKISVGVLTGATAIWLLFE  93



>ref|XP_004961431.1| PREDICTED: reticulon-like protein B1-like [Setaria italica]
Length=252

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 73/95 (77%), Gaps = 2/95 (2%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAE+ +  EES++EK++DK+H     SSS S   ++E+   T+++ A + RLFGR++PVH
Sbjct  1    MAEQHK--EESVLEKLSDKLHGRGGGSSSSSSDSDDERSSATTAVKAKIYRLFGREKPVH  58

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
             VLGGGK AD+FLWRNK+IS GVL GATAIW+LFE
Sbjct  59   SVLGGGKPADLFLWRNKRISGGVLAGATAIWLLFE  93



>ref|XP_010518282.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=255

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 75/98 (77%), Gaps = 6/98 (6%)
 Frame = +2

Query  131  MAEEDRKE---EESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAEE  K    EESL+EKI++KIH HDSSSSS+SE E+ +       + A + RLFGR++
Sbjct  1    MAEEIEKSVPAEESLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRLFGREK  57

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFE  95



>ref|XP_006302727.1| hypothetical protein CARUB_v10020840mg [Capsella rubella]
 gb|EOA35625.1| hypothetical protein CARUB_v10020840mg [Capsella rubella]
Length=253

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 69/95 (73%), Gaps = 5/95 (5%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAEE  K EES++EKIA+KIH HD SSSS    ++++       +   + RLFGR+QPVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHDDSSSSSDSDDDKKSST----LKTKIYRLFGREQPVH  55

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            K+ GGGK AD+FLWRNKK+S GVLG AT  WILFE
Sbjct  56   KIFGGGKPADIFLWRNKKVSGGVLGAATVSWILFE  90



>ref|XP_010418453.1| PREDICTED: reticulon-like protein B3 [Camelina sativa]
 ref|XP_010473656.1| PREDICTED: reticulon-like protein B3 isoform X1 [Camelina sativa]
 ref|XP_010473657.1| PREDICTED: reticulon-like protein B3 isoform X2 [Camelina sativa]
Length=254

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 72/95 (76%), Gaps = 3/95 (3%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAEE  K EES++EKIA+KIH H  SSSS S   +++KK ++  +   V RLFGR+QPVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHGDSSSSSSSDSDDDKKSSS--LKTKVYRLFGREQPVH  57

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE
Sbjct  58   KVFGGGKPADIFLWRNKKVSGGVLGAATVSWILFE  92



>ref|XP_010430525.1| PREDICTED: reticulon-like protein B3 [Camelina sativa]
Length=255

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 73/95 (77%), Gaps = 2/95 (2%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAEE  K EES++EKIA+KIH H  SSSS S  + ++ KK++S +   V RLFGR+QPVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHGDSSSSSSSSDSDDDKKSSS-LKTKVYRLFGREQPVH  58

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE
Sbjct  59   KVFGGGKPADIFLWRNKKVSGGVLGAATVSWILFE  93



>gb|ABC69764.1| unknown [Vitis pseudoreticulata]
Length=211

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 66/94 (70%), Gaps = 2/94 (2%)
 Frame = +2

Query  134  AEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHK  313
            AE      ESL+EKI DK+  HDSSSS      ++    +   + A V RLFGR++PVH 
Sbjct  5    AEGSGAASESLLEKITDKLQGHDSSSSDSDSDSDKAASPSP--IKAKVFRLFGREKPVHT  62

Query  314  VLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VLGGGK ADVFLWRNKKIS GVLGGATA+W+LFE
Sbjct  63   VLGGGKHADVFLWRNKKISAGVLGGATAMWVLFE  96



>ref|NP_001118533.1| reticulon-like protein B5 [Arabidopsis thaliana]
 gb|AEC10652.1| reticulon-like protein B5 [Arabidopsis thaliana]
Length=187

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 75/98 (77%), Gaps = 6/98 (6%)
 Frame = +2

Query  131  MAEEDRKE---EESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAEE  K    EESL+EKI++KIH HDSSSSS+SE E+ +       + A + R+FGR++
Sbjct  1    MAEEIEKSVPTEESLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGREK  57

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSGAVLGVATAIWVLFE  95



>ref|XP_010462746.1| PREDICTED: reticulon-like protein B5 isoform X1 [Camelina sativa]
Length=160

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 75/99 (76%), Gaps = 7/99 (7%)
 Frame = +2

Query  131  MAEEDRK----EEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQ  298
            MAEE  K    EE SL+EKI++KIH HDSSSSS+SE E+ +       + A + R+FGR+
Sbjct  1    MAEEIEKSVPVEEPSLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGRE  57

Query  299  QPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            +PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE
Sbjct  58   KPVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFE  96



>ref|XP_003633964.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 ref|XP_003633965.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 ref|XP_010661856.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 emb|CBI40444.3| unnamed protein product [Vitis vinifera]
Length=255

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 66/94 (70%), Gaps = 2/94 (2%)
 Frame = +2

Query  134  AEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHK  313
            AE      ESL+EKI DK+  HDSSSS      ++    +   + A V RLFGR++PVH 
Sbjct  5    AEGSGAASESLLEKITDKLQGHDSSSSGSDSDSDKPASPSP--IKAKVFRLFGREKPVHT  62

Query  314  VLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VLGGGK ADVFLWRNKKIS GVLGGATA+W+LFE
Sbjct  63   VLGGGKHADVFLWRNKKISAGVLGGATAMWVLFE  96



>ref|XP_010506615.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=255

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 75/98 (77%), Gaps = 6/98 (6%)
 Frame = +2

Query  131  MAEEDRKE---EESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAEE  K    EESL+EKI++KIH HDSSSSS+SE E+ +       + A + R+FGR++
Sbjct  1    MAEEIEKSVPAEESLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGREK  57

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFE  95



>ref|XP_010529625.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 78/101 (77%), Gaps = 4/101 (4%)
 Frame = +2

Query  122  ESXMAEE---DRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFG  292
            ES +A E   +  E ESL++KI++KIH H S SSS S+ E+E+K  + SS+ A V RLFG
Sbjct  9    ESALATEPAVEVVERESLLDKISEKIH-HGSDSSSSSDDEDEKKASSPSSLKAKVYRLFG  67

Query  293  RQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            R++PVHKVLGGGK AD+F+WRNKK+S  VLGG TA+W+LFE
Sbjct  68   REKPVHKVLGGGKPADIFMWRNKKMSASVLGGITAVWVLFE  108



>gb|KJB24286.1| hypothetical protein B456_004G137000 [Gossypium raimondii]
Length=152

 Score = 93.2 bits (230),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 70/95 (74%), Gaps = 3/95 (3%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            M++ + K EESL+EKI++K+  HD SSSS    +++  + +   M A V RLFGR++PVH
Sbjct  1    MSDHEDKHEESLLEKISEKVKGHDLSSSSSDSDDDKPSESS---MKAKVFRLFGRERPVH  57

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
             V GGGKQAD+FLWRNKKIS G LG AT IW+LFE
Sbjct  58   DVFGGGKQADIFLWRNKKISAGALGVATVIWVLFE  92



>gb|KHG04885.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=255

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 78/98 (80%), Gaps = 4/98 (4%)
 Frame = +2

Query  131  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MA+E   ++   ES++EKI++KIH +DSSSSSDS+ + E+    +S + A + RLFGR++
Sbjct  1    MADESESKQSAVESMMEKISEKIHGNDSSSSSDSDSDHEKPASPSS-VKAKIYRLFGRER  59

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVH VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE
Sbjct  60   PVHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFE  97



>gb|KDO56851.1| hypothetical protein CISIN_1g023137mg [Citrus sinensis]
Length=255

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 65/94 (69%), Gaps = 4/94 (4%)
 Frame = +2

Query  134  AEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHK  313
            A E    ++SLVEKI DKIH HDSSSS   + +            + V RLFGR++P+H 
Sbjct  5    APEHESSDKSLVEKITDKIHGHDSSSSDSDDDKPSSIDA----FKSKVFRLFGREKPIHH  60

Query  314  VLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VLG GK AD+FLWRNKKIS GVLGGATA+W+LFE
Sbjct  61   VLGAGKPADIFLWRNKKISAGVLGGATAMWVLFE  94



>gb|KDO56850.1| hypothetical protein CISIN_1g023137mg [Citrus sinensis]
Length=287

 Score = 95.5 bits (236),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 65/94 (69%), Gaps = 4/94 (4%)
 Frame = +2

Query  134  AEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHK  313
            A E    ++SLVEKI DKIH HDSSSS   + +            + V RLFGR++P+H 
Sbjct  5    APEHESSDKSLVEKITDKIHGHDSSSSDSDDDKPSSIDA----FKSKVFRLFGREKPIHH  60

Query  314  VLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VLG GK AD+FLWRNKKIS GVLGGATA+W+LFE
Sbjct  61   VLGAGKPADIFLWRNKKISAGVLGGATAMWVLFE  94



>ref|XP_010508058.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=256

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 75/99 (76%), Gaps = 7/99 (7%)
 Frame = +2

Query  131  MAEEDRK----EEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQ  298
            MAEE  K    EE SL+EKI++KIH HDSSSSS+SE E+ +       + A + R+FGR+
Sbjct  1    MAEEIEKSVPAEEPSLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGRE  57

Query  299  QPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            +PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE
Sbjct  58   KPVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFE  96



>ref|XP_009388111.1| PREDICTED: reticulon-like protein B1 [Musa acuminata subsp. malaccensis]
Length=258

 Score = 95.1 bits (235),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 64/99 (65%), Gaps = 4/99 (4%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexee----eekkkttssMDAXVRRLFGRQ  298
            MAE +    ESL+EKI +K H  DSSSS     +              + A + RLFGR+
Sbjct  1    MAEHEESVAESLLEKITEKFHGGDSSSSDSDGEKSSVVDSSAPSAAEVVKAKIYRLFGRE  60

Query  299  QPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            +PVHKVLGGGK ADVFLWRNKK+S   LGGATAIW+LFE
Sbjct  61   KPVHKVLGGGKPADVFLWRNKKVSAATLGGATAIWVLFE  99



>ref|XP_006294850.1| hypothetical protein CARUB_v10023902mg [Capsella rubella]
 gb|EOA27748.1| hypothetical protein CARUB_v10023902mg [Capsella rubella]
Length=255

 Score = 95.1 bits (235),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 74/98 (76%), Gaps = 6/98 (6%)
 Frame = +2

Query  131  MAEEDRKE---EESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAEE  K    EESL+EKIA+KIH HDSSSSS+SE E+ +       + A + R+FGR++
Sbjct  1    MAEEIEKSVPAEESLMEKIAEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGREK  57

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVHKVLGGGK ADVFLWR+KK+S  VLG AT IW+LFE
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATVIWVLFE  95



>ref|XP_008805646.1| PREDICTED: reticulon-like protein B3 [Phoenix dactylifera]
Length=254

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 70/84 (83%), Gaps = 2/84 (2%)
 Frame = +2

Query  164  LVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQADV  343
            L+EKIADK+H HDSSSSSDS+ E+ E   ++  + A + RLFGR++PVHKVLGGGK ADV
Sbjct  15   LMEKIADKLHGHDSSSSSDSDNEKSEPSASS--VKAKIYRLFGREKPVHKVLGGGKPADV  72

Query  344  FLWRNKKISXGVLGGATAIWILFE  415
             LWRNKKIS GVLGGATA+W+LFE
Sbjct  73   LLWRNKKISAGVLGGATAVWVLFE  96



>ref|XP_006422079.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
 ref|XP_006490603.1| PREDICTED: reticulon-like protein B3-like [Citrus sinensis]
 gb|ESR35319.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
Length=255

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 65/94 (69%), Gaps = 4/94 (4%)
 Frame = +2

Query  134  AEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHK  313
            A E    ++SLVEKI DKIH HDSSSS   + +            + V RLFGR++P+H 
Sbjct  5    APEHESADKSLVEKITDKIHGHDSSSSDSDDDKPSSIDA----FKSKVFRLFGREKPIHH  60

Query  314  VLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VLG GK AD+FLWRNKKIS GVLGGATA+W+LFE
Sbjct  61   VLGAGKPADIFLWRNKKISAGVLGGATAMWVLFE  94



>ref|XP_002441411.1| hypothetical protein SORBIDRAFT_09g026210 [Sorghum bicolor]
 gb|EES19841.1| hypothetical protein SORBIDRAFT_09g026210 [Sorghum bicolor]
Length=255

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = +2

Query  131  MAEEDRKEEE-SLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPV  307
            MAE+ R+E   S+++KI+DK+H   S SSS S   ++E    T+++ A + RLFGR++PV
Sbjct  1    MAEQHREESGGSVLDKISDKLHGRGSGSSSSSSDSDDEHSSATAAVKAKIYRLFGREKPV  60

Query  308  HKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            H VLGGGK AD+FLWRNK+IS GVL GATAIW+LFE
Sbjct  61   HSVLGGGKPADLFLWRNKRISGGVLAGATAIWLLFE  96



>gb|KDP25363.1| hypothetical protein JCGZ_20519 [Jatropha curcas]
Length=257

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 80/98 (82%), Gaps = 3/98 (3%)
 Frame = +2

Query  131  MAEEDRKEE--ESLVEKIADKIHRHdsssssdsex-eeeekkkttssMDAXVRRLFGRQQ  301
            MAE  ++E   ES++EKI++KIH HDSSSSSDS+  E+ +   + SSM + + R+FGR++
Sbjct  1    MAEHHKEESVIESVMEKISEKIHGHDSSSSSDSDNDEKSKSSSSPSSMKSKIYRIFGREK  60

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVHKVLGGGK AD+FLWRNKKIS GVLGGATAIW+LFE
Sbjct  61   PVHKVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFE  98



>ref|XP_006422078.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
 gb|ESR35318.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
Length=287

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 65/94 (69%), Gaps = 4/94 (4%)
 Frame = +2

Query  134  AEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHK  313
            A E    ++SLVEKI DKIH HDSSSS   + +            + V RLFGR++P+H 
Sbjct  5    APEHESADKSLVEKITDKIHGHDSSSSDSDDDKPSSIDA----FKSKVFRLFGREKPIHH  60

Query  314  VLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VLG GK AD+FLWRNKKIS GVLGGATA+W+LFE
Sbjct  61   VLGAGKPADIFLWRNKKISAGVLGGATAMWVLFE  94



>ref|XP_011026963.1| PREDICTED: reticulon-like protein B2 [Populus euphratica]
Length=254

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 73/97 (75%), Gaps = 4/97 (4%)
 Frame = +2

Query  131  MAEEDRKEE--ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQP  304
            MAE D+ +   ES+ EKI++KIH     SSS S+ + E+ K    S+ + + RLFGR++P
Sbjct  1    MAEHDKDDSVVESVTEKISEKIHG--HDSSSGSDSDHEKSKSNPDSLKSKIYRLFGREKP  58

Query  305  VHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VHKVLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE
Sbjct  59   VHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFE  95



>ref|XP_010541290.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 78/109 (72%), Gaps = 15/109 (14%)
 Frame = +2

Query  131  MAEEDRKEE--------------ESLVEKIADKIHRHdsssssdsexeeeekkkttssMD  268
            MAEE + EE              ESL++KI++KIH H   SSS S+ E+E+K  + SS+ 
Sbjct  1    MAEEQKHEETAAAPEPAVEVLERESLLDKISEKIH-HGGDSSSSSDDEDEKKASSLSSLQ  59

Query  269  AXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            A V RLFGR++PVHKVLGGGK AD+F+WRNKK+S GVLGG TA+W+LFE
Sbjct  60   AKVYRLFGREKPVHKVLGGGKPADIFMWRNKKMSGGVLGGITAVWVLFE  108



>ref|NP_566065.1| reticulon-like protein B5 [Arabidopsis thaliana]
 sp|O82352.1|RTNLE_ARATH RecName: Full=Reticulon-like protein B5; Short=AtRTNLB5 [Arabidopsis 
thaliana]
 gb|AAC62889.1| expressed protein [Arabidopsis thaliana]
 gb|AAK96651.1| At2g46170/T3F17.18 [Arabidopsis thaliana]
 gb|AAL69534.1| At2g46170/T3F17.18 [Arabidopsis thaliana]
 gb|AEC10651.1| reticulon-like protein B5 [Arabidopsis thaliana]
Length=255

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 75/98 (77%), Gaps = 6/98 (6%)
 Frame = +2

Query  131  MAEEDRKE---EESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAEE  K    EESL+EKI++KIH HDSSSSS+SE E+ +       + A + R+FGR++
Sbjct  1    MAEEIEKSVPTEESLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGREK  57

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSGAVLGVATAIWVLFE  95



>emb|CDY42012.1| BnaC04g00900D [Brassica napus]
Length=251

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 71/98 (72%), Gaps = 8/98 (8%)
 Frame = +2

Query  131  MAEEDRKE---EESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAEE  K    E+SL++KI++KIH HDSSS S+ E  +         + A + RLFGR++
Sbjct  1    MAEEIEKSMPAEQSLMDKISEKIHHHDSSSDSEYEKPDSPSA-----VKAKIYRLFGREK  55

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE
Sbjct  56   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFE  93



>ref|XP_009142682.1| PREDICTED: reticulon-like protein B5 [Brassica rapa]
 emb|CDX79993.1| BnaA05g01630D [Brassica napus]
Length=251

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 71/98 (72%), Gaps = 8/98 (8%)
 Frame = +2

Query  131  MAEEDRKE---EESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAEE  K    E+SL++KI++KIH HDSSS S+ E  +         + A + RLFGR++
Sbjct  1    MAEEIEKSMPAEQSLMDKISEKIHHHDSSSDSEYEKPDSPSA-----VKAKIYRLFGREK  55

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE
Sbjct  56   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFE  93



>emb|CDY25557.1| BnaC09g11820D [Brassica napus]
Length=251

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 72/95 (76%), Gaps = 6/95 (6%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAEE  K EES++EKIA+KIH HD+SSSSDS+ E++        +   + RLFGR++PVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHDNSSSSDSDDEKKASS-----IKTKIYRLFGREKPVH  54

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE
Sbjct  55   KVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFE  89



>emb|CDY08353.1| BnaC09g12430D [Brassica napus]
Length=250

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 72/95 (76%), Gaps = 6/95 (6%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAEE  K EES++EKIA+KIH HD+SSSSDS+ E++        +   + RLFGR++PVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHDNSSSSDSDDEKKASS-----IKTKIYRLFGREKPVH  54

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE
Sbjct  55   KVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFE  89



>ref|XP_009763461.1| PREDICTED: reticulon-like protein B6 isoform X1 [Nicotiana sylvestris]
Length=267

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 67/96 (70%), Gaps = 5/96 (5%)
 Frame = +2

Query  143  DRKEEESLVEKIADKI-----HRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPV  307
            + KEEESL+EKI DKI         S S ++ +     +  + SS+ A + RLFGR++PV
Sbjct  9    EYKEEESLIEKIEDKIHFDHSSFSSSDSDTEKKPASAPEAASPSSVKATIWRLFGREKPV  68

Query  308  HKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            H+V GGGK ADVFLWRNKKIS  VLGGATAIW+LFE
Sbjct  69   HQVFGGGKPADVFLWRNKKISASVLGGATAIWVLFE  104



>ref|XP_010658515.1| PREDICTED: reticulon-like protein B2 [Vitis vinifera]
 emb|CBI34409.3| unnamed protein product [Vitis vinifera]
Length=252

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 63/86 (73%), Gaps = 5/86 (6%)
 Frame = +2

Query  158  ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQA  337
            ES++EKI++KIH HDSSSS     +            A V R+FGR++PVHKVLGGGK A
Sbjct  13   ESMMEKISEKIHGHDSSSSDSDNEKSSPSA-----FKAKVYRIFGREKPVHKVLGGGKPA  67

Query  338  DVFLWRNKKISXGVLGGATAIWILFE  415
            DV LWRNKKIS GVLGGATA+WILFE
Sbjct  68   DVVLWRNKKISAGVLGGATAVWILFE  93



>gb|KJB24287.1| hypothetical protein B456_004G137000 [Gossypium raimondii]
Length=208

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 70/95 (74%), Gaps = 3/95 (3%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            M++ + K EESL+EKI++K+  HD SSSS    +++  + +   M A V RLFGR++PVH
Sbjct  1    MSDHEDKHEESLLEKISEKVKGHDLSSSSSDSDDDKPSESS---MKAKVFRLFGRERPVH  57

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
             V GGGKQAD+FLWRNKKIS G LG AT IW+LFE
Sbjct  58   DVFGGGKQADIFLWRNKKISAGALGVATVIWVLFE  92



>ref|XP_010261408.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
 ref|XP_010261409.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
Length=255

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 66/94 (70%), Gaps = 4/94 (4%)
 Frame = +2

Query  134  AEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHK  313
            AE+     ES++ KIA+K+H         S  + + +K + SS+ A V RLFGRQ+PVHK
Sbjct  5    AEDSGSTVESVMHKIAEKLHH----KDDSSSSDSDNEKSSPSSVKAAVYRLFGRQKPVHK  60

Query  314  VLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VLGGGK ADVFLWRNKKIS  VLGGATA W+LFE
Sbjct  61   VLGGGKPADVFLWRNKKISASVLGGATAAWVLFE  94



>ref|XP_009763462.1| PREDICTED: reticulon-like protein B1 isoform X2 [Nicotiana sylvestris]
Length=263

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 67/96 (70%), Gaps = 5/96 (5%)
 Frame = +2

Query  143  DRKEEESLVEKIADKI-----HRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPV  307
            + KEEESL+EKI DKI         S S ++ +     +  + SS+ A + RLFGR++PV
Sbjct  9    EYKEEESLIEKIEDKIHFDHSSFSSSDSDTEKKPASAPEAASPSSVKATIWRLFGREKPV  68

Query  308  HKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            H+V GGGK ADVFLWRNKKIS  VLGGATAIW+LFE
Sbjct  69   HQVFGGGKPADVFLWRNKKISASVLGGATAIWVLFE  104



>emb|CDY34396.1| BnaA09g11380D [Brassica napus]
Length=251

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 72/95 (76%), Gaps = 6/95 (6%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAEE  K EES++EKIA+KIH HD+SSSSDS+ E++        +   + RLFGR++PVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHDNSSSSDSDDEKKASS-----IKTKIFRLFGREKPVH  54

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE
Sbjct  55   KVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFE  89



>gb|KFK40472.1| hypothetical protein AALP_AA2G000200 [Arabis alpina]
Length=254

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 73/95 (77%), Gaps = 3/95 (3%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAEE  K EESL+EKI++KIH H  SSSS S+ ++E+K  ++  +   + RLFGR++PVH
Sbjct  1    MAEE-HKHEESLMEKISEKIHGHGDSSSSSSDSDDEKKSDSS--LKTKIYRLFGREKPVH  57

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE
Sbjct  58   KVFGGGKPADIFLWRNKKVSGGVLGAATISWILFE  92



>ref|XP_009112901.1| PREDICTED: reticulon-like protein B3 [Brassica rapa]
Length=251

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 72/95 (76%), Gaps = 6/95 (6%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAEE  K EES++EKIA+KIH HD+SSSSDS+ E++        +   + RLFGR++PVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHDNSSSSDSDDEKKASS-----IKTKIFRLFGREKPVH  54

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE
Sbjct  55   KVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFE  89



>ref|XP_006654676.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=247

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 67/95 (71%), Gaps = 6/95 (6%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAE   KEEES+++ I+DK+H         S    +   + T+++ A + RLFGR++PVH
Sbjct  1    MAE--HKEEESVMDTISDKLHG----RGGSSSSSLDSDGERTAAVKAKIYRLFGREKPVH  54

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
             VLGGGK AD+FLWRNKKIS GVL GATAIW+LFE
Sbjct  55   SVLGGGKPADLFLWRNKKISVGVLAGATAIWLLFE  89



>ref|NP_176592.1| reticulon-like protein B3 [Arabidopsis thaliana]
 sp|Q9SH59.1|RTNLC_ARATH RecName: Full=Reticulon-like protein B3; Short=AtRTNLB3 [Arabidopsis 
thaliana]
 gb|AAF24576.1|AC007764_18 F22C12.15 [Arabidopsis thaliana]
 gb|AAL36421.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51418.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99051.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE34190.1| reticulon-like protein B3 [Arabidopsis thaliana]
Length=255

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 72/95 (76%), Gaps = 4/95 (4%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAEE  K EES++EKI++KIH HD SSSS S+ ++++   +   +   + RLFGR+QP+H
Sbjct  1    MAEE-HKHEESIMEKISEKIHGHDDSSSSSSDSDDDKNSAS---LKTKIYRLFGREQPLH  56

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            K+ GGGK AD+FLWRNKK+S GVLG AT  WILFE
Sbjct  57   KLFGGGKPADIFLWRNKKVSGGVLGAATVSWILFE  91



>gb|KHG29253.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=251

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 74/95 (78%), Gaps = 2/95 (2%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAEE  + ++S VE + +KIH HDSSSSSDS+ + E+     S + A + RLFGR++P+H
Sbjct  1    MAEET-ESKQSAVESVMEKIHGHDSSSSSDSDSDHEKPASPIS-VKAKIYRLFGRERPLH  58

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
             VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE
Sbjct  59   HVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFE  93



>ref|XP_006374287.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52084.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=193

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 66/99 (67%), Gaps = 2/99 (2%)
 Frame = +2

Query  122  ESXMAE-EDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQ  298
            E  MAE E  +E E +VE +ADKI    +     S    +     + ++ + + RLFGR+
Sbjct  7    EREMAEHEGEREREPVVESMADKI-TEKTHDHDSSSSSSDSDDDKSDAVKSKIFRLFGRE  65

Query  299  QPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            +PVHKVLGGGK ADVFLWRNKKIS GVLGGATA+W+ FE
Sbjct  66   KPVHKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFE  104



>gb|KJB19086.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=214

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 72/96 (75%), Gaps = 4/96 (4%)
 Frame = +2

Query  131  MAE-EDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPV  307
            MAE E++K+EESL+EKIA+KIH HDSSSSS    +++  + +   +   V RLFGR++PV
Sbjct  1    MAEHEEKKQEESLMEKIAEKIHGHDSSSSSSDSDDDKPSESS---IKDKVFRLFGREKPV  57

Query  308  HKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            H V GGGK AD+ LWRNKKIS G LG AT IW+LFE
Sbjct  58   HHVFGGGKPADILLWRNKKISAGALGVATVIWVLFE  93



>gb|KJB24285.1| hypothetical protein B456_004G137000 [Gossypium raimondii]
Length=255

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 70/95 (74%), Gaps = 3/95 (3%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            M++ + K EESL+EKI++K+  HD SSSS    +++  + +   M A V RLFGR++PVH
Sbjct  1    MSDHEDKHEESLLEKISEKVKGHDLSSSSSDSDDDKPSESS---MKAKVFRLFGRERPVH  57

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
             V GGGKQAD+FLWRNKKIS G LG AT IW+LFE
Sbjct  58   DVFGGGKQADIFLWRNKKISAGALGVATVIWVLFE  92



>gb|KJB19088.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=254

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 72/96 (75%), Gaps = 4/96 (4%)
 Frame = +2

Query  131  MAE-EDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPV  307
            MAE E++K+EESL+EKIA+KIH HDSSSSS    +++  + +   +   V RLFGR++PV
Sbjct  1    MAEHEEKKQEESLMEKIAEKIHGHDSSSSSSDSDDDKPSESS---IKDKVFRLFGREKPV  57

Query  308  HKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            H V GGGK AD+ LWRNKKIS G LG AT IW+LFE
Sbjct  58   HHVFGGGKPADILLWRNKKISAGALGVATVIWVLFE  93



>ref|XP_006374288.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52085.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=199

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 66/99 (67%), Gaps = 2/99 (2%)
 Frame = +2

Query  122  ESXMAE-EDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQ  298
            E  MAE E  +E E +VE +ADKI    +     S    +     + ++ + + RLFGR+
Sbjct  7    EREMAEHEGEREREPVVESMADKI-TEKTHDHDSSSSSSDSDDDKSDAVKSKIFRLFGRE  65

Query  299  QPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            +PVHKVLGGGK ADVFLWRNKKIS GVLGGATA+W+ FE
Sbjct  66   KPVHKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFE  104



>gb|KJB19089.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=212

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 72/96 (75%), Gaps = 4/96 (4%)
 Frame = +2

Query  131  MAE-EDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPV  307
            MAE E++K+EESL+EKIA+KIH HDSSSSS    +++  + +   +   V RLFGR++PV
Sbjct  1    MAEHEEKKQEESLMEKIAEKIHGHDSSSSSSDSDDDKPSESS---IKDKVFRLFGREKPV  57

Query  308  HKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            H V GGGK AD+ LWRNKKIS G LG AT IW+LFE
Sbjct  58   HHVFGGGKPADILLWRNKKISAGALGVATVIWVLFE  93



>ref|XP_011037168.1| PREDICTED: reticulon-like protein B5 [Populus euphratica]
Length=252

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 75/95 (79%), Gaps = 1/95 (1%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAE+     ES++ KI++KIH H+SSSSSDSE + E+K   + S+   + RLFGR++PVH
Sbjct  1    MAEQSENPIESIMGKISEKIH-HESSSSSDSESDSEKKSYPSESVKDKIWRLFGREKPVH  59

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            +VLGGGK ADVFLWRNKK+S GVLG ATAIW+LFE
Sbjct  60   RVLGGGKPADVFLWRNKKVSAGVLGFATAIWVLFE  94



>ref|NP_198975.1| reticulon-like protein B4 [Arabidopsis thaliana]
 sp|Q9FFS0.1|RTNLD_ARATH RecName: Full=Reticulon-like protein B4; Short=AtRTNLB4; AltName: 
Full=VirB2-interacting protein 3 [Arabidopsis thaliana]
 dbj|BAB11466.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK59673.1| unknown protein [Arabidopsis thaliana]
 gb|AAL15269.1| AT5g41600/MBK23_13 [Arabidopsis thaliana]
 gb|AAN12890.1| unknown protein [Arabidopsis thaliana]
 gb|AED94696.1| reticulon-like protein B4 [Arabidopsis thaliana]
Length=257

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 73/93 (78%), Gaps = 1/93 (1%)
 Frame = +2

Query  140  EDRKEEESLVEKIADKIHRH-dsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKV  316
            ED K EES++EKI +KIH H DSSS SDS+ +++    ++SS  + + RLFGR++PVHKV
Sbjct  3    EDHKHEESILEKIVEKIHGHGDSSSLSDSDDDKKSTSSSSSSFKSKIYRLFGREKPVHKV  62

Query  317  LGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            LGGGK AD+FLWRNKK+S GVLG  TA W+LFE
Sbjct  63   LGGGKPADIFLWRNKKVSGGVLGAVTASWVLFE  95



>gb|KJB19091.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=241

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 72/96 (75%), Gaps = 4/96 (4%)
 Frame = +2

Query  131  MAE-EDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPV  307
            MAE E++K+EESL+EKIA+KIH HDSSSSS    +++  + +   +   V RLFGR++PV
Sbjct  1    MAEHEEKKQEESLMEKIAEKIHGHDSSSSSSDSDDDKPSESS---IKDKVFRLFGREKPV  57

Query  308  HKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            H V GGGK AD+ LWRNKKIS G LG AT IW+LFE
Sbjct  58   HHVFGGGKPADILLWRNKKISAGALGVATVIWVLFE  93



>ref|XP_006374290.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52087.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=263

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 66/99 (67%), Gaps = 2/99 (2%)
 Frame = +2

Query  122  ESXMAE-EDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQ  298
            E  MAE E  +E E +VE +ADKI    +     S    +     + ++ + + RLFGR+
Sbjct  7    EREMAEHEGEREREPVVESMADKI-TEKTHDHDSSSSSSDSDDDKSDAVKSKIFRLFGRE  65

Query  299  QPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            +PVHKVLGGGK ADVFLWRNKKIS GVLGGATA+W+ FE
Sbjct  66   KPVHKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFE  104



>ref|XP_010473658.1| PREDICTED: reticulon-like protein B3 isoform X3 [Camelina sativa]
Length=267

 Score = 92.4 bits (228),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 73/107 (68%), Gaps = 14/107 (13%)
 Frame = +2

Query  131  MAEEDRKEE------------ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAX  274
            MAEE + EE            ES++EKIA+KIH H  SSSS S   +++KK ++  +   
Sbjct  1    MAEEHKHEESIMEKIAEKIHEESIMEKIAEKIHGHGDSSSSSSSDSDDDKKSSS--LKTK  58

Query  275  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            V RLFGR+QPVHKV GGGK AD+FLWRNKK+S GVLG AT  WILFE
Sbjct  59   VYRLFGREQPVHKVFGGGKPADIFLWRNKKVSGGVLGAATVSWILFE  105



>ref|XP_004248066.1| PREDICTED: reticulon-like protein B1 [Solanum lycopersicum]
Length=263

 Score = 92.4 bits (228),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 67/104 (64%), Gaps = 9/104 (9%)
 Frame = +2

Query  131  MAEE----DRKEEESLVEKIADKIH-----RHdsssssdsexeeeekkkttssMDAXVRR  283
            MAE+       +EES +EKIADKIH        SS S          + + SS+ A + R
Sbjct  1    MAEQVEQHSEHKEESFMEKIADKIHFDRSSSSSSSDSDSEVKPAAAPEASPSSVKAKIWR  60

Query  284  LFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            LFGR++PVH V GGGK ADVFLWRNKKIS  VLGGATAIW+LFE
Sbjct  61   LFGREKPVHHVFGGGKPADVFLWRNKKISASVLGGATAIWVLFE  104



>dbj|BAJ98297.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97542.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=255

 Score = 92.4 bits (228),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 71/97 (73%), Gaps = 2/97 (2%)
 Frame = +2

Query  131  MAEEDRKEE--ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQP  304
            MAE   +E   ES+++KI+DK H    SSSS S   +++KK + + + A + RLFGR+QP
Sbjct  1    MAEHKEEEPVAESMMDKISDKFHGGGGSSSSSSSDSDDDKKGSAAGVKAKIYRLFGREQP  60

Query  305  VHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VH VLGGGK AD+ LWRNKKIS GVL GATAIW+LFE
Sbjct  61   VHAVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFE  97



>gb|AFK39432.1| unknown [Lotus japonicus]
Length=150

 Score = 90.1 bits (222),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 75/97 (77%), Gaps = 3/97 (3%)
 Frame = +2

Query  134  AEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAX---VRRLFGRQQP  304
            +E D  + E L+EKIA+KIH HDSSSSSDS+ E+E++K ++S        V RLFGR++P
Sbjct  5    SEHDEPKAEPLMEKIAEKIHGHDSSSSSDSDNEKEKEKSSSSPSSDFKSKVSRLFGREKP  64

Query  305  VHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            +H VLGGGKQADVFLWRNKKIS  VLG AT +WILFE
Sbjct  65   IHHVLGGGKQADVFLWRNKKISGTVLGVATVVWILFE  101



>gb|KDO86332.1| hypothetical protein CISIN_1g025719mg [Citrus sinensis]
Length=213

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAE +    E  +EK+++KIH    SSSS S   + E+    SS+ A + RLFGR++PVH
Sbjct  1    MAEREENPAEPPMEKVSEKIHD-HDSSSSSSSDSDNEEPAAQSSVKADIYRLFGRERPVH  59

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            +V GGGK ADVFLWRNKKIS GVLGGATAIW+LFE
Sbjct  60   QVFGGGKPADVFLWRNKKISAGVLGGATAIWVLFE  94



>ref|XP_006374289.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52086.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=254

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 65/96 (68%), Gaps = 2/96 (2%)
 Frame = +2

Query  131  MAE-EDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPV  307
            MAE E  +E E +VE +ADKI    +     S    +     + ++ + + RLFGR++PV
Sbjct  1    MAEHEGEREREPVVESMADKI-TEKTHDHDSSSSSSDSDDDKSDAVKSKIFRLFGREKPV  59

Query  308  HKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            HKVLGGGK ADVFLWRNKKIS GVLGGATA+W+ FE
Sbjct  60   HKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFE  95



>ref|XP_010545343.1| PREDICTED: reticulon-like protein B3 [Tarenaya hassleriana]
Length=259

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 71/98 (72%), Gaps = 4/98 (4%)
 Frame = +2

Query  131  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAEE + EE   ES++EKIA+KI R     SS S   ++EKK + SS+ A + RLFGR+ 
Sbjct  1    MAEEHKHEESAAESIIEKIAEKI-RGYDDGSSSSSDSDDEKKASLSSLKAKIYRLFGREN  59

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVH VLGGGK AD+ LWRNKK+S GVLG ATA W+LFE
Sbjct  60   PVHNVLGGGKPADIVLWRNKKVSGGVLGAATAAWVLFE  97



>ref|XP_010538815.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = +2

Query  152  EEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGK  331
            E ESL++KI++KIH H   SSS S  E+E++  + SS+ A V RLFGR++PVHKVLGGGK
Sbjct  22   ERESLLDKISEKIH-HGDDSSSSSSDEDEKEASSPSSLKAKVYRLFGREKPVHKVLGGGK  80

Query  332  QADVFLWRNKKISXGVLGGATAIWILFE  415
             AD+F+WR+KK+S  VLGG TA+W+LFE
Sbjct  81   PADIFMWRDKKMSASVLGGITAVWVLFE  108



>gb|KJB19087.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
 gb|KJB19090.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=252

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 72/96 (75%), Gaps = 4/96 (4%)
 Frame = +2

Query  131  MAE-EDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPV  307
            MAE E++K+EESL+EKIA+KIH HDSSSSS    +++  + +   +   V RLFGR++PV
Sbjct  1    MAEHEEKKQEESLMEKIAEKIHGHDSSSSSSDSDDDKPSESS---IKDKVFRLFGREKPV  57

Query  308  HKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            H V GGGK AD+ LWRNKKIS G LG AT IW+LFE
Sbjct  58   HHVFGGGKPADILLWRNKKISAGALGVATVIWVLFE  93



>ref|XP_009603968.1| PREDICTED: reticulon-like protein B1 [Nicotiana tomentosiformis]
 ref|XP_009603969.1| PREDICTED: reticulon-like protein B1 [Nicotiana tomentosiformis]
Length=263

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 68/96 (71%), Gaps = 5/96 (5%)
 Frame = +2

Query  143  DRKEEESLVEKIADKIHRHdssss-----sdsexeeeekkkttssMDAXVRRLFGRQQPV  307
            +  EEESL+EKI DKIH    SSS     ++ +     +  + SS+ A + RLFGR++PV
Sbjct  9    EYNEEESLIEKIEDKIHFDHFSSSSSDSDTEKKPASAPEAASPSSVKAAIWRLFGREKPV  68

Query  308  HKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            H+V GGGK ADVFLWRNKK+S  VLGGATAIW+LFE
Sbjct  69   HQVFGGGKPADVFLWRNKKVSASVLGGATAIWVLFE  104



>gb|KJB37517.1| hypothetical protein B456_006G208500 [Gossypium raimondii]
Length=210

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 65/95 (68%), Gaps = 6/95 (6%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            M E + K EESL+ K+A+KIH HDSSS SD +   E        + A V RLFGR++ VH
Sbjct  1    MGEHEEKHEESLMVKLAEKIHGHDSSSDSDIDKPSESS------IKAKVFRLFGRERSVH  54

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
             V GGGK AD FLWRNKKIS GVLG AT IW+LFE
Sbjct  55   HVFGGGKSADTFLWRNKKISAGVLGVATVIWVLFE  89



>ref|XP_010533622.1| PREDICTED: reticulon-like protein B4 [Tarenaya hassleriana]
Length=259

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 74/98 (76%), Gaps = 4/98 (4%)
 Frame = +2

Query  131  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAEE + EE   ES++EKIA+KI  HD  SSS S+ ++E+K   +S + A + RLFGR++
Sbjct  1    MAEEHKHEESTAESIMEKIAEKIRGHDDGSSSSSDSDDEKKSSPSS-LKAKIYRLFGREK  59

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVH VLGGGK AD+FLWRNKK+S G LG ATA W+LFE
Sbjct  60   PVHSVLGGGKPADIFLWRNKKVSGGALGVATAAWVLFE  97



>ref|XP_011080892.1| PREDICTED: reticulon-like protein B2 [Sesamum indicum]
Length=257

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 70/98 (71%), Gaps = 3/98 (3%)
 Frame = +2

Query  131  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MA+  ++EE   ESL++K+ DK+H HDSSSSS S    +      + +   V RLFGR++
Sbjct  1    MADHHKEEENKGESLIDKVTDKMHAHDSSSSSSSSSSSDSDDDRKARLKTKVYRLFGREK  60

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVHK+LGGG+ ADV LWR+KK+S GVLGGA A+W LF+
Sbjct  61   PVHKILGGGQGADVLLWRDKKVSAGVLGGAAALWFLFD  98



>ref|XP_007218267.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
 gb|EMJ19466.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
Length=280

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = +2

Query  122  ESXMAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            +S  A    + E+SL+EKI++KIH H+SSSSS S+ + E+ +   S     V R+FGR++
Sbjct  86   QSESAGSTVEHEKSLMEKISEKIHDHNSSSSSSSDSDNEKPESPKSE-KPKVFRIFGREK  144

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVH V GGGK ADVFLWRNKK+S GVLGGATA+W+LFE
Sbjct  145  PVHHVFGGGKPADVFLWRNKKVSAGVLGGATAVWVLFE  182



>gb|KDO86331.1| hypothetical protein CISIN_1g025719mg [Citrus sinensis]
Length=249

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAE +    E  +EK+++KIH    SSSS S   + E+    SS+ A + RLFGR++PVH
Sbjct  1    MAEREENPAEPPMEKVSEKIHD-HDSSSSSSSDSDNEEPAAQSSVKADIYRLFGRERPVH  59

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            +V GGGK ADVFLWRNKKIS GVLGGATAIW+LFE
Sbjct  60   QVFGGGKPADVFLWRNKKISAGVLGGATAIWVLFE  94



>ref|XP_006444935.1| hypothetical protein CICLE_v10021860mg [Citrus clementina]
 ref|XP_006491199.1| PREDICTED: reticulon-like protein B5-like [Citrus sinensis]
 gb|ESR58175.1| hypothetical protein CICLE_v10021860mg [Citrus clementina]
Length=249

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAE +    E  +EK+++KIH    SSSS S   + E+    SS+ A + RLFGR++PVH
Sbjct  1    MAEREENPAEPPMEKVSEKIHD-HDSSSSSSSDSDNEEPAAQSSVKADIYRLFGRERPVH  59

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            +V GGGK ADVFLWRNKKIS GVLGGATAIW+LFE
Sbjct  60   QVFGGGKPADVFLWRNKKISAGVLGGATAIWVLFE  94



>ref|XP_002870630.1| VIRB2-interacting protein 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46889.1| VIRB2-interacting protein 3 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +2

Query  140  EDRKEEESLVEKIADKIHRH-dsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKV  316
            ED K EES++EKI +KIH H DSSS SDS+ +++    ++SS  + + RLFGR++PVHKV
Sbjct  3    EDHKHEESIMEKIVEKIHGHGDSSSLSDSDDDKKSTSSSSSSFKSKIYRLFGREKPVHKV  62

Query  317  LGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            LGGGK AD+FLWRNKK+S GV G  TA W+LFE
Sbjct  63   LGGGKPADIFLWRNKKVSGGVFGAVTASWVLFE  95



>ref|XP_007040378.1| Reticulan like protein B3, putative isoform 3, partial [Theobroma 
cacao]
 gb|EOY24879.1| Reticulan like protein B3, putative isoform 3, partial [Theobroma 
cacao]
Length=277

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 71/92 (77%), Gaps = 2/92 (2%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAE + K EE+L+EKI +KIH HDSSSSS S+ E+ +  ++   + + V RLFGR++PVH
Sbjct  1    MAEHEEKHEETLMEKITEKIHGHDSSSSSSSDDEDNKPSESP--IKSNVFRLFGREKPVH  58

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWI  406
            +VLGGGK AD+FLWRNKKIS G LG AT IW+
Sbjct  59   QVLGGGKPADIFLWRNKKISAGALGVATVIWV  90



>ref|XP_007040377.1| Reticulan like protein B3, putative isoform 2 [Theobroma cacao]
 gb|EOY24878.1| Reticulan like protein B3, putative isoform 2 [Theobroma cacao]
Length=291

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 71/92 (77%), Gaps = 2/92 (2%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAE + K EE+L+EKI +KIH HDSSSSS S+ E+ +  ++   + + V RLFGR++PVH
Sbjct  1    MAEHEEKHEETLMEKITEKIHGHDSSSSSSSDDEDNKPSESP--IKSNVFRLFGREKPVH  58

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWI  406
            +VLGGGK AD+FLWRNKKIS G LG AT IW+
Sbjct  59   QVLGGGKPADIFLWRNKKISAGALGVATVIWV  90



>ref|XP_011003673.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=251

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 73/98 (74%), Gaps = 9/98 (9%)
 Frame = +2

Query  131  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAE + + E   ESLV+KI +KI  HDSSSSSDS+ E+ +       + + V RLFGR++
Sbjct  1    MAEHEGQRESAAESLVDKITEKISGHDSSSSSDSDNEKFDA------VKSKVFRLFGRER  54

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVHKVLGGGK ADVFLWRN KIS GVLGGAT +W+LFE
Sbjct  55   PVHKVLGGGKPADVFLWRNTKISAGVLGGATTVWVLFE  92



>ref|XP_009345612.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
 ref|XP_009345624.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=260

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 74/100 (74%), Gaps = 2/100 (2%)
 Frame = +2

Query  122  ESXMAEEDRKEEESLVEKIADKIH--RHdsssssdsexeeeekkkttssMDAXVRRLFGR  295
            E   A    ++E SL+EKI DKIH   HDSSSSS S+ + E+ +K T S+ A V R+FGR
Sbjct  4    EKEHAGSSVEDEPSLLEKIGDKIHVGDHDSSSSSSSDSDNEKSEKKTESVKAKVFRIFGR  63

Query  296  QQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            ++PVH VLGGGK ADVFLWRNKK+S GVL G TAIW+LFE
Sbjct  64   ERPVHHVLGGGKPADVFLWRNKKVSAGVLIGTTAIWVLFE  103



>ref|XP_002303615.1| reticulon family protein [Populus trichocarpa]
 gb|EEE78594.1| reticulon family protein [Populus trichocarpa]
Length=250

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 74/95 (78%), Gaps = 4/95 (4%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAE D+  E+S++E + +KIH HD SS SDS+  + + +  +  + + + R+FGR++PVH
Sbjct  1    MAEHDK--EDSVIESVMEKIHDHDKSSDSDSDHGKPKSESDS--LKSKIYRIFGREKPVH  56

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            KVLGGGK AD+FLWRNKKIS GVLGGATAIW+LFE
Sbjct  57   KVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFE  91



>gb|KHG20258.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=251

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 69/95 (73%), Gaps = 3/95 (3%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            M++ + K EESL+EKI++K   HD SSSS    +++  + +   M A V RLFGR++PVH
Sbjct  1    MSDHEDKHEESLLEKISEKNKGHDLSSSSSDSDDDKPSESS---MKAKVFRLFGRERPVH  57

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
             V GGGKQAD+FLWRNKKIS G LG AT IW+LFE
Sbjct  58   DVFGGGKQADIFLWRNKKISAGTLGVATVIWVLFE  92



>ref|NP_001130478.1| Seed maturation protein [Zea mays]
 ref|XP_008654247.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 ref|XP_008654248.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 gb|ACF78704.1| unknown [Zea mays]
 gb|ACF84299.1| unknown [Zea mays]
 gb|ACG48055.1| seed maturation protein [Zea mays]
 gb|ACR34851.1| unknown [Zea mays]
 gb|AFW85129.1| Seed maturation protein [Zea mays]
Length=253

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 66/94 (70%), Gaps = 3/94 (3%)
 Frame = +2

Query  143  DRKEEESLVEKIADKIH---RHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHK  313
            D KEE+S+++KI++K H      SS S D + +       T +M A + RLFGR++PVH 
Sbjct  3    DHKEEQSVMDKISEKFHGGDSSSSSDSDDEKKKGSSSASATEAMKAKIYRLFGRERPVHS  62

Query  314  VLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VLGGGK AD+ LWRNKKIS GVL GATAIW+LFE
Sbjct  63   VLGGGKPADLVLWRNKKISGGVLAGATAIWLLFE  96



>gb|AEZ00899.1| putative 24 kDa seed maturation protein [Elaeis guineensis]
Length=253

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 74/96 (77%), Gaps = 3/96 (3%)
 Frame = +2

Query  131  MAEEDRKEE-ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPV  307
            MAE++ +   ESL+EKI +K H  DSSSSSDS+ E+     ++  + + + RLFGR++PV
Sbjct  1    MAEKNEESVGESLMEKITEKFHHEDSSSSSDSDNEKSLPSSSS--VQSKIYRLFGREKPV  58

Query  308  HKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            H VLGGGK AD+FLWRNKKIS GVLGGATAIW+LFE
Sbjct  59   HTVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFE  94



>ref|NP_191715.2| reticulon-like protein B6 [Arabidopsis thaliana]
 sp|Q6DBN4.1|RTNLF_ARATH RecName: Full=Reticulon-like protein B6; Short=AtRTNLB6 [Arabidopsis 
thaliana]
 gb|AAT70439.1| At3g61560 [Arabidopsis thaliana]
 gb|AAV85700.1| At3g61560 [Arabidopsis thaliana]
 gb|AEE80222.1| reticulon-like protein B6 [Arabidopsis thaliana]
Length=253

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 71/98 (72%), Gaps = 6/98 (6%)
 Frame = +2

Query  131  MAEEDRK---EEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAEE  K   +EESL+EKIADKI       SS S   E EK ++ S++ A + RLFGR++
Sbjct  1    MAEELEKSMHKEESLMEKIADKI---HDHDSSSSSDSEHEKPESPSALKAKIYRLFGREK  57

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVHKVLGGG  ADVFLWR+KK+S  VLG ATAIW+LFE
Sbjct  58   PVHKVLGGGLPADVFLWRDKKLSASVLGVATAIWVLFE  95



>ref|XP_007040376.1| Reticulan like protein B3, putative isoform 1 [Theobroma cacao]
 gb|EOY24877.1| Reticulan like protein B3, putative isoform 1 [Theobroma cacao]
Length=269

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 71/92 (77%), Gaps = 2/92 (2%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAE + K EE+L+EKI +KIH HDSSSSS S+ E+ +  ++   + + V RLFGR++PVH
Sbjct  1    MAEHEEKHEETLMEKITEKIHGHDSSSSSSSDDEDNKPSESP--IKSNVFRLFGREKPVH  58

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWI  406
            +VLGGGK AD+FLWRNKKIS G LG AT IW+
Sbjct  59   QVLGGGKPADIFLWRNKKISAGALGVATVIWV  90



>ref|NP_001030913.1| reticulon-like protein B6 [Arabidopsis thaliana]
 emb|CAB71086.1| putative protein [Arabidopsis thaliana]
 gb|AEE80223.1| reticulon-like protein B6 [Arabidopsis thaliana]
Length=264

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 71/98 (72%), Gaps = 6/98 (6%)
 Frame = +2

Query  131  MAEEDRK---EEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAEE  K   +EESL+EKIADKI       SS S   E EK ++ S++ A + RLFGR++
Sbjct  1    MAEELEKSMHKEESLMEKIADKI---HDHDSSSSSDSEHEKPESPSALKAKIYRLFGREK  57

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVHKVLGGG  ADVFLWR+KK+S  VLG ATAIW+LFE
Sbjct  58   PVHKVLGGGLPADVFLWRDKKLSASVLGVATAIWVLFE  95



>emb|CDP12094.1| unnamed protein product [Coffea canephora]
Length=252

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 67/93 (72%), Gaps = 6/93 (6%)
 Frame = +2

Query  137  EEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKV  316
            EED K E SL+EK  DK+H      + DS     + +  TSS+ A V RLFGR++PVHK+
Sbjct  7    EEDAKAE-SLIEKTRDKVH-----GADDSSSSSSDDEGKTSSLKAKVFRLFGREKPVHKL  60

Query  317  LGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            LGGGK ADVF+WRNK+IS GVLG ATAIW+LFE
Sbjct  61   LGGGKPADVFMWRNKQISAGVLGVATAIWVLFE  93



>ref|XP_010916969.1| PREDICTED: reticulon-like protein B3 [Elaeis guineensis]
Length=310

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 75/96 (78%), Gaps = 3/96 (3%)
 Frame = +2

Query  131  MAEEDRKEE-ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPV  307
            MAE++ +   ESL+EKI +K H  DSSSSSDS+ E+ +   ++  + + + RLFGR++PV
Sbjct  1    MAEKNEESVGESLMEKITEKFHHEDSSSSSDSDNEKSQPSSSS--VQSKIYRLFGREKPV  58

Query  308  HKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            H VLGGGK AD+FLWRNKKIS GVLGGATAIW+LFE
Sbjct  59   HTVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFE  94



>gb|KDP28552.1| hypothetical protein JCGZ_14323 [Jatropha curcas]
Length=254

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeee-ekkkttssMDAXVRRLFGRQQPV  307
            MAE      ES++EKI++ IH HDSSSSS     +  +K  + SS+ A + RLFGR++PV
Sbjct  1    MAEHHENPIESVMEKISETIHAHDSSSSSSDSDSDSEKKPTSPSSVKAKIFRLFGRERPV  60

Query  308  HKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            H VLGGGK ADV LWRNKKIS  VLG ATAIW+LFE
Sbjct  61   HHVLGGGKPADVLLWRNKKISASVLGVATAIWVLFE  96



>ref|XP_002317731.1| hypothetical protein POPTR_0012s00980g [Populus trichocarpa]
 gb|EEE95951.1| hypothetical protein POPTR_0012s00980g [Populus trichocarpa]
Length=240

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 73/98 (74%), Gaps = 9/98 (9%)
 Frame = +2

Query  131  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAE + + E   ESLV+KI +KI  HDSSSSSDS+ E+ +       + + + RLFGR++
Sbjct  1    MAEHEGQRESAAESLVDKITEKISGHDSSSSSDSDNEKFDA------VKSKIFRLFGREK  54

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVHKVLGGGK ADVFLWRN KIS GVLGGAT +W+LFE
Sbjct  55   PVHKVLGGGKPADVFLWRNTKISAGVLGGATTVWVLFE  92



>ref|XP_007218268.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
 gb|EMJ19467.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
Length=339

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = +2

Query  122  ESXMAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            +S  A    + E+SL+EKI++KIH H+SSSSS S+ + E+ +   S     V R+FGR++
Sbjct  86   QSESAGSTVEHEKSLMEKISEKIHDHNSSSSSSSDSDNEKPESPKSE-KPKVFRIFGREK  144

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVH V GGGK ADVFLWRNKK+S GVLGGATA+W+LFE
Sbjct  145  PVHHVFGGGKPADVFLWRNKKVSAGVLGGATAVWVLFE  182



>ref|XP_009341126.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=260

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 74/100 (74%), Gaps = 2/100 (2%)
 Frame = +2

Query  122  ESXMAEEDRKEEESLVEKIADKIH--RHdsssssdsexeeeekkkttssMDAXVRRLFGR  295
            E   A    ++E SL+EKI DKIH   HDSSSSS S+ + E+ +K T S+ A V R+FGR
Sbjct  4    EKEHAGSPVEDEPSLLEKIGDKIHVGDHDSSSSSSSDSDNEKSEKKTESVKAKVFRIFGR  63

Query  296  QQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            ++PVH VLGGGK ADVFLWRNKK+S GVL G TAIW+LFE
Sbjct  64   ERPVHHVLGGGKPADVFLWRNKKVSAGVLIGTTAIWVLFE  103



>ref|XP_002320163.1| reticulon family protein [Populus trichocarpa]
 gb|ABK92738.1| unknown [Populus trichocarpa]
 gb|EEE98478.1| reticulon family protein [Populus trichocarpa]
Length=251

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 70/95 (74%), Gaps = 2/95 (2%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAE+     ES++ KI++KIH H+SSSS      E++   + S  D  + RLFGR++PVH
Sbjct  1    MAEQSENPIESVMGKISEKIH-HESSSSDSESDSEKKSYPSESVKD-KIWRLFGREKPVH  58

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            +VLGGGK ADVFLWRNKK+S GVLG ATAIW+LFE
Sbjct  59   RVLGGGKPADVFLWRNKKVSAGVLGFATAIWVLFE  93



>gb|KHN40449.1| Reticulon-like protein B5 [Glycine soja]
Length=259

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 74/101 (73%), Gaps = 6/101 (6%)
 Frame = +2

Query  131  MAEEDRKE------EESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFG  292
            MAEE  +       +ESL++KI +K+H HDSSSSS S+ + + +K  TSS+   V RLFG
Sbjct  1    MAEEPERTVTTGAADESLLDKITEKLHGHDSSSSSSSDSDSDSEKTVTSSVKDKVFRLFG  60

Query  293  RQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            R++PVH V G GK ADV LWRNKKIS G+LGGATA+W+LFE
Sbjct  61   RERPVHSVFGAGKPADVLLWRNKKISAGMLGGATAVWVLFE  101



>ref|XP_009793558.1| PREDICTED: reticulon-like protein B4 [Nicotiana sylvestris]
Length=268

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = +2

Query  122  ESXMAEEDRKEEESLVEKIADKIH-------RHdsssssdsexeeeekkkttssMDAXVR  280
            E    E+  + EES++EKI + +H          SSS SD + +       TSS  + VR
Sbjct  5    EERKVEKSDEHEESVMEKITETLHLSNNNHHSSSSSSDSDDDKKTTSSPPVTSSFKSKVR  64

Query  281  RLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            RLFGR++PVHKV GGGK ADVFLWRNKKIS G LGGATAIW+LFE
Sbjct  65   RLFGRERPVHKVFGGGKPADVFLWRNKKISAGFLGGATAIWVLFE  109



>ref|XP_010436110.1| PREDICTED: reticulon-like protein B4 [Camelina sativa]
Length=257

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +2

Query  140  EDRKEEESLVEKIADKIHRH-dsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKV  316
            ED K EES++EKI +KIH H DSSS SDS+ +++    ++SS  + + RLFGR++PVHKV
Sbjct  3    EDHKHEESILEKIVEKIHGHGDSSSLSDSDDDKKSTSSSSSSFKSKIYRLFGREKPVHKV  62

Query  317  LGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            LGGGK AD+FLWRNKK+S GV G  TA W+LFE
Sbjct  63   LGGGKPADIFLWRNKKVSGGVFGAITASWVLFE  95



>ref|XP_010447719.1| PREDICTED: reticulon-like protein B4 [Camelina sativa]
Length=257

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +2

Query  140  EDRKEEESLVEKIADKIHRH-dsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKV  316
            ED K EES++EKI +KIH H DSSS SDS+ +++    ++SS  + + RLFGR++PVHKV
Sbjct  3    EDHKHEESILEKIVEKIHGHGDSSSLSDSDDDKKSTSSSSSSFKSKIYRLFGREKPVHKV  62

Query  317  LGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            LGGGK AD+FLWRNKK+S GV G  TA W+LFE
Sbjct  63   LGGGKPADIFLWRNKKVSGGVFGAITASWVLFE  95



>ref|XP_010441324.1| PREDICTED: reticulon-like protein B4 [Camelina sativa]
Length=257

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +2

Query  140  EDRKEEESLVEKIADKIHRH-dsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKV  316
            ED K EES++EKI +KIH H DSSS SDS+ +++    ++SS  + + RLFGR++PVHKV
Sbjct  3    EDHKHEESILEKIVEKIHGHGDSSSLSDSDDDKKSTSSSSSSFKSKIYRLFGREKPVHKV  62

Query  317  LGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            LGGGK AD+FLWRNKK+S GV G  TA W+LFE
Sbjct  63   LGGGKPADIFLWRNKKVSGGVFGAITASWVLFE  95



>ref|XP_008232963.1| PREDICTED: reticulon-like protein B6 [Prunus mume]
Length=257

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = +2

Query  122  ESXMAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            +S  A    + ++SL+EKI++KIH H+SSSSS S+ + E+ +   S     V R+FGR++
Sbjct  4    QSESAGSTVEHDKSLMEKISEKIHDHESSSSSSSDSDNEKPESPKSE-KPKVFRIFGREK  62

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVH V GGGK ADVFLWRNKK+S GVLGGATA+W+LFE
Sbjct  63   PVHHVFGGGKPADVFLWRNKKVSAGVLGGATAVWVLFE  100



>ref|XP_011047748.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=254

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 62/96 (65%), Gaps = 2/96 (2%)
 Frame = +2

Query  131  MAE-EDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPV  307
            MAE E  +E E +VE + DKI          S    +       ++ + + RLFGR++PV
Sbjct  1    MAEHEGEREREPVVESMVDKI-TEKIHDHHSSSSSSDSDDDKLDAVKSKIFRLFGREKPV  59

Query  308  HKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            HKVLGGGK ADVFLWRNKKIS GVLGGATA+W+ FE
Sbjct  60   HKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFE  95



>gb|KHG15548.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=248

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 66/95 (69%), Gaps = 6/95 (6%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            M E + K E SL+EK+A+KIH HDSSS SD++   E        + A V RLFGR++ VH
Sbjct  1    MGEHEEKHEGSLMEKLAEKIHGHDSSSDSDNDKPSESS------IKAKVFRLFGRERSVH  54

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
             V GGGK AD FLWRNKKIS GVLG AT IW+LFE
Sbjct  55   HVFGGGKSADTFLWRNKKISAGVLGVATVIWVLFE  89



>ref|XP_010251601.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
Length=254

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  263  MDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            + A V RLFGRQ+PVHKV GGGK ADVFLWRNKKIS GVLGGATA W+LFE
Sbjct  45   VTAAVYRLFGRQKPVHKVFGGGKPADVFLWRNKKISAGVLGGATATWVLFE  95



>ref|XP_004245560.1| PREDICTED: reticulon-like protein B4 [Solanum lycopersicum]
Length=270

 Score = 90.1 bits (222),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 68/102 (67%), Gaps = 10/102 (10%)
 Frame = +2

Query  140  EDRKEEESLVEKIADKIH----------RHdsssssdsexeeeekkkttssMDAXVRRLF  289
            E  + +ESL++KI++K+H             SS S D + +       TSS  + VRRLF
Sbjct  10   EKEEHDESLMDKISEKLHFSNHSSSPAPASSSSDSDDEKKKPTSPAPATSSFGSKVRRLF  69

Query  290  GRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            GR++PVHKV GGGK ADVFLWRNKKIS G LGGATAIW+LFE
Sbjct  70   GRERPVHKVFGGGKPADVFLWRNKKISAGFLGGATAIWVLFE  111



>gb|EAY75742.1| hypothetical protein OsI_03655 [Oryza sativa Indica Group]
Length=253

 Score = 90.1 bits (222),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 75/97 (77%), Gaps = 4/97 (4%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkt--tssMDAXVRRLFGRQQP  304
            MAE   KEE+S++EK+++K+H   SSSSSDS+ +++    +   ++M A + RLFGR++P
Sbjct  1    MAE--HKEEQSVMEKLSEKLHGDSSSSSSDSDDDKKGSSSSSSAAAMKAKIYRLFGRERP  58

Query  305  VHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VH VLGGGK AD+ LWRNKKIS GVL GATAIW+LFE
Sbjct  59   VHSVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFE  95



>gb|ABK94480.1| unknown [Populus trichocarpa]
Length=251

 Score = 90.1 bits (222),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 70/95 (74%), Gaps = 2/95 (2%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAE+     ES++ KI++KIH H+SSSS      E++   + S  D  + RLFGR++PVH
Sbjct  1    MAEQSEDPIESVMGKISEKIH-HESSSSDSESDSEKKSYPSESVKD-KIWRLFGREKPVH  58

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            +VLGGGK ADVFLWRNKK+S GVLG ATAIW+LFE
Sbjct  59   RVLGGGKPADVFLWRNKKVSAGVLGFATAIWVLFE  93



>ref|NP_001240231.1| uncharacterized protein LOC100778096 [Glycine max]
 gb|ACU20901.1| unknown [Glycine max]
Length=259

 Score = 90.1 bits (222),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 73/101 (72%), Gaps = 6/101 (6%)
 Frame = +2

Query  131  MAEEDRKE------EESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFG  292
            MAEE          +ESL++KI +K+H HDSSSSS S+ + + +K  TSS+   V RLFG
Sbjct  1    MAEEPESTVTNGAADESLLDKITEKLHGHDSSSSSSSDSDSDSEKTVTSSVKDKVFRLFG  60

Query  293  RQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            R++PVH V G GK ADV LWRNKKIS G+LGGATA+W+LFE
Sbjct  61   RERPVHSVFGAGKPADVLLWRNKKISAGMLGGATAVWVLFE  101



>emb|CDY52012.1| BnaC06g42920D [Brassica napus]
Length=254

 Score = 90.1 bits (222),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 71/98 (72%), Gaps = 5/98 (5%)
 Frame = +2

Query  131  MAEEDRKE---EESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAEE  K    EESL+EKIA+KIH      SS S   + EK ++ S++ A + RLFGR++
Sbjct  1    MAEESEKPVHAEESLMEKIAEKIHD--HHDSSSSSDSDHEKPESPSALKAKIYRLFGREK  58

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVHKVLGGG  ADVFLWR+KK+S  VLG ATAIW+LFE
Sbjct  59   PVHKVLGGGLPADVFLWRDKKLSAAVLGVATAIWVLFE  96



>ref|XP_009104316.1| PREDICTED: reticulon-like protein B6 [Brassica rapa]
 emb|CDY53913.1| BnaA07g38210D [Brassica napus]
Length=254

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 71/98 (72%), Gaps = 5/98 (5%)
 Frame = +2

Query  131  MAEEDRKE---EESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAEE  K    EESL+EKIA+KIH      SS S   + EK ++ S++ A + RLFGR++
Sbjct  1    MAEESEKPVHTEESLMEKIAEKIHD--HHDSSSSSDSDHEKPESQSALKAKIYRLFGREK  58

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVHKVLGGG  ADVFLWR+KK+S  VLG ATAIW+LFE
Sbjct  59   PVHKVLGGGLPADVFLWRDKKLSAAVLGVATAIWVLFE  96



>ref|XP_002887921.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64180.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=254

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 67/95 (71%), Gaps = 3/95 (3%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAEE  K EES++EKIA+KIH       S S   + +  K ++S+   + RLFGR+QP+H
Sbjct  1    MAEE-HKHEESIMEKIAEKIHG--HDDGSSSSSSDSDDDKKSASLKTKIYRLFGREQPLH  57

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE
Sbjct  58   KVFGGGKPADIFLWRNKKVSGGVLGAATVSWILFE  92



>gb|KCW46474.1| hypothetical protein EUGRSUZ_K00300 [Eucalyptus grandis]
Length=218

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 64/87 (74%), Gaps = 0/87 (0%)
 Frame = +2

Query  155  EESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQ  334
            E SL+EK  +KIH  D  S+S S   +++K     S  + V RLFGR++PVHKVLGGGK 
Sbjct  10   EPSLMEKNTEKIHVPDPPSASSSSDSDDDKPSVVDSAKSKVYRLFGREKPVHKVLGGGKP  69

Query  335  ADVFLWRNKKISXGVLGGATAIWILFE  415
            AD+FLWR+KK+S GVLG ATAIWILFE
Sbjct  70   ADIFLWRDKKVSAGVLGVATAIWILFE  96



>ref|XP_011093062.1| PREDICTED: reticulon-like protein B1 [Sesamum indicum]
Length=257

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 76/99 (77%), Gaps = 4/99 (4%)
 Frame = +2

Query  131  MAEEDRKEE---ESLVEKIADKIHR-HdsssssdsexeeeekkkttssMDAXVRRLFGRQ  298
            MAE++   +   +SLV++I++KIH   D+SSSSDS+ + +E     +S+ A + RLFGR+
Sbjct  1    MAEQEEISDPRTDSLVDRISEKIHGGDDTSSSSDSDSQVKEAASPPASVKAKIYRLFGRE  60

Query  299  QPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            +PVHKV GGGK AD+FLWRNKKIS  VLGGATA+W+LFE
Sbjct  61   KPVHKVFGGGKPADIFLWRNKKISATVLGGATAVWVLFE  99



>ref|XP_006343915.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=270

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 67/98 (68%), Gaps = 10/98 (10%)
 Frame = +2

Query  152  EEESLVEKIADKIH----------RHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            ++ESL++KI++K+H             SS S D + +       TSS  + VRRLFGR++
Sbjct  14   QDESLMDKISEKLHFSNHSSSPAPASSSSDSDDEKKKPTSPAPETSSFGSKVRRLFGRER  73

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVHKV GGGK ADVFLWRNKKIS G LGGATAIW+LFE
Sbjct  74   PVHKVFGGGKPADVFLWRNKKISAGFLGGATAIWVLFE  111



>ref|XP_007139766.1| hypothetical protein PHAVU_008G057300g [Phaseolus vulgaris]
 gb|ESW11760.1| hypothetical protein PHAVU_008G057300g [Phaseolus vulgaris]
Length=205

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 71/102 (70%), Gaps = 11/102 (11%)
 Frame = +2

Query  131  MAEEDRKE-------EESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLF  289
            MAEE           +ESL++KI++K+H HDSSSSSDS+ E+         +   V RLF
Sbjct  1    MAEEPESTVTTAAAADESLLDKISEKLHGHDSSSSSDSDSEKTVTSS----VKDKVFRLF  56

Query  290  GRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            GR++PVH VLG GK ADV LWRNKKIS GVLGGATA+W+LFE
Sbjct  57   GRERPVHSVLGAGKPADVLLWRNKKISAGVLGGATAVWVLFE  98



>ref|XP_009416410.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = +2

Query  155  EESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQ  334
            EE+L+E+I +KIH    SSSSDS+ E+ +      ++ + +  LFGR++PVH++LGGGK 
Sbjct  6    EETLIEQINEKIHGDGDSSSSDSDDEKSKASVVAEAVKSKIYHLFGREKPVHQILGGGKP  65

Query  335  ADVFLWRNKKISXGVLGGATAIWILFE  415
            ADVFLW+NKK S  VLGGATAIWILFE
Sbjct  66   ADVFLWKNKKASAVVLGGATAIWILFE  92



>gb|EYU23406.1| hypothetical protein MIMGU_mgv1a012325mg [Erythranthe guttata]
Length=254

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 71/93 (76%), Gaps = 3/93 (3%)
 Frame = +2

Query  137  EEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKV  316
            +E+ K  ES +EKIA+KIH H SSSSS S   ++EK  +   + + V RLFGR++PVHKV
Sbjct  6    KEEEKHGESFMEKIAEKIHGHGSSSSSSSSDSDDEKTAS---LKSKVYRLFGREKPVHKV  62

Query  317  LGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            LGGG+ AD+ LW++KK+S GVLGG TAIW+LF+
Sbjct  63   LGGGQPADLLLWKDKKVSGGVLGGVTAIWVLFD  95



>emb|CDP08746.1| unnamed protein product [Coffea canephora]
Length=263

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 69/100 (69%), Gaps = 6/100 (6%)
 Frame = +2

Query  134  AEEDRKEEESLVEKIADKIH------RHdsssssdsexeeeekkkttssMDAXVRRLFGR  295
            AE+  K+EE+L+EK A+K+H         SS S   +  + +   + +S+   + RLFGR
Sbjct  5    AEDLDKKEETLIEKPAEKVHGDHDSSSSASSESDSEKKVKSKPASSPTSVKDKIFRLFGR  64

Query  296  QQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            ++PVH+V GGGK ADVFLWRNK+IS  VLGGATA+W+LFE
Sbjct  65   EKPVHQVFGGGKPADVFLWRNKRISAAVLGGATAVWVLFE  104



>ref|XP_006339640.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=265

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 64/102 (63%), Gaps = 8/102 (8%)
 Frame = +2

Query  134  AEEDRKEEESLVEKIADKIH--------RHdsssssdsexeeeekkkttssMDAXVRRLF  289
            AE    + ESL+EKIADK H          D+ +       E E +    ++   V RLF
Sbjct  5    AENSDPKGESLMEKIADKFHGDDSSSSSESDTETKKPVVKSEVEAEPEPETLKNKVWRLF  64

Query  290  GRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            GR++PVHKV GGGK ADVFLWRNKKIS  VLGGATAIW+LFE
Sbjct  65   GREKPVHKVFGGGKPADVFLWRNKKISGTVLGGATAIWVLFE  106



>ref|XP_009137373.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=268

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +2

Query  152  EEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGK  331
            E ESL++KI++K+H    SSSSD + ++++  ++ SSM + V RLFGR++PVHKVLGGGK
Sbjct  22   ERESLMDKISEKLHHGGDSSSSDEDEKKKKSSESPSSMKSKVYRLFGREKPVHKVLGGGK  81

Query  332  QADVFLWRNKKISXGVLGGATAIWILFE  415
             AD+F+W+NKK+S GVLGGATA W+LFE
Sbjct  82   PADIFMWKNKKMSGGVLGGATAAWVLFE  109



>dbj|BAJ89699.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=257

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = +2

Query  152  EEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGK  331
            +EESL++KI +K H   SSSSS  +        ++SS+ A + RLFGR++PVH VLGGGK
Sbjct  11   KEESLMDKITEKFHGSSSSSSSSDDEAGRAAGSSSSSVKAKIYRLFGREKPVHSVLGGGK  70

Query  332  QADVFLWRNKKISXGVLGGATAIWILFE  415
             AD+ LWRNKKIS GVL GATAIW+LFE
Sbjct  71   PADLLLWRNKKISGGVLAGATAIWLLFE  98



>ref|XP_010035177.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW46473.1| hypothetical protein EUGRSUZ_K00300 [Eucalyptus grandis]
Length=255

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 64/87 (74%), Gaps = 0/87 (0%)
 Frame = +2

Query  155  EESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQ  334
            E SL+EK  +KIH  D  S+S S   +++K     S  + V RLFGR++PVHKVLGGGK 
Sbjct  10   EPSLMEKNTEKIHVPDPPSASSSSDSDDDKPSVVDSAKSKVYRLFGREKPVHKVLGGGKP  69

Query  335  ADVFLWRNKKISXGVLGGATAIWILFE  415
            AD+FLWR+KK+S GVLG ATAIWILFE
Sbjct  70   ADIFLWRDKKVSAGVLGVATAIWILFE  96



>ref|XP_007139767.1| hypothetical protein PHAVU_008G057300g [Phaseolus vulgaris]
 gb|ESW11761.1| hypothetical protein PHAVU_008G057300g [Phaseolus vulgaris]
Length=256

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 71/102 (70%), Gaps = 11/102 (11%)
 Frame = +2

Query  131  MAEEDRKE-------EESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLF  289
            MAEE           +ESL++KI++K+H HDSSSSSDS+ E+         +   V RLF
Sbjct  1    MAEEPESTVTTAAAADESLLDKISEKLHGHDSSSSSDSDSEKTVTSS----VKDKVFRLF  56

Query  290  GRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            GR++PVH VLG GK ADV LWRNKKIS GVLGGATA+W+LFE
Sbjct  57   GRERPVHSVLGAGKPADVLLWRNKKISAGVLGGATAVWVLFE  98



>ref|XP_009626481.1| PREDICTED: reticulon-like protein B5 isoform X2 [Nicotiana tomentosiformis]
Length=192

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 67/94 (71%), Gaps = 3/94 (3%)
 Frame = +2

Query  134  AEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHK  313
            A E     ES+++KI DK+H     SSS    +E+EK     ++ A + RLFGR++PVHK
Sbjct  5    AGEHESVVESVMDKINDKLHH---DSSSSDSEDEKEKISPVEAVKAKIYRLFGRERPVHK  61

Query  314  VLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VLGGGK AD+FLWR+KKI+ GVLG ATAIW+LFE
Sbjct  62   VLGGGKPADIFLWRDKKITAGVLGFATAIWVLFE  95



>ref|XP_003568063.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=244

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 67/95 (71%), Gaps = 9/95 (9%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAE    +EES+++KI++K+H         S   ++E     +++ A + RLFGR++PVH
Sbjct  1    MAEH---KEESVMDKISEKLHG------GSSSGSDDESSSAAAAVKAKIYRLFGREKPVH  51

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
             VLGGGK AD+FLWRNKKIS GVL GATAIW+LFE
Sbjct  52   SVLGGGKPADLFLWRNKKISGGVLAGATAIWLLFE  86



>ref|XP_006847055.1| hypothetical protein AMTR_s00017p00194840 [Amborella trichopoda]
 gb|ERN08636.1| hypothetical protein AMTR_s00017p00194840 [Amborella trichopoda]
Length=291

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 65/108 (60%), Gaps = 6/108 (6%)
 Frame = +2

Query  92   GELRFEFG*VESXMAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDA  271
             E+   FG V +   E+     ES+++KI +  H        D      +     SS+ +
Sbjct  32   SEVALGFGAVMTEHKEDSGSVVESVMDKITETFHH------DDGSSSSSDSDDEKSSISS  85

Query  272  XVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
             + RLFGRQ+PVHKVLGGGK ADVFLWRNKKIS  VLGGAT IWILFE
Sbjct  86   KINRLFGRQKPVHKVLGGGKPADVFLWRNKKISASVLGGATLIWILFE  133



>ref|XP_002509881.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51268.1| conserved hypothetical protein [Ricinus communis]
Length=260

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%), Gaps = 6/101 (6%)
 Frame = +2

Query  131  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsex---eeeekkkttssMDAXVRRLFG  292
            MA+E   EE   ESL++KI++KIH HDSSSSSDS+     + +   + SS+ + + RLFG
Sbjct  1    MADEHHHEESKGESLMDKISEKIHGHDSSSSSDSDNDEKLKPKSPSSPSSIKSKIYRLFG  60

Query  293  RQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            R++PVH VLGGGK AD+FLWRNKK+S GVLG ATA+W+LFE
Sbjct  61   REKPVHHVLGGGKPADIFLWRNKKVSAGVLGFATAVWVLFE  101



>ref|XP_009395750.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=253

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 58/89 (65%), Gaps = 2/89 (2%)
 Frame = +2

Query  155  EESLVEKIADKIH-RHdsssssdsexeeee-kkkttssMDAXVRRLFGRQQPVHKVLGGG  328
            EESL+EKI +K H RH SS     + +          ++ A + RLFGR++PVHKVLGGG
Sbjct  6    EESLLEKITEKFHGRHSSSVVDSDDEKSSRGPSAAAEAVKAKIYRLFGREKPVHKVLGGG  65

Query  329  KQADVFLWRNKKISXGVLGGATAIWILFE  415
            K ADVFLWRNKK+S    G  TAIW+ FE
Sbjct  66   KPADVFLWRNKKVSASTFGAVTAIWVFFE  94



>ref|XP_006842617.1| hypothetical protein AMTR_s00077p00178230 [Amborella trichopoda]
 gb|ERN04292.1| hypothetical protein AMTR_s00077p00178230 [Amborella trichopoda]
Length=257

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +2

Query  134  AEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHK  313
             +E     ES++EKI +KIH  D SSSS S  + E +K + S+  A V RLFGRQ+PVH 
Sbjct  5    TDESGSHAESIMEKIKEKIHGEDDSSSSSSSSDSETEKPSLSAAKAKVNRLFGRQKPVHS  64

Query  314  VLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VLGGGK ADV LWRNK+IS GVL G T IW+LFE
Sbjct  65   VLGGGKPADVLLWRNKQISAGVLVGVTVIWLLFE  98



>gb|KFK33000.1| hypothetical protein AALP_AA6G316900 [Arabis alpina]
Length=258

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 69/94 (73%), Gaps = 2/94 (2%)
 Frame = +2

Query  140  EDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAX--VRRLFGRQQPVHK  313
            ED K EESL+EKIA+KIH H  SSSS    ++++   ++SS      + RLFGR++PVHK
Sbjct  3    EDHKHEESLLEKIAEKIHGHGDSSSSHDSDDDKKSTSSSSSSSFKSKIYRLFGREKPVHK  62

Query  314  VLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VLGGGK AD+FLWRNKK+S GV G  TA WI+FE
Sbjct  63   VLGGGKPADIFLWRNKKVSGGVFGAVTACWIVFE  96



>ref|XP_009349323.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=259

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 74/103 (72%), Gaps = 9/103 (9%)
 Frame = +2

Query  131  MAEEDR-----KEEESLVEKIADKIH---RHdsssssdsexeeeekkkttssMDAXVRRL  286
            MA+E       + E SL+EKI +KIH   RH SSSSS    +E+ +KK  S + A V R+
Sbjct  1    MADEKNAGSPVEHEPSLLEKIGEKIHGGDRHSSSSSSSDSDDEKSEKKAES-VKAKVFRI  59

Query  287  FGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            FGR++PVH VLGGGK ADVFLWRNKK+S GVLGGAT +W+LFE
Sbjct  60   FGREKPVHHVLGGGKSADVFLWRNKKVSGGVLGGATVVWVLFE  102



>ref|XP_006402470.1| hypothetical protein EUTSA_v10006190mg [Eutrema salsugineum]
 gb|ESQ43923.1| hypothetical protein EUTSA_v10006190mg [Eutrema salsugineum]
Length=253

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 67/93 (72%), Gaps = 3/93 (3%)
 Frame = +2

Query  137  EEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKV  316
            E+    EESL+EKIA+KIH      SS S   E EK  + S++ A + RLFGR++PVHKV
Sbjct  6    EKSVPTEESLIEKIAEKIHD---HDSSSSSESEHEKPDSPSALKAKIYRLFGREKPVHKV  62

Query  317  LGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            LGGG  ADVFLWR+KK+S  VLG ATAIW+LFE
Sbjct  63   LGGGLPADVFLWRDKKLSAAVLGVATAIWVLFE  95



>ref|XP_009338786.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=259

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 74/103 (72%), Gaps = 9/103 (9%)
 Frame = +2

Query  131  MAEEDR-----KEEESLVEKIADKIH---RHdsssssdsexeeeekkkttssMDAXVRRL  286
            MA+E       + E SL+EKI +KIH   RH SSSSS    +E+ +KK  S + A V R+
Sbjct  1    MADEKNAGSPVEHEPSLLEKIGEKIHGGDRHSSSSSSSDSDDEKSEKKAES-VKAKVFRI  59

Query  287  FGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            FGR++PVH VLGGGK ADVFLWRNKK+S GVLGGAT +W+LFE
Sbjct  60   FGREKPVHHVLGGGKSADVFLWRNKKVSGGVLGGATVVWVLFE  102



>ref|XP_004229935.1| PREDICTED: reticulon-like protein B1 [Solanum lycopersicum]
Length=263

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 63/92 (68%), Gaps = 6/92 (7%)
 Frame = +2

Query  158  ESLVEKIADKIH------RHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVL  319
            ESL+EKIADK H        +S + +     + E +  T ++   V RLFGR++PVHKV 
Sbjct  13   ESLLEKIADKFHGDDSSSSSESDTETKKPAVKSEVEPETETLKNKVWRLFGREKPVHKVF  72

Query  320  GGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            GGGK ADVFLWRNKKIS  V+GGATAIW+LFE
Sbjct  73   GGGKPADVFLWRNKKISATVIGGATAIWVLFE  104



>ref|XP_010509305.1| PREDICTED: reticulon-like protein B1 [Camelina sativa]
Length=275

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 75/108 (69%), Gaps = 10/108 (9%)
 Frame = +2

Query  122  ESXMAEE---DRKEEESLVEKIADKIHR-------HdsssssdsexeeeekkkttssMDA  271
            ES +A E   +  E ESL++KI++KIH          SS   D + ++ +K  + SSM +
Sbjct  9    ESVIAPEPAVEVVERESLMDKISEKIHHGGDSSSSSSSSDDEDDKKKKTKKPSSPSSMQS  68

Query  272  XVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
             V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGATA W+LFE
Sbjct  69   KVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFE  116



>ref|XP_009112802.1| PREDICTED: reticulon-like protein B3 [Brassica rapa]
Length=250

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 66/95 (69%), Gaps = 6/95 (6%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAEE  K EES++EKIA+KIH         S   + + +K  SS+   + RLFGR++PVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHG-----HDGSSSSDSDDEKKASSIKTKIFRLFGREKPVH  54

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE
Sbjct  55   KVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFE  89



>ref|XP_006284372.1| hypothetical protein CARUB_v10005543mg [Capsella rubella]
 gb|EOA17270.1| hypothetical protein CARUB_v10005543mg [Capsella rubella]
Length=257

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +2

Query  140  EDRKEEESLVEKIADKIHRH-dsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKV  316
            ED K EES++EKI +KIH + DSSS SDS+ +++    ++SS  + + RLFGR++PVHKV
Sbjct  3    EDHKHEESILEKIVEKIHGNGDSSSLSDSDDDKKSTSSSSSSFKSKIYRLFGREKPVHKV  62

Query  317  LGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            LGGGK AD+FLWRNKK+S GV G  TA W+LFE
Sbjct  63   LGGGKPADIFLWRNKKVSGGVFGAITASWVLFE  95



>ref|XP_010439153.1| PREDICTED: reticulon-like protein B1 isoform X2 [Camelina sativa]
Length=199

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 75/109 (69%), Gaps = 11/109 (10%)
 Frame = +2

Query  122  ESXMAEE---DRKEEESLVEKIADKIHR--------HdsssssdsexeeeekkkttssMD  268
            ES +A E   +  E ESL++KI++KIH           S    D + ++++K  + SSM 
Sbjct  9    ESVIAPEPAVEVVERESLMDKISEKIHHGGDSSSSSSSSDDEDDKKKKKKKKPSSPSSMQ  68

Query  269  AXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            + V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGATA W+LFE
Sbjct  69   SKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFE  117



>gb|AFW78798.1| hypothetical protein ZEAMMB73_677867 [Zea mays]
Length=128

 Score = 85.5 bits (210),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = +2

Query  131  MAEEDRKEE-ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPV  307
            MAE+ ++E   ++++KI+DK+H      SS S   ++E+   T+++ A + R+FGR++PV
Sbjct  1    MAEQHKEESGVTVLDKISDKLHG-RGGGSSSSSDSDDERSSATAAVKAKIYRIFGREKPV  59

Query  308  HKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            H VLGGGK AD+FLWRNK+IS GVL GATA W+LFE
Sbjct  60   HSVLGGGKPADLFLWRNKRISGGVLAGATAFWLLFE  95



>emb|CDY38194.1| BnaA09g11950D [Brassica napus]
Length=250

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 66/95 (69%), Gaps = 6/95 (6%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAEE  K EES++EKIA+KIH         S   + + +K  SS+   + RLFGR++PVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHG-----HDGSSSSDSDDEKKASSIKTKIFRLFGREKPVH  54

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE
Sbjct  55   KVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFE  89



>ref|XP_010433883.1| PREDICTED: reticulon-like protein B1 [Camelina sativa]
Length=276

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 74/109 (68%), Gaps = 11/109 (10%)
 Frame = +2

Query  122  ESXMAEE---DRKEEESLVEKIADKIHR--------HdsssssdsexeeeekkkttssMD  268
            ES +A E   +  E ESL++KI++KIH           S    D + ++ +K  + SSM 
Sbjct  9    ESVIAPEPAVEVVERESLMDKISEKIHHGGDSSSSSSSSDDEDDKKKKKTKKPSSPSSMQ  68

Query  269  AXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            + V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGATA W+LFE
Sbjct  69   SKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFE  117



>ref|XP_010439152.1| PREDICTED: reticulon-like protein B1 isoform X1 [Camelina sativa]
Length=276

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 75/109 (69%), Gaps = 11/109 (10%)
 Frame = +2

Query  122  ESXMAEE---DRKEEESLVEKIADKIHR--------HdsssssdsexeeeekkkttssMD  268
            ES +A E   +  E ESL++KI++KIH           S    D + ++++K  + SSM 
Sbjct  9    ESVIAPEPAVEVVERESLMDKISEKIHHGGDSSSSSSSSDDEDDKKKKKKKKPSSPSSMQ  68

Query  269  AXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            + V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGATA W+LFE
Sbjct  69   SKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFE  117



>ref|XP_009765582.1| PREDICTED: reticulon-like protein B2 [Nicotiana sylvestris]
Length=254

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 67/94 (71%), Gaps = 3/94 (3%)
 Frame = +2

Query  134  AEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHK  313
            A E     ES+++KI DK+H     SSS    +E+EK     ++ A + RLFGR++PVHK
Sbjct  5    AGEHESVVESVMDKINDKLHH---DSSSSDSEDEKEKISPVEAVKAKIYRLFGREKPVHK  61

Query  314  VLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VLGGGK ADVFLWR+KKI+ GVLG ATAIW+LFE
Sbjct  62   VLGGGKPADVFLWRDKKITAGVLGFATAIWVLFE  95



>ref|XP_003528823.2| PREDICTED: reticulon-like protein B1-like [Glycine max]
Length=314

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = +2

Query  158  ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQA  337
            ESL++KIA+KIH HD SSSS     ++++  +   +   V RLFGR++PVH VLGGGK A
Sbjct  73   ESLLDKIAEKIHGHDDSSSSSDSDSDKKESSS---IKEKVFRLFGREKPVHSVLGGGKPA  129

Query  338  DVFLWRNKKISXGVLGGATAIWILFE  415
            DV LWRNKKIS GVLG ATAIWI FE
Sbjct  130  DVLLWRNKKISAGVLGVATAIWIFFE  155



>ref|XP_003565836.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=286

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +2

Query  281  RLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            RLFGR+QP+HKVLGGGK ADVF+WRNK IS GVLGGATAIWILFE
Sbjct  84   RLFGREQPIHKVLGGGKPADVFMWRNKNISAGVLGGATAIWILFE  128



>gb|EMS62606.1| Reticulon-like protein B1 [Triticum urartu]
Length=248

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 72/95 (76%), Gaps = 6/95 (6%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAE   ++EES+++KI +K H     SSS S  ++E +  ++SS+ A + RLFGR++PVH
Sbjct  1    MAE---RKEESVMDKITEKFH---GGSSSSSSSDDEGRSGSSSSVKAKIYRLFGREKPVH  54

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
             VLGGGK AD+FLWRNKKIS GVL GATAIW+LFE
Sbjct  55   SVLGGGKPADLFLWRNKKISGGVLAGATAIWLLFE  89



>gb|AFW80460.1| hypothetical protein ZEAMMB73_353444 [Zea mays]
Length=154

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  275  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            V RLFGR+QP+HK LGGGK ADVFLWRN+ IS GVLGGATAIWILFE
Sbjct  75   VFRLFGREQPIHKALGGGKPADVFLWRNRNISAGVLGGATAIWILFE  121



>ref|XP_010924771.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=252

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 71/98 (72%), Gaps = 8/98 (8%)
 Frame = +2

Query  131  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAE   KEE   ES++EKI +K H      SS S+ + E+ K ++S + + + RLFGR++
Sbjct  1    MAE--NKEESVGESVMEKIMEKFHD---DDSSSSDSDNEKSKPSSSPVKSQIYRLFGREK  55

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVH VLGGG  ADVFLWRNKKIS GVLGGATAIW+LFE
Sbjct  56   PVHTVLGGGTPADVFLWRNKKISAGVLGGATAIWVLFE  93



>ref|XP_008810936.1| PREDICTED: reticulon-like protein B5 [Phoenix dactylifera]
Length=253

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  263  MDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            + A + RLFGR++PVH VLGGGK AD+FLWRNKKIS GVLG ATAIW+LFE
Sbjct  44   VKAKIYRLFGREKPVHTVLGGGKPADIFLWRNKKISAGVLGVATAIWVLFE  94



>ref|NP_001239653.1| uncharacterized protein LOC100793862 [Glycine max]
 gb|ACU21118.1| unknown [Glycine max]
Length=257

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 71/101 (70%), Gaps = 8/101 (8%)
 Frame = +2

Query  131  MAEEDRK------EEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFG  292
            MAEE          +ESL++KI +K+H HDSSSSS S+ + E+   ++  +   V RLFG
Sbjct  1    MAEEPESTVTTGAPDESLLDKITEKLHGHDSSSSSSSDSDSEKTVTSS--VKDRVFRLFG  58

Query  293  RQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            R++PVH V G GK ADV LWRNKKIS GVLGGATA+W+LFE
Sbjct  59   RERPVHSVFGAGKPADVLLWRNKKISAGVLGGATAVWVLFE  99



>ref|XP_009766982.1| PREDICTED: reticulon-like protein B5 [Nicotiana sylvestris]
Length=266

 Score = 87.0 bits (214),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 64/102 (63%), Gaps = 9/102 (9%)
 Frame = +2

Query  137  EEDRKEEESLVEKIADKIH---------RHdsssssdsexeeeekkkttssMDAXVRRLF  289
            E    + ESL+EKIADK H           D+ +   +  EE       SS+   V RLF
Sbjct  6    ENSDPKGESLMEKIADKFHGGDDSSSSSDSDTETKKPAAKEEVVAAAEPSSVKDKVWRLF  65

Query  290  GRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            GR++PVHKV GGGK ADVFLWRNKKIS  VLGGATAIW+LFE
Sbjct  66   GREKPVHKVFGGGKPADVFLWRNKKISASVLGGATAIWVLFE  107



>ref|XP_006645662.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=249

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  269  AXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            A V RLFGR++P+HKVLGGGK ADVFLWRN+ IS GVLGGATAIWILFE
Sbjct  43   ARVFRLFGREEPIHKVLGGGKPADVFLWRNRNISAGVLGGATAIWILFE  91



>emb|CDY57657.1| BnaC01g15350D [Brassica napus]
Length=275

 Score = 87.0 bits (214),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 70/95 (74%), Gaps = 7/95 (7%)
 Frame = +2

Query  152  EEESLVEKIADKIHR-------HdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            E ESL++KI++KIH          SS   + + ++ +K ++ SSM + V RLFGR++PVH
Sbjct  22   ERESLMDKISEKIHHGGDSSSSSSSSDEEEYKEKKTKKPESPSSMKSKVYRLFGREKPVH  81

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            KVLGGGK AD+F+W++KKIS GVLGGATA W+LFE
Sbjct  82   KVLGGGKPADIFMWKDKKISGGVLGGATAAWVLFE  116



>ref|XP_002301382.1| hypothetical protein POPTR_0002s16690g [Populus trichocarpa]
 gb|EEE80655.1| hypothetical protein POPTR_0002s16690g [Populus trichocarpa]
Length=251

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 65/95 (68%), Gaps = 2/95 (2%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAE+     ES++EKI +K+H     SSS     + +K     S+ A + RLFGR++PVH
Sbjct  1    MAEQSESPTESVMEKIIEKVHH--HESSSSDSELDSDKPDPLESVKAKIWRLFGREKPVH  58

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
             VLGGGK ADVFLWRNKK+S GVLG  TA+W+LFE
Sbjct  59   HVLGGGKPADVFLWRNKKVSAGVLGFVTAMWVLFE  93



>ref|XP_006284300.1| hypothetical protein CARUB_v10005469mg [Capsella rubella]
 gb|ACC91263.1| reticulon family protein [Capsella rubella]
 gb|EOA17198.1| hypothetical protein CARUB_v10005469mg [Capsella rubella]
Length=274

 Score = 87.0 bits (214),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 75/107 (70%), Gaps = 9/107 (8%)
 Frame = +2

Query  122  ESXMAEE---DRKEEESLVEKIADKIH------RHdsssssdsexeeeekkkttssMDAX  274
            ES +A E   +  E ESL++KI++KIH         SS   D + ++++K  + SSM + 
Sbjct  9    ESVIAPEPAVEVVERESLMDKISEKIHGGDSSSSSSSSDDDDDKKKKKKKPSSPSSMQSK  68

Query  275  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLG ATA W+LFE
Sbjct  69   VYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGAATAAWVLFE  115



>ref|XP_006396933.1| hypothetical protein EUTSA_v10028886mg [Eutrema salsugineum]
 dbj|BAJ34499.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ38386.1| hypothetical protein EUTSA_v10028886mg [Eutrema salsugineum]
Length=265

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 61/88 (69%), Gaps = 3/88 (3%)
 Frame = +2

Query  152  EEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGK  331
            E ESL+EKI++K+H       S S     + +    S+ + V RLFGR++PVHKVLGGGK
Sbjct  22   ERESLMEKISEKVHH---KGDSSSSSSSSDDENEKKSLKSKVYRLFGRERPVHKVLGGGK  78

Query  332  QADVFLWRNKKISXGVLGGATAIWILFE  415
             AD+F+W+NKK+S GV GGAT  W+LFE
Sbjct  79   PADIFMWKNKKMSGGVFGGATVAWVLFE  106



>ref|XP_009626480.1| PREDICTED: reticulon-like protein B2 isoform X1 [Nicotiana tomentosiformis]
Length=254

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 67/94 (71%), Gaps = 3/94 (3%)
 Frame = +2

Query  134  AEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHK  313
            A E     ES+++KI DK+H     SSS    +E+EK     ++ A + RLFGR++PVHK
Sbjct  5    AGEHESVVESVMDKINDKLHH---DSSSSDSEDEKEKISPVEAVKAKIYRLFGRERPVHK  61

Query  314  VLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VLGGGK AD+FLWR+KKI+ GVLG ATAIW+LFE
Sbjct  62   VLGGGKPADIFLWRDKKITAGVLGFATAIWVLFE  95



>ref|XP_004234204.1| PREDICTED: reticulon-like protein B2 [Solanum lycopersicum]
Length=255

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 68/94 (72%), Gaps = 2/94 (2%)
 Frame = +2

Query  134  AEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHK  313
            A E     ES++EKI +K+H H+SSSS   + +E+        + A + RLFGR++PVHK
Sbjct  5    AGEHEPVVESVMEKINEKLHDHNSSSSDSEDEKEKISSVDA--VKAKIYRLFGRERPVHK  62

Query  314  VLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VLGGGK AD+FLWR+KKI+ GVLG AT++W+LFE
Sbjct  63   VLGGGKPADIFLWRDKKITAGVLGFATSLWVLFE  96



>ref|XP_010676393.1| PREDICTED: reticulon-like protein B2 [Beta vulgaris subsp. vulgaris]
Length=248

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 65/95 (68%), Gaps = 6/95 (6%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAE +  + ES++EKIADKIH HDSSS SD +            + + + RLFGR +PVH
Sbjct  1    MAEHEAPKAESIMEKIADKIHHHDSSSDSDDDKPAPSS------LKSKIYRLFGRDKPVH  54

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            KVLGGGK AD+ LWR+KKIS  VLG  TA+W LFE
Sbjct  55   KVLGGGKPADILLWRDKKISATVLGTVTAVWALFE  89



>ref|XP_008437352.1| PREDICTED: reticulon-like protein B2 [Cucumis melo]
Length=257

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 63/86 (73%), Gaps = 4/86 (5%)
 Frame = +2

Query  158  ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQA  337
            ESL++KI +KIH HDSSSS   + + +        + + + RLFGR++PVHKV GGGK A
Sbjct  17   ESLLDKITEKIHAHDSSSSDSDDDKGDTSAS----IKSKIYRLFGRERPVHKVFGGGKPA  72

Query  338  DVFLWRNKKISXGVLGGATAIWILFE  415
            D+FLWR+KK+S GVLGGAT  WILFE
Sbjct  73   DIFLWRDKKLSGGVLGGATIAWILFE  98



>tpg|DAA52789.1| TPA: seed maturation protein [Zea mays]
Length=283

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  275  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            V RLFGR+QP+HK LGGGK ADVFLWRNK IS GVLGGATAIWILFE
Sbjct  79   VFRLFGREQPIHKALGGGKPADVFLWRNKNISAGVLGGATAIWILFE  125



>ref|XP_004143883.1| PREDICTED: reticulon-like protein B2-like [Cucumis sativus]
 ref|XP_004170740.1| PREDICTED: reticulon-like protein B2-like [Cucumis sativus]
 gb|KGN50045.1| hypothetical protein Csa_5G151610 [Cucumis sativus]
Length=257

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 63/86 (73%), Gaps = 4/86 (5%)
 Frame = +2

Query  158  ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQA  337
            ESL++KI +KIH HDSSSS   + + +        + + + RLFGR++PVHKV GGGK A
Sbjct  17   ESLLDKITEKIHAHDSSSSDSDDDKGDASAS----IKSKIYRLFGRERPVHKVFGGGKPA  72

Query  338  DVFLWRNKKISXGVLGGATAIWILFE  415
            D+FLWR+KK+S GVLGGAT  WILFE
Sbjct  73   DIFLWRDKKLSGGVLGGATIAWILFE  98



>ref|XP_007038874.1| VIRB2-interacting protein 2 [Theobroma cacao]
 gb|EOY23375.1| VIRB2-interacting protein 2 [Theobroma cacao]
Length=247

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 66/87 (76%), Gaps = 3/87 (3%)
 Frame = +2

Query  155  EESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQ  334
            EE+LVEK+A++I    SSSSSDS+ ++         + + V RLFGR++P+H VLG GK 
Sbjct  5    EETLVEKVAEEIQGDASSSSSDSDDDKPFHADA---LKSKVYRLFGREKPIHHVLGAGKP  61

Query  335  ADVFLWRNKKISXGVLGGATAIWILFE  415
            ADVFLWR+KKIS GVLGGATA+WILFE
Sbjct  62   ADVFLWRDKKISAGVLGGATALWILFE  88



>gb|EMS62854.1| Reticulon-like protein B1 [Triticum urartu]
Length=237

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +2

Query  281  RLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            RLFGR+QP+HKVLGGGK ADVF+WRNK IS GVLGGATAIWILFE
Sbjct  3    RLFGREQPIHKVLGGGKPADVFMWRNKHISAGVLGGATAIWILFE  47



>ref|XP_011084470.1| PREDICTED: reticulon-like protein B2 [Sesamum indicum]
Length=258

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 67/93 (72%), Gaps = 2/93 (2%)
 Frame = +2

Query  137  EEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKV  316
            E+     ESL++KI +K H   S SSS    + ++ K   +++ + + RLFGR++PVHKV
Sbjct  9    EKHESAAESLIDKITEKFH--GSDSSSSDSDDNKDIKSAAAAVKSKIYRLFGREKPVHKV  66

Query  317  LGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            LGGGK AD+FLWR+KKI+ GVLG ATAIW+LFE
Sbjct  67   LGGGKPADIFLWRDKKITAGVLGVATAIWVLFE  99



>gb|EMT19773.1| Reticulon-like protein B1 [Aegilops tauschii]
Length=286

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +2

Query  281  RLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            RLFGR+QP+HKVLGGGK ADVF+WRNK IS GVLGGATAIWILFE
Sbjct  84   RLFGREQPIHKVLGGGKPADVFMWRNKHISAGVLGGATAIWILFE  128



>gb|EAY73097.1| hypothetical protein OsI_00974 [Oryza sativa Indica Group]
Length=279

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  275  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            V RLFGR++P+HKVLGGGK ADVFLWRN+ IS GVLGGATAIWILFE
Sbjct  75   VFRLFGREEPIHKVLGGGKPADVFLWRNRNISAGVLGGATAIWILFE  121



>dbj|BAB32723.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAB92114.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ11106.1| hypothetical protein OsJ_00954 [Oryza sativa Japonica Group]
Length=279

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  275  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            V RLFGR++P+HKVLGGGK ADVFLWRN+ IS GVLGGATAIWILFE
Sbjct  75   VFRLFGREEPIHKVLGGGKPADVFLWRNRNISAGVLGGATAIWILFE  121



>gb|KFK37395.1| hypothetical protein AALP_AA4G251600 [Arabis alpina]
Length=249

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 70/95 (74%), Gaps = 4/95 (4%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAEE  K  E + E + +KIH HDSSSSS+SE E+ +       + A + RLFGR++PVH
Sbjct  1    MAEEIEKSVE-VEESLMEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRLFGREKPVH  56

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            KVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE
Sbjct  57   KVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFE  91



>ref|NP_001150474.1| seed maturation protein [Zea mays]
 gb|ACG39226.1| seed maturation protein [Zea mays]
Length=283

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  275  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            V RLFGR+QP+HK LGGGK ADVFLWRNK IS G+LGGATAIWILFE
Sbjct  79   VFRLFGREQPIHKALGGGKPADVFLWRNKNISAGILGGATAIWILFE  125



>ref|XP_009597328.1| PREDICTED: reticulon-like protein B5 [Nicotiana tomentosiformis]
Length=268

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 63/104 (61%), Gaps = 11/104 (11%)
 Frame = +2

Query  137  EEDRKEEESLVEKIADKIH-----------RHdsssssdsexeeeekkkttssMDAXVRR  283
            E    + ESL+EKIADK H             ++   +  E      +   SS+   V R
Sbjct  6    ENSDPKGESLMEKIADKFHGGDDSSSSSDSDTETKKPAAKEEVVAAAEAEPSSVKDKVWR  65

Query  284  LFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            LFGR++PVHKV GGGK ADVFLWRNKKIS  VLGGATAIW+LFE
Sbjct  66   LFGREKPVHKVFGGGKPADVFLWRNKKISASVLGGATAIWVLFE  109



>gb|EYU19605.1| hypothetical protein MIMGU_mgv1a012182mg [Erythranthe guttata]
Length=259

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  275  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            + RLFGR+QPVHKVLGGGK AD+FLWR+KK+S GVLG ATAIW+LFE
Sbjct  54   IYRLFGREQPVHKVLGGGKPADIFLWRDKKVSAGVLGFATAIWVLFE  100



>gb|ACG32549.1| seed maturation protein [Zea mays]
Length=254

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = +2

Query  131  MAEEDRKEE-ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPV  307
            MAE+ ++E   ++++KI+DK+H      SS S   ++E+   T+++ A + R+FGR++PV
Sbjct  1    MAEQHKEESGVTVLDKISDKLHG-RGGGSSSSSDSDDERSSATAAVKAKIYRIFGREKPV  59

Query  308  HKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            H VLGGGK AD+FLWRNK+IS GVL GATA W+LFE
Sbjct  60   HSVLGGGKPADLFLWRNKRISGGVLAGATAFWLLFE  95



>ref|NP_001130268.1| uncharacterized protein LOC100191362 [Zea mays]
 gb|ACF78438.1| unknown [Zea mays]
 gb|ACG39160.1| seed maturation protein [Zea mays]
 gb|ACL53798.1| unknown [Zea mays]
 gb|AFW78797.1| seed maturation protein [Zea mays]
Length=254

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = +2

Query  131  MAEEDRKEE-ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPV  307
            MAE+ ++E   ++++KI+DK+H      SS S   ++E+   T+++ A + R+FGR++PV
Sbjct  1    MAEQHKEESGVTVLDKISDKLHG-RGGGSSSSSDSDDERSSATAAVKAKIYRIFGREKPV  59

Query  308  HKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            H VLGGGK AD+FLWRNK+IS GVL GATA W+LFE
Sbjct  60   HSVLGGGKPADLFLWRNKRISGGVLAGATAFWLLFE  95



>emb|CDY44123.1| BnaA01g13310D [Brassica napus]
Length=276

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 69/96 (72%), Gaps = 8/96 (8%)
 Frame = +2

Query  152  EEESLVEKIADKIHR--------HdsssssdsexeeeekkkttssMDAXVRRLFGRQQPV  307
            E ESL++KI++KIH           S    D + ++ +K ++ SSM + V RLFGR++PV
Sbjct  22   ERESLMDKISEKIHHGGDSSSSSSSSDDDDDKKEKKTKKPESPSSMKSKVYRLFGREKPV  81

Query  308  HKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            HKVLGGGK AD+F+W++KK+S GVLGGATA W+LFE
Sbjct  82   HKVLGGGKPADIFMWKDKKMSGGVLGGATAAWVLFE  117



>ref|XP_006413534.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
 gb|ESQ54987.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
Length=222

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 76/116 (66%), Gaps = 21/116 (18%)
 Frame = +2

Query  131  MAEEDRKEE--------------ESLVEKIADKIHR-------Hdsssssdsexeeeekk  247
            MAEE + EE              ESL++KI++KIH          SSS  + + ++++K 
Sbjct  1    MAEEHKHEESVTALEPAVEVVERESLMDKISEKIHHGGGSSSSSSSSSDDEDDKKKKKKP  60

Query  248  kttssMDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
             + SSM + V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLG ATA W+LFE
Sbjct  61   SSPSSMQSKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGAATAAWVLFE  116



>ref|XP_008655792.1| PREDICTED: reticulon-like protein B1 [Zea mays]
 gb|AFW80459.1| hypothetical protein ZEAMMB73_353444 [Zea mays]
Length=279

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  275  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            V RLFGR+QP+HK LGGGK ADVFLWRN+ IS GVLGGATAIWILFE
Sbjct  75   VFRLFGREQPIHKALGGGKPADVFLWRNRNISAGVLGGATAIWILFE  121



>emb|CDJ26559.1| unnamed protein product, partial [Triticum aestivum]
Length=290

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +2

Query  281  RLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            RLFGR+QP+HKVLGGGK ADVF+WRNK +S GVLGGATAIWILFE
Sbjct  88   RLFGREQPIHKVLGGGKPADVFMWRNKHVSAGVLGGATAIWILFE  132



>ref|XP_008792381.1| PREDICTED: reticulon-like protein B2 isoform X2 [Phoenix dactylifera]
Length=251

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  275  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            + RLFGR++PVH VLGGGK AD+FLWRNKKIS GVLGGATAIW+LF+
Sbjct  47   ICRLFGREKPVHTVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFD  93



>ref|NP_001149653.1| LOC100283279 [Zea mays]
 gb|ACG36248.1| seed maturation protein [Zea mays]
 gb|ACN31840.1| unknown [Zea mays]
 tpg|DAA57749.1| TPA: Seed maturation protein isoform 1 [Zea mays]
 tpg|DAA57750.1| TPA: Seed maturation protein isoform 2 [Zea mays]
Length=257

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 65/97 (67%), Gaps = 6/97 (6%)
 Frame = +2

Query  143  DRKEE---ESLVEKIADKIH---RHdsssssdsexeeeekkkttssMDAXVRRLFGRQQP  304
            D KEE   ES+++KI +K H      SSS SD E +         +M A + RLFGR++P
Sbjct  3    DHKEEPVPESVMDKITEKFHGGDSSSSSSDSDDEKKGSSLASAAEAMKAKIYRLFGRERP  62

Query  305  VHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VH VLGGGK AD+ LWRN+KIS GVL GATAIW+LFE
Sbjct  63   VHSVLGGGKPADLILWRNRKISGGVLAGATAIWLLFE  99



>ref|NP_001241367.1| uncharacterized protein LOC100796111 [Glycine max]
 gb|ACU22605.1| unknown [Glycine max]
Length=256

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 62/86 (72%), Gaps = 3/86 (3%)
 Frame = +2

Query  158  ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQA  337
            ESL++KIA+KIH H  SSSS     E+++  +   +   V RLFGR++PVH VLGGGK A
Sbjct  15   ESLLDKIAEKIHGHHDSSSSSDSDSEKKETSS---IKEKVFRLFGREKPVHSVLGGGKPA  71

Query  338  DVFLWRNKKISXGVLGGATAIWILFE  415
            DV LWRNKKIS  VLG ATA+WI FE
Sbjct  72   DVLLWRNKKISASVLGVATAVWIFFE  97



>emb|CDY05135.1| BnaC03g29330D [Brassica napus]
Length=313

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = +2

Query  152  EEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGK  331
            E  SL++KI++KIH H   SSS S+ E E+K  + SSM + V RLFGR++PVHKVLGGGK
Sbjct  68   ERGSLMDKISEKIH-HKGDSSSSSDDESEKKPSSPSSMKSKVYRLFGRERPVHKVLGGGK  126

Query  332  QADVFLWRNKKISXGVLGGATAIWILFE  415
             AD+F+W+NKK+S GVLGGAT  W+LFE
Sbjct  127  PADIFMWKNKKVSGGVLGGATVAWVLFE  154



>ref|XP_004967455.1| PREDICTED: reticulon-like protein B1-like [Setaria italica]
Length=278

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 64/120 (53%), Gaps = 25/120 (21%)
 Frame = +2

Query  131  MAEEDRKE------EESLVEKIADKIH-------------------RHdsssssdsexee  235
            MAE+   E       E+L+EK+ADK+H                   R  + ++       
Sbjct  1    MAEQPHAEGGASPKHETLMEKLADKLHAGGGKGDSSSSDSDNDERPRPSAPAAEVKPSFS  60

Query  236  eekkkttssMDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
                   +   A V RLFGR+QP+HK LGGGK ADVFLWRN+ IS GVLGG TAIWILFE
Sbjct  61   VSAAAAAAEARAKVFRLFGREQPIHKALGGGKPADVFLWRNRNISAGVLGGVTAIWILFE  120



>ref|XP_008796064.1| PREDICTED: reticulon-like protein B2 [Phoenix dactylifera]
Length=253

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  263  MDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            + A + RLFGR++ VH VLGGGK ADVFLWRNKKIS GV+GGATA+W+LFE
Sbjct  45   IKAKIYRLFGRERSVHNVLGGGKPADVFLWRNKKISAGVIGGATAVWVLFE  95



>ref|XP_008792378.1| PREDICTED: reticulon-like protein B3 isoform X1 [Phoenix dactylifera]
 ref|XP_008792379.1| PREDICTED: reticulon-like protein B3 isoform X1 [Phoenix dactylifera]
Length=280

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  275  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            + RLFGR++PVH VLGGGK AD+FLWRNKKIS GVLGGATAIW+LF+
Sbjct  47   ICRLFGREKPVHTVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFD  93



>ref|XP_006413535.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
 gb|ESQ54988.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
Length=275

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 76/116 (66%), Gaps = 21/116 (18%)
 Frame = +2

Query  131  MAEEDRKEE--------------ESLVEKIADKIHR-------Hdsssssdsexeeeekk  247
            MAEE + EE              ESL++KI++KIH          SSS  + + ++++K 
Sbjct  1    MAEEHKHEESVTALEPAVEVVERESLMDKISEKIHHGGGSSSSSSSSSDDEDDKKKKKKP  60

Query  248  kttssMDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
             + SSM + V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLG ATA W+LFE
Sbjct  61   SSPSSMQSKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGAATAAWVLFE  116



>ref|XP_009137263.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=276

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 69/96 (72%), Gaps = 8/96 (8%)
 Frame = +2

Query  152  EEESLVEKIADKIHR--------HdsssssdsexeeeekkkttssMDAXVRRLFGRQQPV  307
            E ESL++KI++KIH           S    D + ++ +K ++ SSM + V RLFGR++PV
Sbjct  22   ERESLMDKISEKIHHGGDSSSSSSSSDEEEDKKKKKTKKPESPSSMKSKVYRLFGREKPV  81

Query  308  HKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            HKVLGGGK AD+F+W++KK+S GVLGGATA W+LFE
Sbjct  82   HKVLGGGKPADIFMWKDKKMSGGVLGGATAAWVLFE  117



>gb|KHN15986.1| Reticulon-like protein B5, partial [Glycine soja]
Length=242

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 62/86 (72%), Gaps = 3/86 (3%)
 Frame = +2

Query  158  ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQA  337
            ESL++KIA+KIH H  SSSS     E+++  +   +   V RLFGR++PVH VLGGGK A
Sbjct  1    ESLLDKIAEKIHGHHDSSSSSDSDSEKKETSS---IKEKVFRLFGREKPVHSVLGGGKPA  57

Query  338  DVFLWRNKKISXGVLGGATAIWILFE  415
            DV LWRNKKIS  VLG ATA+WI FE
Sbjct  58   DVLLWRNKKISASVLGVATAVWIFFE  83



>emb|CDM81762.1| unnamed protein product [Triticum aestivum]
Length=253

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 71/98 (72%), Gaps = 6/98 (6%)
 Frame = +2

Query  131  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAE   KEE   ES+++KI+DK H     SSS S   ++EKK + + + A + RLFGR++
Sbjct  1    MAE--HKEEPVAESMMDKISDKFHG-GGDSSSSSSDSDDEKKGSAAGVKAKIYRLFGREK  57

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVH VLGGGK AD+ LWRNKKIS GVL GATAIW+LFE
Sbjct  58   PVHAVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFE  95



>ref|XP_010422067.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=265

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = +2

Query  152  EEESLVEKIADKIH-RHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVLGGG  328
            E ESL+EK+++KIH + DSSSS D   ++     +  S+ + V RLFGR++PVHKVLGGG
Sbjct  18   ERESLMEKLSEKIHHKGDSSSSDDENEKKPSSSSSPRSLKSKVYRLFGRERPVHKVLGGG  77

Query  329  KQADVFLWRNKKISXGVLGGATAIWILFE  415
            K AD+F+W+NKK+S GV+GGAT  W+LFE
Sbjct  78   KPADIFMWKNKKMSGGVIGGATVAWVLFE  106



>ref|XP_006644671.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=253

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 71/97 (73%), Gaps = 4/97 (4%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIH--RHdsssssdsexeeeekkkttssMDAXVRRLFGRQQP  304
            MAE   KEE+S++EK+++K+H     SSS SD E +      + +++ A + RLFGR++P
Sbjct  1    MAE--HKEEQSVMEKLSEKLHGDSSSSSSDSDDEKKGSSSSSSAAAVKAKIYRLFGRERP  58

Query  305  VHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VH VLGGGK AD+ LWRNKKIS GVL GATAIW+LFE
Sbjct  59   VHSVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFE  95



>ref|NP_001239711.1| uncharacterized protein LOC100811024 [Glycine max]
 gb|ACU21063.1| unknown [Glycine max]
 gb|KHN16777.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 65/98 (66%), Gaps = 6/98 (6%)
 Frame = +2

Query  131  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAE    EE   ESL+EKI+ KI       SS S   + EK   + S+ + V RLFGR++
Sbjct  1    MAEHHEHEEVKGESLLEKISGKI---HDHDSSSSSDSDNEKTSASDSLKSKVFRLFGREK  57

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            P+H VLGGGK ADVFLWRNKKIS   LG ATAIW+LFE
Sbjct  58   PIHHVLGGGKPADVFLWRNKKISASTLGVATAIWVLFE  95



>ref|XP_011023265.1| PREDICTED: reticulon-like protein B5 [Populus euphratica]
 ref|XP_011023266.1| PREDICTED: reticulon-like protein B5 [Populus euphratica]
Length=252

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 65/95 (68%), Gaps = 2/95 (2%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAE+     +S++EKI +K+H     SSS     + +K     S+ A + RLFGR++PVH
Sbjct  1    MAEQSESPTKSIMEKIIEKVHH--HESSSSDSELDSDKPDRLESVKAKIWRLFGREKPVH  58

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
             VLGGGK ADVFLWRNKK+S GVLG  TA+W+LFE
Sbjct  59   HVLGGGKPADVFLWRNKKVSAGVLGFVTAMWVLFE  93



>emb|CDY10954.1| BnaA03g46130D [Brassica napus]
Length=270

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 71/90 (79%), Gaps = 2/90 (2%)
 Frame = +2

Query  152  EEESLVEKIADKIHR--HdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVLGG  325
            E ESL++KI++K+H     SSS  D + ++++  ++ SSM + V RLFGR++PVHKVLGG
Sbjct  22   ERESLMDKISEKLHHGGDSSSSDEDDDKKKKKSSESPSSMKSKVYRLFGREKPVHKVLGG  81

Query  326  GKQADVFLWRNKKISXGVLGGATAIWILFE  415
            GK AD+F+W+NKK+S GVLGGATA W+LFE
Sbjct  82   GKPADIFMWKNKKMSGGVLGGATAAWVLFE  111



>ref|XP_010669728.1| PREDICTED: reticulon-like protein B4 [Beta vulgaris subsp. vulgaris]
Length=285

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  263  MDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            + A + RLFGR++PVHKVLGGGK ADVFLWRNKKIS  VL  ATAIWILFE
Sbjct  76   VQAKIYRLFGREKPVHKVLGGGKPADVFLWRNKKISGSVLASATAIWILFE  126



>ref|NP_194094.1| VIRB2-interacting protein 1 [Arabidopsis thaliana]
 sp|Q9SUR3.1|RTNLA_ARATH RecName: Full=Reticulon-like protein B1; Short=AtRTNLB1; AltName: 
Full=VirB2-interacting protein 1 [Arabidopsis thaliana]
 emb|CAA23029.1| putative protein [Arabidopsis thaliana]
 emb|CAB79318.1| putative protein [Arabidopsis thaliana]
 gb|AAK91338.1| AT4g23630/F9D16_100 [Arabidopsis thaliana]
 gb|AAM65433.1| unknown [Arabidopsis thaliana]
 gb|AAM91465.1| AT4g23630/F9D16_100 [Arabidopsis thaliana]
 gb|AEE84787.1| VIRB2-interacting protein 1 [Arabidopsis thaliana]
Length=275

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 74/108 (69%), Gaps = 10/108 (9%)
 Frame = +2

Query  122  ESXMAEE---DRKEEESLVEKIADKIHR-------HdsssssdsexeeeekkkttssMDA  271
            ES +A E   +  E ESL++KI++KIH          SS   D + + ++    +SSM +
Sbjct  9    ESVIAPEPAVEVVERESLMDKISEKIHHGGDSSSSSSSSDDEDEKKKTKKPSSPSSSMKS  68

Query  272  XVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
             V RLFGR+QPVHKVLGGGK AD+F+W+NKK+S GVLGGATA W++FE
Sbjct  69   KVYRLFGREQPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVVFE  116



>ref|XP_008437980.1| PREDICTED: reticulon-like protein B5 [Cucumis melo]
Length=255

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = +2

Query  125  SXMAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQP  304
            S  AE    + ESL++KI +KIH    SSSS     E E   ++S++   V R+FGR++P
Sbjct  2    SDHAENTEPKSESLIDKIVEKIHD-HDSSSSSGSDAETEGSASSSTLKEKVFRIFGRERP  60

Query  305  VHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VH VLGGGK AD+FLWRNKKIS GVL GAT IW+ FE
Sbjct  61   VHHVLGGGKPADLFLWRNKKISAGVLSGATLIWVFFE  97



>ref|XP_010523772.1| PREDICTED: reticulon-like protein B5 [Tarenaya hassleriana]
Length=253

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 64/93 (69%), Gaps = 3/93 (3%)
 Frame = +2

Query  137  EEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKV  316
            E     EESL+EKIADKIH      SS S   + EK ++ S++   + RLFGR++PVHKV
Sbjct  6    ENSTPAEESLLEKIADKIHD---HDSSSSSDSDNEKMESPSAVKEKIYRLFGREKPVHKV  62

Query  317  LGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
             GGGK ADV LWR+KK+S  VLG  TA+W+LFE
Sbjct  63   FGGGKPADVLLWRDKKLSAAVLGTTTAVWVLFE  95



>ref|NP_001044177.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAB89453.1| putative 24 kDa seed maturation protein [Oryza sativa Japonica 
Group]
 dbj|BAF06091.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAG89426.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00393.1| unnamed protein product [Oryza sativa Japonica Group]
Length=253

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 70/97 (72%), Gaps = 4/97 (4%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIH--RHdsssssdsexeeeekkkttssMDAXVRRLFGRQQP  304
            MAE   KEE+S++EK+++K+H     SSS SD + +        ++M A + RLFGR++P
Sbjct  1    MAE--HKEEQSVMEKLSEKLHGDSSSSSSDSDDDKKGSSSSSAAAAMKAKIYRLFGRERP  58

Query  305  VHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VH VLGGGK AD+ LWRNKKIS GVL GATAIW+LFE
Sbjct  59   VHSVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFE  95



>gb|EPS71452.1| hypothetical protein M569_03311 [Genlisea aurea]
Length=242

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 62/86 (72%), Gaps = 5/86 (6%)
 Frame = +2

Query  158  ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQA  337
            ESLV+KI +KIH HDSSSSS    ++         + A + RLFGR++ VH +LGGGK A
Sbjct  3    ESLVDKIVEKIHAHDSSSSSSDSDDDRRSS-----LKAKINRLFGRERSVHGLLGGGKAA  57

Query  338  DVFLWRNKKISXGVLGGATAIWILFE  415
            DV LWRNK +S GV+GGATAIWILF+
Sbjct  58   DVLLWRNKNVSLGVIGGATAIWILFD  83



>ref|XP_002876621.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52880.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=254

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 73/99 (74%), Gaps = 7/99 (7%)
 Frame = +2

Query  131  MAEEDRK---EEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAEE  K   +EESL++KIA+KIH      SS S   E EK ++ S++ A + RLFGR++
Sbjct  1    MAEELEKSMPKEESLMDKIAEKIHD---HDSSSSSDSEHEKPESPSALKAKIYRLFGREK  57

Query  302  PVHKVLGGG-KQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVHKVLGGG + ADVFLWR+KK+S  VLG ATAIW+LFE
Sbjct  58   PVHKVLGGGLRTADVFLWRDKKLSASVLGVATAIWVLFE  96



>ref|XP_006485002.1| PREDICTED: reticulon-like protein B8-like isoform X1 [Citrus 
sinensis]
 ref|XP_006485003.1| PREDICTED: reticulon-like protein B8-like isoform X2 [Citrus 
sinensis]
Length=248

 Score = 84.3 bits (207),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 60/97 (62%), Gaps = 10/97 (10%)
 Frame = +2

Query  131  MAEEDRKEE--ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQP  304
            M E+   E   ++LVE I+DK+ +  + S  + E            + A   RLFGRQ+P
Sbjct  1    MPEKITAENILDNLVETISDKVQKQKAVSFFEEETSSS--------VTARFNRLFGRQKP  52

Query  305  VHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VH +LGGGK ADV LWRNKKIS  VL GATAIW+LFE
Sbjct  53   VHHLLGGGKSADVLLWRNKKISASVLMGATAIWVLFE  89



>ref|XP_006437080.1| hypothetical protein CICLE_v10032550mg [Citrus clementina]
 ref|XP_006437081.1| hypothetical protein CICLE_v10032550mg [Citrus clementina]
 ref|XP_006437082.1| hypothetical protein CICLE_v10032550mg [Citrus clementina]
 gb|ESR50320.1| hypothetical protein CICLE_v10032550mg [Citrus clementina]
 gb|ESR50321.1| hypothetical protein CICLE_v10032550mg [Citrus clementina]
 gb|ESR50322.1| hypothetical protein CICLE_v10032550mg [Citrus clementina]
Length=248

 Score = 84.3 bits (207),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 60/97 (62%), Gaps = 10/97 (10%)
 Frame = +2

Query  131  MAEEDRKEE--ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQP  304
            M E+   E   ++LVE I+DK+ +  + S  + E            + A   RLFGRQ+P
Sbjct  1    MPEKITAENILDNLVETISDKVQKQKAVSFFEEETSSS--------VTARFNRLFGRQKP  52

Query  305  VHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VH +LGGGK ADV LWRNKKIS  VL GATAIW+LFE
Sbjct  53   VHHLLGGGKSADVLLWRNKKISASVLMGATAIWVLFE  89



>ref|XP_003525365.1| PREDICTED: reticulon-like protein B2-like isoform 1 [Glycine 
max]
 gb|KHM99936.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score = 84.3 bits (207),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 64/98 (65%), Gaps = 6/98 (6%)
 Frame = +2

Query  131  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAE    EE   ESL+EKI+ KI       SS S   + +K   T S  + V RLFGR++
Sbjct  1    MAEHHEHEEVKGESLLEKISGKI---HDHDSSSSSDSDNDKTSATDSFKSNVFRLFGREK  57

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            P+H VLGGGK ADVFLWRNKKIS   LG ATAIW+LFE
Sbjct  58   PIHHVLGGGKPADVFLWRNKKISASTLGVATAIWVLFE  95



>ref|XP_004133840.1| PREDICTED: reticulon-like protein B5-like [Cucumis sativus]
 ref|XP_004155844.1| PREDICTED: reticulon-like protein B5-like [Cucumis sativus]
 gb|KGN56474.1| hypothetical protein Csa_3G121020 [Cucumis sativus]
Length=255

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = +2

Query  125  SXMAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQP  304
            S  AE    + ESL++KI +KIH    SSSS     E E   ++S++   V R+FGR++P
Sbjct  2    SDHAETAEPKSESLIDKIVEKIHD-HDSSSSSGSDAETEGSASSSTLKEKVFRIFGRERP  60

Query  305  VHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VH VLGGGK AD+FLWRNKKIS GVL GAT IW+ FE
Sbjct  61   VHHVLGGGKPADLFLWRNKKISAGVLSGATLIWVFFE  97



>gb|KDO44767.1| hypothetical protein CISIN_1g025770mg [Citrus sinensis]
 gb|KDO44768.1| hypothetical protein CISIN_1g025770mg [Citrus sinensis]
 gb|KDO44769.1| hypothetical protein CISIN_1g025770mg [Citrus sinensis]
Length=248

 Score = 84.0 bits (206),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 60/97 (62%), Gaps = 10/97 (10%)
 Frame = +2

Query  131  MAEEDRKEE--ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQP  304
            M E+   E   ++LVE I+DK+ +  + S  + E            + A   RLFGRQ+P
Sbjct  1    MPEKITAENILDNLVETISDKVQKQKAVSFFEEETSSS--------VTARFNRLFGRQKP  52

Query  305  VHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VH +LGGGK ADV LWRNKKIS  VL GATAIW+LFE
Sbjct  53   VHHLLGGGKSADVLLWRNKKISASVLMGATAIWVLFE  89



>ref|XP_002302126.2| reticulon family protein [Populus trichocarpa]
 gb|EEE81399.2| reticulon family protein [Populus trichocarpa]
Length=247

 Score = 84.0 bits (206),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 60/97 (62%), Gaps = 11/97 (11%)
 Frame = +2

Query  131  MAEEDRKEE--ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQP  304
            M E+   E    +LVE IAD + +  S S  +   E          + + + RLFGRQ+P
Sbjct  1    MPEKITAENLFSNLVETIADNVPKQKSVSFFEEGEES---------VTSRINRLFGRQKP  51

Query  305  VHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VH +LGGGK ADV LWRNKKIS GVL GATAIW+LFE
Sbjct  52   VHHILGGGKSADVLLWRNKKISAGVLTGATAIWVLFE  88



>ref|XP_009415169.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score = 84.0 bits (206),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 67/86 (78%), Gaps = 1/86 (1%)
 Frame = +2

Query  158  ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQA  337
            E+L+EKI +KIH    SSSSDS+ E+ +  +   ++ + + RLFGR++PVH++LGGGK A
Sbjct  8    ETLIEKIKEKIHG-GDSSSSDSDDEKSKASEVAEAVKSKIFRLFGREKPVHRILGGGKPA  66

Query  338  DVFLWRNKKISXGVLGGATAIWILFE  415
            DVFLW+NKK S  VLGGATAIW+LFE
Sbjct  67   DVFLWKNKKASAIVLGGATAIWVLFE  92



>ref|XP_002275520.1| PREDICTED: reticulon-like protein B5 [Vitis vinifera]
 emb|CBI22609.3| unnamed protein product [Vitis vinifera]
Length=254

 Score = 84.0 bits (206),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  281  RLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            RLFGR++P+HKVLGGGK ADVFLWRNKKIS  VLG ATAIW+LFE
Sbjct  51   RLFGREKPLHKVLGGGKPADVFLWRNKKISASVLGCATAIWVLFE  95



>gb|ACF87936.1| unknown [Zea mays]
Length=208

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  263  MDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            M A + RLFGR++PVH VLGGGK AD+ LWRNKKIS GVL GATAIW+LFE
Sbjct  1    MKAKIYRLFGRERPVHSVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFE  51



>ref|XP_004306726.1| PREDICTED: reticulon-like protein B5 [Fragaria vesca subsp. vesca]
Length=257

 Score = 84.0 bits (206),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 69/99 (70%), Gaps = 4/99 (4%)
 Frame = +2

Query  131  MAE--EDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAX--VRRLFGRQ  298
            MAE  ED K E  L+EK+ +KIH H  SSSS S   + EK K  +       V RLFGR+
Sbjct  1    MAEHGEDAKAEHGLMEKMTEKIHDHHDSSSSSSSDSDTEKPKPAAEESPKEKVFRLFGRE  60

Query  299  QPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            +PVH VLGGGK ADVFLWRNKKIS GVLGGAT +++LFE
Sbjct  61   RPVHHVLGGGKPADVFLWRNKKISAGVLGGATVVYVLFE  99



>ref|XP_008344578.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=260

 Score = 84.0 bits (206),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 67/91 (74%), Gaps = 2/91 (2%)
 Frame = +2

Query  149  KEEESLVEKIADKIHRHdsssssdsexeeeekkk--ttssMDAXVRRLFGRQQPVHKVLG  322
            ++E SL+EK+ DKIH  D  SSS S  + + +K    T S+ A V R+FGR++PVH VLG
Sbjct  13   EDEPSLLEKMGDKIHGGDHHSSSSSSSDSDNEKSEKKTESVKAKVFRIFGRERPVHHVLG  72

Query  323  GGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            GGK ADVFLWRNKK+S GVL GAT IW+LFE
Sbjct  73   GGKXADVFLWRNKKVSAGVLSGATVIWVLFE  103



>ref|XP_010247587.1| PREDICTED: reticulon-like protein B8 [Nelumbo nucifera]
 ref|XP_010247588.1| PREDICTED: reticulon-like protein B8 [Nelumbo nucifera]
Length=248

 Score = 84.0 bits (206),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  275  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            + RLFGRQ+PVHK+LGGGK ADV LWRNKKIS GVL GATAIW+LFE
Sbjct  43   MNRLFGRQKPVHKILGGGKSADVLLWRNKKISAGVLTGATAIWMLFE  89



>ref|XP_007160119.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
 gb|ESW32113.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
Length=254

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 66/98 (67%), Gaps = 6/98 (6%)
 Frame = +2

Query  131  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAE    EE   ESL++KI+ KIH      SS S   + EK   + S+ + V RLFGR++
Sbjct  1    MAEHHEHEEAKGESLLDKISGKIHD---HDSSSSSDSDNEKTGPSDSLKSKVFRLFGREK  57

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            P+H VLGGGKQADVFLWRNKKIS   LG AT IWILFE
Sbjct  58   PIHHVLGGGKQADVFLWRNKKISASTLGVATVIWILFE  95



>dbj|BAJ33905.1| unnamed protein product [Thellungiella halophila]
Length=275

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 76/116 (66%), Gaps = 21/116 (18%)
 Frame = +2

Query  131  MAEEDRKEE--------------ESLVEKIADKIHR-------Hdsssssdsexeeeekk  247
            MAEE + EE              ESL++KI++KIH          SSS  + + ++++K 
Sbjct  1    MAEEHKHEESVTALEPAVEVVERESLMDKISEKIHHGGGSSSSSSSSSDDEDDKKKKKKP  60

Query  248  kttssMDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
             + SSM + V RLFGR++PVHKVLGGGK A++F+W+NKK+S GVLG ATA W+LFE
Sbjct  61   SSPSSMQSKVYRLFGREKPVHKVLGGGKPAEIFMWKNKKMSGGVLGAATAAWVLFE  116



>ref|XP_010688858.1| PREDICTED: reticulon-like protein B8 [Beta vulgaris subsp. vulgaris]
Length=248

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  269  AXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
              + RLFGRQ+PVHKVLGGGK ADV LWRNKKIS GV+GGATA+W +FE
Sbjct  41   CKLNRLFGRQEPVHKVLGGGKSADVLLWRNKKISAGVIGGATALWFIFE  89



>gb|KCW72351.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=224

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 63/99 (64%), Gaps = 6/99 (6%)
 Frame = +2

Query  137  EEDRKEEESLVEKIADKIHRHdsssssdsexeeee------kkkttssMDAXVRRLFGRQ  298
            EE   + ESL+EK A+KIH H    SS S   ++E                 + RLFGR+
Sbjct  5    EEQPHKAESLLEKFAEKIHGHHHDGSSSSSDSDDERKKPSAPPPPKEEEKPKIFRLFGRE  64

Query  299  QPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            +PVHKVLGGGK ADVFLWRNKKIS G LG ATA+WILFE
Sbjct  65   RPVHKVLGGGKPADVFLWRNKKISAGALGVATALWILFE  103



>ref|XP_010544774.1| PREDICTED: reticulon-like protein B6 [Tarenaya hassleriana]
Length=253

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 64/93 (69%), Gaps = 3/93 (3%)
 Frame = +2

Query  137  EEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKV  316
            E+    EESL+EKIA+KI       SS S   + EK ++  ++   + RLFGR++PVHKV
Sbjct  6    EKSAPAEESLLEKIAEKI---HDHDSSSSSDSDNEKMESPMAVKDKIYRLFGREKPVHKV  62

Query  317  LGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
             GGGK ADV LWR+KK+S  VLG ATAIW+LFE
Sbjct  63   FGGGKPADVLLWRDKKLSAAVLGTATAIWVLFE  95



>ref|XP_006366629.1| PREDICTED: reticulon-like protein B8-like isoform X2 [Solanum 
tuberosum]
Length=254

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 65/97 (67%), Gaps = 4/97 (4%)
 Frame = +2

Query  131  MAEEDRKEE--ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQP  304
            M E    E+   ++VE IAD + +  S S   S    E++K ++  ++A + RLFGRQ+P
Sbjct  1    MPERITAEDLLNNIVESIADGLSKQKSLSKQTSGSFLEQEKSSS--VNAQLNRLFGRQKP  58

Query  305  VHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VH +LGGGK ADV LWRNKKIS GVL  ATAIW+LFE
Sbjct  59   VHHILGGGKSADVLLWRNKKISAGVLASATAIWVLFE  95



>ref|XP_002874678.1| VIRB2-interacting protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50937.1| VIRB2-interacting protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=271

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 68/91 (75%), Gaps = 3/91 (3%)
 Frame = +2

Query  152  EEESLVEKIADKIHRH---dsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVLG  322
            E ESL+EKI++KIH      SSSSSD +  E++   +  S+ + V RLFGR++PVHKVLG
Sbjct  22   ERESLMEKISEKIHHKGDSSSSSSSDDDENEKKSSPSPKSLKSKVYRLFGRERPVHKVLG  81

Query  323  GGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            GGK AD+F+W+NKK+S GV GGAT  W+LFE
Sbjct  82   GGKPADIFMWKNKKMSGGVFGGATVAWVLFE  112



>gb|EMT06999.1| Reticulon-like protein B1 [Aegilops tauschii]
Length=248

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 70/98 (71%), Gaps = 7/98 (7%)
 Frame = +2

Query  131  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAE   KEE   ES+++KI+DK H     SSS S   +++KK   + + A + RLFGR++
Sbjct  1    MAE--HKEEPVAESMMDKISDKFH--GGDSSSSSSDSDDDKKGPAAGVKAKIYRLFGREK  56

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVH VLGGGK AD+ LWRNKK+S GVL GATAIW+LFE
Sbjct  57   PVHAVLGGGKPADLVLWRNKKVSGGVLAGATAIWLLFE  94



>ref|XP_006366628.1| PREDICTED: reticulon-like protein B8-like isoform X1 [Solanum 
tuberosum]
Length=260

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 65/97 (67%), Gaps = 4/97 (4%)
 Frame = +2

Query  131  MAEEDRKEE--ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQP  304
            M E    E+   ++VE IAD + +  S S   S    E++K ++  ++A + RLFGRQ+P
Sbjct  7    MPERITAEDLLNNIVESIADGLSKQKSLSKQTSGSFLEQEKSSS--VNAQLNRLFGRQKP  64

Query  305  VHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VH +LGGGK ADV LWRNKKIS GVL  ATAIW+LFE
Sbjct  65   VHHILGGGKSADVLLWRNKKISAGVLASATAIWVLFE  101



>emb|CAN77759.1| hypothetical protein VITISV_034907 [Vitis vinifera]
Length=245

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  281  RLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            RLFGR++P+HKVLGGGK ADVFLWRNKKIS  VLG ATAIW+LFE
Sbjct  51   RLFGREKPLHKVLGGGKPADVFLWRNKKISASVLGCATAIWVLFE  95



>gb|KCW72350.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=232

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  275  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            + RLFGR++PVHKVLGGGK ADVFLWRNKKIS G LG ATA+WILFE
Sbjct  57   IFRLFGRERPVHKVLGGGKPADVFLWRNKKISAGALGVATALWILFE  103



>gb|EMS49910.1| Reticulon-like protein B3 [Triticum urartu]
Length=327

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 71/98 (72%), Gaps = 7/98 (7%)
 Frame = +2

Query  131  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQ  301
            MAE   KEE   ES+++KI+DK H     SSS S   ++EKK + + + A + RLFGR++
Sbjct  1    MAEH--KEEPVAESMMDKISDKFH--GGDSSSSSSDSDDEKKGSAAGVKAKIYRLFGREK  56

Query  302  PVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            PVH VLGGGK AD+ LWRNKK+S GVL GATAIW+LFE
Sbjct  57   PVHAVLGGGKPADLVLWRNKKVSGGVLAGATAIWLLFE  94



>ref|XP_004298843.1| PREDICTED: reticulon-like protein B2 [Fragaria vesca subsp. vesca]
Length=246

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 63/95 (66%), Gaps = 7/95 (7%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAEE +   ESL+EKI DKI  H  S + +    +  +      M   V R+FGR++PVH
Sbjct  1    MAEEVK--AESLMEKIEDKILGHHDSPAPEVVHHDSPRS-----MQDKVFRIFGRERPVH  53

Query  311  KVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
             V GGGK AD+FLWR+KK+S G+LGGAT +W+LFE
Sbjct  54   HVFGGGKLADIFLWRDKKLSGGILGGATVMWLLFE  88



>gb|KHG24129.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=250

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  263  MDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            + A V RLFGR++PVH VLGGGK AD+FLWRNKKIS G LG AT IWILFE
Sbjct  41   IKAKVFRLFGREKPVHHVLGGGKPADIFLWRNKKISAGALGVATVIWILFE  91



>ref|NP_001185307.1| reticulon-like protein B3 [Arabidopsis thaliana]
 gb|AEE34191.1| reticulon-like protein B3 [Arabidopsis thaliana]
Length=271

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 72/111 (65%), Gaps = 20/111 (18%)
 Frame = +2

Query  131  MAEEDRKEEESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVH  310
            MAEE  K EES++EKI++KIH HD SSSS S+ ++++   +   +   + RLFGR+QP+H
Sbjct  1    MAEE-HKHEESIMEKISEKIHGHDDSSSSSSDSDDDKNSAS---LKTKIYRLFGREQPLH  56

Query  311  KVLGGGKQ----------------ADVFLWRNKKISXGVLGGATAIWILFE  415
            K+ GGGK                 AD+FLWRNKK+S GVLG AT  WILFE
Sbjct  57   KLFGGGKHSENQDINERFGLVFAAADIFLWRNKKVSGGVLGAATVSWILFE  107



>ref|XP_006288443.1| hypothetical protein CARUB_v10001704mg [Capsella rubella]
 gb|EOA21341.1| hypothetical protein CARUB_v10001704mg [Capsella rubella]
Length=271

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 68/91 (75%), Gaps = 3/91 (3%)
 Frame = +2

Query  152  EEESLVEKIADKIHRH---dsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVLG  322
            E ESL+EK+++KIH      SSSSS  +  E++   +  S+ + V RLFGR++PVHKVLG
Sbjct  22   ERESLMEKLSEKIHHKGGDSSSSSSSDDENEKKSSSSPRSLKSKVYRLFGRERPVHKVLG  81

Query  323  GGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            GGK AD+F+W+NKK+S GV+GGAT  W+LFE
Sbjct  82   GGKPADIFMWKNKKMSGGVIGGATVAWVLFE  112



>ref|XP_010055800.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW72349.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=262

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  275  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            + RLFGR++PVHKVLGGGK ADVFLWRNKKIS G LG ATA+WILFE
Sbjct  57   IFRLFGRERPVHKVLGGGKPADVFLWRNKKISAGALGVATALWILFE  103



>gb|KJB52211.1| hypothetical protein B456_008G250900 [Gossypium raimondii]
Length=192

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 59/85 (69%), Gaps = 5/85 (6%)
 Frame = +2

Query  161  SLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQAD  340
            SL+++IA+KI  HDSSSS     +  E       + A V  LFGR++PVH VLGGGK AD
Sbjct  12   SLMDRIAEKIQAHDSSSSDSDNDKPSEST-----IKAKVFHLFGREKPVHHVLGGGKPAD  66

Query  341  VFLWRNKKISXGVLGGATAIWILFE  415
            +FLWRNKKIS G LG AT IWILFE
Sbjct  67   IFLWRNKKISAGALGVATVIWILFE  91



>ref|XP_002869770.1| VIRB2-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46029.1| VIRB2-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=272

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  275  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            V RLFGR+QPVHKVLGGGK AD+F+W+NKK+S GVLGGATA W++FE
Sbjct  67   VYRLFGREQPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVVFE  113



>gb|KCW72347.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=265

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  275  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            + RLFGR++PVHKVLGGGK ADVFLWRNKKIS G LG ATA+WILFE
Sbjct  57   IFRLFGRERPVHKVLGGGKPADVFLWRNKKISAGALGVATALWILFE  103



>gb|KCW72348.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=296

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  275  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            + RLFGR++PVHKVLGGGK ADVFLWRNKKIS G LG ATA+WILFE
Sbjct  57   IFRLFGRERPVHKVLGGGKPADVFLWRNKKISAGALGVATALWILFE  103



>ref|XP_007135152.1| hypothetical protein PHAVU_010G105400g [Phaseolus vulgaris]
 gb|ESW07146.1| hypothetical protein PHAVU_010G105400g [Phaseolus vulgaris]
Length=255

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 65/86 (76%), Gaps = 4/86 (5%)
 Frame = +2

Query  158  ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQA  337
            ESL++KIADK+H HDSSSSSDS+ E++E       +   V RLFGR++PVH VLGGGK A
Sbjct  15   ESLLDKIADKLHGHDSSSSSDSDSEKKESSS----IKDKVFRLFGREKPVHSVLGGGKPA  70

Query  338  DVFLWRNKKISXGVLGGATAIWILFE  415
            DV LWRNKKIS  VL  ATA+WI FE
Sbjct  71   DVLLWRNKKISASVLSVATAVWIFFE  96



>ref|XP_011026205.1| PREDICTED: reticulon-like protein B8 [Populus euphratica]
Length=247

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 59/97 (61%), Gaps = 11/97 (11%)
 Frame = +2

Query  131  MAEEDRKEE--ESLVEKIADKIHRHdsssssdsexeeeekkkttssMDAXVRRLFGRQQP  304
            M E+   E    +LVE IAD + +  S S  +              + + + RLFGRQ+P
Sbjct  1    MPEKITAESLLSNLVETIADSVPKQKSVSFFEEGEGS---------VTSRINRLFGRQKP  51

Query  305  VHKVLGGGKQADVFLWRNKKISXGVLGGATAIWILFE  415
            VH +LGGGK ADV LWRNKKIS GVL GATAIW+LFE
Sbjct  52   VHHLLGGGKSADVLLWRNKKISAGVLTGATAIWVLFE  88



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 560060235700