BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF010C08

Length=578
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009798568.1|  PREDICTED: thioredoxin-like protein Clot           206   4e-64   Nicotiana sylvestris
ref|XP_006338899.1|  PREDICTED: thioredoxin-like protein Clot-like      205   6e-64   Solanum tuberosum [potatoes]
ref|XP_010327286.1|  PREDICTED: thioredoxin-like protein Clot           202   1e-62   Solanum lycopersicum
gb|ADR70871.1|  thioredoxin-like family protein                         197   6e-61   Hevea brasiliensis [jebe]
ref|XP_003531426.1|  PREDICTED: thioredoxin-like protein Clot-like      196   2e-60   Glycine max [soybeans]
emb|CDP07714.1|  unnamed protein product                                195   4e-60   Coffea canephora [robusta coffee]
ref|XP_007218586.1|  hypothetical protein PRUPE_ppa013260mg             193   3e-59   Prunus persica
ref|NP_001239644.1|  uncharacterized protein LOC100785157               193   4e-59   Glycine max [soybeans]
ref|XP_002513195.1|  electron transporter, putative                     191   1e-58   Ricinus communis
emb|CDP07717.1|  unnamed protein product                                191   2e-58   Coffea canephora [robusta coffee]
ref|XP_007149056.1|  hypothetical protein PHAVU_005G037200g             190   6e-58   Phaseolus vulgaris [French bean]
gb|AFK40345.1|  unknown                                                 190   6e-58   Lotus japonicus
gb|EYU31342.1|  hypothetical protein MIMGU_mgv1a016170mg                189   9e-58   Erythranthe guttata [common monkey flower]
ref|XP_011093375.1|  PREDICTED: thioredoxin-like protein Clot           190   1e-57   
gb|KDP43426.1|  hypothetical protein JCGZ_16713                         188   2e-57   Jatropha curcas
ref|XP_010265834.1|  PREDICTED: thioredoxin-like protein Clot           188   3e-57   Nelumbo nucifera [Indian lotus]
gb|AFK40851.1|  unknown                                                 188   3e-57   Lotus japonicus
ref|XP_010095387.1|  hypothetical protein L484_013059                   188   4e-57   Morus notabilis
ref|XP_004513172.1|  PREDICTED: thioredoxin-like protein Clot-lik...    187   5e-57   Cicer arietinum [garbanzo]
ref|XP_004306505.1|  PREDICTED: thioredoxin-like protein Clot           187   6e-57   Fragaria vesca subsp. vesca
gb|KGN58616.1|  hypothetical protein Csa_3G701560                       187   6e-57   Cucumis sativus [cucumbers]
ref|XP_010067895.1|  PREDICTED: thioredoxin-like protein Clot           187   1e-56   Eucalyptus grandis [rose gum]
gb|EPS73999.1|  hypothetical protein M569_00758                         186   2e-56   Genlisea aurea
ref|XP_009354687.1|  PREDICTED: thioredoxin-like protein Clot           186   2e-56   Pyrus x bretschneideri [bai li]
ref|XP_008375139.1|  PREDICTED: thioredoxin-like protein Clot           186   2e-56   
ref|XP_002265835.1|  PREDICTED: thioredoxin-like protein Clot           186   2e-56   Vitis vinifera
ref|XP_007052588.1|  Thioredoxin superfamily protein isoform 1          185   7e-56   
ref|XP_007149072.1|  hypothetical protein PHAVU_005G038700g             183   2e-55   Phaseolus vulgaris [French bean]
ref|XP_002298153.1|  hypothetical protein POPTR_0001s23270g             182   4e-55   Populus trichocarpa [western balsam poplar]
ref|XP_008461777.1|  PREDICTED: thioredoxin-like protein Clot iso...    182   4e-55   
ref|XP_003599047.1|  Thioredoxin domain-containing protein              182   5e-55   Medicago truncatula
gb|ADR70873.1|  thioredoxin-like family protein                         181   2e-54   Hevea brasiliensis [jebe]
ref|XP_011035028.1|  PREDICTED: thioredoxin-like protein Clot           181   2e-54   Populus euphratica
ref|XP_010257409.1|  PREDICTED: thioredoxin-like protein Clot           182   3e-54   Nelumbo nucifera [Indian lotus]
ref|XP_006439062.1|  hypothetical protein CICLE_v10033058mg             180   4e-54   Citrus clementina [clementine]
gb|KJB35464.1|  hypothetical protein B456_006G116100                    179   1e-53   Gossypium raimondii
ref|XP_010694184.1|  PREDICTED: thioredoxin-like protein Clot           176   2e-52   Beta vulgaris subsp. vulgaris [field beet]
gb|AGG19197.1|  thioredoxin-like protein 7                              174   1e-51   Tamarix hispida
ref|XP_007052589.1|  Thioredoxin superfamily protein isoform 2          167   6e-49   
ref|XP_010910629.1|  PREDICTED: thioredoxin-like protein Clot           165   9e-48   
ref|XP_008795747.1|  PREDICTED: thioredoxin-like protein Clot           164   1e-47   Phoenix dactylifera
ref|XP_010928449.1|  PREDICTED: thioredoxin-like protein Clot           163   5e-47   Elaeis guineensis
ref|XP_010552738.1|  PREDICTED: thioredoxin-like protein Clot           146   6e-41   Tarenaya hassleriana [spider flower]
gb|ACN40757.1|  unknown                                                 146   8e-41   Picea sitchensis
gb|ABK21521.1|  unknown                                                 145   1e-40   Picea sitchensis
ref|XP_006850070.1|  hypothetical protein AMTR_s00022p00212550          143   9e-40   Amborella trichopoda
ref|XP_009394997.1|  PREDICTED: thioredoxin-like protein Clot           143   1e-39   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX71522.1|  BnaC04g17570D                                          142   3e-39   
emb|CDY22382.1|  BnaA06g37040D                                          142   3e-39   Brassica napus [oilseed rape]
ref|XP_009101833.1|  PREDICTED: thioredoxin-like protein Clot           141   6e-39   Brassica rapa
ref|XP_002863728.1|  hypothetical protein ARALYDRAFT_917431             141   9e-39   Arabidopsis lyrata subsp. lyrata
ref|XP_006403339.1|  hypothetical protein EUTSA_v10003289mg             140   1e-38   Eutrema salsugineum [saltwater cress]
ref|XP_003577742.1|  PREDICTED: thioredoxin-like protein Clot           140   2e-38   
ref|XP_006656041.1|  PREDICTED: thioredoxin-like protein Clot-like      139   4e-38   Oryza brachyantha
ref|XP_002438324.1|  hypothetical protein SORBIDRAFT_10g012200          140   4e-38   
ref|NP_001146464.1|  thioredoxin-like protein 5                         139   7e-38   Zea mays [maize]
gb|ACG38852.1|  thioredoxin-like protein 5                              138   1e-37   Zea mays [maize]
ref|XP_006281304.1|  hypothetical protein CARUB_v10027354mg             138   1e-37   Capsella rubella
ref|XP_010494239.1|  PREDICTED: thioredoxin-like protein Clot           137   2e-37   Camelina sativa [gold-of-pleasure]
gb|AAM64350.1|  unknown                                                 137   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004965341.1|  PREDICTED: thioredoxin-like protein Clot-like      136   5e-37   Setaria italica
dbj|BAJ94490.1|  predicted protein                                      136   7e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010442113.1|  PREDICTED: thioredoxin-like protein Clot           135   9e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010481939.1|  PREDICTED: thioredoxin-like protein Clot           135   1e-36   Camelina sativa [gold-of-pleasure]
ref|NP_568614.1|  thioredoxin-like protein Clot                         135   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001057509.1|  Os06g0320000                                       132   2e-35   
ref|XP_002991106.1|  hypothetical protein SELMODRAFT_132775             126   6e-33   Selaginella moellendorffii
ref|XP_002991648.1|  hypothetical protein SELMODRAFT_134020             126   6e-33   Selaginella moellendorffii
ref|XP_009612559.1|  PREDICTED: thioredoxin-like protein Clot           119   6e-30   
gb|KHN29206.1|  Thioredoxin-like protein Clot                           116   4e-29   Glycine soja [wild soybean]
ref|XP_007052590.1|  Thioredoxin superfamily protein isoform 3          115   6e-29   
ref|XP_001782979.1|  predicted protein                                  108   1e-26   
ref|XP_009601645.1|  PREDICTED: thioredoxin-like protein Clot iso...  95.1    1e-21   
ref|XP_009601647.1|  PREDICTED: thioredoxin-like protein Clot iso...  93.6    3e-21   
ref|XP_009601646.1|  PREDICTED: thioredoxin-like protein Clot iso...  93.6    4e-21   
ref|XP_009601648.1|  PREDICTED: thioredoxin-like protein Clot iso...  92.8    4e-21   
ref|XP_009601649.1|  PREDICTED: thioredoxin-like protein Clot iso...  92.0    8e-21   
ref|XP_009365074.1|  PREDICTED: thioredoxin-like protein Clot         87.8    2e-18   
ref|XP_002155721.1|  PREDICTED: thioredoxin domain-containing pro...  86.3    6e-18   Hydra vulgaris
gb|KIZ05859.1|  hypothetical protein MNEG_2100                        85.5    2e-17   Monoraphidium neglectum
gb|ADD38068.1|  Thioredoxin domain-containing protein 17              81.6    4e-16   Lepeophtheirus salmonis
ref|XP_787642.1|  PREDICTED: thioredoxin domain-containing protei...  80.9    6e-16   Strongylocentrotus purpuratus [purple urchin]
gb|KFH67789.1|  hypothetical protein MVEG_06521                       80.1    1e-15   Mortierella verticillata NRRL 6337
gb|ETO18237.1|  hypothetical protein RFI_19042                        79.7    2e-15   Reticulomyxa filosa
ref|XP_004149619.1|  PREDICTED: uncharacterized protein LOC101210632  82.8    1e-14   
ref|XP_001634184.1|  predicted protein                                77.4    1e-14   Nematostella vectensis
ref|XP_008350865.1|  PREDICTED: uncharacterized protein LOC103414243  76.3    5e-14   
ref|XP_011155994.1|  PREDICTED: thioredoxin domain-containing pro...  74.7    1e-13   Solenopsis invicta [imported red fire ant]
ref|XP_009495772.1|  hypothetical protein H696_03625                  72.4    7e-13   Fonticula alba
ref|XP_005099707.1|  PREDICTED: thioredoxin domain-containing pro...  72.4    7e-13   Aplysia californica
ref|XP_004161416.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  75.9    1e-12   
ref|XP_004991836.1|  thioredoxin domain-containing protein 17         71.6    1e-12   Salpingoeca rosetta
gb|EFX66964.1|  hypothetical protein DAPPUDRAFT_302246                71.2    2e-12   Daphnia pulex
ref|XP_008461776.1|  PREDICTED: uncharacterized protein LOC103500...  75.5    2e-12   
gb|ABK63289.1|  thioredoxin-related protein 14                        71.2    2e-12   Branchiostoma belcheri tsingtauense
gb|EFN74197.1|  Thioredoxin domain-containing protein 17              71.2    2e-12   Camponotus floridanus
ref|XP_005987558.1|  PREDICTED: thioredoxin domain-containing pro...  71.2    2e-12   Latimeria chalumnae
ref|XP_002117291.1|  hypothetical protein TRIADDRAFT_61314            70.1    4e-12   Trichoplax adhaerens
ref|XP_011259215.1|  PREDICTED: thioredoxin domain-containing pro...  71.2    4e-12   Camponotus floridanus
gb|ERZ96762.1|  hypothetical protein GLOINDRAFT_299754                70.5    4e-12   
gb|ACF35500.1|  putative glutaredoxin                                 70.1    4e-12   Dermacentor variabilis
ref|XP_011049937.1|  PREDICTED: thioredoxin domain-containing pro...  70.1    5e-12   Acromyrmex echinatior
pdb|1V9W|A  Chain A, Solution Structure Of Mouse Putative 42-9-9 ...  70.1    5e-12   Mus musculus [mouse]
gb|KHJ46624.1|  hypothetical protein D918_02940                       69.7    5e-12   Trichuris suis
ref|XP_011049936.1|  PREDICTED: thioredoxin domain-containing pro...  70.1    5e-12   Acromyrmex echinatior
ref|XP_002878239.1|  hypothetical protein ARALYDRAFT_907360           70.1    5e-12   
ref|XP_002640925.1|  Hypothetical protein CBG00487                    70.1    6e-12   Caenorhabditis briggsae
emb|CDS08109.1|  hypothetical protein LRAMOSA02058                    69.7    6e-12   Lichtheimia ramosa
gb|KFD62735.1|  hypothetical protein M514_09194                       70.1    6e-12   Trichuris suis
gb|KFD49980.1|  hypothetical protein M513_09194                       70.1    7e-12   Trichuris suis
gb|EGT36737.1|  hypothetical protein CAEBREN_02755                    69.7    8e-12   Caenorhabditis brenneri
ref|XP_011420601.1|  PREDICTED: thioredoxin domain-containing pro...  69.3    9e-12   Crassostrea gigas
ref|XP_001961792.1|  GF15144                                          69.3    9e-12   
gb|KDR20080.1|  Thioredoxin domain-containing protein 17              68.9    1e-11   Zootermopsis nevadensis
ref|XP_002129555.1|  PREDICTED: thioredoxin domain-containing pro...  68.9    1e-11   
ref|XP_003386713.1|  PREDICTED: thioredoxin domain-containing pro...  68.9    1e-11   Amphimedon queenslandica
ref|XP_011334816.1|  PREDICTED: thioredoxin domain-containing pro...  68.9    1e-11   
ref|XP_002594853.1|  hypothetical protein BRAFLDRAFT_124440           68.2    2e-11   Branchiostoma floridae
ref|XP_005525700.1|  PREDICTED: thioredoxin domain-containing pro...  68.2    2e-11   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_003375804.1|  arginyl-tRNA--protein transferase 1              72.0    2e-11   Trichinella spiralis
ref|XP_003111581.1|  hypothetical protein CRE_03102                   68.6    2e-11   Caenorhabditis remanei
emb|CDH49145.1|  hypothetical protein RO3G_05788                      68.6    2e-11   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_312874.2|  AGAP003178-PA                                       68.2    3e-11   Anopheles gambiae str. PEST
ref|XP_001357474.1|  GA10712                                          67.8    3e-11   Drosophila pseudoobscura pseudoobscura
ref|XP_004433300.1|  PREDICTED: thioredoxin domain-containing pro...  67.8    3e-11   
gb|EHJ75979.1|  thioredoxin-like protein                              67.8    3e-11   
ref|NP_001099275.1|  thioredoxin domain-containing protein 17         67.4    4e-11   Rattus norvegicus [brown rat]
gb|ACO09547.1|  Thioredoxin-like protein 5                            67.4    4e-11   Osmerus mordax
emb|CDJ91244.1|  Protein of unknown function DUF953 domain contai...  67.0    5e-11   Haemonchus contortus [red stomach worm]
emb|CEF66639.1|  Protein of unknown function DUF953, thioredoxin-...  67.4    5e-11   Strongyloides ratti
dbj|BAE41434.1|  unnamed protein product                              67.0    5e-11   Mus musculus [mouse]
gb|AAW26135.1|  SJCHGC02110 protein                                   67.0    5e-11   Schistosoma japonicum
emb|CAC51438.1|  putative 42-9-9 protein                              67.0    6e-11   Mus musculus [mouse]
gb|KHN86804.1|  Thioredoxin domain-containing protein 17              67.8    6e-11   Toxocara canis
emb|CDW56879.1|  DUF953 domain containing protein                     66.6    7e-11   Trichuris trichiura
dbj|BAB23225.1|  unnamed protein product                              66.6    7e-11   Mus musculus [mouse]
ref|XP_011151974.1|  PREDICTED: thioredoxin domain-containing pro...  66.6    7e-11   
gb|KFM76754.1|  Thioredoxin domain-containing protein 17              66.6    7e-11   Stegodyphus mimosarum
ref|NP_080835.1|  thioredoxin domain-containing protein 17            66.6    8e-11   Mus musculus [mouse]
ref|XP_005233094.1|  PREDICTED: thioredoxin domain-containing pro...  66.6    8e-11   Falco peregrinus [peregrine]
ref|XP_395877.1|  PREDICTED: thioredoxin domain-containing protei...  66.6    8e-11   Apis mellifera [bee]
ref|XP_005178368.1|  PREDICTED: thioredoxin domain-containing pro...  66.6    8e-11   Musca domestica
ref|XP_011506558.1|  PREDICTED: thioredoxin domain-containing pro...  66.6    9e-11   Ceratosolen solmsi marchali
gb|ACI67762.1|  Thioredoxin domain-containing protein 17              66.2    9e-11   Salmo salar
ref|XP_009052019.1|  hypothetical protein LOTGIDRAFT_214285           66.2    1e-10   Lottia gigantea
emb|CBY33091.1|  unnamed protein product                              66.2    1e-10   Oikopleura dioica
ref|XP_001504786.1|  PREDICTED: thioredoxin domain-containing pro...  66.2    1e-10   Equus caballus [domestic horse]
gb|KFP06109.1|  Thioredoxin domain-containing protein 17              65.9    1e-10   Calypte anna
ref|XP_006992253.1|  PREDICTED: thioredoxin domain-containing pro...  67.0    1e-10   Peromyscus maniculatus bairdii
ref|XP_002064726.1|  GK15089                                          66.2    1e-10   Drosophila willistoni
dbj|GAA32185.2|  thioredoxin domain-containing protein 17             67.4    1e-10   Clonorchis sinensis [oriental liver fluke]
emb|CEG76458.1|  hypothetical protein RMATCC62417_11354               65.9    1e-10   Rhizopus microsporus
ref|XP_008307589.1|  PREDICTED: thioredoxin domain-containing pro...  65.9    1e-10   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_003698736.1|  PREDICTED: thioredoxin domain-containing pro...  65.9    2e-10   Apis florea [dwarf honeybee]
ref|XP_002748358.1|  PREDICTED: thioredoxin domain-containing pro...  65.9    2e-10   Callithrix jacchus [common marmoset]
gb|EGU13508.1|  Thioredoxin-like protein 5                            65.9    2e-10   Rhodotorula toruloides ATCC 204091
ref|XP_003706122.1|  PREDICTED: thioredoxin domain-containing pro...  65.5    2e-10   Megachile rotundata
emb|CEJ03732.1|  hypothetical protein RMCBS344292_17711               65.5    2e-10   Rhizopus microsporus
emb|CEG77919.1|  hypothetical protein RMATCC62417_12594               65.5    2e-10   Rhizopus microsporus
gb|KIH61314.1|  hypothetical protein ANCDUO_08418                     65.5    2e-10   Ancylostoma duodenale
emb|CEJ04121.1|  hypothetical protein RMCBS344292_18088               65.5    2e-10   Rhizopus microsporus
ref|NP_001232421.1|  putative thioredoxin-like 5 variant 1            65.1    2e-10   Taeniopygia guttata
ref|NP_001134971.1|  Thioredoxin domain-containing protein 17         65.1    2e-10   Salmo salar
ref|XP_011214704.1|  PREDICTED: thioredoxin domain-containing pro...  65.1    3e-10   Bactrocera dorsalis [papaya fruit fly]
gb|EYC39076.1|  hypothetical protein Y032_0677g1437                   65.1    3e-10   Ancylostoma ceylanicum
ref|XP_001895247.1|  Chain A, Solution Structure Of Mouse Putativ...  65.1    3e-10   Brugia malayi [agent of lymphatic filariasis]
ref|XP_007567437.1|  PREDICTED: thioredoxin domain-containing pro...  65.1    3e-10   Poecilia formosa
ref|NP_001124889.1|  thioredoxin domain-containing protein 17         65.1    3e-10   Pongo abelii [orang utan]
gb|EYC39075.1|  hypothetical protein Y032_0677g1437                   65.1    3e-10   Ancylostoma ceylanicum
gb|ACO14246.1|  Thioredoxin domain-containing protein 17              64.7    3e-10   Esox lucius
gb|ETE67596.1|  Thioredoxin domain-containing protein 17              64.7    4e-10   Ophiophagus hannah
ref|XP_005349691.1|  PREDICTED: thioredoxin domain-containing pro...  65.1    4e-10   Microtus ochrogaster [prairie voles]
ref|XP_003506415.2|  PREDICTED: thioredoxin domain-containing pro...  64.7    4e-10   Cricetulus griseus [Chinese hamsters]
gb|EMS25763.1|  thioredoxin-like protein 5                            64.7    4e-10   Rhodotorula toruloides NP11
ref|XP_009093102.1|  PREDICTED: thioredoxin domain-containing pro...  64.3    4e-10   Serinus canaria [canary]
ref|XP_001662342.1|  AAEL012238-PA                                    64.7    4e-10   Aedes aegypti
ref|XP_001968808.1|  GG25076                                          65.1    5e-10   
ref|XP_003486500.1|  PREDICTED: thioredoxin domain-containing pro...  64.3    5e-10   Bombus impatiens
gb|EIE81083.1|  hypothetical protein RO3G_05788                       67.8    5e-10   Rhizopus delemar RA 99-880
ref|XP_003394559.1|  PREDICTED: thioredoxin domain-containing pro...  64.3    5e-10   Bombus terrestris [large earth bumblebee]
ref|XP_001607213.1|  PREDICTED: thioredoxin domain-containing pro...  64.3    5e-10   Nasonia vitripennis
ref|XP_008853873.1|  PREDICTED: thioredoxin domain-containing pro...  64.3    5e-10   Nannospalax galili
gb|ACI67575.1|  Thioredoxin domain-containing protein 17              64.3    5e-10   Salmo salar
ref|XP_005056618.1|  PREDICTED: thioredoxin domain-containing pro...  64.3    6e-10   Ficedula albicollis
ref|XP_415925.1|  PREDICTED: thioredoxin domain-containing protei...  63.9    6e-10   Gallus gallus [bantam]
ref|XP_001988963.1|  GH10293                                          64.3    6e-10   Drosophila grimshawi
ref|XP_011192211.1|  PREDICTED: thioredoxin domain-containing pro...  64.3    6e-10   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_009467185.1|  PREDICTED: thioredoxin domain-containing pro...  63.9    6e-10   Nipponia nippon
ref|XP_008629284.1|  PREDICTED: thioredoxin domain-containing pro...  63.9    6e-10   Corvus brachyrhynchos
gb|KFR01254.1|  Thioredoxin domain-containing protein 17              63.9    7e-10   Nipponia nippon
ref|XP_002018634.1|  GL25848                                          63.5    7e-10   
ref|XP_005804132.1|  PREDICTED: thioredoxin domain-containing pro...  63.9    7e-10   Xiphophorus maculatus
ref|NP_116120.1|  thioredoxin domain-containing protein 17            63.9    7e-10   Homo sapiens [man]
gb|KFO57123.1|  Thioredoxin domain-containing protein 17              63.9    7e-10   Corvus brachyrhynchos
ref|XP_005184690.1|  PREDICTED: thioredoxin domain-containing pro...  63.9    7e-10   Musca domestica
ref|XP_001026583.1|  hypothetical protein TTHERM_00332160             63.9    7e-10   
ref|XP_008423155.1|  PREDICTED: thioredoxin domain-containing pro...  63.9    7e-10   Poecilia reticulata
ref|NP_001253357.1|  thioredoxin domain-containing protein 17         63.9    7e-10   Macaca mulatta [rhesus macaque]
ref|XP_004911789.1|  PREDICTED: thioredoxin domain-containing pro...  63.9    7e-10   Xenopus tropicalis [western clawed frog]
ref|XP_002052917.1|  GJ19575                                          63.9    7e-10   Drosophila virilis
ref|XP_008048070.1|  PREDICTED: thioredoxin domain-containing pro...  63.9    8e-10   Carlito syrichta
ref|XP_005184688.1|  PREDICTED: thioredoxin domain-containing pro...  63.9    8e-10   Musca domestica
ref|XP_008579334.1|  PREDICTED: thioredoxin domain-containing pro...  63.5    8e-10   Galeopterus variegatus [Malayan flying lemur]
ref|XP_011287104.1|  PREDICTED: thioredoxin domain-containing pro...  63.5    8e-10   
ref|XP_004594931.1|  PREDICTED: thioredoxin domain-containing pro...  63.5    8e-10   Ochotona princeps [southern American pika]
gb|EAS06338.2|  thioredoxin domain protein                            64.3    9e-10   Tetrahymena thermophila SB210
ref|XP_003931393.1|  PREDICTED: thioredoxin domain-containing pro...  64.3    9e-10   Saimiri boliviensis boliviensis
ref|XP_008154965.1|  PREDICTED: thioredoxin domain-containing pro...  63.5    9e-10   Eptesicus fuscus
gb|ACI67984.1|  Thioredoxin domain-containing protein 17              63.5    9e-10   Salmo salar
ref|XP_004930376.1|  PREDICTED: thioredoxin domain-containing pro...  63.5    9e-10   Bombyx mori [silk moth]
ref|XP_007420950.1|  PREDICTED: thioredoxin domain-containing pro...  63.5    9e-10   Python bivittatus
ref|XP_004531229.1|  PREDICTED: thioredoxin domain-containing pro...  63.5    1e-09   Ceratitis capitata [medfly]
gb|EPB85044.1|  hypothetical protein HMPREF1544_08173                 63.5    1e-09   Mucor circinelloides f. circinelloides 1006PhL
ref|NP_001089800.1|  thioredoxin domain containing 17                 63.5    1e-09   Xenopus laevis [clawed frog]
gb|ETN66960.1|  glutaredoxin                                          63.5    1e-09   Anopheles darlingi [American malaria mosquito]
ref|XP_004760552.1|  PREDICTED: thioredoxin domain-containing pro...  63.2    1e-09   Mustela putorius furo [black ferret]
ref|XP_006100730.1|  PREDICTED: thioredoxin domain-containing pro...  63.2    1e-09   Myotis lucifugus
gb|AAR10216.1|  similar to Drosophila melanogaster CG11024            62.8    1e-09   Drosophila yakuba
gb|EGW06936.1|  Thioredoxin domain-containing protein 17              63.9    1e-09   Cricetulus griseus [Chinese hamsters]
gb|EYC39077.1|  hypothetical protein Y032_0677g1437                   63.5    1e-09   Ancylostoma ceylanicum
gb|ERG87337.1|  thioredoxin domain-containing protein 17              63.2    1e-09   
ref|XP_004535326.1|  PREDICTED: thioredoxin domain-containing pro...  62.8    2e-09   Ceratitis capitata [medfly]
gb|KFM06886.1|  Thioredoxin domain-containing protein 17              62.0    2e-09   Aptenodytes forsteri
ref|XP_007054272.1|  PREDICTED: thioredoxin domain-containing pro...  62.4    2e-09   Chelonia mydas [green seaturtle]
emb|CDW56878.1|  DUF953 domain containing protein                     62.4    2e-09   Trichuris trichiura
ref|XP_009276642.1|  PREDICTED: thioredoxin domain-containing pro...  62.0    2e-09   Aptenodytes forsteri
ref|XP_005858933.1|  PREDICTED: thioredoxin domain-containing pro...  62.4    2e-09   Myotis brandtii
gb|KII65905.1|  Thioredoxin-like protein Clot                         62.8    2e-09   Thelohanellus kitauei
ref|XP_006922289.1|  PREDICTED: thioredoxin domain-containing pro...  62.4    2e-09   Pteropus alecto
ref|XP_005356154.1|  PREDICTED: thioredoxin domain-containing pro...  62.4    2e-09   
ref|XP_002423954.1|  conserved hypothetical protein                   62.4    2e-09   Pediculus humanus corporis [human body lice]
dbj|GAN09157.1|  thioredoxin fold domain-containing protein           62.4    2e-09   Mucor ambiguus
ref|XP_004398663.1|  PREDICTED: thioredoxin domain-containing pro...  62.4    2e-09   
gb|ELK35828.1|  Thioredoxin domain-containing protein 17              62.4    2e-09   Myotis davidii
ref|XP_011307286.1|  PREDICTED: thioredoxin domain-containing pro...  62.4    2e-09   Fopius arisanus
ref|XP_004267062.1|  PREDICTED: thioredoxin domain-containing pro...  62.4    2e-09   Orcinus orca [Orca]
ref|XP_006863353.1|  PREDICTED: thioredoxin domain-containing pro...  62.4    3e-09   Chrysochloris asiatica
ref|XP_006165205.1|  PREDICTED: thioredoxin domain-containing pro...  62.4    3e-09   Tupaia chinensis
ref|XP_007248707.1|  PREDICTED: thioredoxin domain-containing pro...  62.0    3e-09   
ref|XP_011214705.1|  PREDICTED: thioredoxin domain-containing pro...  62.4    3e-09   Bactrocera dorsalis [papaya fruit fly]
ref|XP_002089215.1|  cl                                               62.8    3e-09   
ref|XP_004455586.1|  PREDICTED: thioredoxin domain-containing pro...  63.2    3e-09   
gb|KFB48490.1|  AGAP003178-PA-like protein                            62.0    3e-09   Anopheles sinensis
ref|XP_002718893.1|  PREDICTED: thioredoxin domain-containing pro...  62.0    3e-09   Oryctolagus cuniculus [domestic rabbit]
ref|XP_008557167.1|  PREDICTED: thioredoxin domain-containing pro...  62.0    3e-09   Microplitis demolitor
ref|XP_002078240.1|  GD23345                                          62.8    3e-09   Drosophila simulans
ref|XP_011506560.1|  PREDICTED: thioredoxin domain-containing pro...  61.2    3e-09   Ceratosolen solmsi marchali
ref|NP_001290774.1|  thioredoxin domain containing 17                 62.0    4e-09   Esox lucius
ref|XP_008008233.1|  PREDICTED: thioredoxin domain-containing pro...  62.4    4e-09   Chlorocebus sabaeus
ref|NP_001156529.1|  thioredoxin domain-containing protein 17         61.6    4e-09   Ovis aries [domestic sheep]
ref|XP_006031347.1|  PREDICTED: thioredoxin domain-containing pro...  61.6    4e-09   Alligator sinensis
ref|XP_005337387.1|  PREDICTED: thioredoxin domain-containing pro...  61.6    4e-09   Ictidomys tridecemlineatus
emb|CEP15118.1|  hypothetical protein                                 61.6    4e-09   Parasitella parasitica
gb|EJW87659.1|  hypothetical protein WUBG_01435                       61.6    4e-09   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_004665765.1|  PREDICTED: thioredoxin domain-containing pro...  61.6    4e-09   Jaculus jaculus
ref|XP_005739436.1|  PREDICTED: thioredoxin domain-containing pro...  61.6    4e-09   Pundamilia nyererei
ref|XP_008085043.1|  Thioredoxin-like protein                         61.6    4e-09   Glarea lozoyensis ATCC 20868
ref|XP_006274071.1|  PREDICTED: thioredoxin domain-containing pro...  61.6    5e-09   
gb|AEE63443.1|  unknown                                               61.6    5e-09   Dendroctonus ponderosae
ref|XP_011192212.1|  PREDICTED: thioredoxin domain-containing pro...  61.6    5e-09   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_004804225.1|  PREDICTED: thioredoxin domain-containing pro...  62.0    5e-09   
ref|XP_004310493.1|  PREDICTED: thioredoxin domain-containing pro...  61.6    5e-09   Tursiops truncatus [Atlantic bottle-nosed dolphin]
ref|NP_608930.1|  clot, isoform A                                     61.2    5e-09   Drosophila melanogaster
ref|XP_002037954.1|  GM18551                                          62.0    6e-09   Drosophila sechellia
ref|XP_006756359.1|  PREDICTED: thioredoxin domain-containing pro...  61.6    6e-09   Myotis davidii
ref|XP_005298976.1|  PREDICTED: thioredoxin domain-containing pro...  60.8    7e-09   Chrysemys picta bellii
ref|XP_007102864.1|  PREDICTED: thioredoxin domain-containing pro...  60.8    7e-09   Physeter catodon
ref|XP_007102865.1|  PREDICTED: thioredoxin domain-containing pro...  60.5    8e-09   
ref|XP_007523169.1|  PREDICTED: thioredoxin domain-containing pro...  60.8    8e-09   Erinaceus europaeus [common hedgehog]
ref|XP_006756358.1|  PREDICTED: thioredoxin domain-containing pro...  61.6    9e-09   
ref|NP_001279378.1|  thioredoxin domain containing 17                 60.5    9e-09   Callorhinchus milii [Australian ghost shark]
gb|ADX31293.1|  thioredoxin                                           60.5    9e-09   Ruditapes philippinarum [Japanese littleneck]
ref|XP_006060073.1|  PREDICTED: thioredoxin domain-containing pro...  60.5    1e-08   Bubalus bubalis [domestic water buffalo]
ref|XP_004075376.1|  PREDICTED: thioredoxin domain-containing pro...  60.5    1e-08   Oryzias latipes [Japanese rice fish]
ref|NP_001192750.1|  thioredoxin domain-containing protein 17         60.5    1e-08   Bos taurus [bovine]
ref|NP_001003456.1|  thioredoxin domain-containing protein 17         60.5    1e-08   Danio rerio [leopard danio]
ref|XP_003031920.1|  hypothetical protein SCHCODRAFT_11292            60.5    1e-08   Schizophyllum commune H4-8
gb|EFB23018.1|  hypothetical protein PANDA_018193                     60.1    1e-08   Ailuropoda melanoleuca
ref|XP_004177061.1|  PREDICTED: LOW QUALITY PROTEIN: thioredoxin ...  60.1    1e-08   
ref|XP_006801603.1|  PREDICTED: thioredoxin domain-containing pro...  60.1    1e-08   
ref|XP_004376168.1|  PREDICTED: thioredoxin domain-containing pro...  60.1    1e-08   
ref|XP_002928281.1|  PREDICTED: thioredoxin domain-containing pro...  60.1    1e-08   
ref|XP_007177460.1|  PREDICTED: thioredoxin domain-containing pro...  60.1    1e-08   
ref|XP_008287280.1|  PREDICTED: thioredoxin domain-containing pro...  60.1    2e-08   
ref|XP_004558236.1|  PREDICTED: thioredoxin domain-containing pro...  60.1    2e-08   
gb|EPT03523.1|  hypothetical protein FOMPIDRAFT_1142508               59.7    2e-08   
gb|ACI66088.1|  Thioredoxin domain-containing protein 17              59.3    2e-08   
ref|XP_005154448.1|  PREDICTED: thioredoxin domain-containing pro...  59.7    2e-08   
ref|XP_006217656.1|  PREDICTED: thioredoxin domain-containing pro...  59.7    2e-08   
ref|XP_003782789.1|  PREDICTED: thioredoxin domain-containing pro...  59.7    2e-08   
emb|CAC51430.1|  putative 42-9-9 protein                              59.3    2e-08   
ref|XP_006177082.1|  PREDICTED: thioredoxin domain-containing pro...  59.7    2e-08   
ref|XP_003440170.1|  PREDICTED: thioredoxin domain-containing pro...  59.7    2e-08   
gb|KIJ66206.1|  hypothetical protein HYDPIDRAFT_109190                59.7    2e-08   
ref|XP_003131925.1|  PREDICTED: thioredoxin domain-containing pro...  59.7    2e-08   
gb|EJY71605.1|  DUF953 domain containing protein                      59.7    2e-08   
ref|XP_006899834.1|  PREDICTED: thioredoxin domain-containing pro...  59.3    2e-08   
dbj|GAA51593.1|  thioredoxin domain-containing protein 17             63.2    2e-08   
ref|XP_004605284.1|  PREDICTED: thioredoxin domain-containing pro...  59.3    2e-08   
ref|XP_003738258.1|  PREDICTED: thioredoxin domain-containing pro...  59.3    3e-08   
ref|XP_007935696.1|  PREDICTED: thioredoxin domain-containing pro...  59.3    3e-08   
ref|XP_004889141.1|  PREDICTED: thioredoxin domain-containing pro...  59.3    3e-08   
ref|XP_004909838.1|  PREDICTED: thioredoxin domain-containing pro...  59.3    3e-08   
emb|CDS31923.1|  thioredoxin domain containing protein 17             58.9    3e-08   
ref|XP_004638366.1|  PREDICTED: thioredoxin domain-containing pro...  58.9    3e-08   
ref|XP_004341619.1|  hypothetical protein ACA1_269750                 60.1    4e-08   
ref|XP_010609638.1|  PREDICTED: thioredoxin domain-containing pro...  58.9    4e-08   
gb|KEQ67403.1|  hypothetical protein M437DRAFT_35917                  58.9    4e-08   
ref|XP_007451656.1|  PREDICTED: thioredoxin domain-containing pro...  58.9    4e-08   
ref|XP_005399722.1|  PREDICTED: thioredoxin domain-containing pro...  58.9    4e-08   
ref|XP_003416905.1|  PREDICTED: thioredoxin domain-containing pro...  58.5    5e-08   
ref|XP_003856200.1|  hypothetical protein MYCGRDRAFT_32913            58.5    5e-08   
ref|XP_967120.2|  PREDICTED: thioredoxin domain-containing protei...  58.5    5e-08   
gb|KEQ93592.1|  hypothetical protein AUEXF2481DRAFT_6661              58.2    7e-08   
ref|XP_003469685.1|  PREDICTED: thioredoxin domain-containing pro...  58.2    7e-08   
ref|NP_596592.1|  DUF953 family protein                               57.8    8e-08   
gb|KFB53732.1|  AGAP009738-PA-like protein                            57.8    8e-08   
ref|XP_003766710.1|  PREDICTED: thioredoxin domain-containing pro...  57.8    8e-08   
ref|XP_011134566.1|  putative thioredoxin domain protein              57.8    9e-08   
gb|ETN62579.1|  glutaredoxin                                          57.8    9e-08   
gb|KDN61141.1|  hypothetical protein CSUB01_00822                     57.8    1e-07   
gb|EGT53528.1|  hypothetical protein CAEBREN_22377                    57.8    1e-07   
ref|NP_001155391.1|  thioredoxin domain-containing protein 17-like    57.8    1e-07   
gb|EFQ29107.1|  hypothetical protein GLRG_04251                       57.4    1e-07   
ref|XP_004716209.1|  PREDICTED: thioredoxin domain-containing pro...  57.4    1e-07   
ref|XP_318823.2|  AGAP009738-PA                                       57.4    1e-07   
ref|XP_007292330.1|  hypothetical protein MBM_04441                   57.4    1e-07   
gb|KIK87035.1|  hypothetical protein PAXRUDRAFT_691165                57.0    2e-07   
gb|KEQ82772.1|  hypothetical protein M438DRAFT_336746                 57.0    2e-07   
ref|XP_004684803.1|  PREDICTED: thioredoxin domain-containing pro...  56.6    2e-07   
ref|XP_007337292.1|  hypothetical protein AURDEDRAFT_156207           56.6    2e-07   
gb|EHK40213.1|  hypothetical protein TRIATDRAFT_302638                56.2    2e-07   
emb|CCF46515.1|  hypothetical protein CH063_03890                     56.2    3e-07   
ref|XP_010790780.1|  PREDICTED: thioredoxin domain-containing pro...  56.2    3e-07   
ref|XP_001662259.1|  AAEL012116-PA                                    56.2    3e-07   
ref|XP_010734961.1|  PREDICTED: thioredoxin domain-containing pro...  56.2    4e-07   
ref|XP_002675554.1|  predicted protein                                58.9    4e-07   
ref|XP_004349465.1|  hypothetical protein CAOG_02715                  56.2    4e-07   
gb|KJE91597.1|  hypothetical protein CAOG_002715                      56.2    4e-07   
gb|EWG38381.1|  hypothetical protein FVEG_01606                       55.5    4e-07   
ref|XP_007283849.1|  thioredoxin-like protein 5                       55.8    5e-07   
gb|KIY73573.1|  hypothetical protein CYLTODRAFT_485419                55.5    5e-07   
gb|AFH68185.1|  thioredoxin-like protein 14                           55.5    6e-07   
gb|ETS07227.1|  hypothetical protein M419DRAFT_68896                  55.5    6e-07   
ref|XP_004362609.1|  thioredoxin fold domain-containing protein       55.5    6e-07   
ref|XP_001847851.1|  glutaredoxin                                     55.5    6e-07   
gb|EFA81846.1|  thioredoxin fold domain-containing protein            55.5    6e-07   
ref|NP_497626.1|  Protein Y71H2AR.1                                   55.5    7e-07   
ref|XP_005843096.1|  hypothetical protein CHLNCDRAFT_141501           55.5    7e-07   
ref|XP_004591733.1|  PREDICTED: thioredoxin domain-containing pro...  55.5    7e-07   
gb|EJU02630.1|  thioredoxin-like protein                              55.5    7e-07   
ref|XP_004037287.1|  thioredoxin-related protein 14, putative         55.5    7e-07   
gb|KIL71514.1|  hypothetical protein M378DRAFT_225100                 55.1    7e-07   
gb|ACQ58847.1|  Thioredoxin domain-containing protein 17              55.1    7e-07   
gb|AGT42005.1|  TRP14                                                 55.1    8e-07   
emb|CCC52665.1|  conserved hypothetical protein                       57.8    8e-07   
emb|CCI46961.1|  unnamed protein product                              57.8    9e-07   
ref|XP_001435307.1|  hypothetical protein                             54.7    1e-06   
emb|CCM00024.1|  predicted protein                                    54.7    1e-06   
emb|CCO31779.1|  hypothetical protein BN14_05829                      54.3    1e-06   
ref|XP_007391072.1|  hypothetical protein PHACADRAFT_83680            54.3    1e-06   
gb|KIJ22011.1|  hypothetical protein PAXINDRAFT_165324                54.3    2e-06   
ref|XP_003968579.1|  PREDICTED: thioredoxin domain-containing pro...  54.3    2e-06   
ref|XP_008031941.1|  hypothetical protein TRAVEDRAFT_32840            53.9    2e-06   
ref|XP_001458405.1|  hypothetical protein                             54.3    2e-06   
gb|ACG47569.1|  thioredoxin-like protein 5                            54.3    2e-06   
gb|KFA81785.1|  hypothetical protein S40288_07003                     53.9    2e-06   
ref|XP_011112401.1|  hypothetical protein H072_6618                   54.3    2e-06   
ref|XP_006747047.1|  PREDICTED: 1,2-dihydroxy-3-keto-5-methylthio...  56.2    3e-06   
gb|KIM24968.1|  hypothetical protein M408DRAFT_331442                 53.5    3e-06   
ref|XP_002956357.1|  hypothetical protein VOLCADRAFT_107196           55.1    3e-06   
ref|XP_002011697.1|  GI11174                                          53.9    3e-06   
gb|EKC99265.1|  hypothetical protein A1Q2_06465                       54.3    3e-06   
gb|EJT48370.1|  hypothetical protein A1Q1_02653                       53.9    3e-06   
ref|XP_001693996.1|  predicted protein                                54.7    3e-06   
ref|XP_001513772.1|  PREDICTED: thioredoxin domain-containing pro...  53.5    3e-06   
ref|XP_001276063.1|  DUF953 domain protein                            53.5    3e-06   
ref|XP_002171767.1|  DUF953 family protein                            53.1    4e-06   
gb|KEQ69392.1|  hypothetical protein M436DRAFT_76312                  53.1    4e-06   
gb|EHK25070.1|  hypothetical protein TRIVIDRAFT_81916                 53.1    4e-06   
gb|EPY53648.1|  DUF953 family protein                                 53.1    4e-06   
gb|KFA69513.1|  hypothetical protein S40285_05684                     53.1    4e-06   
gb|KDN50867.1|  thioredoxin-like protein                              53.1    4e-06   
ref|XP_009521039.1|  hypothetical protein PHYSODRAFT_478912           55.5    4e-06   
ref|XP_011200370.1|  PREDICTED: thioredoxin domain-containing pro...  53.1    5e-06   
emb|CCA71331.1|  hypothetical protein PIIN_05270                      53.5    5e-06   
gb|KJA28413.1|  hypothetical protein HYPSUDRAFT_33788                 52.8    6e-06   
gb|EDM05094.1|  thioredoxin-like 5 (predicted), isoform CRA_a         52.0    6e-06   
ref|XP_007732355.1|  hypothetical protein A1O3_04034                  52.4    6e-06   
ref|XP_007879630.1|  hypothetical protein PFL1_03916                  52.8    6e-06   
gb|KFA50655.1|  hypothetical protein S40293_04905                     52.8    6e-06   
gb|KEY72801.1|  hypothetical protein S7711_04394                      52.8    6e-06   
ref|XP_001394794.1|  hypothetical protein ANI_1_2334094               52.8    6e-06   
ref|XP_003711802.1|  hypothetical protein MGG_05962                   52.8    6e-06   
gb|KDN40853.1|  hypothetical protein RSAG8_07871                      52.0    7e-06   
emb|CDS22756.1|  thioredoxin domain containing protein 17             52.4    7e-06   
ref|XP_681899.1|  hypothetical protein AN8630.2                       52.8    7e-06   
emb|CCT70596.1|  uncharacterized protein FFUJ_06583                   52.4    7e-06   
ref|XP_011200369.1|  PREDICTED: thioredoxin domain-containing pro...  53.1    8e-06   
dbj|GAA85878.1|  DUF953 domain protein                                52.4    8e-06   
ref|XP_002003571.1|  GI17989                                          52.0    9e-06   
emb|CCA22749.1|  conserved hypothetical protein                       54.7    1e-05   
gb|EPX71157.1|  DUF953 family protein                                 52.0    1e-05   
dbj|GAM22436.1|  hypothetical protein SAMD00019534_056110             52.0    1e-05   
ref|XP_011182048.1|  PREDICTED: thioredoxin domain-containing pro...  52.0    1e-05   
ref|XP_001732969.1|  thioredoxin fold domain-containing protein       52.0    1e-05   
gb|EHA19887.1|  hypothetical protein ASPNIDRAFT_39312                 52.4    1e-05   
ref|XP_007597767.1|  hypothetical protein CFIO01_05542                52.0    1e-05   
gb|ENH62290.1|  Thioredoxin-like protein Clot                         51.6    1e-05   
dbj|GAM39533.1|  DUF953 domain protein                                52.0    1e-05   
gb|KEP54185.1|  thioredoxin-like protein                              51.6    1e-05   
gb|EXM08645.1|  hypothetical protein FOIG_01721                       51.6    1e-05   
gb|KIJ54230.1|  hypothetical protein M422DRAFT_153602                 51.2    1e-05   
ref|XP_001976782.1|  GG18647                                          52.0    1e-05   
gb|EDL12664.1|  thioredoxin-like 5, isoform CRA_a                     50.8    1e-05   
ref|XP_006677509.1|  hypothetical protein BATDEDRAFT_86770            51.6    2e-05   
gb|EUC59208.1|  thioredoxin-like protein                              51.6    2e-05   
ref|XP_002904979.1|  conserved hypothetical protein                   53.9    2e-05   
gb|EXA41504.1|  hypothetical protein FOVG_09979                       51.2    2e-05   
gb|KII93677.1|  hypothetical protein PLICRDRAFT_100806                51.2    2e-05   
gb|EWZ81897.1|  hypothetical protein FOWG_14321                       51.2    2e-05   
gb|KDQ18261.1|  hypothetical protein BOTBODRAFT_128360                51.6    2e-05   
emb|CDO73100.1|  hypothetical protein BN946_scf185007.g154            54.3    2e-05   
ref|XP_003466870.1|  PREDICTED: thioredoxin domain-containing pro...  51.6    2e-05   
gb|KIO24183.1|  hypothetical protein M407DRAFT_103175                 51.2    2e-05   
gb|EXM16097.1|  hypothetical protein FOTG_15570                       50.8    2e-05   
gb|EWY87793.1|  hypothetical protein FOYG_09185                       50.8    2e-05   
ref|XP_003792232.1|  PREDICTED: uncharacterized protein LOC100953464  53.5    2e-05   
gb|KIM47477.1|  hypothetical protein M413DRAFT_439137                 50.4    3e-05   
ref|XP_009031750.1|  hypothetical protein HELRODRAFT_186220           50.8    3e-05   
ref|NP_570048.1|  CG3939, isoform A                                   50.4    4e-05   
gb|AAY27505.2|  CG3939                                                50.1    5e-05   
ref|XP_007841041.1|  hypothetical protein PFICI_14269                 50.1    5e-05   
gb|AAY27493.2|  CG3939                                                50.1    5e-05   
ref|XP_003041569.1|  hypothetical protein NECHADRAFT_34957            49.7    5e-05   
ref|XP_006263984.1|  PREDICTED: thioredoxin domain-containing pro...  49.3    6e-05   
gb|AAY27533.2|  CG3939                                                50.1    6e-05   
ref|XP_001829208.1|  hypothetical protein CC1G_06545                  50.1    6e-05   
ref|XP_001992320.1|  GH24687                                          50.1    6e-05   
gb|AAY27497.1|  CG3939                                                50.1    6e-05   
emb|CBH17050.1|  hypothetical protein, conserved                      52.0    7e-05   
ref|XP_828245.1|  hypothetical protein                                52.0    7e-05   
ref|XP_002061206.1|  GK10352                                          50.1    7e-05   
ref|XP_003723064.1|  conserved hypothetical protein                   52.0    7e-05   
ref|XP_010698714.1|  acireductone dioxygenase (ARD)-like protein,...  52.0    8e-05   
gb|EPE07536.1|  hypothetical protein F503_00258                       50.8    8e-05   
gb|AAY27433.1|  CG3939                                                49.7    8e-05   
gb|AAY27477.1|  CG3939                                                49.7    8e-05   
gb|AAY27489.2|  CG3939                                                49.7    9e-05   
gb|KIN07495.1|  hypothetical protein OIDMADRAFT_16173                 49.3    9e-05   
gb|AAY27513.1|  CG3939                                                49.7    9e-05   
gb|KDE09453.1|  hypothetical protein MVLG_00355                       49.7    9e-05   
gb|AAY27509.1|  CG3939                                                49.7    9e-05   
gb|KDR85746.1|  hypothetical protein GALMADRAFT_234806                49.3    9e-05   
gb|KDE04493.1|  hypothetical protein MVLG_05059                       49.7    1e-04   
gb|KFZ46146.1|  Thioredoxin domain-containing protein 17              48.5    1e-04   
gb|KID92749.1|  DUF953 domain protein                                 49.3    1e-04   
gb|AAY27432.1|  CG3939                                                49.7    1e-04   
gb|KIE01716.1|  DUF953 domain protein                                 49.3    1e-04   
ref|XP_007818546.1|  DUF953 domain protein                            49.3    1e-04   
ref|XP_002100190.1|  GE16296                                          49.3    1e-04   
ref|XP_002143736.1|  DUF953 domain protein                            49.3    1e-04   
gb|KFP46132.1|  Thioredoxin domain-containing protein 17              48.5    1e-04   
gb|KIP11094.1|  hypothetical protein PHLGIDRAFT_60352                 48.5    1e-04   
ref|XP_007002431.1|  hypothetical protein TREMEDRAFT_28131            48.9    1e-04   
emb|CDW71746.1|  UNKNOWN                                              49.3    1e-04   
gb|KHO01607.1|  hypothetical protein MAM_00608                        48.9    1e-04   
gb|EWZ40731.1|  hypothetical protein FOZG_09363                       48.5    1e-04   
gb|EGU86363.1|  hypothetical protein FOXB_03122                       48.5    1e-04   
ref|XP_002106037.1|  GD16632                                          48.9    2e-04   
ref|XP_002568133.1|  Pc21g11010                                       48.9    2e-04   
gb|ESZ90359.1|  hypothetical protein SBOR_9250                        48.9    2e-04   
gb|ELT93421.1|  hypothetical protein CAPTEDRAFT_228764                50.4    2e-04   
gb|AAY27537.1|  CG3939                                                48.9    2e-04   
gb|AAW27079.1|  SJCHGC01827 protein                                   48.9    2e-04   
ref|XP_007860264.1|  hypothetical protein GLOTRDRAFT_31613            48.5    2e-04   
gb|ESS63986.1|  1,2-Dihydroxy-3-keto-5-methylthiopentene dioxygenase  50.4    2e-04   
ref|XP_009308284.1|  1,2-Dihydroxy-3-keto-5-methylthiopentene dio...  50.4    2e-04   
emb|CAG08948.1|  unnamed protein product                              48.5    2e-04   
gb|EKG03480.1|  1,2-Dihydroxy-3-keto-5-methylthiopentene dioxygen...  50.4    2e-04   
ref|XP_006965739.1|  predicted protein                                47.8    3e-04   
ref|XP_007298789.1|  hypothetical protein STEHIDRAFT_127155           48.1    3e-04   
ref|XP_006959706.1|  hypothetical protein WALSEDRAFT_61059            48.1    3e-04   
gb|KFQ80273.1|  Thioredoxin domain-containing protein 17              47.4    3e-04   
emb|CDM29252.1|  Thioredoxin-like fold                                48.1    3e-04   
ref|XP_001967544.1|  GF19600                                          48.1    3e-04   
ref|XP_009269316.1|  Pre-mRNA-splicing ATP-dependent RNA helicase...  50.4    3e-04   
gb|KGO72294.1|  hypothetical protein PITC_050940                      47.8    4e-04   
gb|KIK30165.1|  hypothetical protein PISMIDRAFT_671294                47.8    4e-04   
gb|ETM37034.1|  hypothetical protein L914_16379                       49.7    4e-04   
ref|XP_008912311.1|  hypothetical protein PPTG_16522                  49.7    4e-04   
gb|ETO65680.1|  hypothetical protein F444_17047                       49.7    4e-04   
gb|ETK77162.1|  hypothetical protein L915_16547                       49.7    4e-04   
gb|ETP34846.1|  hypothetical protein F442_16874                       49.7    4e-04   
gb|KIR39034.1|  hypothetical protein I313_05183                       47.4    5e-04   
gb|AAU93510.1|  glutathione-dependent peroxidase                      46.6    5e-04   
gb|KGO43870.1|  hypothetical protein PEXP_093120                      47.4    5e-04   
gb|KIS02500.1|  hypothetical protein L804_00770                       47.4    6e-04   
gb|KIR36631.1|  hypothetical protein I352_01589                       47.4    6e-04   
gb|KGB78841.1|  hypothetical protein CNBG_4679                        47.4    6e-04   



>ref|XP_009798568.1| PREDICTED: thioredoxin-like protein Clot [Nicotiana sylvestris]
Length=132

 Score =   206 bits (523),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPLKVLDAT+ATFNGVFEKF+AEAP+NKAN ILFLADI+PST+LSWCPDCVRAEPVIYKK
Sbjct  1    MPLKVLDATIATFNGVFEKFRAEAPQNKANFILFLADIDPSTNLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQRS  343
            +E S++D+ALL+AYVGDRPTWR PQHPWRVDP+FNLKGVPTLIRWE+ A + 
Sbjct  61   MEESAEDIALLRAYVGDRPTWRTPQHPWRVDPSFNLKGVPTLIRWENDATKG  112



>ref|XP_006338899.1| PREDICTED: thioredoxin-like protein Clot-like [Solanum tuberosum]
Length=132

 Score =   205 bits (522),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPLKVLDATVATF+GVFEKF+AE+PKNKAN ILFLADI+PST+LSWCPDCVRAEPVIYKK
Sbjct  1    MPLKVLDATVATFDGVFEKFRAESPKNKANFILFLADIDPSTNLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            LEASSDD+ALL+AYVGDRPTWR PQHPWRVD  FNLKGVPTLIRWE+ A
Sbjct  61   LEASSDDIALLRAYVGDRPTWRTPQHPWRVDGRFNLKGVPTLIRWENDA  109



>ref|XP_010327286.1| PREDICTED: thioredoxin-like protein Clot [Solanum lycopersicum]
Length=132

 Score =   202 bits (513),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPLKVLDAT+ TF+GVFEKFKAE+PKNKAN ILFLADI+PST+LSWCPDCVRAEPVIYKK
Sbjct  1    MPLKVLDATITTFDGVFEKFKAESPKNKANFILFLADIDPSTNLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            LEAS DD+ALL+AYVGDRPTWR PQHPWRVD  FNLKGVPTLIRWE+ A
Sbjct  61   LEASYDDIALLRAYVGDRPTWRTPQHPWRVDGRFNLKGVPTLIRWENDA  109



>gb|ADR70871.1| thioredoxin-like family protein [Hevea brasiliensis]
Length=132

 Score =   197 bits (502),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPLK+LDATV+TF+GVFEKF++EAPKNKANLILFLAD +PST+LSWCPDCVRAEPVIYKK
Sbjct  1    MPLKLLDATVSTFDGVFEKFRSEAPKNKANLILFLADKDPSTNLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            LEASSDD+ALL+AYVGDRPTWRNPQHPWRVD  F L GVPTL+ WE+ A
Sbjct  61   LEASSDDIALLRAYVGDRPTWRNPQHPWRVDSRFKLTGVPTLVSWENDA  109



>ref|XP_003531426.1| PREDICTED: thioredoxin-like protein Clot-like [Glycine max]
 gb|KHN29199.1| Thioredoxin-like protein Clot [Glycine soja]
Length=132

 Score =   196 bits (498),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            M LKVLDATV++F+GVFEKF++EAPKNKANLILFLAD +PSTSLSWCPDCVRAEPVIYKK
Sbjct  1    MTLKVLDATVSSFDGVFEKFRSEAPKNKANLILFLADKDPSTSLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWED  328
            LEASSD+++LL+AYVGDRPTWRNPQHPWRV P F L GVPTLIRWE+
Sbjct  61   LEASSDEISLLRAYVGDRPTWRNPQHPWRVQPRFKLTGVPTLIRWEN  107



>emb|CDP07714.1| unnamed protein product [Coffea canephora]
Length=132

 Score =   195 bits (496),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MP+KV+DAT++ F+GVF+KFKAEAP  KANLILFLAD +P+TSLSWCPDCVRAEPVIYKK
Sbjct  1    MPMKVMDATLSNFDGVFDKFKAEAPNYKANLILFLADKDPATSLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            LE SSDD+ALL+AYVGDRPTWRNPQHPWRVD  F L+GVPTL+RWE+GA
Sbjct  61   LEVSSDDIALLRAYVGDRPTWRNPQHPWRVDSTFKLRGVPTLVRWENGA  109



>ref|XP_007218586.1| hypothetical protein PRUPE_ppa013260mg [Prunus persica]
 ref|XP_008231331.1| PREDICTED: thioredoxin-like protein Clot [Prunus mume]
 gb|EMJ19785.1| hypothetical protein PRUPE_ppa013260mg [Prunus persica]
Length=132

 Score =   193 bits (491),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPLK+LDAT++TF+ VFEKF+AEAPKNKANLILFLAD +PSTSLSWCPDCVRAEPVIYKK
Sbjct  1    MPLKLLDATISTFDSVFEKFRAEAPKNKANLILFLADKDPSTSLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            LEA++DDVALL+AYVGDRPTWRNP HPWRVD  F L GVPTL RWE+ A
Sbjct  61   LEATADDVALLRAYVGDRPTWRNPVHPWRVDSRFKLTGVPTLFRWENDA  109



>ref|NP_001239644.1| uncharacterized protein LOC100785157 [Glycine max]
 gb|ACU13745.1| unknown [Glycine max]
 gb|ACU17879.1| unknown [Glycine max]
 gb|KHN49027.1| Thioredoxin-like protein Clot [Glycine soja]
Length=132

 Score =   193 bits (490),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPLKVL+ATV++F+ VFEKF++EAP+NKANLILFLAD +P+TSLSWCPDCVRAEPVIYKK
Sbjct  1    MPLKVLEATVSSFDVVFEKFRSEAPQNKANLILFLADNDPATSLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQRS  343
            LEAS DD+ALL+AYVGDRPTWRNPQHPWRVDP F L GVPTLIRWE+   + 
Sbjct  61   LEASPDDIALLRAYVGDRPTWRNPQHPWRVDPRFKLTGVPTLIRWENNTVKG  112



>ref|XP_002513195.1| electron transporter, putative [Ricinus communis]
 gb|EEF49186.1| electron transporter, putative [Ricinus communis]
Length=132

 Score =   191 bits (486),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPLK++DAT++TF+ VFEKFK+EA KNKANLILFLAD +PST+LSWCPDCVRAEPVIYKK
Sbjct  1    MPLKLVDATISTFDSVFEKFKSEAAKNKANLILFLADKDPSTNLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            LEASSDDV LL+AYVGDRPTWRNPQHPWRVD  F L GVPTL+ WED A
Sbjct  61   LEASSDDVTLLRAYVGDRPTWRNPQHPWRVDSKFKLTGVPTLVCWEDDA  109



>emb|CDP07717.1| unnamed protein product [Coffea canephora]
Length=132

 Score =   191 bits (486),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MP+KVLDAT++ F+GVF+KFKAEAP  KANLILFLAD +P TSLSWCPDCVRAEPVIYKK
Sbjct  1    MPMKVLDATLSNFDGVFDKFKAEAPNYKANLILFLADKDPVTSLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            LE SSDD+ALL+AYVGDRPTWRNPQHPWRVD  F L+GVPTL+RWE+ A
Sbjct  61   LEVSSDDMALLRAYVGDRPTWRNPQHPWRVDSTFKLRGVPTLVRWENDA  109



>ref|XP_007149056.1| hypothetical protein PHAVU_005G037200g [Phaseolus vulgaris]
 gb|ESW21050.1| hypothetical protein PHAVU_005G037200g [Phaseolus vulgaris]
Length=132

 Score =   190 bits (482),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPLKVL+ATV++F+GVFEKF++EA +NKANLILFLAD +P+TSLSWCPDCVRAEP IY K
Sbjct  1    MPLKVLEATVSSFDGVFEKFRSEAAQNKANLILFLADNDPATSLSWCPDCVRAEPAIYMK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDG  331
            LEASSD++ALL+AYVGDRPTWRNP HPWRVDP F L GVPTLIRWE+ 
Sbjct  61   LEASSDEIALLRAYVGDRPTWRNPHHPWRVDPRFKLTGVPTLIRWENN  108



>gb|AFK40345.1| unknown [Lotus japonicus]
Length=132

 Score =   190 bits (482),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPLK+ DATV+TF+GVF+KF++EA +NKANLILFLAD +P+TSLSWCPDCVRAEPVIYKK
Sbjct  1    MPLKLFDATVSTFDGVFDKFRSEASQNKANLILFLADKDPATSLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWED  328
            LEAS DD+AL++AYVGDRPTWRNP HPWRVDP F L GVPTLIRWE+
Sbjct  61   LEASPDDIALIRAYVGDRPTWRNPHHPWRVDPKFKLTGVPTLIRWEN  107



>gb|EYU31342.1| hypothetical protein MIMGU_mgv1a016170mg [Erythranthe guttata]
Length=132

 Score =   189 bits (481),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MP+KV+DATV+TF  VFEKFK+EA  +KANLILFLAD EPST+LSWCPDCVRAEPVIYKK
Sbjct  1    MPMKVVDATVSTFGEVFEKFKSEADNHKANLILFLADNEPSTNLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQRS  343
            L++S DDVALL+AYVGDRPTWRNP HPWR D +F L+GVPTLIRWEDGA ++
Sbjct  61   LDSSPDDVALLRAYVGDRPTWRNPVHPWRTDSSFKLRGVPTLIRWEDGAVKA  112



>ref|XP_011093375.1| PREDICTED: thioredoxin-like protein Clot [Sesamum indicum]
Length=163

 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    QKMPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIY  181
            QKMP+K LDATV+TF GVFEKF++EA  NKAN ILFLAD +PST+LSWCPDCVRAEPVIY
Sbjct  30   QKMPMKTLDATVSTFEGVFEKFRSEAANNKANFILFLADKDPSTNLSWCPDCVRAEPVIY  89

Query  182  KKLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQRS  343
            KKLEAS D+VALL+AYVGDRPTWRNP HP+R D  F+LKGVPTLI WEDG  ++
Sbjct  90   KKLEASPDNVALLRAYVGDRPTWRNPLHPFRSDSRFSLKGVPTLILWEDGVVKA  143



>gb|KDP43426.1| hypothetical protein JCGZ_16713 [Jatropha curcas]
Length=132

 Score =   188 bits (478),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPLK++DATV+ F+ VFE F++EAPKNKANLILFLAD +PST+LSWCPDCVRAEPVIYKK
Sbjct  1    MPLKLVDATVSNFDSVFEMFRSEAPKNKANLILFLADKDPSTNLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWED  328
            LEASSDD+ALL+AYVGDRPTWRNPQHPWRVD  F L GVPTL+ WE+
Sbjct  61   LEASSDDIALLRAYVGDRPTWRNPQHPWRVDSRFKLTGVPTLVSWEN  107



>ref|XP_010265834.1| PREDICTED: thioredoxin-like protein Clot [Nelumbo nucifera]
Length=140

 Score =   188 bits (478),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPL +LDATV++FN VFE+FK+EAPK++ANLILFLAD +PSTSLSWCPDCVRAEPVIYKK
Sbjct  1    MPLNMLDATVSSFNQVFERFKSEAPKHQANLILFLADKDPSTSLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            LEASS +VALL+ +VGDRPTWRNP HPWRVD  F LKGVPTL+ WE+GA
Sbjct  61   LEASSANVALLRGFVGDRPTWRNPNHPWRVDSRFKLKGVPTLVSWENGA  109



>gb|AFK40851.1| unknown [Lotus japonicus]
Length=132

 Score =   188 bits (477),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPLK+ DATV+TF+GVF+ F++EA +NKANLILFLAD +P+TSLSWCPDCVRAEPVIYKK
Sbjct  1    MPLKLFDATVSTFDGVFDNFRSEASQNKANLILFLADKDPATSLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWED  328
            LEAS DD+AL++AYVGDRPTWRNP HPWRVDP F L GVPTLIRWE+
Sbjct  61   LEASPDDIALIRAYVGDRPTWRNPHHPWRVDPKFKLTGVPTLIRWEN  107



>ref|XP_010095387.1| hypothetical protein L484_013059 [Morus notabilis]
 gb|EXB59939.1| hypothetical protein L484_013059 [Morus notabilis]
Length=132

 Score =   188 bits (477),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPLK+LDATV+ F  +FEKF +E+ KNKANLILFLAD +PSTSLSWCPDCVRAEPVIYKK
Sbjct  1    MPLKLLDATVSNFESIFEKFISESTKNKANLILFLADKDPSTSLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            LEA+SDDVALL+AYVGDRPTWRNP HPWRVD  F L GVPTLIRWE+ A
Sbjct  61   LEATSDDVALLRAYVGDRPTWRNPPHPWRVDSRFKLTGVPTLIRWENDA  109



>ref|XP_004513172.1| PREDICTED: thioredoxin-like protein Clot-like isoform X1 [Cicer 
arietinum]
 ref|XP_004513173.1| PREDICTED: thioredoxin-like protein Clot-like isoform X2 [Cicer 
arietinum]
Length=132

 Score =   187 bits (476),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPLKV +AT++TF+ VFEKF++E+P+NKANLILFLAD +PSTSLSWCPDCVRAEPVIYKK
Sbjct  1    MPLKVSEATISTFDAVFEKFRSESPQNKANLILFLADNDPSTSLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            LE SS+++ALLKAYVGDRPTWRN +HPWRVDP F L GVPTLIRWE+ +
Sbjct  61   LETSSNEIALLKAYVGDRPTWRNSKHPWRVDPRFKLTGVPTLIRWENDS  109



>ref|XP_004306505.1| PREDICTED: thioredoxin-like protein Clot [Fragaria vesca subsp. 
vesca]
Length=132

 Score =   187 bits (475),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPLKVLDAT+++F+ VFEKF+ EAPKNKAN ILFLAD +PSTSLSWCPDCVRAEPVIYKK
Sbjct  1    MPLKVLDATISSFDSVFEKFREEAPKNKANFILFLADKDPSTSLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            LEA+  DVALL+AYVGDRPTWR PQHPWRVD  F + GVPTL+RWE+ A
Sbjct  61   LEAAPGDVALLRAYVGDRPTWRTPQHPWRVDSRFKISGVPTLVRWENDA  109



>gb|KGN58616.1| hypothetical protein Csa_3G701560 [Cucumis sativus]
Length=133

 Score =   187 bits (475),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPLKV+DATV+ F+ VF+KF++E P NKAN ILFLAD +PSTS SWCPDCVRAEPVIYKK
Sbjct  1    MPLKVVDATVSDFSAVFDKFRSELPNNKANFILFLADKDPSTSRSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQRS  343
            LEA+SDD+ALL+AYVGDRPTWRNPQHPWRVDP F L GVPTL+RWE+  + S
Sbjct  61   LEAASDDIALLRAYVGDRPTWRNPQHPWRVDPRFKLTGVPTLVRWEENDKIS  112



>ref|XP_010067895.1| PREDICTED: thioredoxin-like protein Clot [Eucalyptus grandis]
 gb|KCW66137.1| hypothetical protein EUGRSUZ_G03402 [Eucalyptus grandis]
Length=132

 Score =   187 bits (474),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPLK++DATV++F+ VF+KF++EAP + ANLI FLAD +PSTSLSWCPDCVRAEPVIYKK
Sbjct  1    MPLKLVDATVSSFDAVFDKFRSEAPNHNANLIFFLADKDPSTSLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQRS  343
            LEASSD++ALL+AYVGDRPTWRNPQHPWRVDP F L GVPTL+ WED A + 
Sbjct  61   LEASSDNIALLQAYVGDRPTWRNPQHPWRVDPRFKLTGVPTLMLWEDDAVKG  112



>gb|EPS73999.1| hypothetical protein M569_00758 [Genlisea aurea]
Length=130

 Score =   186 bits (472),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MP+KVL+AT++TF+  F+KF+ EA  N+ANLILFLAD +P+T+LSWCPDCVRAEPVIY+K
Sbjct  1    MPMKVLEATLSTFDEAFDKFQGEAANNRANLILFLADKDPTTNLSWCPDCVRAEPVIYEK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQRS  343
            LE+SSD++ALLKAYVGDRPTWR+PQHPWR D  F L+GVPTLIRWEDGA ++
Sbjct  61   LESSSDEIALLKAYVGDRPTWRSPQHPWRTDSTFKLRGVPTLIRWEDGAVKA  112



>ref|XP_009354687.1| PREDICTED: thioredoxin-like protein Clot [Pyrus x bretschneideri]
Length=132

 Score =   186 bits (472),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPLK+ DAT++TF+  FEKFKAEAP NKAN ILFLAD +PSTSLSWCPDCVRAEPVIYKK
Sbjct  1    MPLKLSDATISTFDSAFEKFKAEAPNNKANFILFLADKDPSTSLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            LEA+ DDVALL+AYVGDRPTWRN  HPWRVD  F L GVPTLIRWE+ A
Sbjct  61   LEATPDDVALLRAYVGDRPTWRNAHHPWRVDSRFKLTGVPTLIRWENDA  109



>ref|XP_008375139.1| PREDICTED: thioredoxin-like protein Clot [Malus domestica]
 ref|XP_008364705.1| PREDICTED: thioredoxin-like protein Clot [Malus domestica]
Length=132

 Score =   186 bits (472),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPLK  DAT++TF+  FEKFKAEAP NKAN ILFLAD +PSTSLSWCPDCVRAEPVIYKK
Sbjct  1    MPLKJSDATISTFDSXFEKFKAEAPNNKANFILFLADKDPSTSLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            LEA+ DDVALL+AYVGDRPTWRN  HPWRVD  F L GVPTLIRWE+ A
Sbjct  61   LEATPDDVALLRAYVGDRPTWRNAHHPWRVDSRFKLTGVPTLIRWENDA  109



>ref|XP_002265835.1| PREDICTED: thioredoxin-like protein Clot [Vitis vinifera]
 emb|CBI24842.3| unnamed protein product [Vitis vinifera]
Length=132

 Score =   186 bits (471),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 99/111 (89%), Gaps = 1/111 (1%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPLK++DATV+TF GV EKF++EAPKNKANLILFLAD +PSTSLSWCPDCVRAEPVIYKK
Sbjct  1    MPLKMVDATVSTFEGVLEKFRSEAPKNKANLILFLADKDPSTSLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE-DGAQ  337
            LE SSDD+ALL+AYVGDRPTWR+ +HPWRVD  F L GVPTL+ WE DG +
Sbjct  61   LEESSDDIALLRAYVGDRPTWRDRKHPWRVDSRFKLTGVPTLVYWENDGVK  111



>ref|XP_007052588.1| Thioredoxin superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX96745.1| Thioredoxin superfamily protein isoform 1 [Theobroma cacao]
Length=133

 Score =   185 bits (469),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MP+K +DATV+ F+ VFEKF+++AP NKANLILFLAD +PSTSLSWCPDCVRAEPVIYKK
Sbjct  1    MPMKSVDATVSGFDSVFEKFRSDAPNNKANLILFLADKDPSTSLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
            LEAS+DDVA+L+AYVGDRPTWRNPQHPWR+D  F L GVPTL+RW+
Sbjct  61   LEASADDVAVLRAYVGDRPTWRNPQHPWRLDSRFKLTGVPTLVRWD  106



>ref|XP_007149072.1| hypothetical protein PHAVU_005G038700g [Phaseolus vulgaris]
 gb|ESW21066.1| hypothetical protein PHAVU_005G038700g [Phaseolus vulgaris]
Length=131

 Score =   183 bits (465),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPLK+L+ATV  F+GVFEKF++EA KNKANLILFLAD +P+TSLSWCPDCVRAEPVIYKK
Sbjct  1    MPLKLLEATVWNFDGVFEKFRSEAAKNKANLILFLADKDPATSLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWED  328
            LEASSDD+ALL+AYVGDR TWRNP+HPWRV+P F L GVPTLI W++
Sbjct  61   LEASSDDIALLRAYVGDRKTWRNPKHPWRVEPRFMLTGVPTLIHWDN  107



>ref|XP_002298153.1| hypothetical protein POPTR_0001s23270g [Populus trichocarpa]
 gb|ABK93836.1| unknown [Populus trichocarpa]
 gb|EEE82958.1| hypothetical protein POPTR_0001s23270g [Populus trichocarpa]
 gb|AFH68083.1| thioredoxin-like protein Clot [Populus trichocarpa x Populus 
deltoides]
Length=132

 Score =   182 bits (463),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            M +K++DAT+++F  VFEKFKAEAPKNK NLILFLAD +PST+LSWCPDCVRAEPVI KK
Sbjct  1    MTVKLVDATISSFGSVFEKFKAEAPKNKVNLILFLADNDPSTNLSWCPDCVRAEPVILKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQRS  343
            LEA  DDVALL+AYVGDRPTWRNPQHPWRVD  F LKGVPTLI WE+ A + 
Sbjct  61   LEALPDDVALLRAYVGDRPTWRNPQHPWRVDSRFKLKGVPTLISWENDAVKG  112



>ref|XP_008461777.1| PREDICTED: thioredoxin-like protein Clot isoform X2 [Cucumis 
melo]
Length=133

 Score =   182 bits (463),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPLKV+DAT++ FN VF+KF+++ P NKAN ILFLAD +PSTS SWCPDCVRAEPVIYKK
Sbjct  1    MPLKVVDATLSDFNAVFDKFRSQLPNNKANFILFLADKDPSTSRSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQRS  343
            LEA+SDD ALL+AYVGDRPTWRNPQHPWRVD  F L GVPTL+RWE+  + S
Sbjct  61   LEAASDDTALLRAYVGDRPTWRNPQHPWRVDCRFKLTGVPTLVRWEENDKIS  112



>ref|XP_003599047.1| Thioredoxin domain-containing protein [Medicago truncatula]
 gb|AES69298.1| thioredoxin-like protein [Medicago truncatula]
 gb|AFK44613.1| unknown [Medicago truncatula]
Length=132

 Score =   182 bits (463),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            M LKV  +TV+ F+ VFEKF++E P++KANLILFLAD +PSTSLSWCPDCVRAEPVIYKK
Sbjct  1    MTLKVFTSTVSNFDSVFEKFRSEIPQHKANLILFLADNDPSTSLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQRS  343
            LEAS +++ALLKAYVGDRPTWRNP HPWRVDP F L GVPTLIRWE+ A + 
Sbjct  61   LEASPNEIALLKAYVGDRPTWRNPHHPWRVDPKFKLTGVPTLIRWENDAVKG  112



>gb|ADR70873.1| thioredoxin-like family protein [Hevea brasiliensis]
Length=132

 Score =   181 bits (459),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPLK+LDATV++F+GVF+KF +EAP+NKANLIL LAD +PST+LSWCP CVRAEPVIYKK
Sbjct  1    MPLKLLDATVSSFDGVFQKFISEAPQNKANLILLLADKDPSTNLSWCPACVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            LEASSDD+ LL+A VGDRPTWRNPQHPWR+D  F L GVPTL+ WE+ A
Sbjct  61   LEASSDDITLLRADVGDRPTWRNPQHPWRLDSRFKLTGVPTLVSWENDA  109



>ref|XP_011035028.1| PREDICTED: thioredoxin-like protein Clot [Populus euphratica]
Length=132

 Score =   181 bits (458),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            M +K++DA +++F  VFEKFKAEAPKNK NLILFLAD +PST+LSWCPDCVRAEPVI KK
Sbjct  1    MTVKLVDANISSFGSVFEKFKAEAPKNKVNLILFLADNDPSTNLSWCPDCVRAEPVILKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            LEA  DDVALL+AYVGDRPTWRNPQHPWRVD  F LKGVPTLI WE+ A
Sbjct  61   LEALPDDVALLRAYVGDRPTWRNPQHPWRVDSRFKLKGVPTLISWENDA  109



>ref|XP_010257409.1| PREDICTED: thioredoxin-like protein Clot [Nelumbo nucifera]
Length=179

 Score =   182 bits (461),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +2

Query  2    QKMPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIY  181
            +KM L +LDAT+++F+ VFE+FK++APK++ NLILFLAD +PSTSLSWCPDCVRAEPVIY
Sbjct  46   RKMHLNMLDATLSSFDQVFERFKSDAPKHQVNLILFLADKDPSTSLSWCPDCVRAEPVIY  105

Query  182  KKLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            KKLEAS+ DV LL+A+VGDRPTWRNP HPWRVD  F LKGVPTL+RWE+ A
Sbjct  106  KKLEASATDVVLLRAFVGDRPTWRNPLHPWRVDSRFKLKGVPTLVRWENDA  156



>ref|XP_006439062.1| hypothetical protein CICLE_v10033058mg [Citrus clementina]
 ref|XP_006482840.1| PREDICTED: thioredoxin-like protein Clot-like [Citrus sinensis]
 gb|ESR52302.1| hypothetical protein CICLE_v10033058mg [Citrus clementina]
 gb|KDO83489.1| hypothetical protein CISIN_1g032841mg [Citrus sinensis]
Length=132

 Score =   180 bits (456),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPL + DATV++F+ VF+KFK+EAPKNKAN ILFLAD +PSTSLSWCPDCVRAEPVIYK 
Sbjct  1    MPLNLSDATVSSFDNVFDKFKSEAPKNKANFILFLADKDPSTSLSWCPDCVRAEPVIYKT  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWED  328
            LEAS DD+ALL+AYVGDRPTWRNPQHP+RV+  F L GVPTL RWE+
Sbjct  61   LEASPDDIALLQAYVGDRPTWRNPQHPFRVNSRFKLTGVPTLFRWEN  107



>gb|KJB35464.1| hypothetical protein B456_006G116100 [Gossypium raimondii]
Length=134

 Score =   179 bits (454),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPLKV+D+TV++F G+FEKF+++AP  KAN ILFLAD +PSTSLSWCPDCVRAEPVIYKK
Sbjct  1    MPLKVVDSTVSSFGGMFEKFRSDAPNYKANFILFLADKDPSTSLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQ  337
            LEAS +DV LL+AYVGDRPTWRNPQHPWR+D  F L GVPTL+ W+   Q
Sbjct  61   LEASPEDVTLLRAYVGDRPTWRNPQHPWRLDSTFKLTGVPTLLLWDSNNQ  110



>ref|XP_010694184.1| PREDICTED: thioredoxin-like protein Clot [Beta vulgaris subsp. 
vulgaris]
Length=133

 Score =   176 bits (445),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            M LK+++ATVA FN VF KFK EA  NKANLILFLAD EPSTSLSWCPDCVRAEPVIYKK
Sbjct  1    MGLKIVEATVANFNEVFNKFKEEAANNKANLILFLADKEPSTSLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            LE + ++VALL+AYVGDRPTWR P +P+R+D  F LKGVPTLIRWE+ A
Sbjct  61   LEEAGENVALLRAYVGDRPTWRTPSNPFRIDSRFQLKGVPTLIRWENDA  109



>gb|AGG19197.1| thioredoxin-like protein 7 [Tamarix hispida]
Length=132

 Score =   174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MP K+ DAT++ FN  F+KF AEAPK+KAN ILFLADI+P++SLSWCPDCVRAEPVIYKK
Sbjct  1    MPAKITDATLSNFNEAFDKFAAEAPKHKANFILFLADIDPTSSLSWCPDCVRAEPVIYKK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            LEA  +DVALL+AY+GDRPTWRN QHP ++D  F LKGVPTL+RWE+ A
Sbjct  61   LEAIPEDVALLRAYIGDRPTWRNVQHPLKMDSRFQLKGVPTLVRWENDA  109



>ref|XP_007052589.1| Thioredoxin superfamily protein isoform 2 [Theobroma cacao]
 gb|EOX96746.1| Thioredoxin superfamily protein isoform 2 [Theobroma cacao]
Length=129

 Score =   167 bits (422),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 93/106 (88%), Gaps = 4/106 (4%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MP+K +DATV+ F+ VFEKF+++AP NKANLILFLAD +PSTSL    +CVRAEPVIYKK
Sbjct  1    MPMKSVDATVSGFDSVFEKFRSDAPNNKANLILFLADKDPSTSL----NCVRAEPVIYKK  56

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
            LEAS+DDVA+L+AYVGDRPTWRNPQHPWR+D  F L GVPTL+RW+
Sbjct  57   LEASADDVAVLRAYVGDRPTWRNPQHPWRLDSRFKLTGVPTLVRWD  102



>ref|XP_010910629.1| PREDICTED: thioredoxin-like protein Clot [Elaeis guineensis]
Length=164

 Score =   165 bits (417),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +2

Query  2    QKMPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIY  181
            + MPLK +DATV+ F  VFE+F++E  +N+   +LFLA+ +PSTSL+WCPDC  AEP+IY
Sbjct  31   KTMPLKTVDATVSEFEEVFERFQSENSQNQLKFLLFLANKDPSTSLTWCPDCNVAEPIIY  90

Query  182  KKLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            +KL+AS +DV LL+AYVGDRPTWRNP HPWR+DP F L+GVPTLIRWE+ A
Sbjct  91   EKLKASEEDVVLLRAYVGDRPTWRNPSHPWRIDPRFRLRGVPTLIRWENEA  141



>ref|XP_008795747.1| PREDICTED: thioredoxin-like protein Clot [Phoenix dactylifera]
 ref|XP_008778356.1| PREDICTED: thioredoxin-like protein Clot [Phoenix dactylifera]
Length=132

 Score =   164 bits (414),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPLK +DATV+ F  VFE+FK+E  +N+   +LFLA+ +PSTSLSWCPDC  AEPVIY+K
Sbjct  1    MPLKTVDATVSDFEEVFERFKSENSQNQLKFLLFLANKDPSTSLSWCPDCNVAEPVIYEK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            LEAS  DVALL+ YVGD+ TWRNP HPWRVDP F L GVPTLIRWE+ A
Sbjct  61   LEASQSDVALLRGYVGDKGTWRNPSHPWRVDPRFKLSGVPTLIRWENEA  109



>ref|XP_010928449.1| PREDICTED: thioredoxin-like protein Clot [Elaeis guineensis]
Length=164

 Score =   163 bits (412),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +2

Query  2    QKMPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIY  181
            + M LK +DATV+ F  VFE+F++E  +N+   +LFLA+ +PSTSL+WCPDC  AEPVIY
Sbjct  31   KTMSLKTVDATVSEFEEVFERFQSENSQNQLKFLLFLANKDPSTSLTWCPDCNVAEPVIY  90

Query  182  KKLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            +KLEAS +DVALL+ YVGD+PTWRNP HPWRVDP F L G+PTLIRWE+ A
Sbjct  91   QKLEASQNDVALLRGYVGDKPTWRNPSHPWRVDPRFKLTGIPTLIRWENEA  141



>ref|XP_010552738.1| PREDICTED: thioredoxin-like protein Clot [Tarenaya hassleriana]
Length=132

 Score =   146 bits (369),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            M +K  DAT +T   V ++ ++EA   K +LILFLAD +PST LSWCPDCVRAEPVIYK 
Sbjct  1    MAMKAWDATPSTLESVLQRLRSEAVNRKISLILFLADKDPSTDLSWCPDCVRAEPVIYKM  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
            LE   ++V+L++AY GDR TWRNP HPWR+DP F L GVPTL+RWE
Sbjct  61   LEEWPEEVSLIRAYAGDRATWRNPAHPWRLDPRFKLTGVPTLLRWE  106



>gb|ACN40757.1| unknown [Picea sitchensis]
Length=130

 Score =   146 bits (368),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            M    +DAT+  F+  FE  +    K++  L+LFLAD +P++ LSWCPDCVRAEPVIYK 
Sbjct  1    MGFTQIDATLENFSTAFESIETNNVKDQVTLLLFLADKDPASGLSWCPDCVRAEPVIYKT  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            LE S  +  LL+A+ G+RPTWRNP HPWRVD  F LKG+PTLIRW DGA
Sbjct  61   LEKSEKNTVLLRAFAGNRPTWRNPSHPWRVDERFQLKGLPTLIRWRDGA  109



>gb|ABK21521.1| unknown [Picea sitchensis]
 gb|ABK25334.1| unknown [Picea sitchensis]
 gb|ACN40908.1| unknown [Picea sitchensis]
 gb|ACN41043.1| unknown [Picea sitchensis]
Length=130

 Score =   145 bits (367),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            M    +DAT+  F+  FE  +    K++  L+LFLAD +P++ LSWCPDCVRAEPVIYK 
Sbjct  1    MGFTQIDATLENFSTAFESIETNNVKDQVTLLLFLADKDPASGLSWCPDCVRAEPVIYKT  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            LE S  +  LL+A+ G+RPTWRNP HPWRVD  F LKG+PTLIRW DGA
Sbjct  61   LEKSEKNTVLLRAFAGNRPTWRNPSHPWRVDERFRLKGLPTLIRWRDGA  109



>ref|XP_006850070.1| hypothetical protein AMTR_s00022p00212550 [Amborella trichopoda]
 gb|ERN11651.1| hypothetical protein AMTR_s00022p00212550 [Amborella trichopoda]
Length=130

 Score =   143 bits (361),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPLK+ DA +  F   F+ F +E P N  +LILFLAD  PS++LSWCPDC RAEPVIY+K
Sbjct  1    MPLKMYDANLCNFEEKFKSFASETPSNHISLILFLADKNPSSNLSWCPDCNRAEPVIYQK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQRS  343
            +   + DVALL+A+ GDR TWR   HPWRVD  F L GVPTL+RW DG  R 
Sbjct  61   VADCNRDVALLRAFAGDRATWRKADHPWRVDQRFRLSGVPTLVRWVDGDIRG  112



>ref|XP_009394997.1| PREDICTED: thioredoxin-like protein Clot [Musa acuminata subsp. 
malaccensis]
Length=139

 Score =   143 bits (360),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 85/114 (75%), Gaps = 7/114 (6%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKF-KAEAPKN------KANLILFLADIEPSTSLSWCPDCVRA  166
            MPLK  DA ++ F+ VF  F K+E  +       +   +LFLAD +PST+ SWCPDC  A
Sbjct  1    MPLKTFDADLSNFDQVFGGFTKSETTEGSPSEPGQLKFLLFLADKDPSTNRSWCPDCNVA  60

Query  167  EPVIYKKLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWED  328
            EP+IY+KLEAS+ ++ LL+AYVGDRPTWRNP HPWRVDP F LKGVPTLIRWE+
Sbjct  61   EPIIYEKLEASNSNLVLLRAYVGDRPTWRNPSHPWRVDPRFKLKGVPTLIRWEN  114



>emb|CDX71522.1| BnaC04g17570D [Brassica napus]
Length=134

 Score =   142 bits (358),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 84/107 (79%), Gaps = 1/107 (1%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKA-EAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYK  184
            M LK LDA  +T   V E+ K+ E+ +NK N ILF+A+ +P+T+ SWCPDCVRAEPVIYK
Sbjct  1    MTLKKLDADPSTLETVLEELKSDESNRNKINFILFVANNDPTTNRSWCPDCVRAEPVIYK  60

Query  185  KLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
             LE S+++V +++AY GDRPTWRNP HPWRVDP F + GVPTL+RW+
Sbjct  61   TLEESAEEVNVIRAYAGDRPTWRNPVHPWRVDPRFKVTGVPTLVRWD  107



>emb|CDY22382.1| BnaA06g37040D [Brassica napus]
Length=134

 Score =   142 bits (357),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 84/107 (79%), Gaps = 1/107 (1%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKA-EAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYK  184
            M +K +DA  +T   V E+ K+ E+ +NK N ILFLA+ +P+T+ SWCPDCVRAEPVIYK
Sbjct  1    MSVKKVDADPSTLEKVLEELKSDESNRNKINFILFLANNDPTTNRSWCPDCVRAEPVIYK  60

Query  185  KLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
             LE S+++V +++AY GDRPTWRNP HPWRVDP F + GVPTL+RW+
Sbjct  61   TLEESAEEVNVIRAYAGDRPTWRNPMHPWRVDPRFKVTGVPTLVRWD  107



>ref|XP_009101833.1| PREDICTED: thioredoxin-like protein Clot [Brassica rapa]
Length=134

 Score =   141 bits (356),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 83/107 (78%), Gaps = 1/107 (1%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKA-EAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYK  184
            M +K +DA  +T   V E  K+ E+ +NK N ILFLA+ +P+T+ SWCPDCVRAEPVIYK
Sbjct  1    MSVKKVDADPSTLEKVLEDLKSDESNRNKINFILFLANNDPTTNRSWCPDCVRAEPVIYK  60

Query  185  KLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
             LE S+++V +++AY GDRPTWRNP HPWRVDP F + GVPTL+RW+
Sbjct  61   TLEESAEEVNVIRAYAGDRPTWRNPMHPWRVDPRFKVTGVPTLVRWD  107



>ref|XP_002863728.1| hypothetical protein ARALYDRAFT_917431 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39987.1| hypothetical protein ARALYDRAFT_917431 [Arabidopsis lyrata subsp. 
lyrata]
Length=134

 Score =   141 bits (355),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 79/107 (74%), Gaps = 1/107 (1%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKA-EAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYK  184
            M LK LDA  +T   V E+ K+ E  ++K N ILFLAD +P+T  SWCPDCVRAEPVIYK
Sbjct  1    MTLKKLDANPSTLESVLEQLKSDETNRSKINFILFLADNDPTTGQSWCPDCVRAEPVIYK  60

Query  185  KLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
             LE   ++V L++AY GDRPTWR P HPWRVDP F L GVPTL+RW+
Sbjct  61   TLEEFPEEVNLIRAYAGDRPTWRTPAHPWRVDPRFKLTGVPTLVRWD  107



>ref|XP_006403339.1| hypothetical protein EUTSA_v10003289mg [Eutrema salsugineum]
 ref|XP_006403340.1| hypothetical protein EUTSA_v10003289mg [Eutrema salsugineum]
 gb|ESQ44792.1| hypothetical protein EUTSA_v10003289mg [Eutrema salsugineum]
 gb|ESQ44793.1| hypothetical protein EUTSA_v10003289mg [Eutrema salsugineum]
Length=140

 Score =   140 bits (354),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 80/107 (75%), Gaps = 1/107 (1%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKA-EAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYK  184
            M +K  DA  +TF  V E+ K+ E  + K N ILFLAD +P+T+ SWCPDCVRAEPVI K
Sbjct  1    MTMKKWDANPSTFESVLEELKSDETNRTKINFILFLADNDPTTNRSWCPDCVRAEPVILK  60

Query  185  KLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
             LE S ++V L++AY GDRPTWRNP HPWRVDP F L GVPTL+RW+
Sbjct  61   TLEESPEEVNLIRAYAGDRPTWRNPTHPWRVDPRFKLTGVPTLVRWD  107



>ref|XP_003577742.1| PREDICTED: thioredoxin-like protein Clot [Brachypodium distachyon]
Length=137

 Score =   140 bits (353),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 79/110 (72%), Gaps = 1/110 (1%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIE-PSTSLSWCPDCVRAEPVIYK  184
            M ++ +DATVA      EK  A A   K  L+LFLAD E PS+SL+WCPDC  AEP+IY 
Sbjct  1    MTVEKVDATVADLESHLEKLSAAAADGKLKLLLFLADRESPSSSLTWCPDCNVAEPLIYS  60

Query  185  KLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            KLEA   DV LL+A+VGD+PTWR+P HPWR DP F L GVPTL+RWE GA
Sbjct  61   KLEALGKDVLLLRAFVGDKPTWRDPAHPWRADPRFALSGVPTLLRWEKGA  110



>ref|XP_006656041.1| PREDICTED: thioredoxin-like protein Clot-like [Oryza brachyantha]
Length=138

 Score =   139 bits (351),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 82/111 (74%), Gaps = 2/111 (2%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKA--EAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIY  181
            M ++ +D TVA F+  F+K  A  E    K  L+LFLAD + S+ L+WCPDC  AEPVIY
Sbjct  1    MAVEKVDTTVADFDAHFDKLFAAGEDGGGKVKLLLFLADRDASSDLTWCPDCNVAEPVIY  60

Query  182  KKLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            +++EA   DV LL+AYVGD+PTWR+P HPWRVDP F L GVPTLIRWE+GA
Sbjct  61   ERVEALGKDVVLLRAYVGDKPTWRDPAHPWRVDPRFRLTGVPTLIRWENGA  111



>ref|XP_002438324.1| hypothetical protein SORBIDRAFT_10g012200 [Sorghum bicolor]
 gb|EER89691.1| hypothetical protein SORBIDRAFT_10g012200 [Sorghum bicolor]
Length=173

 Score =   140 bits (353),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 84/114 (74%), Gaps = 5/114 (4%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAE---APKNKANLILFLADIEPSTSLSWCPDCVRAEPVI  178
            M ++ +DA +A F+  F++  A    A   K  L+LFLAD EP +SL+WCPDC  AEPVI
Sbjct  1    MTVEKVDAALADFDAHFDRLFASPDAASDGKVKLLLFLADREPDSSLTWCPDCNVAEPVI  60

Query  179  YKKLEAS--SDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            Y++LEA+    D  LL+AYVGD+PTWR+P HPWRVDP F LKGVPTLIRWEDGA
Sbjct  61   YERLEAALQGKDAVLLRAYVGDKPTWRDPAHPWRVDPRFGLKGVPTLIRWEDGA  114



>ref|NP_001146464.1| thioredoxin-like protein 5 [Zea mays]
 gb|ACL54071.1| unknown [Zea mays]
 gb|AFW86490.1| thioredoxin-like protein 5 [Zea mays]
Length=138

 Score =   139 bits (349),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 83/113 (73%), Gaps = 4/113 (4%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAE---APKNKANLILFLADIEPSTSLSWCPDCVRAEPVI  178
            M ++ +DA ++ F+  F++  A    A   K  L+LFLAD +P +SLSWCPDC  AEPVI
Sbjct  1    MTVEKVDAGLSDFDAHFDRLFASPDAASDGKVKLLLFLADRKPGSSLSWCPDCNVAEPVI  60

Query  179  YKKLEA-SSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            Y++LEA    D  LL+AYVGD+PTWR+P HPWRVDP F LKGVPTLIRWEDGA
Sbjct  61   YERLEALEGKDAVLLRAYVGDKPTWRDPAHPWRVDPRFGLKGVPTLIRWEDGA  113



>gb|ACG38852.1| thioredoxin-like protein 5 [Zea mays]
Length=138

 Score =   138 bits (348),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 83/113 (73%), Gaps = 4/113 (4%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAE---APKNKANLILFLADIEPSTSLSWCPDCVRAEPVI  178
            M ++ +DA ++ F+  F++  A    A   K  L+LFLAD +P +SLSWCPDC  AEPVI
Sbjct  1    MTVEKVDAGLSDFDAHFDRLFASPDAASDGKVKLLLFLADRKPDSSLSWCPDCNVAEPVI  60

Query  179  YKKLEA-SSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            Y++LEA    D  LL+AYVGD+PTWR+P HPWRVDP F LKGVPTLIRWEDGA
Sbjct  61   YERLEALEGKDAVLLRAYVGDKPTWRDPAHPWRVDPRFGLKGVPTLIRWEDGA  113



>ref|XP_006281304.1| hypothetical protein CARUB_v10027354mg [Capsella rubella]
 gb|EOA14202.1| hypothetical protein CARUB_v10027354mg [Capsella rubella]
Length=134

 Score =   138 bits (347),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 77/107 (72%), Gaps = 1/107 (1%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKA-EAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYK  184
            M +K +DA  +T   V +  K+ E  + K N ILFLAD EP+T  SWCPDCVRAEPVIYK
Sbjct  1    MTVKKIDANPSTLESVLQDLKSNETNRTKINFILFLADDEPTTGRSWCPDCVRAEPVIYK  60

Query  185  KLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
             LE   ++V L++AY GDRPTWR P HPWRVDP F L GVPTL+RW+
Sbjct  61   TLEEFPEEVNLIRAYAGDRPTWRTPAHPWRVDPRFKLTGVPTLVRWD  107



>ref|XP_010494239.1| PREDICTED: thioredoxin-like protein Clot [Camelina sativa]
 ref|XP_010494240.1| PREDICTED: thioredoxin-like protein Clot [Camelina sativa]
Length=134

 Score =   137 bits (345),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 79/107 (74%), Gaps = 1/107 (1%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKA-EAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYK  184
            M +K +DA  +T   V ++ K+ E  ++K N ILFLAD EP+T  SWCPDCVRAEPVI+K
Sbjct  1    MTVKKIDANPSTLESVLQELKSDETNRSKINFILFLADDEPTTGRSWCPDCVRAEPVIFK  60

Query  185  KLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
             LE   ++V L++AY GDRPTWR P HPWRVDP F L GVPTL+RW+
Sbjct  61   TLEEFPEEVNLIRAYAGDRPTWRTPAHPWRVDPRFKLTGVPTLVRWD  107



>gb|AAM64350.1| unknown [Arabidopsis thaliana]
Length=134

 Score =   137 bits (344),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 78/107 (73%), Gaps = 1/107 (1%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKA-EAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYK  184
            M LK LDA  +T   + ++ K+ E  ++K N ILFLAD +P+T  SWCPDCVRAEPVIYK
Sbjct  1    MTLKKLDANPSTLESILQELKSDETNRSKINFILFLADNDPTTGQSWCPDCVRAEPVIYK  60

Query  185  KLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
             LE   ++V L++AY GDRPTWR P HPWRVD  F L GVPTL+RW+
Sbjct  61   TLEEFPEEVNLIRAYAGDRPTWRTPAHPWRVDSRFKLTGVPTLVRWD  107



>ref|XP_004965341.1| PREDICTED: thioredoxin-like protein Clot-like [Setaria italica]
Length=138

 Score =   136 bits (343),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAE---APKNKANLILFLADIEPSTSLSWCPDCVRAEPVI  178
            M ++ +DAT+A F+  F++  A    A   K  L+LFLAD EP +SL+WCPDC  AEPVI
Sbjct  1    MTVQKVDATLADFSAHFDRLIASPAAASDGKLKLLLFLADREPGSSLTWCPDCNVAEPVI  60

Query  179  YKKLEA-SSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            Y++LEA    D  LL+AYVGD+PTWR+P HPWR DP F +KGVPTLIRWE+G 
Sbjct  61   YERLEALQGRDAVLLRAYVGDKPTWRDPAHPWREDPKFGIKGVPTLIRWENGG  113



>dbj|BAJ94490.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=130

 Score =   136 bits (342),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            M ++ +DATVA F+G FE+  A     K  L+LFLAD EPS+SL+WCPDC  AEPVIY K
Sbjct  1    MTVEKVDATVADFDGHFERLFAGDDGGKLKLLLFLADREPSSSLTWCPDCNVAEPVIYGK  60

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            LE+   DV LL+A+VGD+PTWR+P HPWRVDP F LKGVPTL+RWE GA
Sbjct  61   LESLGRDVVLLRAFVGDKPTWRDPAHPWRVDPRFALKGVPTLLRWEKGA  109



>ref|XP_010442113.1| PREDICTED: thioredoxin-like protein Clot [Camelina sativa]
Length=134

 Score =   135 bits (341),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 79/107 (74%), Gaps = 1/107 (1%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKA-EAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYK  184
            M +K +DA  +T   V ++ K+ E  ++K + ILFLAD EP+T  SWCPDCVRAEPVI+K
Sbjct  1    MTVKKIDANPSTLESVLQELKSDETNRSKISFILFLADDEPTTGRSWCPDCVRAEPVIFK  60

Query  185  KLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
             L+   +DV L++AY GDRPTWR P HPWRVDP F L GVPTL+RW+
Sbjct  61   TLDEFPEDVNLIRAYAGDRPTWRTPAHPWRVDPRFKLTGVPTLVRWD  107



>ref|XP_010481939.1| PREDICTED: thioredoxin-like protein Clot [Camelina sativa]
Length=134

 Score =   135 bits (341),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 79/107 (74%), Gaps = 1/107 (1%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKA-EAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYK  184
            M +K +DA  +T   V ++ K+ E  ++K + ILFLAD EP+T  SWCPDCVRAEPVI+K
Sbjct  1    MTVKKIDANPSTLESVLQELKSDETNRSKISFILFLADDEPTTGRSWCPDCVRAEPVIFK  60

Query  185  KLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
             LE   ++V L++AY GDRPTWR P HPWRVDP F L GVPTL+RW+
Sbjct  61   TLEEFPEEVNLIRAYAGDRPTWRTPAHPWRVDPRFKLTGVPTLVRWD  107



>ref|NP_568614.1| thioredoxin-like protein Clot [Arabidopsis thaliana]
 ref|NP_974872.1| thioredoxin-like protein Clot [Arabidopsis thaliana]
 sp|Q9FMN4.1|TCLOT_ARATH RecName: Full=Thioredoxin-like protein Clot; AltName: Full=Thioredoxin 
Clot; Short=AtClot [Arabidopsis thaliana]
 dbj|BAB09186.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAC42750.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63864.1| unknown protein [Arabidopsis thaliana]
 gb|AED94874.1| thioredoxin-like protein Clot [Arabidopsis thaliana]
 gb|AED94875.1| thioredoxin-like protein Clot [Arabidopsis thaliana]
Length=134

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 77/107 (72%), Gaps = 1/107 (1%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKA-EAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYK  184
            M LK +DA  +T     ++ K+ E  ++K N ILFLAD +P+T  SWCPDCVRAEPVIYK
Sbjct  1    MTLKKVDANPSTLESSLQELKSDETSRSKINFILFLADNDPTTGQSWCPDCVRAEPVIYK  60

Query  185  KLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
             LE   ++V L++AY GDRPTWR P HPWRVD  F L GVPTL+RW+
Sbjct  61   TLEEFPEEVKLIRAYAGDRPTWRTPAHPWRVDSRFKLTGVPTLVRWD  107



>ref|NP_001057509.1| Os06g0320000 [Oryza sativa Japonica Group]
 sp|Q5Z9Z3.1|OCLOT_ORYSJ RecName: Full=Thioredoxin-like protein Clot; AltName: Full=Thioredoxin 
Clot; Short=OsClot [Oryza sativa Japonica Group]
 dbj|BAD61617.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF19423.1| Os06g0320000 [Oryza sativa Japonica Group]
 gb|EAZ00725.1| hypothetical protein OsI_22750 [Oryza sativa Indica Group]
 gb|EAZ36813.1| hypothetical protein OsJ_21152 [Oryza sativa Japonica Group]
 dbj|BAH01247.1| unnamed protein product [Oryza sativa Japonica Group]
Length=139

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 84/115 (73%), Gaps = 6/115 (5%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKA--EAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIY  181
            M ++ +DATVA F+  F+K  A  +  + K  L+LFLAD + S++ +WCPDC  AEPVIY
Sbjct  1    MTVEKVDATVADFDAHFDKLFAAGDDAEGKVKLLLFLADRDASSNQTWCPDCNVAEPVIY  60

Query  182  KKLEASSD----DVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
             ++EA++     DV LL+AYVGD+PTWR+P HPWR DP F L GVPTLIRWE+GA
Sbjct  61   DRVEAAAKGKEKDVVLLRAYVGDKPTWRDPAHPWRADPRFRLTGVPTLIRWENGA  115



>ref|XP_002991106.1| hypothetical protein SELMODRAFT_132775 [Selaginella moellendorffii]
 gb|EFJ07914.1| hypothetical protein SELMODRAFT_132775 [Selaginella moellendorffii]
Length=136

 Score =   126 bits (316),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 73/108 (68%), Gaps = 2/108 (2%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            M   ++D++V   +GV E   AE     A L+LFL D  PS   SWCPDCVRAEPVIYK+
Sbjct  1    MAAAIVDSSVGDLDGVLEA--AEKQGGGAVLLLFLGDRIPSIGQSWCPDCVRAEPVIYKE  58

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDG  331
            +E++   V L++  VGD+PTWR+P HP R+DP F L GVPTLIRW  G
Sbjct  59   VESAGHKVTLVRVNVGDKPTWRDPAHPLRIDPRFRLTGVPTLIRWSSG  106



>ref|XP_002991648.1| hypothetical protein SELMODRAFT_134020 [Selaginella moellendorffii]
 gb|EFJ07219.1| hypothetical protein SELMODRAFT_134020 [Selaginella moellendorffii]
Length=136

 Score =   126 bits (316),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 73/108 (68%), Gaps = 2/108 (2%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            M   ++D++V   +GV E   AE     A L+LFL D  PS   SWCPDCVRAEPVIYK+
Sbjct  1    MAAAIVDSSVGDLDGVLEA--AEKQGGGAVLLLFLGDRIPSIGRSWCPDCVRAEPVIYKE  58

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDG  331
            +E++   V L++  VGD+PTWR+P HP R+DP F L GVPTLIRW  G
Sbjct  59   VESAGHKVTLVRVNVGDKPTWRDPAHPLRIDPRFRLTGVPTLIRWSSG  106



>ref|XP_009612559.1| PREDICTED: thioredoxin-like protein Clot [Nicotiana tomentosiformis]
Length=158

 Score =   119 bits (297),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  152  DCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDG  331
            DCVRAEPVIYKKLE S++D+ALL+AYVGDRPTWR PQHPWRVDP FNLKGVPTLIRWE+ 
Sbjct  75   DCVRAEPVIYKKLEESAEDIALLRAYVGDRPTWRTPQHPWRVDPRFNLKGVPTLIRWEND  134

Query  332  AQRS  343
            A + 
Sbjct  135  ATKG  138



>gb|KHN29206.1| Thioredoxin-like protein Clot [Glycine soja]
Length=147

 Score =   116 bits (291),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  131  TSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPT  310
            T L+    CVRAEPVIYKKLEAS DD+ALL+AYVGDRPTWRNPQHPWR+DP F L GVPT
Sbjct  57   TQLANENHCVRAEPVIYKKLEASPDDIALLRAYVGDRPTWRNPQHPWRMDPRFKLTGVPT  116

Query  311  LIRWED  328
            LIRWE+
Sbjct  117  LIRWEN  122



>ref|XP_007052590.1| Thioredoxin superfamily protein isoform 3 [Theobroma cacao]
 gb|EOX96747.1| Thioredoxin superfamily protein isoform 3 [Theobroma cacao]
Length=122

 Score =   115 bits (287),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 61/74 (82%), Gaps = 6/74 (8%)
 Frame = +2

Query  122  EPSTSLSW------CPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWRNPQHPWRVDP  283
            +P +S SW      C DCVRAEPVIYKKLEAS+DDVA+L+AYVGDRPTWRNPQHPWR+D 
Sbjct  22   KPISSSSWPIKTLVCLDCVRAEPVIYKKLEASADDVAVLRAYVGDRPTWRNPQHPWRLDS  81

Query  284  NFNLKGVPTLIRWE  325
             F L GVPTL+RW+
Sbjct  82   RFKLTGVPTLVRWD  95



>ref|XP_001782979.1| predicted protein [Physcomitrella patens]
 gb|EDQ52225.1| predicted protein, partial [Physcomitrella patens]
Length=109

 Score =   108 bits (271),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +2

Query  98   LILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWRNPQHPWRV  277
            L+LFL D   S   SWCPDCVRAEP+IYK +  S   V L++ YVGD+PTWR   HP R 
Sbjct  1    LLLFLGDRIASVGKSWCPDCVRAEPIIYKLVNESESPVTLVRVYVGDKPTWRTSDHPLRC  60

Query  278  DPNFNLKGVPTLIRWEDGA  334
            D  F LKGVPTLIRWE+GA
Sbjct  61   DDRFKLKGVPTLIRWENGA  79



>ref|XP_009601645.1| PREDICTED: thioredoxin-like protein Clot isoform X1 [Nicotiana 
tomentosiformis]
Length=75

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPD  154
            MPLKVLDAT+ATFNGVFEKF+AEAP+NKAN ILFLADI+PST+LSWCPD
Sbjct  1    MPLKVLDATIATFNGVFEKFRAEAPQNKANFILFLADIDPSTNLSWCPD  49



>ref|XP_009601647.1| PREDICTED: thioredoxin-like protein Clot isoform X3 [Nicotiana 
tomentosiformis]
Length=60

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPD  154
            MPLKVLDAT+ATFNGVFEKF+AEAP+NKAN ILFLADI+PST+LSWCP+
Sbjct  1    MPLKVLDATIATFNGVFEKFRAEAPQNKANFILFLADIDPSTNLSWCPE  49



>ref|XP_009601646.1| PREDICTED: thioredoxin-like protein Clot isoform X2 [Nicotiana 
tomentosiformis]
Length=74

 Score = 93.6 bits (231),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCP  151
            MPLKVLDAT+ATFNGVFEKF+AEAP+NKAN ILFLADI+PST+LSWCP
Sbjct  1    MPLKVLDATIATFNGVFEKFRAEAPQNKANFILFLADIDPSTNLSWCP  48



>ref|XP_009601648.1| PREDICTED: thioredoxin-like protein Clot isoform X4 [Nicotiana 
tomentosiformis]
Length=54

 Score = 92.8 bits (229),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPD  154
            MPLKVLDAT+ATFNGVFEKF+AEAP+NKAN ILFLADI+PST+LSWCP+
Sbjct  1    MPLKVLDATIATFNGVFEKFRAEAPQNKANFILFLADIDPSTNLSWCPE  49



>ref|XP_009601649.1| PREDICTED: thioredoxin-like protein Clot isoform X5 [Nicotiana 
tomentosiformis]
Length=49

 Score = 92.0 bits (227),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCP  151
            MPLKVLDAT+ATFNGVFEKF+AEAP+NKAN ILFLADI+PST+LSWCP
Sbjct  1    MPLKVLDATIATFNGVFEKFRAEAPQNKANFILFLADIDPSTNLSWCP  48



>ref|XP_009365074.1| PREDICTED: thioredoxin-like protein Clot [Pyrus x bretschneideri]
Length=122

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 59/92 (64%), Gaps = 13/92 (14%)
 Frame = +2

Query  101  ILFLADIEPSTSLSWCPD--CVR---------AEPVIYKKLEASSDDVALLKAYVGDRPT  247
            I+ ++D+ P    ++CPD  C R         AEPV YKKL A +D VALL+AYVGDR T
Sbjct  13   IIMVSDLGP-VGFTFCPDFDCSRQYIVIKLCGAEPVTYKKLLAIAD-VALLEAYVGDRRT  70

Query  248  WRNPQHPWRVDPNFNLKGVPTLIRWEDGAQRS  343
            WRN  HPWRVD  F L GVPTL+R E+ A + 
Sbjct  71   WRNAHHPWRVDSRFKLTGVPTLVRRENDAIKG  102



>ref|XP_002155721.1| PREDICTED: thioredoxin domain-containing protein 17-like [Hydra 
vulgaris]
Length=126

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = +2

Query  98   LILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWRNPQHPWRV  277
             +LF    +P+T  SWCPDCVRA+PVI K +   + D   +   VGDRPTW++P  P+R 
Sbjct  28   FVLFTGQEDPATGKSWCPDCVRADPVIEKCITKMNQDDVFIYCVVGDRPTWKDPLSPFRT  87

Query  278  DPNFNLKGVPTLIRW  322
            DP   LK +PTL++W
Sbjct  88   DPKLLLKAIPTLVKW  102



>gb|KIZ05859.1| hypothetical protein MNEG_2100 [Monoraphidium neglectum]
Length=142

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 52/80 (65%), Gaps = 3/80 (4%)
 Frame = +2

Query  101  ILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWR-NPQHPWRV  277
            ++F AD +P+T L WCPDCVRA P + + +EA     ALL+  VG R  W+ N  HP R 
Sbjct  33   VVFTADPDPATGLPWCPDCVRALPAVRRTMEAQG--AALLEVGVGQRADWKGNAAHPCRT  90

Query  278  DPNFNLKGVPTLIRWEDGAQ  337
            DP FN+ GVPTL+ W+ G +
Sbjct  91   DPRFNVGGVPTLVHWKGGEE  110



>gb|ADD38068.1| Thioredoxin domain-containing protein 17 [Lepeophtheirus salmonis]
Length=122

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 60/105 (57%), Gaps = 1/105 (1%)
 Frame = +2

Query  23   LDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASS  202
            + A V  + G   K K          +LF   I+PS+  SWCPDCV AEP++   ++  +
Sbjct  1    MKADVHGYEGFLSKVKEMEALGGTLAVLFTGSIDPSSGKSWCPDCVVAEPIVDSVMKDKT  60

Query  203  DDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQ  337
            + V  L+ +VG R  W++PQ P+R +P+  LK +PTLI W+  ++
Sbjct  61   E-VHFLRVFVGPRDFWKDPQCPFRTNPDTRLKSIPTLIIWKSQSK  104



>ref|XP_787642.1| PREDICTED: thioredoxin domain-containing protein 17-like [Strongylocentrotus 
purpuratus]
Length=126

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 60/107 (56%), Gaps = 5/107 (5%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            M L+     +  F  + EK K    + K  + LF      S  +SWCPDCV AEP+I K 
Sbjct  1    MVLQEKTEGLDNFLQLLEKHK----EKKTIIALFCGGKNSSDGVSWCPDCVSAEPIIEKG  56

Query  188  LEASS-DDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
            L A++ +D   +   VGDR +W++P + +R  P   LKGVPTL++W+
Sbjct  57   LAAAAPEDAVFIYCSVGDRTSWKDPNNAYRTHPKLQLKGVPTLLQWD  103



>gb|KFH67789.1| hypothetical protein MVEG_06521 [Mortierella verticillata NRRL 
6337]
Length=128

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 57/111 (51%), Gaps = 1/111 (1%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MP  +++ T   F    +   A     K     F    E  T  SWCPDCVR++P++ K+
Sbjct  1    MPATIINTTSDKFLADIQHTVATNADKKIYAYFFGHHTE-ETGKSWCPDCVRSDPIVLKR  59

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQR  340
               +  +V L+   VGDR TW++P H  R + +  L G+PTL+RW    QR
Sbjct  60   FTEADSNVVLVSVDVGDRATWKDPAHHLRHNKDTRLIGIPTLLRWNHFDQR  110



>gb|ETO18237.1| hypothetical protein RFI_19042 [Reticulomyxa filosa]
Length=145

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 56/103 (54%), Gaps = 7/103 (7%)
 Frame = +2

Query  35   VATFNGVFE---KFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSD  205
            +   NG+ E   + +  + K     +LF   I+  T  SWCPDCV A+PVI K L   SD
Sbjct  18   IVVVNGMDELNSRLEESSKKYARVWVLFCGTIDEKTGGSWCPDCVEADPVINKCLSKLSD  77

Query  206  D----VALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
                    +K YVGDRP W++P   +R D  F+LK VPTLI W
Sbjct  78   KEWDKSIFIKCYVGDRPFWKDPNCIFRKDKRFSLKAVPTLIEW  120



>ref|XP_004149619.1| PREDICTED: uncharacterized protein LOC101210632 [Cucumis sativus]
Length=1058

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    QKMPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCP  151
            +KMPLKV+DATV+ F+ VF+KF++E P NKAN ILFLAD +PSTS SWCP
Sbjct  544  KKMPLKVVDATVSDFSAVFDKFRSELPNNKANFILFLADKDPSTSRSWCP  593



>ref|XP_001634184.1| predicted protein [Nematostella vectensis]
 gb|EDO42121.1| predicted protein [Nematostella vectensis]
Length=128

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 54/93 (58%), Gaps = 6/93 (6%)
 Frame = +2

Query  53   VFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDD---VALLK  223
            +FEK   E  K K   ++F+  I+  T  SWCPDCVRAEP + K +E    D      + 
Sbjct  16   LFEKI--EEQKGKRIFVMFIGAID-ETGDSWCPDCVRAEPNVEKAVENFQGDKNAAVFIL  72

Query  224  AYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            A VGDRPTW++P + +RV     LK +PTL+ W
Sbjct  73   AIVGDRPTWKDPNNEFRVHEKLRLKSIPTLMEW  105



>ref|XP_008350865.1| PREDICTED: uncharacterized protein LOC103414243 [Malus domestica]
Length=592

 Score = 76.3 bits (186),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = +2

Query  164  AEPVIYKKLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGA  334
            AEPV YK LEA +D VALL AYVGD PTWRN   P RVD  F L GVPTL RWE+ A
Sbjct  514  AEPVTYKXLEAXAD-VALLGAYVGDXPTWRNAXXPXRVDSRFKLTGVPTLXRWENDA  569


 Score = 27.7 bits (60),  Expect(2) = 5e-14, Method: Composition-based stats.
 Identities = 10/17 (59%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +3

Query  333  LKGRLEDHEAHLEHKID  383
            +KG LEDH+ H+E+KI+
Sbjct  570  IKGXLEDHKXHVENKIN  586



>ref|XP_011155994.1| PREDICTED: thioredoxin domain-containing protein 17-like [Solenopsis 
invicta]
Length=126

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 53/99 (54%), Gaps = 6/99 (6%)
 Frame = +2

Query  44   FNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLK  223
            F    E  KA  P      +L+     P T  SWCPDCV AEP I K  EA+ ++  L+ 
Sbjct  13   FLKYMEDLKATTPI----YVLYTGTKLPDTGESWCPDCVEAEPFIEKGFEAAPENTLLVI  68

Query  224  AYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQR  340
              VGDRP W++   P+R +P   LK +PTL RW  G Q+
Sbjct  69   VEVGDRPFWKDHNCPFRTNPVTKLKVLPTLARW--GTQK  105



>ref|XP_009495772.1| hypothetical protein H696_03625 [Fonticula alba]
 gb|KCV70166.1| hypothetical protein H696_03625 [Fonticula alba]
Length=128

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 56/98 (57%), Gaps = 2/98 (2%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVG  235
            F+   A+        ++F++ + P T  +WCPDCV A+PVI K +    + + L++  VG
Sbjct  13   FDSIMADLADEPLVFVVFISSVAPETGETWCPDCVIADPVIRKTVFELKNAI-LVECPVG  71

Query  236  DRPTWRN-PQHPWRVDPNFNLKGVPTLIRWEDGAQRST  346
             R  ++N P+HP+RV P   L+ +PTL+RW+      T
Sbjct  72   SRDEYKNRPEHPYRVHPKIQLRAIPTLMRWKGDGPVGT  109



>ref|XP_005099707.1| PREDICTED: thioredoxin domain-containing protein 17-like [Aplysia 
californica]
Length=126

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 55/96 (57%), Gaps = 1/96 (1%)
 Frame = +2

Query  29   ATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDD  208
             +V T +G     KA   K+    ++F AD + + S+SWCPDC  A+PV+ + L     D
Sbjct  2    TSVVTVHGHEALSKALKEKSSNAYVVFYADPDEN-SMSWCPDCRNADPVLRRHLSRLPSD  60

Query  209  VALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLI  316
              ++  YVGDRP W++  + +R DP + L  VPT+I
Sbjct  61   AQVIFCYVGDRPQWKDQNNSFRTDPVYKLTSVPTVI  96



>ref|XP_004161416.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101228417 
[Cucumis sativus]
Length=544

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPD  154
            MPLKV+DATV+ F+ VF+KF++E P NKAN ILFLAD +PSTS SWCP+
Sbjct  1    MPLKVVDATVSDFSAVFDKFRSELPNNKANFILFLADKDPSTSRSWCPE  49



>ref|XP_004991836.1| thioredoxin domain-containing protein 17 [Salpingoeca rosetta]
 gb|EGD75379.1| thioredoxin domain-containing protein 17 [Salpingoeca rosetta]
Length=126

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 56/106 (53%), Gaps = 4/106 (4%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            M  KV++  V   +      +A     K  ++L   D + S S SWCPDCV A+PV+ K 
Sbjct  1    MAHKVVE--VNAVDACLGAAEAATKDGKLAVVLCTGDDDESGS-SWCPDCVAAKPVVDKV  57

Query  188  L-EASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            L E   D V L+   VGDR TW++P + +R    F LK +PTL  W
Sbjct  58   LKEHGGDHVVLVVCKVGDRTTWKDPNNAFRTHDKFRLKSIPTLFAW  103



>gb|EFX66964.1| hypothetical protein DAPPUDRAFT_302246 [Daphnia pulex]
Length=124

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = +2

Query  83   KNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWRNPQ  262
            K+K   ILF +  + +T  SWCPDCV AEPVI K LE++  D   +   VGDR  W++P 
Sbjct  23   KSKEIFILF-SGSKDTTGHSWCPDCVEAEPVIEKALESAPKDAIFVYVGVGDRSFWKDPD  81

Query  263  HPWRVDPNFNLKGVPTLIRW  322
              +R D    L  +PTL++W
Sbjct  82   CVFRTDSKTKLTCIPTLLQW  101



>ref|XP_008461776.1| PREDICTED: uncharacterized protein LOC103500299 isoform X1 [Cucumis 
melo]
Length=544

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPD  154
            MPLKV+DAT++ FN VF+KF+++ P NKAN ILFLAD +PSTS SWCP+
Sbjct  1    MPLKVVDATLSDFNAVFDKFRSQLPNNKANFILFLADKDPSTSRSWCPE  49



>gb|ABK63289.1| thioredoxin-related protein 14 [Branchiostoma belcheri tsingtauense]
Length=123

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 46/84 (55%), Gaps = 1/84 (1%)
 Frame = +2

Query  74   EAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWR  253
            E  K K    LF      +   SWCPDCV A+PV+ + ++ + +D   +   VGDR  W+
Sbjct  18   EKHKGKTIFALFTGS-HDAQGKSWCPDCVAADPVVEECVKGAPEDAVFITCSVGDRAMWK  76

Query  254  NPQHPWRVDPNFNLKGVPTLIRWE  325
            + Q+ +R  P   L  VPTL+RWE
Sbjct  77   DQQNEFRTHPKLKLTSVPTLMRWE  100



>gb|EFN74197.1| Thioredoxin domain-containing protein 17 [Camponotus floridanus]
Length=126

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVG  235
            F K+  +    ++  IL+     P T  SWCPDCV A+P I +  EA+ ++  L+   VG
Sbjct  13   FLKYVDDLETAESVYILYTGTKLPDTGKSWCPDCVEADPFIEQGFEAAPEETQLIIVEVG  72

Query  236  DRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            DR  W++   P+R +P   LK +PTLI+W
Sbjct  73   DRSFWKDRNCPFRTNPITRLKVLPTLIKW  101



>ref|XP_005987558.1| PREDICTED: thioredoxin domain-containing protein 17 [Latimeria 
chalumnae]
Length=123

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 57/105 (54%), Gaps = 7/105 (7%)
 Frame = +2

Query  26   DATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSD  205
            +  V  F G  E    E  K+K  +  + +  +    +SWCPDCVRAEPV++ +L    +
Sbjct  6    EVNVCGFEGFMEA--VEQHKDK-QIFAYFSGSKNEQGVSWCPDCVRAEPVVHGELGHMPE  62

Query  206  DVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQR  340
                +   VG++P W+NP + +R     NL GVPTL+++  G Q+
Sbjct  63   GSVFIYCQVGEKPYWKNPNNEFR--EKLNLTGVPTLLKY--GTQK  103



>ref|XP_002117291.1| hypothetical protein TRIADDRAFT_61314 [Trichoplax adhaerens]
 gb|EDV20130.1| hypothetical protein TRIADDRAFT_61314 [Trichoplax adhaerens]
Length=107

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +2

Query  134  SLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTL  313
             LSWCPDCV+AEP+I K      D+V L+   VGDRP W++ ++ +R      LK +PTL
Sbjct  38   GLSWCPDCVKAEPIIDKIFSELKDNVLLVSCAVGDRPKWKDQENEFRKHEIIQLKSIPTL  97

Query  314  IRW  322
            I W
Sbjct  98   IEW  100



>ref|XP_011259215.1| PREDICTED: thioredoxin domain-containing protein 17-like [Camponotus 
floridanus]
Length=170

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVG  235
            F K+  +    ++  IL+     P T  SWCPDCV A+P I +  EA+ ++  L+   VG
Sbjct  57   FLKYVDDLETAESVYILYTGTKLPDTGKSWCPDCVEADPFIEQGFEAAPEETQLIIVEVG  116

Query  236  DRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            DR  W++   P+R +P   LK +PTLI+W
Sbjct  117  DRSFWKDRNCPFRTNPITRLKVLPTLIKW  145



>gb|ERZ96762.1| hypothetical protein GLOINDRAFT_299754 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX68715.1| hypothetical protein RirG_102570 [Rhizophagus irregularis DAOM 
197198w]
 gb|EXX68716.1| hypothetical protein RirG_102570 [Rhizophagus irregularis DAOM 
197198w]
Length=133

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
 Frame = +2

Query  44   FNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSD-DVALL  220
            F+G   K   E  K +   +L      P T  SWCPDCV+A+P+I K LE  +  +  L+
Sbjct  13   FDGTVNKIVQER-KGQNIFVLLFGTENPDTGKSWCPDCVKADPLIRKHLEEDAPVNSVLI  71

Query  221  KAYVGDRPTWRN-PQHPWRVDPNFNLKGVPTLIRWEDGAQ  337
            +  VG R  ++  P +P+R+ P   LK +PTLI+W +  +
Sbjct  72   EVPVGTREEYKGRPDNPYRLHPRIQLKSIPTLIKWTENVE  111



>gb|ACF35500.1| putative glutaredoxin [Dermacentor variabilis]
Length=127

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 61/109 (56%), Gaps = 3/109 (3%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYK  184
            M  KV+  +   F     ++K   PK++ +L+L F A  E +   SWCPDCV A+P++  
Sbjct  1    MVKKVVTRSFDEFQDAINRWKPR-PKDRQDLVLCFFAGSEDAKGDSWCPDCVAAKPILEA  59

Query  185  KLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDG  331
             L+ + +   L+  Y+ +R  W++ ++P+  D    LK VPTLIRW  G
Sbjct  60   ALKKAPEKTTLIMCYI-ERTIWKDMRNPFGTDKELELKCVPTLIRWGTG  107



>ref|XP_011049937.1| PREDICTED: thioredoxin domain-containing protein 17-like isoform 
X2 [Acromyrmex echinatior]
Length=120

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 41/76 (54%), Gaps = 0/76 (0%)
 Frame = +2

Query  95   NLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWRNPQHPWR  274
            N +LF     P T  SWC DCV AEP I      +S    LL   VGDR  W++P  P+R
Sbjct  29   NYVLFTGTKLPDTGKSWCSDCVEAEPFIEAGFADASQGTILLTVEVGDRAFWKDPNCPFR  88

Query  275  VDPNFNLKGVPTLIRW  322
             D    LK +PTLI+W
Sbjct  89   TDRCTRLKVLPTLIKW  104



>pdb|1V9W|A Chain A, Solution Structure Of Mouse Putative 42-9-9 Protein
Length=130

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 59/103 (57%), Gaps = 7/103 (7%)
 Frame = +2

Query  29   ATVATFNGV----FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLE  193
            AT+ATF  V    FE+F     ++++  I  + +  + +   SWCPDCV AEPVI + L+
Sbjct  6    ATMATFEEVSVLGFEEFDKAVKEHESKTIFAYFSGSKDTEGKSWCPDCVEAEPVIREGLK  65

Query  194  ASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
              ++D   +   VGD+P W++P + +R      +  VPTL+++
Sbjct  66   HVTEDCVFIYCQVGDKPYWKDPNNDFR--QKLKITAVPTLLKY  106



>gb|KHJ46624.1| hypothetical protein D918_02940 [Trichuris suis]
Length=115

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 54/96 (56%), Gaps = 3/96 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKA-NLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
             ++  +E  +N   N+ ++    +     SWCPDC  A+PVI +  +   +D  L++  V
Sbjct  3    LQELLSEIDRNAGKNIFIYFTGSKGKDGKSWCPDCNVADPVITECAKKLPEDSVLIRCEV  62

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQR  340
            GDRPTW++P + +R    F L  VPTLI+W  G Q+
Sbjct  63   GDRPTWKDPNNEYRKHDKFRLTCVPTLIKW--GTQQ  96



>ref|XP_011049936.1| PREDICTED: thioredoxin domain-containing protein 17-like isoform 
X1 [Acromyrmex echinatior]
 gb|EGI68384.1| Thioredoxin domain-containing protein 17 [Acromyrmex echinatior]
Length=129

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 41/76 (54%), Gaps = 0/76 (0%)
 Frame = +2

Query  95   NLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWRNPQHPWR  274
            N +LF     P T  SWC DCV AEP I      +S    LL   VGDR  W++P  P+R
Sbjct  29   NYVLFTGTKLPDTGKSWCSDCVEAEPFIEAGFADASQGTILLTVEVGDRAFWKDPNCPFR  88

Query  275  VDPNFNLKGVPTLIRW  322
             D    LK +PTLI+W
Sbjct  89   TDRCTRLKVLPTLIKW  104



>ref|XP_002878239.1| hypothetical protein ARALYDRAFT_907360 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54498.1| hypothetical protein ARALYDRAFT_907360 [Arabidopsis lyrata subsp. 
lyrata]
Length=134

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 45/93 (48%), Gaps = 26/93 (28%)
 Frame = +2

Query  47   NGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKA  226
            +G     + E  ++K + ILFLAD +P+T  SWCP                         
Sbjct  44   DGPISCSRIETNRSKISFILFLADNDPTTGQSWCP-------------------------  78

Query  227  YVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
              GDRP WR P H WRVD  F L GVPTL+RW+
Sbjct  79   -AGDRPAWRTPTHSWRVDSRFKLIGVPTLVRWD  110



>ref|XP_002640925.1| Hypothetical protein CBG00487 [Caenorhabditis briggsae]
 emb|CAP21777.1| Protein CBG00487 [Caenorhabditis briggsae]
Length=132

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 51/89 (57%), Gaps = 3/89 (3%)
 Frame = +2

Query  83   KNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLE---ASSDDVALLKAYVGDRPTWR  253
            K K  + LF      ST  SWCPDCV AEP++ + ++    ++ DV  +  +VG+R  WR
Sbjct  24   KGKRVVALFTGSKNLSTGQSWCPDCVVAEPIVDQVIQDTVVAAIDVHFITVFVGNREVWR  83

Query  254  NPQHPWRVDPNFNLKGVPTLIRWEDGAQR  340
            +P   +R DP+  L  +PTL+   + A+R
Sbjct  84   DPAVGFRTDPSLKLTCIPTLLEVRNKAKR  112



>emb|CDS08109.1| hypothetical protein LRAMOSA02058 [Absidia idahoensis var. thermophila]
Length=129

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 58/105 (55%), Gaps = 7/105 (7%)
 Frame = +2

Query  14   LKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK-L  190
            +K + AT+  F+ V    K     +    ++F    +P T+ SWCPDCV A+P+I K  L
Sbjct  1    MKAIRATLENFDAVL---KNGLESHNPVYVVFFGTEKPETNESWCPDCVVADPLIRKAIL  57

Query  191  EASSDDVALLKAYVGDRPTWR-NPQHPWRVDPNFNLKGVPTLIRW  322
              + ++  LL+A VG R  W+ N  HP+R    FNL  +PTL RW
Sbjct  58   THAPENALLLEAPVGHREDWKGNASHPYRT--RFNLSAIPTLFRW  100



>gb|KFD62735.1| hypothetical protein M514_09194 [Trichuris suis]
Length=139

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 54/96 (56%), Gaps = 3/96 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKA-NLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
             ++  +E  +N   N+ ++    +     SWCPDC  A+PVI +  +   +D  L++  V
Sbjct  27   LQELLSEIDRNAGKNIFIYFTGSKGKDGKSWCPDCNVADPVITECAKKLPEDSVLIRCEV  86

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQR  340
            GDRPTW++P + +R    F L  VPTLI+W  G Q+
Sbjct  87   GDRPTWKDPNNEYRKHDKFRLTCVPTLIKW--GTQQ  120



>gb|KFD49980.1| hypothetical protein M513_09194 [Trichuris suis]
Length=139

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 54/96 (56%), Gaps = 3/96 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKA-NLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
             ++  +E  +N   N+ ++    +     SWCPDC  A+PVI +  +   +D  L++  V
Sbjct  27   LQELLSEIDRNAGKNIFIYFTGSKGKDGKSWCPDCNVADPVITECAKKLPEDSVLIRCEV  86

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQR  340
            GDRPTW++P + +R    F L  VPTLI+W  G Q+
Sbjct  87   GDRPTWKDPNNEYRKHDKFRLTCVPTLIKW--GTQQ  120



>gb|EGT36737.1| hypothetical protein CAEBREN_02755 [Caenorhabditis brenneri]
Length=130

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 51/100 (51%), Gaps = 3/100 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVI---YKKLEASSDDVALLKA  226
            F++      K    + LF      +T  SWCPDCV AEPVI    K  + +  DV  +  
Sbjct  14   FQETLKSIGKGHRVVALFTGSKSLTTGESWCPDCVVAEPVIDEVIKGADVAGIDVHFVTV  73

Query  227  YVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQRST  346
            +VG+R  WR+P   +R DP   L  +PTL+   + A+R T
Sbjct  74   FVGNREVWRDPSVGFRTDPALKLTCIPTLLEIGNKAKRLT  113



>ref|XP_011420601.1| PREDICTED: thioredoxin domain-containing protein 17-like [Crassostrea 
gigas]
Length=123

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 49/89 (55%), Gaps = 1/89 (1%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLILFL-ADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
             E +K    +NK   I  L +    +   SWCPDCV A+PV+ + L+ + +D   +   V
Sbjct  10   LEAYKKAVDENKGKTIFALFSGSTDADGKSWCPDCVTADPVVMRNLKHAEEDAVFIHCGV  69

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIR  319
            GDR  W++  + +R +P   LK VPTL++
Sbjct  70   GDRAFWKDQSNAFRKEPGLELKSVPTLLK  98



>ref|XP_001961792.1| GF15144 [Drosophila ananassae]
 gb|EDV31013.1| GF15144 [Drosophila ananassae]
Length=126

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 57/102 (56%), Gaps = 1/102 (1%)
 Frame = +2

Query  20   VLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEAS  199
            V+   V  ++   +K +     N A  +LF    +    LSWCP CV+AEPVI+  L+ +
Sbjct  2    VVTHNVKGYDEFSKKMEELESGNGAVHVLFSGG-KDENGLSWCPYCVKAEPVIHDALKKA  60

Query  200  SDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
             D+   +   VG+R  W++   P+R DPN +L  +PTL+RW+
Sbjct  61   PDNSHFVHVDVGERAFWKDLNCPFRKDPNTHLVFLPTLLRWK  102



>gb|KDR20080.1| Thioredoxin domain-containing protein 17 [Zootermopsis nevadensis]
Length=124

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = +2

Query  98   LILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWRNPQHPWRV  277
            + L+    + +   SWCPDCV+A PV+ K +E  ++++  +   VGDR  W++P+ P+R 
Sbjct  27   VYLYFCGSKKADGKSWCPDCVKASPVVEKAVE-EAENIHFVYVGVGDRDVWKDPKCPFRT  85

Query  278  DPNFNLKGVPTLIRW  322
            D +  LK VPTLI W
Sbjct  86   DKHLQLKSVPTLIVW  100



>ref|XP_002129555.1| PREDICTED: thioredoxin domain-containing protein 17-like [Ciona 
intestinalis]
Length=124

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 3/82 (4%)
 Frame = +2

Query  83   KNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAY--VGDRPTWRN  256
            K+K  + LF  D +     SWCPDCV +EP++ K LE   DD + +  Y  VG R  W++
Sbjct  22   KDKIIICLFTGD-KDENGKSWCPDCVTSEPIVRKSLELIKDDDSFVFVYCSVGGRAFWKD  80

Query  257  PQHPWRVDPNFNLKGVPTLIRW  322
              +P+R +    L GVPTL++W
Sbjct  81   KSNPFRTNDKLKLNGVPTLMKW  102



>ref|XP_003386713.1| PREDICTED: thioredoxin domain-containing protein 17-like [Amphimedon 
queenslandica]
Length=126

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (57%), Gaps = 3/76 (4%)
 Frame = +2

Query  98   LILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWRNPQHPWRV  277
             +LF    +  T  SWC DCV+A+PVI       S  V L+   VGDRP W++  +P+R 
Sbjct  31   FVLFCGSTDQQTGHSWCSDCVKADPVIENVASKQSSGV-LITCSVGDRPAWKDLNNPFRT  89

Query  278  DPNFNLKGVPTLIRWE  325
              N  L GVPTL+ WE
Sbjct  90   --NLKLTGVPTLMEWE  103



>ref|XP_011334816.1| PREDICTED: thioredoxin domain-containing protein 17-like [Cerapachys 
biroi]
 ref|XP_011334817.1| PREDICTED: thioredoxin domain-containing protein 17-like [Cerapachys 
biroi]
 gb|EZA56875.1| Thioredoxin domain-containing protein [Cerapachys biroi]
Length=131

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 50/83 (60%), Gaps = 4/83 (5%)
 Frame = +2

Query  98   LILFLADIEPSTSLSWCPDCVRAEPVIYKKLEA--SSDDVALLKAYVGDRPTWRNPQHPW  271
             +L+     P T+ SWCPDCV AEPV+ + LEA  SS ++ L+   VGDR  W++   P+
Sbjct  28   FMLYTGTKLPDTTKSWCPDCVEAEPVLEQALEAADSSQEMQLVVVEVGDRAFWKDQNCPF  87

Query  272  RVDPNFNLKGVPTLIRWEDGAQR  340
            R +P   LK +PTL  W  G Q+
Sbjct  88   RTNPITKLKVLPTLALW--GTQK  108



>ref|XP_002594853.1| hypothetical protein BRAFLDRAFT_124440 [Branchiostoma floridae]
 gb|EEN50864.1| hypothetical protein BRAFLDRAFT_124440 [Branchiostoma floridae]
Length=113

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 45/83 (54%), Gaps = 1/83 (1%)
 Frame = +2

Query  74   EAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWR  253
            E  K K    LF      +   SWCPDCV A+PV+ K ++ + +D   +   VGDR TW+
Sbjct  18   EKHKGKTIFALFTGS-HDAQGKSWCPDCVAADPVVEKCVKGAPEDAVFITCSVGDRATWK  76

Query  254  NPQHPWRVDPNFNLKGVPTLIRW  322
            + ++ +R      L  VPTL+RW
Sbjct  77   DQKNDFRTHDKLKLTSVPTLMRW  99



>ref|XP_005525700.1| PREDICTED: thioredoxin domain-containing protein 17 [Pseudopodoces 
humilis]
Length=122

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = +2

Query  71   AEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTW  250
            A++   +   +LF  D + +   SWCPDCV AEP++ K+L    D+   +   VGDRP W
Sbjct  18   AQSYHGRPIFVLFCGD-KGAEGRSWCPDCVTAEPIVRKELHNLPDESVFIYCLVGDRPYW  76

Query  251  RNPQHPWRVDPNFNLKGVPTLIRW  322
            ++P + +R   N  L GVPTL+++
Sbjct  77   KDPNNEFR--KNLKLTGVPTLLKY  98



>ref|XP_003375804.1| arginyl-tRNA--protein transferase 1 [Trichinella spiralis]
 gb|EFV58951.1| arginyl-tRNA--protein transferase 1 [Trichinella spiralis]
Length=484

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 57/105 (54%), Gaps = 9/105 (9%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFL-ADIEPSTSLSWCPDCVRAEPVIYK  184
            MP+K L          ++   AE  + K  ++  L    + S   SWCPDCV+A+ +I K
Sbjct  351  MPIKDLKG--------YQSLLAEIDRLKGKVVFLLFTGSKDSFGKSWCPDCVKADKIIEK  402

Query  185  KLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIR  319
              E    D  L++  VGDR TW+NP++ +R D  F++  +PTL++
Sbjct  403  YAEKLDADSVLIRCDVGDRSTWKNPENEFRTDKTFHITAIPTLMK  447



>ref|XP_003111581.1| hypothetical protein CRE_03102 [Caenorhabditis remanei]
 gb|EFO83442.1| hypothetical protein CRE_03102 [Caenorhabditis remanei]
Length=132

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 57/108 (53%), Gaps = 4/108 (4%)
 Frame = +2

Query  32   TVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLE---ASS  202
            T   ++G F++      K +  + LF      +T  SWCPDCV AEPVI + ++    S 
Sbjct  8    TAQGYDG-FKQTVETIGKGQRIVALFTGSKILTTGKSWCPDCVVAEPVIDQIIKEPPVSE  66

Query  203  DDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQRST  346
             DV  +  +VG+R  WR+P   +R DP+  L  +PTL+     A+R T
Sbjct  67   TDVHFITVFVGNREVWRDPAVGFRTDPSLKLTCIPTLLEVGKKAKRLT  114



>emb|CDH49145.1| hypothetical protein RO3G_05788 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=129

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 58/106 (55%), Gaps = 9/106 (8%)
 Frame = +2

Query  14   LKVLDATVATFNGVF-EKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK-  187
            +K + AT+  F+    E  ++  P      ++F    +P T+ SWCPDCV A+P+I K  
Sbjct  1    MKAVRATLENFDAALKEGLESHNPV----YVVFFGTEKPETNESWCPDCVVADPLIRKAI  56

Query  188  LEASSDDVALLKAYVGDRPTWR-NPQHPWRVDPNFNLKGVPTLIRW  322
            L  +  +  LL+A VG R  W+ N  HP+R    FNL  +PTL RW
Sbjct  57   LTHAPQNALLLEAPVGHREDWKGNASHPYRT--RFNLSAIPTLFRW  100



>ref|XP_312874.2| AGAP003178-PA [Anopheles gambiae str. PEST]
 gb|EAA08363.2| AGAP003178-PA [Anopheles gambiae str. PEST]
Length=127

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 50/92 (54%), Gaps = 1/92 (1%)
 Frame = +2

Query  53   VFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASS-DDVALLKAY  229
             F  F  +   N   + +     +    LSWC DCV A P I K +E ++ ++   +   
Sbjct  12   AFVAFMKDFNGNGGAINILFTGAKLENGLSWCGDCVDAAPYIEKAIETNAPENSHFIYVD  71

Query  230  VGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
            VGDRPTW++  +P+R D N +L  +PT+IRW+
Sbjct  72   VGDRPTWKDMNNPFRKDTNTHLSVIPTMIRWK  103



>ref|XP_001357474.1| GA10712 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL34544.1| GA10712 [Drosophila pseudoobscura pseudoobscura]
Length=126

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 55/101 (54%), Gaps = 1/101 (1%)
 Frame = +2

Query  20   VLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEAS  199
            V+   V  F    +K +     N A  +LF    + +   SWCP CV+AEPVI+  L+ +
Sbjct  2    VVTHNVKGFEEFSKKMEELETGNNAVHVLFSGGKDENGE-SWCPYCVKAEPVIHDALKKA  60

Query  200  SDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
             D+   +   VG+R  W++   P+R DPN +L  +PTL+RW
Sbjct  61   PDNSHFVHVDVGERAYWKDLNCPFRKDPNTHLIFLPTLLRW  101



>ref|XP_004433300.1| PREDICTED: thioredoxin domain-containing protein 17 [Ceratotherium 
simum simum]
Length=123

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 52/90 (58%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            FE+F     ++K  +I  +    + +   SWCPDCV+AEPV+ + L+  S+    +   V
Sbjct  12   FEEFSRAVEQHKGKIIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHVSEGCVFIYCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            G+RP W++P + +R   N  +  VPTL+++
Sbjct  72   GERPYWKDPNNDFR--KNLKITAVPTLLKY  99



>gb|EHJ75979.1| thioredoxin-like protein [Danaus plexippus]
Length=126

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 49/95 (52%), Gaps = 1/95 (1%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVG  235
            F K+  +   N   ++ F +  +     SWCPDCV AEPV+   L     D+  +   VG
Sbjct  13   FTKYTEQINSNDPPVLFFFSGSKLPNGNSWCPDCVEAEPVVKAFLSELKKDITFVYVDVG  72

Query  236  DRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQR  340
            DR  W++   P+R D    L  +PT+I+W+ G QR
Sbjct  73   DRDYWKDRACPFRTDSRTKLMVIPTIIKWK-GVQR  106



>ref|NP_001099275.1| thioredoxin domain-containing protein 17 [Rattus norvegicus]
 gb|EDM05095.1| thioredoxin-like 5 (predicted), isoform CRA_b [Rattus norvegicus]
 gb|AAI59409.1| Thioredoxin domain containing 17 [Rattus norvegicus]
Length=123

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 56/101 (55%), Gaps = 7/101 (7%)
 Frame = +2

Query  35   VATFNGV----FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEAS  199
            +ATF  V    FE+F     +++   I  F +  + +   SWCPDCV AEP+I + L+  
Sbjct  1    MATFEEVSVLGFEEFDKAVKEHQGKTIFAFFSGSKDTEGKSWCPDCVEAEPIIREGLKHV  60

Query  200  SDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            ++D   +   VGD+P W++P + +R      +  VPTL+++
Sbjct  61   TEDCVFIYCQVGDKPYWKDPNNDFR--QKLKITAVPTLLKY  99



>gb|ACO09547.1| Thioredoxin-like protein 5 [Osmerus mordax]
Length=123

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 53/90 (59%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKF-KAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            +E+F KA + +   ++  + +  + +  +SWCPDCV+AEPV+  +L    D    +   V
Sbjct  12   YEEFSKAVSERKGKDIFAYFSGNKDAQGMSWCPDCVKAEPVVRGELSHLPDGSVFIYCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            G+RP W++P + ++      L GVPTL+R+
Sbjct  72   GERPYWKDPSNEFK--KTLKLSGVPTLLRY  99



>emb|CDJ91244.1| Protein of unknown function DUF953 domain containing protein 
[Haemonchus contortus]
Length=123

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 50/104 (48%), Gaps = 5/104 (5%)
 Frame = +2

Query  38   ATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVI---YKKLEASSDD  208
             T NG  E  KA +  N    +LF          SWCPDCV AEP I     K +  S D
Sbjct  4    VTVNGYEEVNKAISSANGRVFVLFTGS--KVDGKSWCPDCVSAEPFIESVTHKEDVKSLD  61

Query  209  VALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQR  340
               +  +VG R  W++P+ P+R DP + L  +PTLI      +R
Sbjct  62   ATFITCFVGARDYWKDPKCPFRTDPTYKLTCIPTLIECGKKHKR  105



>emb|CEF66639.1| Protein of unknown function DUF953, thioredoxin-like family and 
Thioredoxin-like fold domain-containing protein [Strongyloides 
ratti]
Length=128

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 56/104 (54%), Gaps = 5/104 (5%)
 Frame = +2

Query  47   NGVFEKFKAEAPKNKANLILFL-ADIEPSTSLSWCPDCVRAEPVIYKKLE---ASSDDVA  214
            NG +++ K     NK   I  L    + S  +SWCPDCV AEPVI + +E      ++V 
Sbjct  9    NG-YDELKKTILSNKGRRIFVLFTGSKNSDGVSWCPDCVEAEPVIEEAIEKDLTKEENVT  67

Query  215  LLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQRST  346
             +  +VG+R  W++ ++P+R D  F +  +PTLI      +R T
Sbjct  68   FITCFVGERAYWKDMENPFRKDDEFKVNCIPTLIEIGVKGKRLT  111



>dbj|BAE41434.1| unnamed protein product [Mus musculus]
Length=123

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 56/101 (55%), Gaps = 7/101 (7%)
 Frame = +2

Query  35   VATFNGV----FEKF-KAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEAS  199
            +ATF  V    FE+F KA   +    +  + +  + +   SWCPDCV AEPVI + L+  
Sbjct  1    MATFEEVSVLGFEEFDKAVKEREGKTIFAYFSGSKDTEGKSWCPDCVEAEPVIREGLKHV  60

Query  200  SDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            ++D   +   VGD+P W++P + +R      +  VPTL+++
Sbjct  61   TEDCVFIYCQVGDKPHWKDPNNDFR--QKLKITAVPTLLKY  99



>gb|AAW26135.1| SJCHGC02110 protein [Schistosoma japonicum]
Length=122

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 52/91 (57%), Gaps = 3/91 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKAN--LILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAY  229
             ++  AE  K++     ILF     P  + +WCPDCV+ EP++ + L+   ++   LKA 
Sbjct  10   IDELLAEVKKHEGKRIFILFCGTPFPDGT-NWCPDCVKGEPIVKEALKKLPENAVFLKAE  68

Query  230  VGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            VGDR TWR+P + +R  P   +  +P+LI +
Sbjct  69   VGDRTTWRDPNNVFRTHPKCQISSIPSLIEF  99



>emb|CAC51438.1| putative 42-9-9 protein [Mus musculus]
Length=123

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 56/101 (55%), Gaps = 7/101 (7%)
 Frame = +2

Query  35   VATFNGV----FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEAS  199
            +ATF  V    FE+F     +++   I  + +  + +   SWCPDCV AEPVI + L+  
Sbjct  1    MATFEEVSVLGFEEFDKAVKEHEGKTIFAYFSGSKDTEGQSWCPDCVEAEPVIREGLKHV  60

Query  200  SDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            ++D   +   VGD+P W++P + +R      +  VPTL+++
Sbjct  61   TEDCVFIYCQVGDKPYWKDPNNDFR--QKLKITAVPTLLKY  99



>gb|KHN86804.1| Thioredoxin domain-containing protein 17 [Toxocara canis]
Length=173

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 58/116 (50%), Gaps = 16/116 (14%)
 Frame = +2

Query  23   LDATVATFNGVFEKFKAEA---------PKNKANLILFLADIEPSTSLSWCPDCVRAEPV  175
            L+  +A F+ V EK   E                +ILF    + ++  SWCPDCV+AEPV
Sbjct  32   LEGLIAKFDMVLEKITLEGYDALKKVLEGSKTRTVILFTGSKDSASGRSWCPDCVQAEPV  91

Query  176  IYKKLE-------ASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            I K +        A  +++  ++  VG R  W++P++ +R+D    +  +PTL+ +
Sbjct  92   IGKVMHELSTSSFAEQNNMRYIECSVGPREYWKDPKNSFRIDEKLKISCIPTLLEY  147



>emb|CDW56879.1| DUF953 domain containing protein [Trichuris trichiura]
Length=115

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 51/96 (53%), Gaps = 3/96 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKA-NLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
             ++  +E  +N   N+ ++    +     SWCPDC  A+PVI        +D  L++  V
Sbjct  3    LQELLSEIDRNAGKNIFIYFTGSKDKDGKSWCPDCNVADPVITDCATKLPEDSVLIRCEV  62

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQR  340
            GDRPTW++P + +R      L  VPTLI+W  G Q+
Sbjct  63   GDRPTWKDPNNEYRKHDKLRLTCVPTLIKW--GTQQ  96



>dbj|BAB23225.1| unnamed protein product [Mus musculus]
Length=123

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 57/101 (56%), Gaps = 7/101 (7%)
 Frame = +2

Query  35   VATFNGV----FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEAS  199
            +ATF  V    FE+F     ++++  I  + +  + +   SWCPDCV AEPVI + L+  
Sbjct  1    MATFEEVSVLGFEEFDKAVKEHESKTIFAYFSGSKDTEGKSWCPDCVEAEPVIREGLKHV  60

Query  200  SDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            ++D   +   VGD+P W++P + +R      +  VPTL+++
Sbjct  61   TEDCVFIYCQVGDKPYWKDPNNDFR--QKLKITAVPTLLKY  99



>ref|XP_011151974.1| PREDICTED: thioredoxin domain-containing protein 17-like [Harpegnathos 
saltator]
 ref|XP_011151975.1| PREDICTED: thioredoxin domain-containing protein 17-like [Harpegnathos 
saltator]
Length=126

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 48/90 (53%), Gaps = 2/90 (2%)
 Frame = +2

Query  71   AEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTW  250
             E  K K  + +     + +   SWCPDCV AEP I K  E +S +  L+   VGDRP W
Sbjct  17   VEKLKKKEPIYVLYTGTKLANGKSWCPDCVNAEPFIEKAFETASANTQLVIVEVGDRPFW  76

Query  251  RNPQHPWRVDPNFNLKGVPTLIRWEDGAQR  340
            ++   P+R +    LK +PTL RW  G Q+
Sbjct  77   KDQNCPFRTNFITKLKVLPTLSRW--GTQK  104



>gb|KFM76754.1| Thioredoxin domain-containing protein 17, partial [Stegodyphus 
mimosarum]
Length=123

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = +2

Query  95   NLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWRNPQHPWR  274
            +L L     E +   SWCPDCV A+PVI+  L+ + ++  L+   VGDR  W++P + +R
Sbjct  25   SLFLLFTGAEDADGRSWCPDCVDAKPVIFDCLKYAPENSVLVIGSVGDRNAWKDPNNDFR  84

Query  275  VDPNFNLKGVPTLIRWE  325
             D    L  VPTLI+++
Sbjct  85   RDEQLKLTCVPTLIKFK  101



>ref|NP_080835.1| thioredoxin domain-containing protein 17 [Mus musculus]
 sp|Q9CQM5.1|TXD17_MOUSE RecName: Full=Thioredoxin domain-containing protein 17; AltName: 
Full=14 kDa thioredoxin-related protein; Short=TRP14; AltName: 
Full=Protein 42-9-9; AltName: Full=Thioredoxin-like protein 
5 [Mus musculus]
 dbj|BAB25126.1| unnamed protein product [Mus musculus]
 dbj|BAB28648.1| unnamed protein product [Mus musculus]
 gb|AAH30344.1| Thioredoxin domain containing 17 [Mus musculus]
 dbj|BAC36336.1| unnamed protein product [Mus musculus]
 gb|EDL12665.1| thioredoxin-like 5, isoform CRA_b [Mus musculus]
Length=123

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 56/101 (55%), Gaps = 7/101 (7%)
 Frame = +2

Query  35   VATFNGV----FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEAS  199
            +ATF  V    FE+F     +++   I  + +  + +   SWCPDCV AEPVI + L+  
Sbjct  1    MATFEEVSVLGFEEFDKAVKEHEGKTIFAYFSGSKDTEGKSWCPDCVEAEPVIREGLKHV  60

Query  200  SDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            ++D   +   VGD+P W++P + +R      +  VPTL+++
Sbjct  61   TEDCVFIYCQVGDKPYWKDPNNDFR--QKLKITAVPTLLKY  99



>ref|XP_005233094.1| PREDICTED: thioredoxin domain-containing protein 17 [Falco peregrinus]
Length=122

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 45/75 (60%), Gaps = 3/75 (4%)
 Frame = +2

Query  98   LILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWRNPQHPWRV  277
              LF  D + +   SWCPDCVRAEPV+ K+L    D+   +   VGDR  W++P + +R 
Sbjct  27   FALFCGDKD-AEGRSWCPDCVRAEPVVRKELHNMPDESVFIYCLVGDRAYWKDPNNEFR-  84

Query  278  DPNFNLKGVPTLIRW  322
              N  L GVPTL+++
Sbjct  85   -KNLKLTGVPTLLKY  98



>ref|XP_395877.1| PREDICTED: thioredoxin domain-containing protein 17 isoform X2 
[Apis mellifera]
 ref|XP_006559744.1| PREDICTED: thioredoxin domain-containing protein 17 isoform X1 
[Apis mellifera]
 ref|XP_006609827.1| PREDICTED: thioredoxin domain-containing protein 17-like isoform 
X1 [Apis dorsata]
 ref|XP_006609828.1| PREDICTED: thioredoxin domain-containing protein 17-like isoform 
X2 [Apis dorsata]
Length=126

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 55/107 (51%), Gaps = 4/107 (4%)
 Frame = +2

Query  20   VLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEAS  199
            VL   V  F   FE F      N++  IL+     P+   SWCPDCV AEP I +  + +
Sbjct  2    VLRHHVEGFENFFE-FMKNFKSNESIYILYTGKKLPNGK-SWCPDCVEAEPFIEEGFKIA  59

Query  200  SDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQR  340
                 L++  VGDRP W++   P+R +    LK +PTL +W  G Q+
Sbjct  60   PTSAHLIEVEVGDRPYWKDLNCPFRANSVTKLKVLPTLAKW--GTQK  104



>ref|XP_005178368.1| PREDICTED: thioredoxin domain-containing protein 17-like [Musca 
domestica]
Length=126

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 51/95 (54%), Gaps = 2/95 (2%)
 Frame = +2

Query  44   FNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKL-EASSDDVALL  220
            F+G FEK   E  K    L ++    +    +SWCPDC  A P +   + E + DD   L
Sbjct  10   FDG-FEKSVEELSKCGKKLFVYFTGEKDENGVSWCPDCNVAGPKVEAAVKEFADDDSVFL  68

Query  221  KAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
               VG+RP W++ ++P+R D    L  +PTLIRW+
Sbjct  69   TVDVGNRPFWKDMKNPFREDARLKLMVIPTLIRWQ  103



>ref|XP_011506558.1| PREDICTED: thioredoxin domain-containing protein 17-like isoform 
X1 [Ceratosolen solmsi marchali]
 ref|XP_011506559.1| PREDICTED: thioredoxin domain-containing protein 17-like isoform 
X1 [Ceratosolen solmsi marchali]
Length=126

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 57/111 (51%), Gaps = 7/111 (6%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            M +K      A F    + FK   P      IL++   E +   SWCPDCV+A P I K 
Sbjct  1    MVIKHHINGYANFITFIKNFKTNNPT----FILYMGS-EMADGNSWCPDCVKAHPFIEKG  55

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQR  340
            ++++      +   VGDR  W+N + P+R +   +++ +PTL++W  G Q+
Sbjct  56   IQSAPGTYHYIIVSVGDRAFWKNSKCPFRTNSEIHIQTLPTLVKW--GTQK  104



>gb|ACI67762.1| Thioredoxin domain-containing protein 17 [Salmo salar]
Length=123

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 52/92 (57%), Gaps = 2/92 (2%)
 Frame = +2

Query  47   NGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKA  226
            +G  E  KA + +   ++  + +  + +  +SWCPDCV AEPV+  ++    +    +  
Sbjct  10   HGYDEFCKAVSERKGKDIFAYFSGDKDAQGMSWCPDCVEAEPVVRGEMSHLPEGSVFIYC  69

Query  227  YVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
             VG+RP W++P + ++  P   L GVPTLIR+
Sbjct  70   QVGERPYWKDPNNKFKKTP--KLSGVPTLIRY  99



>ref|XP_009052019.1| hypothetical protein LOTGIDRAFT_214285 [Lottia gigantea]
 gb|ESO97430.1| hypothetical protein LOTGIDRAFT_214285 [Lottia gigantea]
Length=123

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 50/90 (56%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLI--LFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAY  229
            +E +K  A +NK+ L+  LF   +  +   SWCPDCV A PVI   L+ +  D   +   
Sbjct  10   YEAYKKAAEENKSKLVFALFCGSVNANGE-SWCPDCVTAAPVIADNLKHAPKDSVFIHCG  68

Query  230  VGDRPTWRNPQHPWRVDPNFNLKGVPTLIR  319
            VG R  W++  + +R DP   LK VPTL++
Sbjct  69   VGGRDFWKDQNNVFRKDPVLKLKSVPTLLK  98



>emb|CBY33091.1| unnamed protein product [Oikopleura dioica]
Length=121

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  140  SWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIR  319
            SWCPDCV AEPV++ +L    +    +   VG R  W+N ++ +RVDP   L GVPTL++
Sbjct  37   SWCPDCVTAEPVVHGELNKLPEGAVFVHVDVGGRTYWKNKENDFRVDPKLKLSGVPTLLK  96

Query  320  W  322
            +
Sbjct  97   Y  97



>ref|XP_001504786.1| PREDICTED: thioredoxin domain-containing protein 17 [Equus caballus]
 ref|XP_008517596.1| PREDICTED: thioredoxin domain-containing protein 17 [Equus przewalskii]
Length=123

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 50/90 (56%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            FE+F     ++K   I  +    + +   SWCPDCV+AEPV+ + L+   +    +   V
Sbjct  12   FEEFNRAVEQHKGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVQEGLKHVGEGCVFIHCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            G+RP W++P + +R   N  +  VPTL+++
Sbjct  72   GERPYWKDPNNDFR--KNLKITAVPTLLKY  99



>gb|KFP06109.1| Thioredoxin domain-containing protein 17, partial [Calypte anna]
Length=116

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 47/84 (56%), Gaps = 3/84 (4%)
 Frame = +2

Query  71   AEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTW  250
            A+    +    LF  D + +   SWCPDCV AEPV+ K+L    DD   +   VGDR  W
Sbjct  12   AQRYHGRPIFALFCGD-KDAEGRSWCPDCVTAEPVVRKELHNMPDDSVFIYCLVGDRTYW  70

Query  251  RNPQHPWRVDPNFNLKGVPTLIRW  322
            ++P + +R   N  L GVPTL+++
Sbjct  71   KDPNNEFR--KNLKLTGVPTLLKY  92



>ref|XP_006992253.1| PREDICTED: thioredoxin domain-containing protein 17 [Peromyscus 
maniculatus bairdii]
Length=191

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 56/101 (55%), Gaps = 7/101 (7%)
 Frame = +2

Query  35   VATFNGV----FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEAS  199
            +ATF  V    FE+F     +++   I  + +  + +   SWCPDCV AEPV+ + L+  
Sbjct  69   MATFEEVSVSGFEEFDQAVKEHQGKTIFAYFSGSKDAEGKSWCPDCVEAEPVVREGLKHV  128

Query  200  SDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            ++D   +   VGDRP W++P + +R      L  VPTL+++
Sbjct  129  TEDCVFIYCQVGDRPYWKDPSNDFRQ--KLKLTAVPTLLKY  167



>ref|XP_002064726.1| GK15089 [Drosophila willistoni]
 gb|EDW75712.1| GK15089 [Drosophila willistoni]
Length=127

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +2

Query  20   VLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEAS  199
            V+   V  +    +K +        ++ +  +  +    LSWCP CV+AEPVI+  L+ +
Sbjct  2    VVTHNVKGYEEFSKKMEELEGNGNGSVHVLFSGGKDENGLSWCPYCVKAEPVIHDALQKA  61

Query  200  SDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
              +   +   VG+R  W++   P+R DPN +L  +PTL+RW+
Sbjct  62   PQNSHFVHVDVGERAFWKDLNCPFRKDPNTHLIFLPTLLRWK  103



>dbj|GAA32185.2| thioredoxin domain-containing protein 17 [Clonorchis sinensis]
Length=227

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 47/88 (53%), Gaps = 1/88 (1%)
 Frame = +2

Query  68   KAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPT  247
            K E  K K   +LF +       +SWCPDCV  +PVI + L+   +D   L   VGDRP 
Sbjct  70   KTEENKGKRIFVLF-SGTPSENGVSWCPDCVAVKPVINEALKYLPEDSIFLTVLVGDRPA  128

Query  248  WRNPQHPWRVDPNFNLKGVPTLIRWEDG  331
            WR+  + +R + N  +  +PTLI +  G
Sbjct  129  WRSSSNVFRTNSNCAISSIPTLIEFGTG  156



>emb|CEG76458.1| hypothetical protein RMATCC62417_11354 [Rhizopus microsporus]
Length=124

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 55/101 (54%), Gaps = 18/101 (18%)
 Frame = +2

Query  23   LDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASS  202
            L+ +VAT N VF              +LF     P TS SWCPDCV A+P+I K + +  
Sbjct  15   LNESVATGNPVF--------------VLFFGTEVPETSESWCPDCVIADPLIRKAI-SPV  59

Query  203  DDVALLKAYVGDRPTWR-NPQHPWRVDPNFNLKGVPTLIRW  322
            ++  LL+A VG R  W+ N  HP+RV   F L  +PTL +W
Sbjct  60   ENAILLEAPVGARNEWKGNTTHPYRV--RFGLSAIPTLFKW  98



>ref|XP_008307589.1| PREDICTED: thioredoxin domain-containing protein 17 [Cynoglossus 
semilaevis]
Length=123

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 53/90 (59%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKF-KAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            +E+F +A A +   ++ ++ +  + +   SWCPDCV+AEPV+  ++    D    +   V
Sbjct  12   YEEFCQAIAERKGKDIFVYFSGNKDAEGKSWCPDCVKAEPVVRGEMSNLPDGSVFIYCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            G+R  W+NP + ++   N  L GVPTL+R+
Sbjct  72   GERTYWKNPNNDFK--KNLKLTGVPTLMRY  99



>ref|XP_003698736.1| PREDICTED: thioredoxin domain-containing protein 17-like [Apis 
florea]
Length=126

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 55/107 (51%), Gaps = 4/107 (4%)
 Frame = +2

Query  20   VLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEAS  199
            VL   V  F   FE F      N++  IL+     P+   SWCPDCV AEP I +  + +
Sbjct  2    VLRHHVEGFENFFE-FMKNFKSNESIYILYTGKKLPNGK-SWCPDCVEAEPFIEEGFKIA  59

Query  200  SDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQR  340
                 L++  VGDRP W++   P+R +    LK +PTL +W  G Q+
Sbjct  60   PISAHLIEVEVGDRPYWKDLNCPFRANSVTKLKVLPTLAKW--GTQK  104



>ref|XP_002748358.1| PREDICTED: thioredoxin domain-containing protein 17 [Callithrix 
jacchus]
Length=123

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 51/90 (57%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKF-KAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            FE+F +A    N   +  +    + +   SWCPDCV+AEPV+ + L+  S+    +   V
Sbjct  12   FEEFNRAVKQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHVSEGCVFIYCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            GD+P W++P + +R   N  +  VPTL+++
Sbjct  72   GDKPYWKDPNNDFR--KNLKVTAVPTLLKY  99



>gb|EGU13508.1| Thioredoxin-like protein 5 [Rhodotorula glutinis ATCC 204091]
Length=131

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 57/111 (51%), Gaps = 7/111 (6%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPL   D  V     + +  KA +  +  + ++F A I+P+T   WCPDC   +  + + 
Sbjct  1    MPLLFPDTQVTPQTVLQQANKASS--SNPHFLIFFASIDPATGKPWCPDCSEVQSEVDRL  58

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQR  340
            +  S   +     +VGDR  W+ P +PWR  P FN+  +PT+IR E G  +
Sbjct  59   VPESRSTL----VFVGDRTEWKKPDNPWRNAP-FNISRIPTIIRVEQGGDQ  104



>ref|XP_003706122.1| PREDICTED: thioredoxin domain-containing protein 17-like [Megachile 
rotundata]
Length=126

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 54/95 (57%), Gaps = 3/95 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVG  235
            F KF      N    +L+    + +   SWCPDCV+AEP I +  + + ++V L++  VG
Sbjct  13   FFKFIKNLKTNDPIYVLY-GGTKLANGNSWCPDCVQAEPFIEQGFKDAPENVNLVEVEVG  71

Query  236  DRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQR  340
            DRP W++ + P+R D    L+ +PTL +W  G Q+
Sbjct  72   DRPYWKDLKCPFRTDSTTKLRVLPTLAKW--GTQK  104



>emb|CEJ03732.1| hypothetical protein RMCBS344292_17711 [Rhizopus microsporus]
Length=124

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 55/101 (54%), Gaps = 18/101 (18%)
 Frame = +2

Query  23   LDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASS  202
            L+ +VAT N VF              +LF     P TS SWCPDCV A+P+I K + +  
Sbjct  15   LNESVATGNPVF--------------VLFFGTEIPETSESWCPDCVIADPLIRKAI-SPI  59

Query  203  DDVALLKAYVGDRPTWR-NPQHPWRVDPNFNLKGVPTLIRW  322
            ++  LL+A VG R  W+ N  HP+RV   F L  +PTL +W
Sbjct  60   ENAILLEAPVGARNEWKGNTTHPYRV--RFGLSAIPTLFKW  98



>emb|CEG77919.1| hypothetical protein RMATCC62417_12594 [Rhizopus microsporus]
Length=124

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 55/101 (54%), Gaps = 18/101 (18%)
 Frame = +2

Query  23   LDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASS  202
            L+ +VAT N VF              +LF     P TS SWCPDCV A+P+I K + +  
Sbjct  15   LNESVATGNPVF--------------VLFFGTEIPETSESWCPDCVIADPLIRKAI-SPI  59

Query  203  DDVALLKAYVGDRPTWR-NPQHPWRVDPNFNLKGVPTLIRW  322
            ++  LL+A VG R  W+ N  HP+RV   F L  +PTL +W
Sbjct  60   ENAILLEAPVGARNEWKGNTTHPYRV--RFGLSAIPTLFKW  98



>gb|KIH61314.1| hypothetical protein ANCDUO_08418 [Ancylostoma duodenale]
Length=125

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 38/63 (60%), Gaps = 3/63 (5%)
 Frame = +2

Query  140  SWCPDCVRAEPVIYKKLEAS---SDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPT  310
            SWCPDCV AEPVI   L +S   S D   +  YVG R  W++P  P+R D +F L  VPT
Sbjct  36   SWCPDCVAAEPVIDSILHSSEGKSLDATFVTCYVGAREYWKDPACPFRTDKDFKLTCVPT  95

Query  311  LIR  319
            LI 
Sbjct  96   LIE  98



>emb|CEJ04121.1| hypothetical protein RMCBS344292_18088 [Rhizopus microsporus]
Length=124

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 55/101 (54%), Gaps = 18/101 (18%)
 Frame = +2

Query  23   LDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASS  202
            L+ ++AT N VF              +LF     P TS SWCPDCV A+P+I K + +  
Sbjct  15   LNESIATGNPVF--------------VLFFGTEVPETSESWCPDCVIADPLIRKAI-SPI  59

Query  203  DDVALLKAYVGDRPTWR-NPQHPWRVDPNFNLKGVPTLIRW  322
            ++  LL+A VG R  W+ N  HP+RV   F L  +PTL +W
Sbjct  60   ENAILLEAPVGARNEWKGNTTHPYRV--RFGLSAIPTLFKW  98



>ref|NP_001232421.1| putative thioredoxin-like 5 variant 1 [Taeniopygia guttata]
 gb|ACH44628.1| putative thioredoxin-like 5 variant 1 [Taeniopygia guttata]
 gb|ACH44629.1| putative thioredoxin-like 5 variant 1 [Taeniopygia guttata]
 gb|ACH46335.1| putative thioredoxin-like 5 variant 2 [Taeniopygia guttata]
 gb|ACH46423.1| putative thioredoxin-like 5 variant 1 [Taeniopygia guttata]
Length=122

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 49/84 (58%), Gaps = 3/84 (4%)
 Frame = +2

Query  71   AEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTW  250
            A++ + +    LF  D + +   SWCPDCV AEP++ K+L    D+   +   VGDR  W
Sbjct  18   AQSYRGRPIFALFCGD-KDAEGRSWCPDCVTAEPIVRKELHNLPDESVFIYCLVGDRAYW  76

Query  251  RNPQHPWRVDPNFNLKGVPTLIRW  322
            ++P + +R   N  L GVPTL+++
Sbjct  77   KDPNNEFRT--NLKLTGVPTLLKY  98



>ref|NP_001134971.1| Thioredoxin domain-containing protein 17 [Salmo salar]
 gb|ACI69244.1| Thioredoxin domain-containing protein 17 [Salmo salar]
 gb|ACI69684.1| Thioredoxin domain-containing protein 17 [Salmo salar]
 gb|ACO10758.1| Thioredoxin domain-containing protein 17 [Caligus rogercresseyi]
 emb|CDQ80880.1| unnamed protein product [Oncorhynchus mykiss]
Length=123

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = +2

Query  47   NGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKA  226
            +G  E  KA + +   ++  + +  + +  +SWCPDCV AEPV+  ++    +    +  
Sbjct  10   HGYDEFCKAVSERKGKDIFAYFSGDKDAQGMSWCPDCVEAEPVVRGEMSHLPEGSVFIYC  69

Query  227  YVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
             VG+RP W++P + ++      L GVPTLIR+
Sbjct  70   QVGERPYWKDPNNKFK--KTLKLSGVPTLIRY  99



>ref|XP_011214704.1| PREDICTED: thioredoxin domain-containing protein 17 isoform X1 
[Bactrocera dorsalis]
Length=131

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 51/94 (54%), Gaps = 2/94 (2%)
 Frame = +2

Query  44   FNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLK  223
            F  + E+ ++ A     +++      E  T  SWCP CV+AEPV++  L  + +    + 
Sbjct  13   FTKLVEELESNADGQPIHVLFSGGKDE--TGASWCPYCVKAEPVVHDALPKAPEKSHFIH  70

Query  224  AYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
              VG+R  W++P  P+R DP   +  VPTL+RW+
Sbjct  71   VDVGERAYWKDPNCPFRTDPRLKMVWVPTLMRWK  104



>gb|EYC39076.1| hypothetical protein Y032_0677g1437 [Ancylostoma ceylanicum]
Length=125

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 37/63 (59%), Gaps = 3/63 (5%)
 Frame = +2

Query  140  SWCPDCVRAEPVIYKKL---EASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPT  310
            SWCPDCV AEPVI   L   E  S D   +  YVG R  W++P  P+R D +F L  VPT
Sbjct  36   SWCPDCVAAEPVIDSILHGNEGKSLDATFVTCYVGAREYWKDPACPFRTDKDFKLTCVPT  95

Query  311  LIR  319
            LI 
Sbjct  96   LIE  98



>ref|XP_001895247.1| Chain A, Solution Structure Of Mouse Putative 42-9-9 Protein, 
putative [Brugia malayi]
Length=129

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 47/73 (64%), Gaps = 6/73 (8%)
 Frame = +2

Query  140  SWCPDCVRAEPVIYKKLE---ASSD---DVALLKAYVGDRPTWRNPQHPWRVDPNFNLKG  301
            SWCPDCV+AEPVI K +E   +S+D   D+  ++  VG R  W++  + +R D  F LK 
Sbjct  38   SWCPDCVQAEPVIEKVIEQIVSSNDTDIDLTFIECAVGPRTCWKDQTNAFRTDQRFKLKE  97

Query  302  VPTLIRWEDGAQR  340
            +PTL+ + + A+R
Sbjct  98   IPTLLDYSNKAKR  110



>ref|XP_007567437.1| PREDICTED: thioredoxin domain-containing protein 17 [Poecilia 
formosa]
Length=123

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 52/96 (54%), Gaps = 2/96 (2%)
 Frame = +2

Query  35   VATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVA  214
            V   +G  E  KA + +   ++  + +  + +   SWCPDCV+AEP++  +L    +   
Sbjct  6    VVNVHGYEEFCKAVSERKGKDIFAYFSGNKDAEGKSWCPDCVKAEPIVRGELTHLPEGSV  65

Query  215  LLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
             +   VGDRP W++P + ++      L GVPTL+R+
Sbjct  66   FIYCQVGDRPYWKDPNNDFK--KTLKLTGVPTLLRY  99



>ref|NP_001124889.1| thioredoxin domain-containing protein 17 [Pongo abelii]
 sp|Q5REA8.1|TXD17_PONAB RecName: Full=Thioredoxin domain-containing protein 17; AltName: 
Full=Thioredoxin-like protein 5 [Pongo abelii]
 emb|CAH89899.1| hypothetical protein [Pongo abelii]
Length=123

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 51/90 (57%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKF-KAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            FE+F +A    N   +  +    + +   SWCPDCV+AEPV+ + L+  S+    +   V
Sbjct  12   FEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            G++P W++P + +R   N  +  VPTLI++
Sbjct  72   GEKPYWKDPNNDFR--KNLKVTAVPTLIKY  99



>gb|EYC39075.1| hypothetical protein Y032_0677g1437 [Ancylostoma ceylanicum]
Length=135

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 37/63 (59%), Gaps = 3/63 (5%)
 Frame = +2

Query  140  SWCPDCVRAEPVIYKKL---EASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPT  310
            SWCPDCV AEPVI   L   E  S D   +  YVG R  W++P  P+R D +F L  VPT
Sbjct  36   SWCPDCVAAEPVIDSILHGNEGKSLDATFVTCYVGAREYWKDPACPFRTDKDFKLTCVPT  95

Query  311  LIR  319
            LI 
Sbjct  96   LIE  98



>gb|ACO14246.1| Thioredoxin domain-containing protein 17 [Esox lucius]
 gb|ACO14450.1| Thioredoxin domain-containing protein 17 [Esox lucius]
Length=123

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = +2

Query  47   NGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKA  226
            +G  E  KA + +   ++  + +  +    +SWCPDCV+AEP++  ++    +    +  
Sbjct  10   HGYDEFCKAVSERKGKDIFAYFSGNKDDQGMSWCPDCVKAEPIVRGEMSHLPEGSVFIYC  69

Query  227  YVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
             VG+RP W++P + ++      L GVPTLIR+
Sbjct  70   QVGERPYWKDPNNEFK--KTLKLSGVPTLIRY  99



>gb|ETE67596.1| Thioredoxin domain-containing protein 17 [Ophiophagus hannah]
Length=124

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVG  235
            F +   E        + F  D +P++  SWCPDCV+AEP++  +L    D    +   VG
Sbjct  14   FVRVAREQQHQGQVFVYFSGDKDPASGTSWCPDCVKAEPIVRAELPNLPDGSIFIYCQVG  73

Query  236  DRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
             R  W+NP + ++   N  L GVPTL+++
Sbjct  74   PRDYWKNPNNEFK--KNLKLTGVPTLLKY  100



>ref|XP_005349691.1| PREDICTED: thioredoxin domain-containing protein 17 [Microtus 
ochrogaster]
Length=139

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 55/101 (54%), Gaps = 7/101 (7%)
 Frame = +2

Query  35   VATFNGV----FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEAS  199
            +AT+  V    FE+F     +++   I  + +  + +   SWCPDCV AEPV+ + L+  
Sbjct  17   MATYKEVSVSGFEEFDQAVKEHQGKTIFAYFSGSKDAEGKSWCPDCVEAEPVVREGLKHV  76

Query  200  SDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            ++D   +   VGDR  W++P + +R      L  VPTL+++
Sbjct  77   TEDCVFIYCQVGDRSYWKDPNNDFR--QKLKLTAVPTLLKY  115



>ref|XP_003506415.2| PREDICTED: thioredoxin domain-containing protein 17 [Cricetulus 
griseus]
 ref|XP_007633417.1| PREDICTED: thioredoxin domain-containing protein 17 [Cricetulus 
griseus]
 gb|ERE68824.1| thioredoxin domain-containing protein 17 [Cricetulus griseus]
Length=123

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 51/90 (57%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            FE+F     ++K   I  + +  + +   SWCPDCV AEPV+ + L++ ++D   +   V
Sbjct  12   FEEFDQAVKEHKGKTIFAYFSGSKDAEGKSWCPDCVEAEPVVREGLKSVTEDCVFIYCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            GD+  W++P + +R      +  VPTL+++
Sbjct  72   GDKSYWKDPNNDFR--QQLQVTAVPTLLKY  99



>gb|EMS25763.1| thioredoxin-like protein 5 [Rhodosporidium toruloides NP11]
 emb|CDR38100.1| RHTO0S03e03532g1_1 [Rhodosporidium toruloides]
Length=131

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 57/111 (51%), Gaps = 7/111 (6%)
 Frame = +2

Query  8    MPLKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKK  187
            MPL   D  +     + +  KA +  +  + ++F A I+P+T   WCPDC   +  + + 
Sbjct  1    MPLLFPDTQITPQTVLQQANKASS--SAPHFLIFFASIDPATGKPWCPDCSEVQSEVDRL  58

Query  188  LEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQR  340
            +  S   +     ++GDR  W+ P +PWR  P FN+  +PT+IR E G  +
Sbjct  59   VPESRSTL----VFIGDRAEWKKPDNPWRNAP-FNISRIPTIIRVEQGGDQ  104



>ref|XP_009093102.1| PREDICTED: thioredoxin domain-containing protein 17 [Serinus 
canaria]
Length=122

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 48/84 (57%), Gaps = 3/84 (4%)
 Frame = +2

Query  71   AEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTW  250
            A++   +    LF  D + +   SWCPDCV AEPVI K+L    D+   +   VGDR  W
Sbjct  18   AQSYHGRPIFALFCGDKD-AEGRSWCPDCVTAEPVIRKELHNLPDESVFIYCLVGDRAYW  76

Query  251  RNPQHPWRVDPNFNLKGVPTLIRW  322
            ++P + +R   N  L GVPTL+++
Sbjct  77   KDPNNEFR--RNLKLTGVPTLLKY  98



>ref|XP_001662342.1| AAEL012238-PA [Aedes aegypti]
 gb|ABF18381.1| thioredoxin [Aedes aegypti]
 gb|EAT35597.1| AAEL012238-PA [Aedes aegypti]
Length=126

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 48/91 (53%), Gaps = 0/91 (0%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVG  235
            F  F  +   N   + +  +  +    +SWC DCV A P I   L  +  +   +   VG
Sbjct  13   FVSFMKDFQSNGQMVNILFSGAKLENGVSWCSDCVEAAPFIEAALATAPAESHFIHVDVG  72

Query  236  DRPTWRNPQHPWRVDPNFNLKGVPTLIRWED  328
            DRPTW++  +P+R + + +L  +PTLIRW++
Sbjct  73   DRPTWKDMNNPFRKNSDTHLSVIPTLIRWKN  103



>ref|XP_001968808.1| GG25076 [Drosophila erecta]
 gb|EDV57867.1| GG25076 [Drosophila erecta]
Length=176

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 58/104 (56%), Gaps = 1/104 (1%)
 Frame = +2

Query  14   LKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLE  193
            + V+   V  ++   +K +     N+A  +LF    + +   SWCP CV+AEPVI+  L+
Sbjct  50   IMVVTHNVKGYDEFSKKMEELENGNEAVHVLFSGGKDENGQ-SWCPYCVKAEPVIHDALK  108

Query  194  ASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
             +  +   +   VG+R  W++   P+R DPN +L  +PTL+RW+
Sbjct  109  KAPGNSHFVHVDVGERAYWKDLNCPFRKDPNTHLIFLPTLLRWK  152



>ref|XP_003486500.1| PREDICTED: thioredoxin domain-containing protein 17-like [Bombus 
impatiens]
Length=126

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +2

Query  20   VLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEAS  199
            VL   V  +   F KF      N++  +L+     P+   SWCPDCV AEP I    + +
Sbjct  2    VLRHHVEGYENFF-KFMKNFKSNESIYVLYSGKKLPNGK-SWCPDCVEAEPFIEDGFKTA  59

Query  200  SDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
             + V L++  VGDRP W++   P+R +    L+ +PTL +W
Sbjct  60   PESVHLVEVEVGDRPFWKDLNCPFRTNSVTKLRVLPTLAKW  100



>gb|EIE81083.1| hypothetical protein RO3G_05788 [Rhizopus delemar RA 99-880]
Length=448

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 51/94 (54%), Gaps = 8/94 (9%)
 Frame = +2

Query  56   FEKFKAEAPK--NKAN--LILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLK  223
             E F AE  K     N   +LF     P TS SWCPDCV A+P++ K +     D  LL+
Sbjct  332  LENFDAEVNKAVETGNPVFVLFFGTEVPETSESWCPDCVIADPLVRKAI-IPVKDAILLE  390

Query  224  AYVGDRPTWR-NPQHPWRVDPNFNLKGVPTLIRW  322
            A VG R  W+ N  HP+RV   FNL  +PTL +W
Sbjct  391  APVGGRNEWKGNTTHPYRV--RFNLSAIPTLFKW  422



>ref|XP_003394559.1| PREDICTED: thioredoxin domain-containing protein 17-like [Bombus 
terrestris]
Length=126

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +2

Query  20   VLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEAS  199
            VL   V  +   F KF      N++  +L+     P+   SWCPDCV AEP I    + +
Sbjct  2    VLRHRVEGYENFF-KFMKNFKSNESVYVLYSGKKLPNGK-SWCPDCVEAEPFIEDGFKTA  59

Query  200  SDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
             + V L++  VGDRP W++   P+R +    L+ +PTL +W
Sbjct  60   PESVHLVEVEVGDRPFWKDLNCPFRTNSVTKLRVLPTLAKW  100



>ref|XP_001607213.1| PREDICTED: thioredoxin domain-containing protein 17-like [Nasonia 
vitripennis]
Length=126

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 53/95 (56%), Gaps = 3/95 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVG  235
            F KF  +   ++   +L+     P+   SWCPDCV A+P I K +EA  +    +   VG
Sbjct  13   FLKFIEDFKPDEPTFVLYTGTKLPNGD-SWCPDCVVAKPHIEKGIEALPEKYNYVVVEVG  71

Query  236  DRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQR  340
            DRP W++ + P+R +P   LK +PTL +W  G Q+
Sbjct  72   DRPFWKDNKCPFRTNPKTQLKVLPTLAKW--GTQK  104



>ref|XP_008853873.1| PREDICTED: thioredoxin domain-containing protein 17 [Nannospalax 
galili]
Length=123

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 56/101 (55%), Gaps = 7/101 (7%)
 Frame = +2

Query  35   VATFNGV----FEKF-KAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEAS  199
            +ATF  V    FE+F +A    N   +  + +  + +   SWCPDCV+AEPV+ + L+  
Sbjct  1    MATFQEVSVSGFEEFNQAVKDHNGKTIFAYFSGSKDAEGKSWCPDCVQAEPVVREGLKYV  60

Query  200  SDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            +++   +   VGDR  W++P + +R      L  VPTL+++
Sbjct  61   NEECVFIYCQVGDRSYWKDPNNDFR--QKLKLTAVPTLLKY  99



>gb|ACI67575.1| Thioredoxin domain-containing protein 17 [Salmo salar]
Length=123

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = +2

Query  47   NGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKA  226
            +G  E  KA + +   ++  + +  + +  +SWCPDCV AEPV+  ++    +    +  
Sbjct  10   HGYDEFCKAVSERKGKDIFAYFSGDKDAQGMSWCPDCVEAEPVVRGEMSHLPEGPVFIYC  69

Query  227  YVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
             VG+RP W++P + ++      L GVPTLIR+
Sbjct  70   QVGERPYWKDPNNKFK--KTLKLSGVPTLIRY  99



>ref|XP_005056618.1| PREDICTED: thioredoxin domain-containing protein 17 [Ficedula 
albicollis]
Length=122

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 3/84 (4%)
 Frame = +2

Query  71   AEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTW  250
            A++   +    LF  D + +   SWCPDCV AEPV+ K+L    D+   +   VGDR  W
Sbjct  18   AQSYHGRPIFALFCGDKD-AEGRSWCPDCVTAEPVVRKELHNLPDESVFIYCLVGDRAYW  76

Query  251  RNPQHPWRVDPNFNLKGVPTLIRW  322
            ++P + +R   N  L GVPTL+++
Sbjct  77   KDPNNEFR--KNLKLTGVPTLLKY  98



>ref|XP_415925.1| PREDICTED: thioredoxin domain-containing protein 17 isoform X2 
[Gallus gallus]
Length=122

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 44/73 (60%), Gaps = 3/73 (4%)
 Frame = +2

Query  104  LFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWRNPQHPWRVDP  283
            LF  D + +   SWCPDCV AEPV+ K+L    D+   +   VGDR  W++P + +R   
Sbjct  29   LFCGD-KDAEGRSWCPDCVTAEPVVRKELHNMPDESVFIYCLVGDRAYWKDPNNEFR--K  85

Query  284  NFNLKGVPTLIRW  322
            N  L GVPTL+++
Sbjct  86   NLKLTGVPTLLKY  98



>ref|XP_001988963.1| GH10293 [Drosophila grimshawi]
 gb|EDW03830.1| GH10293 [Drosophila grimshawi]
Length=128

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  140  SWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIR  319
            SWCP CV+AEPVI+  L+ ++++   +   VG+R  W++   P+R DPN +L  +PTL+R
Sbjct  43   SWCPYCVKAEPVIHDALKKAAENSHFVHVDVGERSYWKDLNCPFRKDPNTHLVFLPTLLR  102

Query  320  W  322
            W
Sbjct  103  W  103



>ref|XP_011192211.1| PREDICTED: thioredoxin domain-containing protein 17 isoform X1 
[Bactrocera cucurbitae]
Length=131

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 51/94 (54%), Gaps = 2/94 (2%)
 Frame = +2

Query  44   FNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLK  223
            F  + E+ ++ A     +++      E     SWCP CV+AEPV++  L  +++    + 
Sbjct  13   FTKLVEELESNADGQPIHVLFSGGKDE--NGQSWCPYCVKAEPVVHDALPKAAEKSHFIH  70

Query  224  AYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
              VG+R  W++P  P+R DP   +  VPTL+RW+
Sbjct  71   VDVGERAYWKDPNCPFRTDPRLKMVWVPTLMRWK  104



>ref|XP_009467185.1| PREDICTED: thioredoxin domain-containing protein 17 [Nipponia 
nippon]
Length=122

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 44/73 (60%), Gaps = 3/73 (4%)
 Frame = +2

Query  104  LFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWRNPQHPWRVDP  283
            LF  D + +   SWCPDCV AEPV+ K+L    D+   +   VGDR  W++P + +R   
Sbjct  29   LFCGDKD-AEGRSWCPDCVTAEPVVRKELHNMPDESVFIYCLVGDRAYWKDPNNEFR--K  85

Query  284  NFNLKGVPTLIRW  322
            N  L GVPTL+++
Sbjct  86   NLKLTGVPTLLKY  98



>ref|XP_008629284.1| PREDICTED: thioredoxin domain-containing protein 17 [Corvus brachyrhynchos]
Length=122

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 3/84 (4%)
 Frame = +2

Query  71   AEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTW  250
            A++   +    LF  D + +   SWCPDCV AEPV+ K+L    D+   +   VGDR  W
Sbjct  18   AQSYHGRPIFALFCGDKD-AEGRSWCPDCVTAEPVVRKELHNLPDESVFIYCLVGDRAYW  76

Query  251  RNPQHPWRVDPNFNLKGVPTLIRW  322
            ++P + +R   N  L GVPTL+++
Sbjct  77   KDPNNEFR--RNLKLTGVPTLLKY  98



>gb|KFR01254.1| Thioredoxin domain-containing protein 17, partial [Nipponia nippon]
Length=120

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 44/73 (60%), Gaps = 3/73 (4%)
 Frame = +2

Query  104  LFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWRNPQHPWRVDP  283
            LF  D + +   SWCPDCV AEPV+ K+L    D+   +   VGDR  W++P + +R   
Sbjct  27   LFCGDKD-AEGRSWCPDCVTAEPVVRKELHNMPDESVFIYCLVGDRAYWKDPNNEFR--K  83

Query  284  NFNLKGVPTLIRW  322
            N  L GVPTL+++
Sbjct  84   NLKLTGVPTLLKY  96



>ref|XP_002018634.1| GL25848 [Drosophila persimilis]
 gb|EDW36830.1| GL25848 [Drosophila persimilis]
Length=102

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  SWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIR  319
            SWCP CV+AEPVI+  L+ + D+   +   VG+R  W++   P+R DPN +L  +PTL+R
Sbjct  17   SWCPYCVKAEPVIHDALKKAPDNSHFVHVDVGERAYWKDLNCPFRKDPNTHLIFLPTLLR  76

Query  320  WE  325
            W+
Sbjct  77   WK  78



>ref|XP_005804132.1| PREDICTED: thioredoxin domain-containing protein 17-like [Xiphophorus 
maculatus]
Length=123

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = +2

Query  47   NGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKA  226
            +G  E  KA + +   ++  + +  + +   SWCPDCV+AEP++  +L    +    +  
Sbjct  10   HGYEEFCKAVSARKGKDIFAYFSGNKDAEGKSWCPDCVKAEPIVRGELTHLPEGSVFIYC  69

Query  227  YVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
             VGDRP W++P + ++      L GVPTL+R+
Sbjct  70   QVGDRPYWKDPNNDFK--KTLKLTGVPTLLRY  99



>ref|NP_116120.1| thioredoxin domain-containing protein 17 [Homo sapiens]
 ref|XP_511988.2| PREDICTED: thioredoxin domain-containing protein 17 [Pan troglodytes]
 ref|XP_003274631.1| PREDICTED: thioredoxin domain-containing protein 17 [Nomascus 
leucogenys]
 ref|XP_003810187.1| PREDICTED: thioredoxin domain-containing protein 17 [Pan paniscus]
 ref|XP_004058471.1| PREDICTED: thioredoxin domain-containing protein 17 [Gorilla 
gorilla gorilla]
 sp|Q9BRA2.1|TXD17_HUMAN RecName: Full=Thioredoxin domain-containing protein 17; AltName: 
Full=14 kDa thioredoxin-related protein; Short=TRP14; AltName: 
Full=Protein 42-9-9; AltName: Full=Thioredoxin-like protein 
5 [Homo sapiens]
 pdb|1WOU|A Chain A, Crystal Structure Of Human Trp14
 gb|AAH06405.1| Thioredoxin domain containing 17 [Homo sapiens]
 emb|CAC51435.1| putative 42-9-9 protein [Homo sapiens]
 gb|EAW90302.1| thioredoxin-like 5 [Homo sapiens]
 dbj|BAF84652.1| unnamed protein product [Homo sapiens]
 gb|AIC52614.1| TXNDC17, partial [synthetic construct]
Length=123

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 51/90 (57%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKF-KAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            FE+F +A    N   +  +    + +   SWCPDCV+AEPV+ + L+  S+    +   V
Sbjct  12   FEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            G++P W++P + +R   N  +  VPTL+++
Sbjct  72   GEKPYWKDPNNDFR--KNLKVTAVPTLLKY  99



>gb|KFO57123.1| Thioredoxin domain-containing protein 17, partial [Corvus brachyrhynchos]
Length=120

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 3/84 (4%)
 Frame = +2

Query  71   AEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTW  250
            A++   +    LF  D + +   SWCPDCV AEPV+ K+L    D+   +   VGDR  W
Sbjct  16   AQSYHGRPIFALFCGDKD-AEGRSWCPDCVTAEPVVRKELHNLPDESVFIYCLVGDRAYW  74

Query  251  RNPQHPWRVDPNFNLKGVPTLIRW  322
            ++P + +R   N  L GVPTL+++
Sbjct  75   KDPNNEFR--RNLKLTGVPTLLKY  96



>ref|XP_005184690.1| PREDICTED: thioredoxin domain-containing protein 17-like [Musca 
domestica]
Length=126

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 55/101 (54%), Gaps = 1/101 (1%)
 Frame = +2

Query  20   VLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEAS  199
            V++  V  ++  F+    E  +++  + +  +  +     SWCP CV AEPV++  L  +
Sbjct  2    VIEHNVKGYDE-FKTLVGELEQSEKPIFVLFSGGKDENGESWCPYCVTAEPVVHDALSKA  60

Query  200  SDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
             ++   +   VG+R  W++  +P+R DP  +L  VPTL+RW
Sbjct  61   PENAHFIHVDVGERSYWKDVNNPFRKDPKTHLVWVPTLLRW  101



>ref|XP_001026583.1| hypothetical protein TTHERM_00332160 [Tetrahymena thermophila]
Length=134

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 52/106 (49%), Gaps = 5/106 (5%)
 Frame = +2

Query  20   VLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKL--E  193
            V+      F+  + + K +    K   +LF  D  P T+ SWC DCVRA PVI   +  +
Sbjct  7    VIHLNYKEFDAKYTELKQQG---KPFAVLFTGDNVPGTTDSWCGDCVRAHPVIQSTVIPK  63

Query  194  ASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDG  331
             +  ++  L+  VG R  WR P H  R  P+  L  +PTL+  + G
Sbjct  64   CAELNIPFLEVLVGLREEWRTPTHSIRNHPDLMLTNIPTLLLNQKG  109



>ref|XP_008423155.1| PREDICTED: thioredoxin domain-containing protein 17 [Poecilia 
reticulata]
Length=123

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = +2

Query  47   NGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKA  226
            +G  E  KA + +   ++  + +  + +   SWCPDCV+AEP++  +L    +    +  
Sbjct  10   HGYEEFCKAVSERKGKDIFAYFSGNKDAEGKSWCPDCVKAEPIVRGELTHLPEGSVFIYC  69

Query  227  YVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
             VGDRP W++P + ++      L GVPTL+R+
Sbjct  70   QVGDRPYWKDPNNDFK--KTLKLTGVPTLLRY  99



>ref|NP_001253357.1| thioredoxin domain-containing protein 17 [Macaca mulatta]
 ref|XP_003912247.1| PREDICTED: thioredoxin domain-containing protein 17 [Papio anubis]
 ref|XP_005582722.1| PREDICTED: thioredoxin domain-containing protein 17 [Macaca fascicularis]
 ref|XP_010376190.1| PREDICTED: thioredoxin domain-containing protein 17 [Rhinopithecus 
roxellana]
 gb|EHH24431.1| Thioredoxin-like protein 5 [Macaca mulatta]
 gb|EHH57639.1| Thioredoxin-like protein 5 [Macaca fascicularis]
Length=123

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 51/90 (57%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKF-KAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            FE+F +A    N   +  +    + +   SWCPDCV+AEPV+ + L+  S+    +   V
Sbjct  12   FEEFHRAVEEHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            G++P W++P + +R   N  +  VPTL+++
Sbjct  72   GEKPYWKDPNNDFR--KNLKVTAVPTLLKY  99



>ref|XP_004911789.1| PREDICTED: thioredoxin domain-containing protein 17 [Xenopus 
(Silurana) tropicalis]
Length=123

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 52/89 (58%), Gaps = 3/89 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            +E+F     K+K   +  + +  +    +SWCPDCV+AEPV+  +L+   +    +   V
Sbjct  12   YEEFCEALKKHKGKQVFAYFSGNKNEQGVSWCPDCVKAEPVVRGELKNLPEGSVFIYCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIR  319
            G+RP W++P++ ++   N  L GVPTL++
Sbjct  72   GERPYWKDPKNEFK--ENLKLTGVPTLLK  98



>ref|XP_002052917.1| GJ19575 [Drosophila virilis]
 gb|EDW65072.1| GJ19575 [Drosophila virilis]
Length=128

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  140  SWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIR  319
            SWCP CV+AEPVI+  L+ ++++   +   VG+R  W++   P+R DPN +L  +PTL+R
Sbjct  43   SWCPYCVKAEPVIHDALKKAAENSHFVHVDVGERSYWKDLNCPFRKDPNTHLIFLPTLLR  102

Query  320  W  322
            W
Sbjct  103  W  103



>ref|XP_008048070.1| PREDICTED: thioredoxin domain-containing protein 17 [Tarsius 
syrichta]
Length=123

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 50/89 (56%), Gaps = 3/89 (3%)
 Frame = +2

Query  56   FEKFK-AEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            FE+FK A    N   +  +    + +   SWCPDCV+AEPV+ + L+  S+    +   V
Sbjct  12   FEEFKRAVEQHNGKTIFAYFTGSKDAEGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIR  319
            G++P W++P + +R   N  +  VPTL++
Sbjct  72   GEKPYWKDPNNDFR--KNLKVTAVPTLLK  98



>ref|XP_005184688.1| PREDICTED: thioredoxin domain-containing protein 17 [Musca domestica]
Length=126

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 50/90 (56%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVG  235
            F K   E   +   + +  +  +  +  SWCP CV+AEPVI+  L  +++    +   VG
Sbjct  13   FIKLVGELEGSGQPIHVLFSGGKDESGNSWCPYCVKAEPVIHDALAKATEKSHFVHVDVG  72

Query  236  DRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
            +R  W++   P+R DPN +L  +PTL+RW+
Sbjct  73   ERSYWKDLNCPFRKDPNTHLVFLPTLLRWK  102



>ref|XP_008579334.1| PREDICTED: thioredoxin domain-containing protein 17 [Galeopterus 
variegatus]
Length=123

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 51/90 (57%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            FE+F     ++KA  I  +    + +   SWCPDCV+AEPV+ + L+   +    +   V
Sbjct  12   FEEFNRAVEQHKAKTIFAYFTGSKDAEGKSWCPDCVQAEPVVREGLKHICEGCVFIYCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            G++P W++P + +R   N  +  VPTL+++
Sbjct  72   GEKPYWKDPNNDFR--KNLKVTAVPTLLKY  99



>ref|XP_011287104.1| PREDICTED: thioredoxin domain-containing protein 17 [Felis catus]
Length=123

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 50/90 (56%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            FE+F     ++    I  +    + +   SWCPDCV+AEPV+ + L+  S+    +   V
Sbjct  12   FEEFSRAVEQHHGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHVSEGCVFIYCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            G++P W++P + +R   N  +  VPTL+++
Sbjct  72   GEKPYWKDPNNEFR--KNLKVTAVPTLLKY  99



>ref|XP_004594931.1| PREDICTED: thioredoxin domain-containing protein 17 [Ochotona 
princeps]
Length=123

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 51/90 (57%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            FE+F     ++K   +  + +  + +   SWCPDCV+AEPV+ + L+ ++     +   V
Sbjct  12   FEEFNRAVEEHKDKTVFAYFSGSKDAEGKSWCPDCVKAEPVVQEALKHATKGCVFIYCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            GDRP W++P + +R      +  VPTL+++
Sbjct  72   GDRPYWKDPNNEFR--KKLKITAVPTLLKY  99



>gb|EAS06338.2| thioredoxin domain protein [Tetrahymena thermophila SB210]
Length=155

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 52/106 (49%), Gaps = 5/106 (5%)
 Frame = +2

Query  20   VLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKL--E  193
            V+      F+  + + K +    K   +LF  D  P T+ SWC DCVRA PVI   +  +
Sbjct  28   VIHLNYKEFDAKYTELKQQG---KPFAVLFTGDNVPGTTDSWCGDCVRAHPVIQSTVIPK  84

Query  194  ASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDG  331
             +  ++  L+  VG R  WR P H  R  P+  L  +PTL+  + G
Sbjct  85   CAELNIPFLEVLVGLREEWRTPTHSIRNHPDLMLTNIPTLLLNQKG  130



>ref|XP_003931393.1| PREDICTED: thioredoxin domain-containing protein 17 [Saimiri 
boliviensis boliviensis]
Length=180

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 51/90 (57%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKF-KAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            FE+F +A    N   +  +    + +   SWCPDCV+AEPV+ + L+  S+    +   V
Sbjct  69   FEEFNRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHVSEGCVFIYCQV  128

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            GD+P W++P + +R   N  +  VPTL+++
Sbjct  129  GDKPYWKDPNNDFR--KNLKVTAVPTLLKY  156



>ref|XP_008154965.1| PREDICTED: thioredoxin domain-containing protein 17 [Eptesicus 
fuscus]
Length=123

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 50/90 (56%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            FE F     ++K   I  +    + +   SWCPDCV+AEPV+ + L+   ++   +   V
Sbjct  12   FEDFSRAVEQHKGKTIFAYFTGSKDAEGKSWCPDCVQAEPVVREGLKHICEECVFIYCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            G++P W++P + +R   N  +  VPTL+++
Sbjct  72   GEKPYWKDPNNDFRT--NLKITAVPTLLKY  99



>gb|ACI67984.1| Thioredoxin domain-containing protein 17 [Salmo salar]
Length=123

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 50/92 (54%), Gaps = 2/92 (2%)
 Frame = +2

Query  47   NGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKA  226
            +G  E  KA + +   ++  + +  + +   SWCPDCV AEPV+  ++    +    +  
Sbjct  10   HGYDEFCKAVSERKGRDIFAYFSGDKDAQGTSWCPDCVEAEPVVRGEMSHLPEGSVFIYC  69

Query  227  YVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
             VG+RP W++P + ++      L GVPTLIR+
Sbjct  70   QVGERPYWKDPNNKFK--KTLKLSGVPTLIRY  99



>ref|XP_004930376.1| PREDICTED: thioredoxin domain-containing protein 17-like [Bombyx 
mori]
Length=126

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = +2

Query  140  SWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIR  319
            SWCPDCV AEPV+   L      +  +   VGDR  W++ + P+R D    L  +PTLI+
Sbjct  41   SWCPDCVEAEPVVRHYLSELDKSIIFVYVDVGDREYWKDKECPFRTDSRSKLMVIPTLIK  100

Query  320  WEDGAQR  340
            W+ G QR
Sbjct  101  WK-GVQR  106



>ref|XP_007420950.1| PREDICTED: thioredoxin domain-containing protein 17 [Python bivittatus]
Length=124

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 49/89 (55%), Gaps = 2/89 (2%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVG  235
            F +   E  +     + F  D +P + +SWCPDC++AEP++  +L    +    +   VG
Sbjct  14   FVRVAREQQQRGQVFVYFSGDKDPVSGVSWCPDCIKAEPIVRAELPNLPEGSVFIYCQVG  73

Query  236  DRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
             R  W+NP + ++   N +L GVPTL+++
Sbjct  74   PRDYWKNPNNEFK--KNLSLTGVPTLLKY  100



>ref|XP_004531229.1| PREDICTED: thioredoxin domain-containing protein 17-like [Ceratitis 
capitata]
Length=128

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  140  SWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIR  319
            SWCP CV+AEPV++  L  +S+    +   VG+R  W++   P+R DPN +L  +PTL+R
Sbjct  43   SWCPYCVKAEPVVHDALAKASEKSHFIHVDVGERAYWKDLNCPFRKDPNTHLIFLPTLLR  102

Query  320  W  322
            W
Sbjct  103  W  103



>gb|EPB85044.1| hypothetical protein HMPREF1544_08173 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=124

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 4/76 (5%)
 Frame = +2

Query  98   LILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWR-NPQHPWR  274
             +LF     P TS SWCPDCV A+P++ K +    + + LL+A VG R  W+ N  HP+R
Sbjct  26   FVLFFGTETPETSESWCPDCVIADPLVRKAIIPIQNAI-LLEAPVGARNDWKGNTSHPYR  84

Query  275  VDPNFNLKGVPTLIRW  322
            V   FN+  +PTL +W
Sbjct  85   V--RFNVPAIPTLFKW  98



>ref|NP_001089800.1| thioredoxin domain containing 17 [Xenopus laevis]
 gb|AAI06590.1| MGC131361 protein [Xenopus laevis]
Length=124

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 51/89 (57%), Gaps = 3/89 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            +E+F     K K   +  + +  +    +SWCPDCV+AEPV+  +L++  +    +   V
Sbjct  13   YEEFCETVKKYKGKQVFAYFSGNKNDEGVSWCPDCVKAEPVVRGELKSLPEGSVFIYCQV  72

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIR  319
            G+RP W++P + ++     NL GVPTL++
Sbjct  73   GERPYWKDPNNEFK--KKLNLTGVPTLLK  99



>gb|ETN66960.1| glutaredoxin [Anopheles darlingi]
Length=141

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 47/92 (51%), Gaps = 1/92 (1%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASS-DDVALLKAYV  232
            F  F  +   N  ++ +     +     SWC DCV A P I   +E  +  D   +   V
Sbjct  27   FVAFMKDFKGNGGSINILFTGAKLENGQSWCGDCVEAAPFIESAVEKDAPSDSHFIYVDV  86

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRWED  328
            GDRPTW++  + +R D N +L  +PTLIRW++
Sbjct  87   GDRPTWKDMNNSFRKDVNTHLSVIPTLIRWKN  118



>ref|XP_004760552.1| PREDICTED: thioredoxin domain-containing protein 17 [Mustela 
putorius furo]
 ref|XP_004804226.1| PREDICTED: thioredoxin domain-containing protein 17 isoform X4 
[Mustela putorius furo]
Length=123

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 51/90 (57%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            FE+F     +++   I  +    + +   SWCPDCV+AEPV+ + L+  S+    +   V
Sbjct  12   FEEFSRAVERHRDKTIFAYFTGSKDAGGQSWCPDCVQAEPVVREGLKHMSEGCVFIYCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            G++P W++P + +R   N  +  VPTL+++
Sbjct  72   GEKPYWKDPNNDFR--KNLKVTAVPTLLKY  99



>ref|XP_006100730.1| PREDICTED: thioredoxin domain-containing protein 17 [Myotis lucifugus]
Length=123

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 51/90 (57%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            FE+F     ++K   I  +    + +   SWCPDCV AEPV+ + L+  S++   +   V
Sbjct  12   FEEFTRAVEQHKGKTIFAYFTGSKDAEGKSWCPDCVLAEPVVREGLKHISEECVFIYCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            G++P W++P + ++   N  +  VPTL+++
Sbjct  72   GEKPYWKDPNNDFKT--NLKITAVPTLLKY  99



>gb|AAR10216.1| similar to Drosophila melanogaster CG11024, partial [Drosophila 
yakuba]
Length=102

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 55/102 (54%), Gaps = 1/102 (1%)
 Frame = +2

Query  20   VLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEAS  199
            V+   V  ++   +K +     N+   +LF    +     SWCP CV+AEPVI+  L+ +
Sbjct  2    VVTHNVKGYDEFSKKMEELENGNEPVHVLFSGGKD-ENGQSWCPYCVKAEPVIHDALKKA  60

Query  200  SDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
              +   +   VG+R  W++   P+R DPN +L  +PTL+RW+
Sbjct  61   PGNSHFVHVDVGERAYWKDLNCPFRKDPNTHLIFLPTLLRWK  102



>gb|EGW06936.1| Thioredoxin domain-containing protein 17 [Cricetulus griseus]
Length=176

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 51/90 (57%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            FE+F     ++K   I  + +  + +   SWCPDCV AEPV+ + L++ ++D   +   V
Sbjct  65   FEEFDQAVKEHKGKTIFAYFSGSKDAEGKSWCPDCVEAEPVVREGLKSVTEDCVFIYCQV  124

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            GD+  W++P + +R      +  VPTL+++
Sbjct  125  GDKSYWKDPNNDFR--QQLQVTAVPTLLKY  152



>gb|EYC39077.1| hypothetical protein Y032_0677g1437 [Ancylostoma ceylanicum]
Length=158

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 37/62 (60%), Gaps = 3/62 (5%)
 Frame = +2

Query  140  SWCPDCVRAEPVIYKKL---EASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPT  310
            SWCPDCV AEPVI   L   E  S D   +  YVG R  W++P  P+R D +F L  VPT
Sbjct  36   SWCPDCVAAEPVIDSILHGNEGKSLDATFVTCYVGAREYWKDPACPFRTDKDFKLTCVPT  95

Query  311  LI  316
            LI
Sbjct  96   LI  97



>gb|ERG87337.1| thioredoxin domain-containing protein 17 [Ascaris suum]
Length=131

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 50/96 (52%), Gaps = 8/96 (8%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLE-------ASSDDVA  214
            +E  K     +K   ++     + S   SWCPDCV AEPVI K +        A+  D+ 
Sbjct  11   YEALKKAIEGSKTRTVILFTGSKDSGK-SWCPDCVAAEPVIAKVIGELSSSNFANEHDIR  69

Query  215  LLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
             ++  VG R  W++ ++P+R D +F L  +PTLI +
Sbjct  70   FIECSVGPREYWKDAKNPFRTDDHFKLSCIPTLIEY  105



>ref|XP_004535326.1| PREDICTED: thioredoxin domain-containing protein 17-like isoform 
X1 [Ceratitis capitata]
 ref|XP_004535327.1| PREDICTED: thioredoxin domain-containing protein 17-like isoform 
X2 [Ceratitis capitata]
 ref|XP_004535328.1| PREDICTED: thioredoxin domain-containing protein 17-like isoform 
X3 [Ceratitis capitata]
Length=129

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 54/104 (52%), Gaps = 8/104 (8%)
 Frame = +2

Query  44   FNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLK  223
            F    EK   +   N+ N+  +    +  T  SWCPDC  AEP +   L+  +D+ ++  
Sbjct  12   FRSTVEKLTNDGSNNQINV--YFTGEKDETGKSWCPDCNEAEPFVLSALKEHADEKSVFV  69

Query  224  AY-VGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE-----DGAQ  337
               VG RP W++ Q+P+R DP   +  +P+L+RW+     DG Q
Sbjct  70   VVDVGPRPFWKDMQNPFRKDPIAPISVIPSLVRWKSPVRLDGDQ  113



>gb|KFM06886.1| Thioredoxin domain-containing protein 17, partial [Aptenodytes 
forsteri]
Length=93

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 2/61 (3%)
 Frame = +2

Query  140  SWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIR  319
            SWCPDCV AEPV+ ++L    D+   +   VGDR  W++P + +R   N  L GVPTL++
Sbjct  11   SWCPDCVTAEPVVRRELHNMPDESVFIYCLVGDRAYWKDPNNEFR--KNLKLTGVPTLLK  68

Query  320  W  322
            +
Sbjct  69   Y  69



>ref|XP_007054272.1| PREDICTED: thioredoxin domain-containing protein 17, partial 
[Chelonia mydas]
Length=113

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 47/84 (56%), Gaps = 3/84 (4%)
 Frame = +2

Query  71   AEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTW  250
            A+  + +    LF  D + +   SWCPDCV AEPV+  +L +  D    +   VG+R  W
Sbjct  9    AQQSRGRPVFALFCGDKD-AQGRSWCPDCVTAEPVVRSELNSLPDGSVFIYCQVGERAYW  67

Query  251  RNPQHPWRVDPNFNLKGVPTLIRW  322
            ++P + +R   N  L GVPTL+++
Sbjct  68   KDPNNEFR--KNLKLTGVPTLLKY  89



>emb|CDW56878.1| DUF953 domain containing protein [Trichuris trichiura]
Length=115

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 47/90 (52%), Gaps = 1/90 (1%)
 Frame = +2

Query  56   FEKFKAEAPKNKA-NLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
             E+  +E  +N   N+ ++ A  +     SWC  C  A+PVI        +D  L++  V
Sbjct  3    LEELLSEVDRNAGKNIFVYFAASKEKDGKSWCQHCNEADPVIADCATKLPEDSVLIRCDV  62

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            GDRPTW++P + +R      L  VPTLI+W
Sbjct  63   GDRPTWKDPNNEYRKYDKLRLHFVPTLIKW  92



>ref|XP_009276642.1| PREDICTED: thioredoxin domain-containing protein 17, partial 
[Aptenodytes forsteri]
Length=92

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 2/61 (3%)
 Frame = +2

Query  140  SWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIR  319
            SWCPDCV AEPV+ ++L    D+   +   VGDR  W++P + +R   N  L GVPTL++
Sbjct  10   SWCPDCVTAEPVVRRELHNMPDESVFIYCLVGDRAYWKDPNNEFR--KNLKLTGVPTLLK  67

Query  320  W  322
            +
Sbjct  68   Y  68



>ref|XP_005858933.1| PREDICTED: thioredoxin domain-containing protein 17 [Myotis brandtii]
 gb|EPQ03152.1| Thioredoxin domain-containing protein 17 [Myotis brandtii]
Length=123

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 50/90 (56%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            FE F     ++K   I  +    + +   SWCPDCV AEPV+ + L+  S++   +   V
Sbjct  12   FEDFTRAVEQHKGKTIFAYFTGSKDAEGKSWCPDCVLAEPVVREGLKHISEECVFIYCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            G++P W++P + ++   N  +  VPTL+++
Sbjct  72   GEKPYWKDPNNDFKT--NLKITAVPTLLKY  99



>gb|KII65905.1| Thioredoxin-like protein Clot [Thelohanellus kitauei]
Length=129

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = +2

Query  62   KFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDR  241
            K K+E  K K N ++F + ++PST   WCPDC   + ++   ++   +DV L +  VG+R
Sbjct  13   KEKSEFMKGKRNFMVFESSLDPSTGTFWCPDCTVFDKMLATHIDKLPEDVFLYRFNVGNR  72

Query  242  PTWRNPQHPWRVDPNFNLK--GVPTLI  316
             +W++P +P R     NLK   VP+L+
Sbjct  73   KSWKDPGNPIRHGVFLNLKVTSVPSLV  99



>ref|XP_006922289.1| PREDICTED: thioredoxin domain-containing protein 17 [Pteropus 
alecto]
 ref|XP_011358071.1| PREDICTED: thioredoxin domain-containing protein 17 [Pteropus 
vampyrus]
 gb|ELK03740.1| Thioredoxin domain-containing protein 17 [Pteropus alecto]
Length=123

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 49/90 (54%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            FE F     ++K   I  +    + +   SWCPDCV+AEPV+ + L+   +    +   V
Sbjct  12   FEDFSRAVEQHKGKTIFAYFTGSKDAEGKSWCPDCVQAEPVVREGLKHVCEGCVFIYCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            G++P W++P + +R   N  +  VPTL+++
Sbjct  72   GEKPYWKDPNNDFR--KNLKVTAVPTLLKY  99



>ref|XP_005356154.1| PREDICTED: thioredoxin domain-containing protein 17-like [Microtus 
ochrogaster]
Length=123

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 49/90 (54%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            FE+F     +++   I  + +  + +   SWCPDCV AEP + + L+  ++D   +   V
Sbjct  12   FEEFDQAVKEHQGKTIFAYFSGSKDAEGKSWCPDCVEAEPFVREGLKHVTEDCMFIYCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            GDR  W++P + +R      L  VPTL+++
Sbjct  72   GDRSYWKDPNNDFR--QKLKLTAVPTLLKY  99



>ref|XP_002423954.1| conserved hypothetical protein [Pediculus humanus corporis]
 gb|EEB11216.1| conserved hypothetical protein [Pediculus humanus corporis]
Length=125

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (51%), Gaps = 3/102 (3%)
 Frame = +2

Query  20   VLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLE-A  196
            V +  V  ++ + E   +  P+ K  L+L+ A        +WCPDC  AEP++ + LE  
Sbjct  2    VTEVHVDGYDALNELLHSLNPETK--LVLYFAGQVNDKGENWCPDCQAAEPIVKEVLEEC  59

Query  197  SSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            S  +   +   VG R  W++P   +R D  F L  VPTLI++
Sbjct  60   SKKNFTFIHVSVGSREEWKDPNCKFRTDERFKLTSVPTLIKF  101



>dbj|GAN09157.1| thioredoxin fold domain-containing protein [Mucor ambiguus]
Length=124

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 4/76 (5%)
 Frame = +2

Query  98   LILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWR-NPQHPWR  274
             +LF     P TS SWCPDCV A+P++ K +    ++  LL+A VG R  W+ N  HP+R
Sbjct  26   FVLFFGTETPETSESWCPDCVIADPLVRKAI-IPIENAILLEAPVGARNEWKGNTTHPYR  84

Query  275  VDPNFNLKGVPTLIRW  322
                FN+  +PTL +W
Sbjct  85   A--RFNVPAIPTLFKW  98



>ref|XP_004398663.1| PREDICTED: thioredoxin domain-containing protein 17 isoform 1 
[Odobenus rosmarus divergens]
 ref|XP_004398664.1| PREDICTED: thioredoxin domain-containing protein 17 isoform 2 
[Odobenus rosmarus divergens]
 ref|XP_004398665.1| PREDICTED: thioredoxin domain-containing protein 17 isoform 3 
[Odobenus rosmarus divergens]
Length=123

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 51/90 (57%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            FE+F+    ++    I  +    + +   SWCPDCV+AEPV+ + L+  S+    +   V
Sbjct  12   FEEFRRAVEQHHDKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFICCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            G++P W++P + +R   N  +  VPTL+++
Sbjct  72   GEKPYWKDPNNDFR--KNLKVTAVPTLLKY  99



>gb|ELK35828.1| Thioredoxin domain-containing protein 17 [Myotis davidii]
Length=123

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 49/90 (54%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            FE F     ++K   I  +    + +   SWCPDCV AEPV+ + L+  S+    +   V
Sbjct  12   FEDFTRAVEQHKGKTIFAYFTGSKDAEGKSWCPDCVLAEPVVREGLKHISEACVFIYCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            G++P W++P + +R   N  +  VPTL+++
Sbjct  72   GEKPYWKDPNNDFRT--NLKITAVPTLLKY  99



>ref|XP_011307286.1| PREDICTED: thioredoxin domain-containing protein 17 [Fopius arisanus]
Length=125

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 53/99 (54%), Gaps = 7/99 (7%)
 Frame = +2

Query  44   FNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLK  223
            F    E  K++ P     ++L+     PS   SWCPDCV AEP I K L+A+ ++  L+ 
Sbjct  13   FLTFMENLKSQGPV----IVLYSGSKLPSGK-SWCPDCVEAEPFIEKGLKAAPENAILVH  67

Query  224  AYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQR  340
              VGDR  W++ + P+R +    L  +PTL  W  G Q+
Sbjct  68   VDVGDRAFWKDHKCPFRSNSKTKLNVLPTLSLW--GTQK  104



>ref|XP_004267062.1| PREDICTED: thioredoxin domain-containing protein 17 [Orcinus 
orca]
Length=123

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            +E+F     ++    I  + +  + +   SWCPDCV+AEPV+ + L+   +    +   V
Sbjct  12   YEEFMQAVEQHSGKTIFAYFSGSKDAEGKSWCPDCVQAEPVVREGLKHVGEGCVFIYCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            G++P W+ P + +R      L GVPTL+++
Sbjct  72   GEKPYWKEPNNDFR--KKLKLTGVPTLLKY  99



>ref|XP_006863353.1| PREDICTED: thioredoxin domain-containing protein 17 [Chrysochloris 
asiatica]
Length=123

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 50/90 (56%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            FE+F   A ++K   I  +    + +   SWCPDCV AEPV+ + L+  S+    +   V
Sbjct  12   FEEFSRAAEQHKGKTIYAYFTGSKDAEGKSWCPDCVLAEPVVLEGLKHISEGCVFIYCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            G++P W++P + +R      +  VPTL+++
Sbjct  72   GEKPYWKDPNNDFR--KKLKVTAVPTLLKY  99



>ref|XP_006165205.1| PREDICTED: thioredoxin domain-containing protein 17 [Tupaia chinensis]
Length=123

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 48/90 (53%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            FE+F     K+    I  +    + +   SWCPDCV+AEPV+ + L+   +    +   V
Sbjct  12   FEEFNQAVEKHSGKTIFAYFTGSKDAEGKSWCPDCVQAEPVVREGLKHVGEGCVFIHCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            G++P W++P + +R      +  VPTL+++
Sbjct  72   GEKPYWKDPNNDFRT--KLKITAVPTLLKY  99



>ref|XP_007248707.1| PREDICTED: thioredoxin domain-containing protein 17-like [Astyanax 
mexicanus]
Length=123

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 50/90 (56%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKF-KAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            +E+F K  + +   ++  + +  +     SWCPDCV+AEPV+  ++    +    +   V
Sbjct  12   YEEFCKTVSDRAGKDIFAYFSGDKDQQGQSWCPDCVKAEPVVRGEMNHLPEGSVFIYCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            GDRP W++P + ++      L GVPTL+R+
Sbjct  72   GDRPYWKDPNNEFK--KTLKLTGVPTLLRY  99



>ref|XP_011214705.1| PREDICTED: thioredoxin domain-containing protein 17 isoform X2 
[Bactrocera dorsalis]
Length=128

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 52/95 (55%), Gaps = 2/95 (2%)
 Frame = +2

Query  41   TFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALL  220
             F  + E+ ++ A     +++      E  T  SWCP CV+AEPV++  L  + +    +
Sbjct  12   AFTKLVEELESNADGQPIHVLFSGGKDE--TGASWCPYCVKAEPVVHDALPKAPEKSHFI  69

Query  221  KAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
               VG+R  W++   P+R DPN +L  +PTL+RW+
Sbjct  70   HVDVGERAYWKDLNCPFRKDPNTHLIFLPTLLRWK  104



>ref|XP_002089215.1| cl [Drosophila yakuba]
 gb|EDW88927.1| cl [Drosophila yakuba]
Length=176

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 57/104 (55%), Gaps = 1/104 (1%)
 Frame = +2

Query  14   LKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLE  193
            + V+   V  ++   +K +     N+   +LF    + +   SWCP CV+AEPVI+  L+
Sbjct  50   IMVVTHNVKGYDEFSKKMEELENGNEPVHVLFSGGKDENGQ-SWCPYCVKAEPVIHDALK  108

Query  194  ASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
             +  +   +   VG+R  W++   P+R DPN +L  +PTL+RW+
Sbjct  109  KAPGNSHFVHVDVGERAYWKDLNCPFRKDPNTHLIFLPTLLRWK  152



>ref|XP_004455586.1| PREDICTED: thioredoxin domain-containing protein 17 isoform 1 
[Dasypus novemcinctus]
Length=199

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 51/90 (57%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKF-KAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            FE+F +A    N   +  +    + +   SWCPDCV+AEPV+ + L+  S+    +   V
Sbjct  88   FEEFNQAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHVSEGCVFIYCQV  147

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            G+RP W++P + +R   N  +  VPTL+++
Sbjct  148  GERPYWKDPNNDFRK--NLKVTAVPTLLKY  175



>gb|KFB48490.1| AGAP003178-PA-like protein [Anopheles sinensis]
Length=127

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = +2

Query  140  SWCPDCVRAEPVIYKKLEASS-DDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLI  316
            SWC DCV A P I   + +S+  +   +   VGDRPTW++  +P+R D N +L  +PTLI
Sbjct  41   SWCSDCVEAAPFIENAVASSAPKESHFIYVDVGDRPTWKDMNNPFRKDKNTHLSVIPTLI  100

Query  317  RWED  328
            RW++
Sbjct  101  RWKN  104



>ref|XP_002718893.1| PREDICTED: thioredoxin domain-containing protein 17 [Oryctolagus 
cuniculus]
Length=123

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 50/90 (56%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            FE+F     ++K   I  + +  +     SWCPDCV+AEPV+ + L+ ++     +   V
Sbjct  12   FEEFNRAVEEHKDKTIFAYFSGSKDDEGKSWCPDCVKAEPVVQEALKHATKGCVFIYCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            GDR +W++P + +R      +  VPTL+++
Sbjct  72   GDRSSWKDPNNDFR--KKLKVTAVPTLLKY  99



>ref|XP_008557167.1| PREDICTED: thioredoxin domain-containing protein 17 [Microplitis 
demolitor]
Length=126

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 51/95 (54%), Gaps = 3/95 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYVG  235
            F KF  E  K    +I+  +  +    LSWC DCV AEP I + L+A+ +   ++   VG
Sbjct  13   FLKF-MEDLKADGQVIVIYSGSKLDNGLSWCSDCVEAEPAIEEGLKAALESSHIVHVEVG  71

Query  236  DRPTWRNPQHPWRVDPNFNLKGVPTLIRWEDGAQR  340
            DR  W++ + P+R +P   L  +PT+  W  G Q+
Sbjct  72   DRAYWKDFKCPFRTNPKTKLNVLPTMALW--GTQK  104



>ref|XP_002078240.1| GD23345 [Drosophila simulans]
 gb|EDX03825.1| GD23345 [Drosophila simulans]
Length=176

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 57/104 (55%), Gaps = 1/104 (1%)
 Frame = +2

Query  14   LKVLDATVATFNGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLE  193
            + V+   V  ++   +K +     N+   +LF    + +   SWCP CV+AEPVI+  L+
Sbjct  50   IMVVTHNVKGYDEFSKKMEELENGNEPVHVLFSGGKDENGE-SWCPYCVKAEPVIHDALK  108

Query  194  ASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRWE  325
             +  +   +   VG+R  W++   P+R DPN +L  +PTL+RW+
Sbjct  109  KAPGNSHFVHVDVGERAYWKDLNCPFRKDPNTHLIFLPTLLRWK  152



>ref|XP_011506560.1| PREDICTED: thioredoxin domain-containing protein 17-like isoform 
X2 [Ceratosolen solmsi marchali]
 ref|XP_011506561.1| PREDICTED: thioredoxin domain-containing protein 17-like isoform 
X2 [Ceratosolen solmsi marchali]
Length=98

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = +2

Query  140  SWCPDCVRAEPVIYKKLEASSDDVALLKAYVGDRPTWRNPQHPWRVDPNFNLKGVPTLIR  319
            SWCPDCV+A P I K ++++      +   VGDR  W+N + P+R +   +++ +PTL++
Sbjct  12   SWCPDCVKAHPFIEKGIQSAPGTYHYIIVSVGDRAFWKNSKCPFRTNSEIHIQTLPTLVK  71

Query  320  WEDGAQR  340
            W  G Q+
Sbjct  72   W--GTQK  76



>ref|NP_001290774.1| thioredoxin domain containing 17 [Esox lucius]
 gb|ACO14095.1| Thioredoxin domain-containing protein 17 [Esox lucius]
Length=123

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 50/92 (54%), Gaps = 2/92 (2%)
 Frame = +2

Query  47   NGVFEKFKAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKA  226
            +G  E  KA + +   ++  + +  +    +SWCPDCV+A P++  ++    +    +  
Sbjct  10   HGYDEFCKAVSERKGKDIFAYFSGNKDDQGMSWCPDCVKAVPIVRGEMSHLPEGSVFIYC  69

Query  227  YVGDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
             VG+RP W++P + ++      L GVPTLIR+
Sbjct  70   QVGERPYWKDPNNEFK--KTLKLSGVPTLIRY  99



>ref|XP_008008233.1| PREDICTED: thioredoxin domain-containing protein 17 [Chlorocebus 
sabaeus]
Length=178

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 51/90 (57%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKF-KAEAPKNKANLILFLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            FE+F +A    N   +  +    + +   SWCPDCV+AEPV+ + L+  S+    +   V
Sbjct  67   FEEFHRAVEEHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQV  126

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            G++P W++P + +R   N  +  VPTL+++
Sbjct  127  GEKPYWKDPNNDFR--KNLKVTAVPTLLKY  154



>ref|NP_001156529.1| thioredoxin domain-containing protein 17 [Ovis aries]
 ref|XP_005693486.1| PREDICTED: thioredoxin domain-containing protein 17 [Capra hircus]
 ref|XP_005975755.1| PREDICTED: thioredoxin domain-containing protein 17 [Pantholops 
hodgsonii]
 gb|ACR55762.1| thioredoxin domain containing 17 [Ovis aries]
Length=123

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 50/90 (56%), Gaps = 3/90 (3%)
 Frame = +2

Query  56   FEKFKAEAPKNKANLIL-FLADIEPSTSLSWCPDCVRAEPVIYKKLEASSDDVALLKAYV  232
            +E+F     ++    I  + +  + +   SWCPDCV+AEPV+ + L+   +    +   V
Sbjct  12   YEEFMQVVEQHSGKTIFAYFSGSKDAEGKSWCPDCVQAEPVVREGLKHVGEGCVFIYCQV  71

Query  233  GDRPTWRNPQHPWRVDPNFNLKGVPTLIRW  322
            G++P W++P + +R   N  L  VPTL+++
Sbjct  72   GEKPYWKDPNNDFR--KNLKLTAVPTLLKY  99



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 696633491985