BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF009P15

Length=542
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011097825.1|  PREDICTED: syntaxin-51-like                        209   2e-64   Sesamum indicum [beniseed]
ref|XP_011095474.1|  PREDICTED: syntaxin-52-like                        202   1e-61   Sesamum indicum [beniseed]
ref|XP_009786725.1|  PREDICTED: syntaxin-51-like                        199   3e-60   Nicotiana sylvestris
ref|XP_010324299.1|  PREDICTED: syntaxin-51-like isoform X1             197   1e-59   Solanum lycopersicum
ref|XP_006346178.1|  PREDICTED: syntaxin-51-like isoform X1             197   2e-59   
ref|XP_009591371.1|  PREDICTED: syntaxin-51-like                        196   3e-59   Nicotiana tomentosiformis
ref|XP_004244081.1|  PREDICTED: syntaxin-51-like isoform X2             196   3e-59   Solanum lycopersicum
ref|XP_006346179.1|  PREDICTED: syntaxin-51-like isoform X2             196   4e-59   Solanum tuberosum [potatoes]
gb|EYU27391.1|  hypothetical protein MIMGU_mgv1a013014mg                193   3e-58   Erythranthe guttata [common monkey flower]
ref|XP_009625654.1|  PREDICTED: syntaxin-51-like isoform X1             193   1e-57   Nicotiana tomentosiformis
ref|XP_006452473.1|  hypothetical protein CICLE_v10009364mg             192   1e-57   Citrus clementina [clementine]
ref|XP_009625656.1|  PREDICTED: syntaxin-51-like isoform X2             191   2e-57   Nicotiana tomentosiformis
emb|CDP13772.1|  unnamed protein product                                191   3e-57   Coffea canephora [robusta coffee]
ref|XP_006595709.1|  PREDICTED: syntaxin-51-like                        188   3e-56   Glycine max [soybeans]
gb|ACU19604.1|  unknown                                                 188   3e-56   Glycine max [soybeans]
ref|XP_004491441.1|  PREDICTED: syntaxin-52-like isoform X2             186   1e-55   Cicer arietinum [garbanzo]
ref|XP_009765136.1|  PREDICTED: syntaxin-51-like isoform X1             187   1e-55   Nicotiana sylvestris
ref|XP_009765138.1|  PREDICTED: syntaxin-51-like isoform X2             186   3e-55   Nicotiana sylvestris
ref|XP_004491440.1|  PREDICTED: syntaxin-52-like isoform X1             186   3e-55   Cicer arietinum [garbanzo]
ref|XP_010246481.1|  PREDICTED: syntaxin-52-like                        186   3e-55   Nelumbo nucifera [Indian lotus]
ref|XP_010647220.1|  PREDICTED: syntaxin-51-like                        184   2e-54   
ref|XP_002277100.1|  PREDICTED: syntaxin-51                             183   3e-54   Vitis vinifera
ref|XP_010245902.1|  PREDICTED: syntaxin-51-like                        183   5e-54   Nelumbo nucifera [Indian lotus]
ref|XP_010099994.1|  hypothetical protein L484_014031                   182   6e-54   
ref|XP_010537838.1|  PREDICTED: syntaxin-51                             181   2e-53   Tarenaya hassleriana [spider flower]
gb|KJB22166.1|  hypothetical protein B456_004G032900                    178   3e-53   Gossypium raimondii
gb|KJB81689.1|  hypothetical protein B456_013G156800                    177   4e-53   Gossypium raimondii
ref|XP_007146536.1|  hypothetical protein PHAVU_006G048900g             180   4e-53   Phaseolus vulgaris [French bean]
gb|KJB22169.1|  hypothetical protein B456_004G032900                    179   6e-53   Gossypium raimondii
ref|XP_006602182.1|  PREDICTED: syntaxin-52-like isoform X2             180   7e-53   Glycine max [soybeans]
gb|KJB81687.1|  hypothetical protein B456_013G156800                    177   8e-53   Gossypium raimondii
gb|KJB22167.1|  hypothetical protein B456_004G032900                    177   8e-53   Gossypium raimondii
gb|KJB81686.1|  hypothetical protein B456_013G156800                    178   9e-53   Gossypium raimondii
gb|KJB22168.1|  hypothetical protein B456_004G032900                    178   9e-53   Gossypium raimondii
gb|KHG18509.1|  Syntaxin-51 -like protein                               179   1e-52   Gossypium arboreum [tree cotton]
gb|KDP39206.1|  hypothetical protein JCGZ_00963                         179   1e-52   Jatropha curcas
gb|ACU23148.1|  unknown                                                 179   1e-52   Glycine max [soybeans]
ref|XP_003551745.1|  PREDICTED: syntaxin-52-like isoform X1             179   1e-52   Glycine max [soybeans]
gb|KJB81691.1|  hypothetical protein B456_013G156800                    177   2e-52   Gossypium raimondii
gb|KJB22165.1|  hypothetical protein B456_004G032900                    179   2e-52   Gossypium raimondii
ref|XP_007142350.1|  hypothetical protein PHAVU_008G273200g             179   2e-52   Phaseolus vulgaris [French bean]
gb|KHG11788.1|  Syntaxin-51 -like protein                               179   2e-52   Gossypium arboreum [tree cotton]
ref|XP_004149588.1|  PREDICTED: syntaxin-52-like                        178   3e-52   Cucumis sativus [cucumbers]
gb|KJB81690.1|  hypothetical protein B456_013G156800                    178   3e-52   Gossypium raimondii
gb|KGN56069.1|  hypothetical protein Csa_3G064180                       178   3e-52   Cucumis sativus [cucumbers]
gb|KHN30881.1|  Syntaxin-51                                             178   3e-52   Glycine soja [wild soybean]
gb|AFK34174.1|  unknown                                                 178   4e-52   Lotus japonicus
gb|AFK40726.1|  unknown                                                 178   4e-52   Lotus japonicus
ref|XP_010532045.1|  PREDICTED: syntaxin-51-like isoform X2             177   5e-52   Tarenaya hassleriana [spider flower]
gb|AFK42434.1|  unknown                                                 175   5e-52   Lotus japonicus
ref|XP_010532042.1|  PREDICTED: syntaxin-51-like isoform X1             177   6e-52   Tarenaya hassleriana [spider flower]
gb|KHM99515.1|  Syntaxin-51                                             177   6e-52   Glycine soja [wild soybean]
ref|XP_007020671.1|  Syntaxin of plants 51 isoform 1                    177   7e-52   
ref|XP_003532151.1|  PREDICTED: syntaxin-51-like isoform X1             177   8e-52   Glycine max [soybeans]
ref|XP_006344878.1|  PREDICTED: syntaxin-52-like                        177   1e-51   
ref|XP_008449105.1|  PREDICTED: syntaxin-51-like                        176   2e-51   Cucumis melo [Oriental melon]
gb|AHA84215.1|  syntaxin-51                                             180   2e-51   Phaseolus vulgaris [French bean]
gb|ACJ84463.1|  unknown                                                 175   2e-51   Medicago truncatula
gb|AAZ32890.1|  syntaxin of plants                                      173   2e-51   Medicago sativa [alfalfa]
gb|EPS71742.1|  hypothetical protein M569_03017                         176   3e-51   Genlisea aurea
gb|AFK40910.1|  unknown                                                 175   3e-51   Lotus japonicus
ref|XP_004500114.1|  PREDICTED: syntaxin-52-like                        175   3e-51   Cicer arietinum [garbanzo]
gb|KEH18882.1|  syntaxin of plants protein                              175   5e-51   Medicago truncatula
gb|AFK34675.1|  unknown                                                 173   2e-50   Medicago truncatula
ref|XP_003600182.1|  Syntaxin-52                                        173   2e-50   
gb|AES70433.2|  syntaxin of plants protein                              173   5e-50   Medicago truncatula
gb|AFK35227.1|  unknown                                                 172   6e-50   Medicago truncatula
gb|ABI84247.1|  syntaxin                                                169   7e-50   Arachis hypogaea [goober]
gb|KJB11950.1|  hypothetical protein B456_002G094300                    169   7e-50   Gossypium raimondii
gb|KJB11948.1|  hypothetical protein B456_002G094300                    169   7e-50   Gossypium raimondii
gb|KHG00459.1|  Syntaxin-51 -like protein                               172   8e-50   Gossypium arboreum [tree cotton]
gb|KJB11949.1|  hypothetical protein B456_002G094300                    169   9e-50   Gossypium raimondii
ref|XP_010909005.1|  PREDICTED: syntaxin-52-like                        171   1e-49   Elaeis guineensis
gb|KJB11947.1|  hypothetical protein B456_002G094300                    169   1e-49   Gossypium raimondii
ref|XP_003617659.1|  Syntaxin-51                                        169   2e-49   Medicago truncatula
ref|XP_008787642.1|  PREDICTED: syntaxin-52-like                        170   3e-49   Phoenix dactylifera
gb|KJB11954.1|  hypothetical protein B456_002G094300                    169   4e-49   Gossypium raimondii
gb|KJB11946.1|  hypothetical protein B456_002G094300                    170   4e-49   Gossypium raimondii
ref|XP_010675821.1|  PREDICTED: syntaxin-52-like                        167   7e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007211870.1|  hypothetical protein PRUPE_ppa010128mg             166   1e-47   Prunus persica
ref|XP_004151390.1|  PREDICTED: syntaxin-51-like                        166   1e-47   Cucumis sativus [cucumbers]
emb|CDX88551.1|  BnaC06g39950D                                          165   3e-47   
ref|XP_006302763.1|  hypothetical protein CARUB_v10020885mg             165   3e-47   Capsella rubella
gb|ABK23110.1|  unknown                                                 165   4e-47   Picea sitchensis
ref|XP_008447706.1|  PREDICTED: syntaxin-51-like                        164   8e-47   Cucumis melo [Oriental melon]
ref|XP_002887794.1|  hypothetical protein ARALYDRAFT_477131             164   9e-47   
ref|XP_010940839.1|  PREDICTED: syntaxin-52-like                        164   9e-47   Elaeis guineensis
ref|XP_008227024.1|  PREDICTED: syntaxin-52-like                        164   1e-46   Prunus mume [ume]
ref|XP_006389870.1|  hypothetical protein EUTSA_v10019084mg             163   2e-46   
ref|XP_009106789.1|  PREDICTED: syntaxin-52-like                        162   4e-46   
emb|CDY68585.1|  BnaAnng27700D                                          162   6e-46   Brassica napus [oilseed rape]
ref|XP_009117773.1|  PREDICTED: syntaxin-51-like                        161   1e-45   Brassica rapa
ref|XP_009128371.1|  PREDICTED: syntaxin-52 isoform X1                  161   1e-45   Brassica rapa
emb|CDY52847.1|  BnaA09g56390D                                          161   1e-45   Brassica napus [oilseed rape]
ref|XP_009128372.1|  PREDICTED: syntaxin-52 isoform X2                  161   2e-45   Brassica rapa
ref|XP_006304162.1|  hypothetical protein CARUB_v10010186mg             160   2e-45   Capsella rubella
emb|CDY33349.1|  BnaC05g12340D                                          160   2e-45   Brassica napus [oilseed rape]
gb|AAM64357.1|  unknown                                                 160   2e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009149057.1|  PREDICTED: syntaxin-51                             160   3e-45   Brassica rapa
ref|XP_010472824.1|  PREDICTED: syntaxin-52                             160   3e-45   Camelina sativa [gold-of-pleasure]
ref|XP_002892898.1|  hypothetical protein ARALYDRAFT_471821             160   3e-45   
ref|XP_008784838.1|  PREDICTED: syntaxin-52-like                        160   4e-45   Phoenix dactylifera
ref|XP_008775700.1|  PREDICTED: syntaxin-52-like isoform X2             159   4e-45   Phoenix dactylifera
ref|XP_008345031.1|  PREDICTED: syntaxin-52-like isoform X3             159   4e-45   
ref|XP_008775698.1|  PREDICTED: syntaxin-52-like isoform X1             159   5e-45   Phoenix dactylifera
emb|CDX81754.1|  BnaC08g38470D                                          159   5e-45   
ref|NP_565213.1|  syntaxin-52                                           159   5e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008345029.1|  PREDICTED: syntaxin-52-like isoform X1             160   5e-45   
gb|AAF68106.1|AC010793_1  F20B17.2                                      160   9e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010429855.1|  PREDICTED: syntaxin-52-like                        159   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_009361063.1|  PREDICTED: syntaxin-52-like isoform X1             159   1e-44   Pyrus x bretschneideri [bai li]
ref|XP_009361064.1|  PREDICTED: syntaxin-52-like isoform X2             159   1e-44   Pyrus x bretschneideri [bai li]
ref|XP_011461087.1|  PREDICTED: syntaxin-52-like                        158   2e-44   Fragaria vesca subsp. vesca
ref|XP_004249335.1|  PREDICTED: syntaxin-51                             157   2e-44   Solanum lycopersicum
emb|CDX87371.1|  BnaA07g35020D                                          164   3e-44   
ref|XP_009606725.1|  PREDICTED: syntaxin-52-like                        157   4e-44   Nicotiana tomentosiformis
ref|XP_010417628.1|  PREDICTED: syntaxin-52-like                        157   6e-44   Camelina sativa [gold-of-pleasure]
ref|XP_009773941.1|  PREDICTED: syntaxin-52-like                        156   7e-44   Nicotiana sylvestris
gb|KCW66898.1|  hypothetical protein EUGRSUZ_F00647                     154   8e-44   Eucalyptus grandis [rose gum]
ref|XP_007211871.1|  hypothetical protein PRUPE_ppa010128mg             157   1e-43   
gb|AFW61957.1|  hypothetical protein ZEAMMB73_963395                    155   1e-43   
ref|XP_006339244.1|  PREDICTED: syntaxin-51-like                        156   1e-43   Solanum tuberosum [potatoes]
ref|XP_010060271.1|  PREDICTED: syntaxin-51-like isoform X2             155   2e-43   Eucalyptus grandis [rose gum]
gb|KCW66897.1|  hypothetical protein EUGRSUZ_F00647                     154   2e-43   Eucalyptus grandis [rose gum]
gb|KCW66896.1|  hypothetical protein EUGRSUZ_F00647                     155   2e-43   Eucalyptus grandis [rose gum]
gb|ACF80713.1|  unknown                                                 152   3e-43   Zea mays [maize]
ref|XP_004976388.1|  PREDICTED: syntaxin-52-like                        155   3e-43   Setaria italica
ref|XP_006416838.1|  hypothetical protein EUTSA_v10008662mg             154   4e-43   Eutrema salsugineum [saltwater cress]
ref|XP_010060270.1|  PREDICTED: syntaxin-51-like isoform X1             155   4e-43   Eucalyptus grandis [rose gum]
gb|AFW61961.1|  hypothetical protein ZEAMMB73_963395                    153   4e-43   
gb|ACN36591.1|  unknown                                                 152   5e-43   Zea mays [maize]
gb|EAY84230.1|  hypothetical protein OsI_05611                          154   6e-43   Oryza sativa Indica Group [Indian rice]
ref|NP_563994.1|  syntaxin-51                                           154   6e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001045701.1|  Os02g0119400                                       154   6e-43   
ref|XP_009416129.1|  PREDICTED: syntaxin-52-like                        154   6e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008385825.1|  PREDICTED: syntaxin-52-like                        154   6e-43   
ref|NP_001077546.1|  syntaxin-51                                        154   7e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008676698.1|  PREDICTED: uncharacterized protein LOC100217...    153   7e-43   Zea mays [maize]
gb|AFW61956.1|  SNARE domain containing protein                         155   8e-43   
ref|XP_009343645.1|  PREDICTED: syntaxin-52-like isoform X2             153   2e-42   Pyrus x bretschneideri [bai li]
ref|XP_009343644.1|  PREDICTED: syntaxin-52-like isoform X1             153   2e-42   Pyrus x bretschneideri [bai li]
ref|XP_009334172.1|  PREDICTED: syntaxin-52-like isoform X2             153   2e-42   Pyrus x bretschneideri [bai li]
ref|XP_009334173.1|  PREDICTED: syntaxin-52-like isoform X3             153   2e-42   Pyrus x bretschneideri [bai li]
ref|XP_006646793.1|  PREDICTED: syntaxin-52-like                        153   2e-42   Oryza brachyantha
ref|NP_001136935.1|  uncharacterized protein LOC100217094               153   2e-42   Zea mays [maize]
gb|KCW70251.1|  hypothetical protein EUGRSUZ_F03509                     151   2e-42   Eucalyptus grandis [rose gum]
ref|NP_001131944.1|  uncharacterized protein LOC100193337               152   3e-42   Zea mays [maize]
gb|ACG48507.1|  SNARE domain containing protein                         152   4e-42   Zea mays [maize]
ref|XP_010063061.1|  PREDICTED: syntaxin-52-like                        152   4e-42   Eucalyptus grandis [rose gum]
ref|XP_006659260.1|  PREDICTED: syntaxin-52-like                        152   5e-42   Oryza brachyantha
ref|XP_010459159.1|  PREDICTED: syntaxin-51-like                        152   5e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010497722.1|  PREDICTED: syntaxin-51-like                        152   5e-42   Camelina sativa [gold-of-pleasure]
ref|XP_006406341.1|  hypothetical protein EUTSA_v10021502mg             151   6e-42   
ref|XP_009334171.1|  PREDICTED: syntaxin-52-like isoform X1             153   7e-42   
gb|ACG31926.1|  SNARE domain containing protein                         151   8e-42   Zea mays [maize]
ref|XP_010476728.1|  PREDICTED: syntaxin-51                             150   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_009407478.1|  PREDICTED: syntaxin-52-like                        150   3e-41   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ06340.1|  hypothetical protein OsI_28572                          145   2e-40   Oryza sativa Indica Group [Indian rice]
dbj|BAJ97107.1|  predicted protein                                      146   5e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008240610.1|  PREDICTED: syntaxin-51-like                        146   6e-40   Prunus mume [ume]
gb|EMS60104.1|  Syntaxin-51                                             146   7e-40   Triticum urartu
ref|NP_001061436.1|  Os08g0277900                                       145   2e-39   
ref|XP_007202519.1|  hypothetical protein PRUPE_ppa010912mg             145   2e-39   Prunus persica
ref|XP_010673197.1|  PREDICTED: syntaxin-52-like                        144   3e-39   Beta vulgaris subsp. vulgaris [field beet]
gb|EEE68383.1|  hypothetical protein OsJ_26713                          147   5e-39   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ85147.1|  predicted protein                                      144   5e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT28389.1|  hypothetical protein F775_28894                         144   8e-39   
ref|XP_008668816.1|  PREDICTED: syntaxin-52-like                        143   9e-39   
gb|EEC83251.1|  hypothetical protein OsI_28573                          147   9e-39   Oryza sativa Indica Group [Indian rice]
ref|XP_009377637.1|  PREDICTED: syntaxin-51-like                        142   2e-38   Pyrus x bretschneideri [bai li]
ref|XP_006373682.1|  hypothetical protein POPTR_0016s02990g             143   2e-38   
ref|XP_011041363.1|  PREDICTED: syntaxin-52-like                        141   8e-38   Populus euphratica
ref|XP_007020672.1|  Syntaxin of plants 51 isoform 2                    139   2e-37   
ref|XP_006373681.1|  hypothetical protein POPTR_0016s02990g             140   2e-37   
ref|XP_006373683.1|  hypothetical protein POPTR_0016s03000g             136   4e-36   
gb|ABK92777.1|  unknown                                                 133   8e-36   Populus trichocarpa [western balsam poplar]
ref|XP_011040715.1|  PREDICTED: syntaxin-52-like                        135   2e-35   Populus euphratica
ref|XP_002307951.1|  hypothetical protein POPTR_0006s03120g             133   8e-35   
gb|ABK92902.1|  unknown                                                 132   1e-34   Populus trichocarpa [western balsam poplar]
ref|XP_011041367.1|  PREDICTED: syntaxin-52-like                        132   2e-34   Populus euphratica
gb|KJB62826.1|  hypothetical protein B456_009G444600                    130   5e-34   Gossypium raimondii
ref|XP_011040717.1|  PREDICTED: syntaxin-52-like                        129   2e-33   Populus euphratica
ref|XP_010111270.1|  hypothetical protein L484_027923                   125   2e-32   
emb|CBI29594.3|  unnamed protein product                                115   1e-29   Vitis vinifera
ref|XP_003573428.1|  PREDICTED: syntaxin-52-like                        113   3e-27   Brachypodium distachyon [annual false brome]
ref|XP_006836711.1|  hypothetical protein AMTR_s00088p00114370          106   4e-26   
gb|EYU33678.1|  hypothetical protein MIMGU_mgv1a021393mg                109   6e-26   Erythranthe guttata [common monkey flower]
gb|AFW61958.1|  hypothetical protein ZEAMMB73_963395                    104   4e-25   
ref|NP_173073.2|  Target SNARE coiled-coil domain protein               106   6e-25   
ref|XP_006380963.1|  hypothetical protein POPTR_0006s03130g           89.4    8e-19   
ref|XP_006399472.1|  hypothetical protein EUTSA_v10015786mg           86.3    1e-17   
ref|XP_001778077.1|  predicted protein                                84.3    1e-16   
ref|XP_004987204.1|  PREDICTED: syntaxin-52-like                      82.0    8e-16   
ref|XP_001751913.1|  Qc-SNARE, SYP5 family                            79.3    7e-15   
gb|AAM52319.1|AC105363_8  Hypothetical protein                        78.2    4e-14   Oryza sativa Japonica Group [Japonica rice]
ref|NP_683311.2|  putative syntaxin-type t-SNARE protein              75.9    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002465967.1|  hypothetical protein SORBIDRAFT_01g049130        74.7    4e-13   Sorghum bicolor [broomcorn]
ref|XP_006650984.1|  PREDICTED: syntaxin-52-like                      73.6    5e-13   
ref|XP_010646520.1|  PREDICTED: syntaxin-52-like                      73.6    2e-12   Vitis vinifera
ref|XP_011398897.1|  Syntaxin-52                                      70.9    6e-12   Auxenochlorella protothecoides
gb|EAY88317.1|  hypothetical protein OsI_09776                        71.6    8e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_005649717.1|  Qc-snare protein, Syn8/Syntaxin8-family          70.1    1e-11   Coccomyxa subellipsoidea C-169
ref|XP_005850452.1|  hypothetical protein CHLNCDRAFT_59611            68.6    4e-11   Chlorella variabilis
gb|ABR25694.1|  syntaxin 51                                           66.6    1e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_004363668.1|  hypothetical protein CAOG_03940                  63.2    4e-09   Capsaspora owczarzaki ATCC 30864
gb|KIZ07812.1|  Syntaxin-51                                           63.2    4e-09   Monoraphidium neglectum
ref|XP_002531208.1|  syntaxin, putative                               61.6    5e-09   
ref|XP_002730935.1|  PREDICTED: syntaxin-8-like                       60.8    2e-08   Saccoglossus kowalevskii
gb|KJB62825.1|  hypothetical protein B456_009G444600                  59.3    4e-08   Gossypium raimondii
ref|XP_004206098.1|  PREDICTED: syntaxin-8-like                       58.5    1e-07   Hydra vulgaris
gb|KJB26468.1|  hypothetical protein B456_004G245700                  57.0    3e-07   Gossypium raimondii
gb|KDD75355.1|  hypothetical protein H632_c726p1                      55.8    9e-07   Helicosporidium sp. ATCC 50920
gb|KHG02271.1|  Syntaxin-52 -like protein                             55.5    2e-06   Gossypium arboreum [tree cotton]
ref|XP_007030625.1|  Syntaxin of plants 52, putative isoform 2        52.8    1e-05   
ref|XP_002951465.1|  Qc-SNARE, Syn8/Syntaxin8-family                  52.0    4e-05   Volvox carteri f. nagariensis
ref|XP_010041363.1|  PREDICTED: uncharacterized protein LOC104430313  51.2    4e-05   Eucalyptus grandis [rose gum]
ref|XP_003064731.1|  predicted protein                                51.2    7e-05   Micromonas pusilla CCMP1545
ref|XP_011005693.1|  PREDICTED: uncharacterized protein LOC105111906  48.9    3e-04   Populus euphratica
gb|KDP23638.1|  hypothetical protein JCGZ_23471                       49.7    4e-04   Jatropha curcas
ref|XP_011418529.1|  PREDICTED: syntaxin-8-like                       48.9    5e-04   Crassostrea gigas
ref|XP_002970090.1|  hypothetical protein SELMODRAFT_441012           48.9    5e-04   Selaginella moellendorffii
ref|XP_005093027.1|  PREDICTED: syntaxin-8-like                       48.5    5e-04   
ref|XP_011005695.1|  PREDICTED: uncharacterized protein LOC105111907  48.1    6e-04   Populus euphratica
ref|XP_006836710.1|  hypothetical protein AMTR_s00088p00114030        45.4    8e-04   
ref|XP_799247.2|  PREDICTED: syntaxin-8-like                          47.4    0.001   Strongylocentrotus purpuratus [purple urchin]



>ref|XP_011097825.1| PREDICTED: syntaxin-51-like [Sesamum indicum]
Length=235

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/112 (91%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MAASGDSWVREYNEAV+LADDITNMISERSSLP TG EAQRHSSAIRRKIT LGTRLDSL
Sbjct  3    MAASGDSWVREYNEAVRLADDITNMISERSSLPATGPEAQRHSSAIRRKITILGTRLDSL  62

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP KQPLTEKE+NRRKDM+A LRSK NQMASTLNMSNFANRDSLLG
Sbjct  63   QSLLSKLPGKQPLTEKEMNRRKDMVANLRSKVNQMASTLNMSNFANRDSLLG  114



>ref|XP_011095474.1| PREDICTED: syntaxin-52-like [Sesamum indicum]
Length=233

 Score =   202 bits (515),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/112 (89%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MAASGDSWVREYNEAVKLADDIT+MISERSSLP TG EAQRHSSAIRRKIT LGTRLDSL
Sbjct  1    MAASGDSWVREYNEAVKLADDITSMISERSSLPATGPEAQRHSSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP KQ LTEKE+NRR DM+A LRSK NQMASTLNMSNFANRDSLLG
Sbjct  61   QSLLSKLPGKQSLTEKEMNRRADMVANLRSKVNQMASTLNMSNFANRDSLLG  112



>ref|XP_009786725.1| PREDICTED: syntaxin-51-like [Nicotiana sylvestris]
 ref|XP_009786781.1| PREDICTED: syntaxin-51-like [Nicotiana sylvestris]
 ref|XP_009786839.1| PREDICTED: syntaxin-51-like [Nicotiana sylvestris]
 ref|XP_009786902.1| PREDICTED: syntaxin-51-like [Nicotiana sylvestris]
Length=233

 Score =   199 bits (505),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+SGDSW+REYNEA+K+ADDITNMISERSSLP +G EAQRHSSAIRRKIT LGTRLD+L
Sbjct  1    MASSGDSWIREYNEALKIADDITNMISERSSLPASGPEAQRHSSAIRRKITILGTRLDNL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP KQPLTEKE+NRRKDMLA L+SK  QMASTLNMS+FANRDSLLG
Sbjct  61   QSLLSKLPGKQPLTEKEMNRRKDMLANLKSKVTQMASTLNMSSFANRDSLLG  112



>ref|XP_010324299.1| PREDICTED: syntaxin-51-like isoform X1 [Solanum lycopersicum]
Length=238

 Score =   197 bits (501),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +3

Query  201  KAMAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLD  380
            + MA+SGDSW+REYNE +KLADDITNMISERSSLP +G EAQRHSSAIRRKIT LGTRLD
Sbjct  4    QVMASSGDSWIREYNEGLKLADDITNMISERSSLPASGPEAQRHSSAIRRKITILGTRLD  63

Query  381  SLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +L+S+LSKLP KQPL+EKE+NRRKDMLA L+SK +QMASTLNMS+FANRDSLLG
Sbjct  64   NLQSILSKLPGKQPLSEKEMNRRKDMLANLKSKVSQMASTLNMSSFANRDSLLG  117



>ref|XP_006346178.1| PREDICTED: syntaxin-51-like isoform X1 [Solanum tuberosum]
Length=238

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +3

Query  201  KAMAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLD  380
            + MA+SGDSW+REYNE +KLADDITNMISERSSLP +G EAQRHSSAIRRKIT LGTRLD
Sbjct  4    QVMASSGDSWIREYNEGLKLADDITNMISERSSLPASGPEAQRHSSAIRRKITILGTRLD  63

Query  381  SLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +L+S+LSKLP KQPL+EKE+NRRKDMLA L+SK +QMASTLNMS+FANRDSLLG
Sbjct  64   NLQSILSKLPGKQPLSEKEMNRRKDMLANLKSKVSQMASTLNMSSFANRDSLLG  117



>ref|XP_009591371.1| PREDICTED: syntaxin-51-like [Nicotiana tomentosiformis]
 ref|XP_009591379.1| PREDICTED: syntaxin-51-like [Nicotiana tomentosiformis]
 ref|XP_009591390.1| PREDICTED: syntaxin-51-like [Nicotiana tomentosiformis]
 ref|XP_009591398.1| PREDICTED: syntaxin-51-like [Nicotiana tomentosiformis]
 ref|XP_009591404.1| PREDICTED: syntaxin-51-like [Nicotiana tomentosiformis]
Length=233

 Score =   196 bits (498),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+SGDSW+REYNEA+K+ADDITNMISE+SSLP +G E QRHSSAIRRKIT LGTRLD+L
Sbjct  1    MASSGDSWIREYNEALKIADDITNMISEKSSLPASGPEVQRHSSAIRRKITILGTRLDNL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP KQPLTEKE+NRRKDMLA L+SK  QMASTLNMS+FANRDSLLG
Sbjct  61   QSLLSKLPGKQPLTEKEMNRRKDMLANLKSKVTQMASTLNMSSFANRDSLLG  112



>ref|XP_004244081.1| PREDICTED: syntaxin-51-like isoform X2 [Solanum lycopersicum]
Length=233

 Score =   196 bits (498),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+SGDSW+REYNE +KLADDITNMISERSSLP +G EAQRHSSAIRRKIT LGTRLD+L
Sbjct  1    MASSGDSWIREYNEGLKLADDITNMISERSSLPASGPEAQRHSSAIRRKITILGTRLDNL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +S+LSKLP KQPL+EKE+NRRKDMLA L+SK +QMASTLNMS+FANRDSLLG
Sbjct  61   QSILSKLPGKQPLSEKEMNRRKDMLANLKSKVSQMASTLNMSSFANRDSLLG  112



>ref|XP_006346179.1| PREDICTED: syntaxin-51-like isoform X2 [Solanum tuberosum]
Length=233

 Score =   196 bits (498),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+SGDSW+REYNE +KLADDITNMISERSSLP +G EAQRHSSAIRRKIT LGTRLD+L
Sbjct  1    MASSGDSWIREYNEGLKLADDITNMISERSSLPASGPEAQRHSSAIRRKITILGTRLDNL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +S+LSKLP KQPL+EKE+NRRKDMLA L+SK +QMASTLNMS+FANRDSLLG
Sbjct  61   QSILSKLPGKQPLSEKEMNRRKDMLANLKSKVSQMASTLNMSSFANRDSLLG  112



>gb|EYU27391.1| hypothetical protein MIMGU_mgv1a013014mg [Erythranthe guttata]
Length=233

 Score =   193 bits (491),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MAA GDSWVREYNEAVKLADDITNMISERSSLP TG EAQRHSSAIRRKIT LGTRLDSL
Sbjct  1    MAAPGDSWVREYNEAVKLADDITNMISERSSLPATGPEAQRHSSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SL SKLP KQ L+EKE+NRR+DM+A LRSK  QMAS LNMSNFA RDSLLG
Sbjct  61   QSLFSKLPGKQSLSEKEMNRRRDMVANLRSKVTQMASALNMSNFAIRDSLLG  112



>ref|XP_009625654.1| PREDICTED: syntaxin-51-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625655.1| PREDICTED: syntaxin-51-like isoform X1 [Nicotiana tomentosiformis]
Length=250

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  201  KAMAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLD  380
            + MA+SGDSW+REYNEAVKL DDI NMISERSSLP TG EAQRHSS+IRRKIT LGTRLD
Sbjct  16   QGMASSGDSWIREYNEAVKLTDDIGNMISERSSLPATGPEAQRHSSSIRRKITILGTRLD  75

Query  381  SLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            SL+S+ S LP KQ LTEKE+NRRKDMLA L+SKA QMASTLNMSNFANRDSLLG
Sbjct  76   SLQSIDSNLPGKQRLTEKEMNRRKDMLANLKSKATQMASTLNMSNFANRDSLLG  129



>ref|XP_006452473.1| hypothetical protein CICLE_v10009364mg [Citrus clementina]
 ref|XP_006474986.1| PREDICTED: syntaxin-51-like [Citrus sinensis]
 gb|ESR65713.1| hypothetical protein CICLE_v10009364mg [Citrus clementina]
 gb|KDO62148.1| hypothetical protein CISIN_1g026774mg [Citrus sinensis]
Length=233

 Score =   192 bits (487),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA++ DSW++EYNEA+KLADDI  MISERSS+P +G E+QRH+SAIRRKIT LGTRLDSL
Sbjct  1    MASASDSWIKEYNEAIKLADDINGMISERSSMPASGPESQRHASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP KQP++EKE+NRRKDMLA LRSK NQMASTLNMSNFANRDSLLG
Sbjct  61   QSLLSKLPGKQPISEKEMNRRKDMLANLRSKVNQMASTLNMSNFANRDSLLG  112



>ref|XP_009625656.1| PREDICTED: syntaxin-51-like isoform X2 [Nicotiana tomentosiformis]
Length=233

 Score =   191 bits (486),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+SGDSW+REYNEAVKL DDI NMISERSSLP TG EAQRHSS+IRRKIT LGTRLDSL
Sbjct  1    MASSGDSWIREYNEAVKLTDDIGNMISERSSLPATGPEAQRHSSSIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +S+ S LP KQ LTEKE+NRRKDMLA L+SKA QMASTLNMSNFANRDSLLG
Sbjct  61   QSIDSNLPGKQRLTEKEMNRRKDMLANLKSKATQMASTLNMSNFANRDSLLG  112



>emb|CDP13772.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   191 bits (485),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 103/112 (92%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+SGD WV+EYNEAVKLADDITNMISER+SLP TG EAQRH+SAIRRKIT L TRL+SL
Sbjct  1    MASSGDPWVKEYNEAVKLADDITNMISERNSLPATGPEAQRHASAIRRKITILSTRLESL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLS+LP KQ LTEKE+NRRKDMLA LRSK NQMASTLNMSNFANRDSLLG
Sbjct  61   QSLLSRLPGKQ-LTEKEMNRRKDMLANLRSKVNQMASTLNMSNFANRDSLLG  111



>ref|XP_006595709.1| PREDICTED: syntaxin-51-like [Glycine max]
 gb|KHN23883.1| Syntaxin-51 [Glycine soja]
Length=232

 Score =   188 bits (478),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSWV+EYNEA+KLADDI+ MISE+SS P +G E Q HSSAIRRKIT LGTRLDSL
Sbjct  1    MASSSDSWVKEYNEALKLADDISGMISEQSSFPASGPETQHHSSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP KQP++EKE+NRRKDML+ LRSK NQMASTLNMSNFANRDSLLG
Sbjct  61   QSLLSKLPGKQPISEKEMNRRKDMLSNLRSKVNQMASTLNMSNFANRDSLLG  112



>gb|ACU19604.1| unknown [Glycine max]
Length=232

 Score =   188 bits (478),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSWV+EYNEA+KLADDI+ MISE+SS P +G E Q HSSAIRRKIT LGTRLDSL
Sbjct  1    MASSSDSWVKEYNEALKLADDISGMISEQSSFPASGPETQHHSSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP KQP++EKE+NRRKDML+ LRSK NQMASTLNMSNFANRDSLLG
Sbjct  61   QSLLSKLPGKQPISEKEMNRRKDMLSNLRSKVNQMASTLNMSNFANRDSLLG  112



>ref|XP_004491441.1| PREDICTED: syntaxin-52-like isoform X2 [Cicer arietinum]
Length=198

 Score =   186 bits (472),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA++ D WV+EYNEA+KL DDI++MISE+SS P +G EAQR SSAIRRKIT LGTRLDSL
Sbjct  1    MASNSDQWVKEYNEALKLGDDISSMISEQSSFPASGPEAQRQSSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP KQPL+EKE+NRRKDMLA LRSK NQMAS+LNMSNFANRDSLLG
Sbjct  61   QSLLSKLPGKQPLSEKEMNRRKDMLANLRSKVNQMASSLNMSNFANRDSLLG  112



>ref|XP_009765136.1| PREDICTED: syntaxin-51-like isoform X1 [Nicotiana sylvestris]
Length=250

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  201  KAMAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLD  380
            + MA+SGDSW+REYNEAVKL DDI NMISERSSL TTG EAQRHSS+IRRKIT LGTRLD
Sbjct  16   QGMASSGDSWIREYNEAVKLTDDIGNMISERSSLSTTGPEAQRHSSSIRRKITILGTRLD  75

Query  381  SLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            SL+S+ SKLP  + LT+KE+NRRKDMLA L+SKA QMASTLNMSNFANRDSLLG
Sbjct  76   SLQSIDSKLPGMERLTKKEMNRRKDMLANLKSKATQMASTLNMSNFANRDSLLG  129



>ref|XP_009765138.1| PREDICTED: syntaxin-51-like isoform X2 [Nicotiana sylvestris]
Length=233

 Score =   186 bits (472),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+SGDSW+REYNEAVKL DDI NMISERSSL TTG EAQRHSS+IRRKIT LGTRLDSL
Sbjct  1    MASSGDSWIREYNEAVKLTDDIGNMISERSSLSTTGPEAQRHSSSIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +S+ SKLP  + LT+KE+NRRKDMLA L+SKA QMASTLNMSNFANRDSLLG
Sbjct  61   QSIDSKLPGMERLTKKEMNRRKDMLANLKSKATQMASTLNMSNFANRDSLLG  112



>ref|XP_004491440.1| PREDICTED: syntaxin-52-like isoform X1 [Cicer arietinum]
Length=232

 Score =   186 bits (472),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA++ D WV+EYNEA+KL DDI++MISE+SS P +G EAQR SSAIRRKIT LGTRLDSL
Sbjct  1    MASNSDQWVKEYNEALKLGDDISSMISEQSSFPASGPEAQRQSSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP KQPL+EKE+NRRKDMLA LRSK NQMAS+LNMSNFANRDSLLG
Sbjct  61   QSLLSKLPGKQPLSEKEMNRRKDMLANLRSKVNQMASSLNMSNFANRDSLLG  112



>ref|XP_010246481.1| PREDICTED: syntaxin-52-like [Nelumbo nucifera]
 ref|XP_010246482.1| PREDICTED: syntaxin-52-like [Nelumbo nucifera]
Length=233

 Score =   186 bits (471),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW+RE++EA KLADDI  MISERSS P +G E QRHSSAIRRKIT LGTRLDSL
Sbjct  1    MASSSDSWMREFSEASKLADDINGMISERSSFPPSGPETQRHSSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP+KQP+TEKE++RR+DMLA L+SKANQMASTLNMSNFANRDSL+G
Sbjct  61   QSLLSKLPSKQPITEKEMHRRQDMLANLKSKANQMASTLNMSNFANRDSLIG  112



>ref|XP_010647220.1| PREDICTED: syntaxin-51-like [Vitis vinifera]
Length=233

 Score =   184 bits (466),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EY EA KLADDI  MISER SLPT+G+E QRH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDSWIKEYYEASKLADDIYGMISERISLPTSGSETQRHASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL KLP KQP+TEKE+NRRKDML+ LRSK +QMASTLNMSNFANRDSLLG
Sbjct  61   QSLLLKLPGKQPITEKEMNRRKDMLSNLRSKVSQMASTLNMSNFANRDSLLG  112



>ref|XP_002277100.1| PREDICTED: syntaxin-51 [Vitis vinifera]
 emb|CBI26707.3| unnamed protein product [Vitis vinifera]
Length=232

 Score =   183 bits (465),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +3

Query  213  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLES  392
            AS DSW++EYN+AVKLADDI  MISER S    G +AQRH+SAIRRKIT LGTRLDSL+S
Sbjct  2    ASSDSWMKEYNDAVKLADDINGMISERISFSAPGVDAQRHASAIRRKITILGTRLDSLQS  61

Query  393  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            LLSKLP KQPLTEKE+NRRKDM+A L+SKANQMASTLNMSNFANRDSLLG
Sbjct  62   LLSKLPGKQPLTEKEMNRRKDMVANLKSKANQMASTLNMSNFANRDSLLG  111



>ref|XP_010245902.1| PREDICTED: syntaxin-51-like [Nelumbo nucifera]
 ref|XP_010245903.1| PREDICTED: syntaxin-51-like [Nelumbo nucifera]
 ref|XP_010245904.1| PREDICTED: syntaxin-51-like [Nelumbo nucifera]
Length=233

 Score =   183 bits (464),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++E++EA KLADDI  MISER S P +G E QRHSSAIRRKIT LGTRLDSL
Sbjct  1    MASSSDSWMKEFSEASKLADDINGMISERGSFPPSGPETQRHSSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +S+LSKLP+KQP+TEKE++RR+DMLA  RSKANQMASTLNMSNFANRDSLLG
Sbjct  61   QSILSKLPSKQPITEKEMHRRQDMLANFRSKANQMASTLNMSNFANRDSLLG  112



>ref|XP_010099994.1| hypothetical protein L484_014031 [Morus notabilis]
 gb|EXB81099.1| hypothetical protein L484_014031 [Morus notabilis]
Length=223

 Score =   182 bits (462),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +3

Query  216  SGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLESL  395
            +GDSWV+EYNEA+KLADDI  MISERSSL  +G E QRH+SAIRRKIT LGTRLD L+S+
Sbjct  2    AGDSWVKEYNEAMKLADDINGMISERSSLHASGPETQRHASAIRRKITILGTRLDGLQSI  61

Query  396  LSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            L+KLP KQP++EKE+NRRKDMLA LRSK NQMAS LNMSNFANRDSLLG
Sbjct  62   LTKLPGKQPISEKEMNRRKDMLANLRSKVNQMASALNMSNFANRDSLLG  110



>ref|XP_010537838.1| PREDICTED: syntaxin-51 [Tarenaya hassleriana]
 ref|XP_010537839.1| PREDICTED: syntaxin-51 [Tarenaya hassleriana]
Length=233

 Score =   181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSWVREYNEA+KL++DI  MIS+RSS   +G EAQRH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDSWVREYNEALKLSEDINGMISQRSSSAVSGPEAQRHASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL+K+P KQP++EKE+NRRKDM+  LRSKANQMAS LNMSNFANRDSLLG
Sbjct  61   QSLLAKIPGKQPISEKEMNRRKDMIGNLRSKANQMASALNMSNFANRDSLLG  112



>gb|KJB22166.1| hypothetical protein B456_004G032900 [Gossypium raimondii]
Length=141

 Score =   178 bits (451),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 97/112 (87%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEAVK+ DDI  MISERSSLP +G E QRH+SAIRRKIT LGTRLD L
Sbjct  1    MASSSDSWIKEYNEAVKMVDDINAMISERSSLPASGPETQRHASAIRRKITILGTRLDGL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLS+ PT +PLTEKE+NRRKDM+A LRSK NQMAS  NMSNFANRDSLLG
Sbjct  61   QSLLSR-PTGKPLTEKEMNRRKDMVANLRSKVNQMASAFNMSNFANRDSLLG  111



>gb|KJB81689.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
Length=141

 Score =   177 bits (450),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 96/112 (86%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MAAS D W++EYNEAVK+ADDI  MISER SLP +G E QRH+SAIRRKIT LGTRLD L
Sbjct  1    MAASSDPWIKEYNEAVKIADDINGMISERISLPASGPETQRHASAIRRKITILGTRLDGL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
             SL+S+ PT +PLTEKE+NRRKDM+A LRSKANQMAS  NMSNFANRDSLLG
Sbjct  61   HSLMSR-PTGKPLTEKEMNRRKDMVANLRSKANQMASAFNMSNFANRDSLLG  111



>ref|XP_007146536.1| hypothetical protein PHAVU_006G048900g [Phaseolus vulgaris]
 gb|ESW18530.1| hypothetical protein PHAVU_006G048900g [Phaseolus vulgaris]
Length=229

 Score =   180 bits (457),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 98/112 (88%), Gaps = 3/112 (3%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEAVKLADDIT MISERSS P +G E QRH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDSWMKEYNEAVKLADDITGMISERSSFPASGPETQRHASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSK+P K   TEKE+NRRKDML  LR+K NQMASTLNMSNFANRDSLLG
Sbjct  61   QSLLSKVPAK---TEKEMNRRKDMLGNLRTKVNQMASTLNMSNFANRDSLLG  109



>gb|KJB22169.1| hypothetical protein B456_004G032900 [Gossypium raimondii]
Length=196

 Score =   179 bits (453),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 97/112 (87%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEAVK+ DDI  MISERSSLP +G E QRH+SAIRRKIT LGTRLD L
Sbjct  1    MASSSDSWIKEYNEAVKMVDDINAMISERSSLPASGPETQRHASAIRRKITILGTRLDGL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLS+ PT +PLTEKE+NRRKDM+A LRSK NQMAS  NMSNFANRDSLLG
Sbjct  61   QSLLSR-PTGKPLTEKEMNRRKDMVANLRSKVNQMASAFNMSNFANRDSLLG  111



>ref|XP_006602182.1| PREDICTED: syntaxin-52-like isoform X2 [Glycine max]
Length=251

 Score =   180 bits (457),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 99/114 (87%), Gaps = 3/114 (3%)
 Frame = +3

Query  201  KAMAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLD  380
            + MA+S DSW++EYNEAVKLADDIT MISERSS P +G E QRH+SAIRRKIT LGTRLD
Sbjct  21   RVMASSSDSWMKEYNEAVKLADDITGMISERSSFPASGPETQRHASAIRRKITILGTRLD  80

Query  381  SLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            SL+SLLSK+P K   TEKE+NRRKDML+ LR+K NQMASTLNMSNFANRDSL G
Sbjct  81   SLQSLLSKVPAK---TEKEMNRRKDMLSNLRTKVNQMASTLNMSNFANRDSLFG  131



>gb|KJB81687.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
 gb|KJB81688.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
Length=150

 Score =   177 bits (448),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 96/112 (86%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MAAS D W++EYNEAVK+ADDI  MISER SLP +G E QRH+SAIRRKIT LGTRLD L
Sbjct  1    MAASSDPWIKEYNEAVKIADDINGMISERISLPASGPETQRHASAIRRKITILGTRLDGL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
             SL+S+ PT +PLTEKE+NRRKDM+A LRSKANQMAS  NMSNFANRDSLLG
Sbjct  61   HSLMSR-PTGKPLTEKEMNRRKDMVANLRSKANQMASAFNMSNFANRDSLLG  111



>gb|KJB22167.1| hypothetical protein B456_004G032900 [Gossypium raimondii]
Length=152

 Score =   177 bits (448),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 97/112 (87%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEAVK+ DDI  MISERSSLP +G E QRH+SAIRRKIT LGTRLD L
Sbjct  1    MASSSDSWIKEYNEAVKMVDDINAMISERSSLPASGPETQRHASAIRRKITILGTRLDGL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLS+ PT +PLTEKE+NRRKDM+A LRSK NQMAS  NMSNFANRDSLLG
Sbjct  61   QSLLSR-PTGKPLTEKEMNRRKDMVANLRSKVNQMASAFNMSNFANRDSLLG  111



>gb|KJB81686.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
Length=190

 Score =   178 bits (451),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 96/112 (86%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MAAS D W++EYNEAVK+ADDI  MISER SLP +G E QRH+SAIRRKIT LGTRLD L
Sbjct  1    MAASSDPWIKEYNEAVKIADDINGMISERISLPASGPETQRHASAIRRKITILGTRLDGL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
             SL+S+ PT +PLTEKE+NRRKDM+A LRSKANQMAS  NMSNFANRDSLLG
Sbjct  61   HSLMSR-PTGKPLTEKEMNRRKDMVANLRSKANQMASAFNMSNFANRDSLLG  111



>gb|KJB22168.1| hypothetical protein B456_004G032900 [Gossypium raimondii]
Length=190

 Score =   178 bits (451),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 97/112 (87%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEAVK+ DDI  MISERSSLP +G E QRH+SAIRRKIT LGTRLD L
Sbjct  1    MASSSDSWIKEYNEAVKMVDDINAMISERSSLPASGPETQRHASAIRRKITILGTRLDGL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLS+ PT +PLTEKE+NRRKDM+A LRSK NQMAS  NMSNFANRDSLLG
Sbjct  61   QSLLSR-PTGKPLTEKEMNRRKDMVANLRSKVNQMASAFNMSNFANRDSLLG  111



>gb|KHG18509.1| Syntaxin-51 -like protein [Gossypium arboreum]
Length=223

 Score =   179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 97/112 (87%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEAVK+ DDI  MISERSSLP +G E QRH+SAIRRKIT LGTRLD L
Sbjct  1    MASSSDSWIKEYNEAVKMVDDINAMISERSSLPVSGPETQRHASAIRRKITILGTRLDGL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLS+ PT +PLTEKE+NRRKDM+A LRSK NQMAS  NMSNFANRDSLLG
Sbjct  61   QSLLSR-PTGKPLTEKEMNRRKDMVANLRSKVNQMASAFNMSNFANRDSLLG  111



>gb|KDP39206.1| hypothetical protein JCGZ_00963 [Jatropha curcas]
Length=233

 Score =   179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D W++EYNEAVKLADDI+ MISERSS P +G E QRH SAIRRKIT LGTRLDSL
Sbjct  1    MASSADPWMKEYNEAVKLADDISGMISERSSFPASGPETQRHGSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL+KLP KQ ++EKE+NRRKDM+A LR+K NQMAS+LNMSNFA+RDSL G
Sbjct  61   QSLLTKLPGKQQVSEKEMNRRKDMVANLRTKVNQMASSLNMSNFAHRDSLFG  112



>gb|ACU23148.1| unknown [Glycine max]
Length=229

 Score =   179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 98/112 (88%), Gaps = 3/112 (3%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEAVKLADDIT MISERSS P +G E QRH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDSWMKEYNEAVKLADDITGMISERSSFPASGPETQRHASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSK+P K   TEKE+NRRKDML+ LR+K NQMASTLNMSNFANRDSL G
Sbjct  61   QSLLSKVPAK---TEKEMNRRKDMLSNLRTKVNQMASTLNMSNFANRDSLFG  109



>ref|XP_003551745.1| PREDICTED: syntaxin-52-like isoform X1 [Glycine max]
Length=229

 Score =   179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 98/112 (88%), Gaps = 3/112 (3%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEAVKLADDIT MISERSS P +G E QRH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDSWMKEYNEAVKLADDITGMISERSSFPASGPETQRHASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSK+P K   TEKE+NRRKDML+ LR+K NQMASTLNMSNFANRDSL G
Sbjct  61   QSLLSKVPAK---TEKEMNRRKDMLSNLRTKVNQMASTLNMSNFANRDSLFG  109



>gb|KJB81691.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
Length=195

 Score =   177 bits (450),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 96/112 (86%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MAAS D W++EYNEAVK+ADDI  MISER SLP +G E QRH+SAIRRKIT LGTRLD L
Sbjct  1    MAASSDPWIKEYNEAVKIADDINGMISERISLPASGPETQRHASAIRRKITILGTRLDGL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
             SL+S+ PT +PLTEKE+NRRKDM+A LRSKANQMAS  NMSNFANRDSLLG
Sbjct  61   HSLMSR-PTGKPLTEKEMNRRKDMVANLRSKANQMASAFNMSNFANRDSLLG  111



>gb|KJB22165.1| hypothetical protein B456_004G032900 [Gossypium raimondii]
Length=231

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 97/112 (87%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEAVK+ DDI  MISERSSLP +G E QRH+SAIRRKIT LGTRLD L
Sbjct  1    MASSSDSWIKEYNEAVKMVDDINAMISERSSLPASGPETQRHASAIRRKITILGTRLDGL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLS+ PT +PLTEKE+NRRKDM+A LRSK NQMAS  NMSNFANRDSLLG
Sbjct  61   QSLLSR-PTGKPLTEKEMNRRKDMVANLRSKVNQMASAFNMSNFANRDSLLG  111



>ref|XP_007142350.1| hypothetical protein PHAVU_008G273200g [Phaseolus vulgaris]
 ref|XP_007142351.1| hypothetical protein PHAVU_008G273200g [Phaseolus vulgaris]
 gb|ESW14344.1| hypothetical protein PHAVU_008G273200g [Phaseolus vulgaris]
 gb|ESW14345.1| hypothetical protein PHAVU_008G273200g [Phaseolus vulgaris]
Length=232

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S +SW++EYNEA+KL+DDI+ MISE+SS   +G E QRHS+AIRRKIT LGTRLDSL
Sbjct  1    MASSSNSWMKEYNEALKLSDDISGMISEQSSFSASGPEIQRHSTAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSK P KQP++EKE+NRRKDMLA+LRS+ NQMASTLNMSNF+NRDSLLG
Sbjct  61   QSLLSKFPGKQPISEKEMNRRKDMLASLRSRVNQMASTLNMSNFSNRDSLLG  112



>gb|KHG11788.1| Syntaxin-51 -like protein [Gossypium arboreum]
Length=238

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 97/112 (87%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MAAS D W++EYNEAVK+ADDI  MISER SLP +G E QRH+SAIRRKIT LGTRLD L
Sbjct  1    MAASSDPWIKEYNEAVKIADDINGMISERISLPASGPETQRHASAIRRKITILGTRLDGL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SL+S+ PT +PLTEKE+NRRKDM+A LRSKANQMAS  NMSNFANRDSLLG
Sbjct  61   QSLMSR-PTGKPLTEKEMNRRKDMVANLRSKANQMASAFNMSNFANRDSLLG  111



>ref|XP_004149588.1| PREDICTED: syntaxin-52-like [Cucumis sativus]
 ref|XP_004161879.1| PREDICTED: syntaxin-52-like [Cucumis sativus]
Length=233

 Score =   178 bits (452),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            M A  D W++EYNEA KL DDI  MISERSS P TG E+QRH+SAIRRKIT LGT++D L
Sbjct  1    MMAPSDLWIKEYNEASKLGDDINGMISERSSFPATGPESQRHASAIRRKITILGTKVDGL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL KLP KQPL+EKEINRRKDML  +RSK  QMASTLNMSNFANRDSLLG
Sbjct  61   QSLLLKLPVKQPLSEKEINRRKDMLVQMRSKVKQMASTLNMSNFANRDSLLG  112



>gb|KJB81690.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
 gb|KJB81692.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
Length=231

 Score =   178 bits (452),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 96/112 (86%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MAAS D W++EYNEAVK+ADDI  MISER SLP +G E QRH+SAIRRKIT LGTRLD L
Sbjct  1    MAASSDPWIKEYNEAVKIADDINGMISERISLPASGPETQRHASAIRRKITILGTRLDGL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
             SL+S+ PT +PLTEKE+NRRKDM+A LRSKANQMAS  NMSNFANRDSLLG
Sbjct  61   HSLMSR-PTGKPLTEKEMNRRKDMVANLRSKANQMASAFNMSNFANRDSLLG  111



>gb|KGN56069.1| hypothetical protein Csa_3G064180 [Cucumis sativus]
Length=230

 Score =   178 bits (452),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            M A  D W++EYNEA KL DDI  MISERSS P TG E+QRH+SAIRRKIT LGT++D L
Sbjct  1    MMAPSDLWIKEYNEASKLGDDINGMISERSSFPATGPESQRHASAIRRKITILGTKVDGL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL KLP KQPL+EKEINRRKDML  +RSK  QMASTLNMSNFANRDSLLG
Sbjct  61   QSLLLKLPVKQPLSEKEINRRKDMLVQMRSKVKQMASTLNMSNFANRDSLLG  112



>gb|KHN30881.1| Syntaxin-51 [Glycine soja]
Length=229

 Score =   178 bits (451),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 97/112 (87%), Gaps = 3/112 (3%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEAVKLADDIT MISERSS P +G E QRH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDSWMKEYNEAVKLADDITGMISERSSFPASGPETQRHASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSK+P K   TEKE+NRRKDML  LR+K NQMASTLNMSNFANRDSL G
Sbjct  61   QSLLSKVPAK---TEKEMNRRKDMLLNLRTKVNQMASTLNMSNFANRDSLFG  109



>gb|AFK34174.1| unknown [Lotus japonicus]
Length=233

 Score =   178 bits (451),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 101/113 (89%), Gaps = 1/113 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSWV+EYNEAVKLADDI+ MISERSS   +G EAQRHSSAIRRKIT LGTRLDSL
Sbjct  1    MASSSDSWVKEYNEAVKLADDISTMISERSSSVESGPEAQRHSSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPT-KQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP  KQP++EKE+NRRKDMLA+LRS+ N+MASTL+M NF+NRDSL G
Sbjct  61   QSLLSKLPAGKQPVSEKELNRRKDMLASLRSRVNEMASTLSMPNFSNRDSLFG  113



>gb|AFK40726.1| unknown [Lotus japonicus]
Length=233

 Score =   178 bits (451),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 101/113 (89%), Gaps = 1/113 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSWV+EYNEAVKLADDI+ MISERSS   +G EAQRHSSAIRRKIT LGTRLDSL
Sbjct  1    MASSSDSWVKEYNEAVKLADDISTMISERSSSVESGPEAQRHSSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPT-KQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP  KQP++EKE+NRRKDMLA+LRS+ N+MASTL+M NF+NRDSL G
Sbjct  61   QSLLSKLPAGKQPVSEKELNRRKDMLASLRSRVNEMASTLSMPNFSNRDSLFG  113



>ref|XP_010532045.1| PREDICTED: syntaxin-51-like isoform X2 [Tarenaya hassleriana]
Length=234

 Score =   177 bits (450),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 102/113 (90%), Gaps = 1/113 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPT-TGTEAQRHSSAIRRKITXLGTRLDS  383
            MA+S DSWVREYNEA+KL++DI  MISERSSL   +G EAQRH+SAIRRKIT LGTRLDS
Sbjct  1    MASSSDSWVREYNEALKLSEDINGMISERSSLAVVSGPEAQRHASAIRRKITILGTRLDS  60

Query  384  LESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            L+SLL+K+P KQP++EKE+NRRKDM++ LRSKA+QMAS LN+SNFANRDSLLG
Sbjct  61   LQSLLAKIPGKQPISEKEMNRRKDMISNLRSKASQMASALNVSNFANRDSLLG  113



>gb|AFK42434.1| unknown [Lotus japonicus]
Length=149

 Score =   175 bits (443),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 98/112 (88%), Gaps = 3/112 (3%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D+W++EYNEA+KLADDI +MISERSS P +G E QRH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDTWMKEYNEAMKLADDINSMISERSSFPASGPETQRHASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFANRDSLLG
Sbjct  61   QSLLSKLPVK---SEKEMNRRKDTLANLRSKVNQMASTLNMSNFANRDSLLG  109



>ref|XP_010532042.1| PREDICTED: syntaxin-51-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010532044.1| PREDICTED: syntaxin-51-like isoform X1 [Tarenaya hassleriana]
Length=235

 Score =   177 bits (450),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 102/113 (90%), Gaps = 1/113 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPT-TGTEAQRHSSAIRRKITXLGTRLDS  383
            MA+S DSWVREYNEA+KL++DI  MISERSSL   +G EAQRH+SAIRRKIT LGTRLDS
Sbjct  1    MASSSDSWVREYNEALKLSEDINGMISERSSLAVVSGPEAQRHASAIRRKITILGTRLDS  60

Query  384  LESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            L+SLL+K+P KQP++EKE+NRRKDM++ LRSKA+QMAS LN+SNFANRDSLLG
Sbjct  61   LQSLLAKIPGKQPISEKEMNRRKDMISNLRSKASQMASALNVSNFANRDSLLG  113



>gb|KHM99515.1| Syntaxin-51 [Glycine soja]
Length=234

 Score =   177 bits (450),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 97/112 (87%), Gaps = 3/112 (3%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            + AS DSW++EYNEAVKLADDI  MISERSS P +G E QRH+SAIRRKIT LGTRLDSL
Sbjct  6    LMASSDSWMKEYNEAVKLADDINGMISERSSFPASGPETQRHASAIRRKITILGTRLDSL  65

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSK+P K   TEKE+NRRKDMLA LR+K NQMASTLNMSNFANRDSLLG
Sbjct  66   QSLLSKVPAK---TEKEMNRRKDMLANLRTKVNQMASTLNMSNFANRDSLLG  114



>ref|XP_007020671.1| Syntaxin of plants 51 isoform 1 [Theobroma cacao]
 ref|XP_007020673.1| Syntaxin of plants 51 isoform 1 [Theobroma cacao]
 gb|EOY12196.1| Syntaxin of plants 51 isoform 1 [Theobroma cacao]
 gb|EOY12198.1| Syntaxin of plants 51 isoform 1 [Theobroma cacao]
Length=231

 Score =   177 bits (449),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 98/112 (88%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D WV+EYNEAVK+ADDI  MIS+RSSLP +G E QRH+SAIRRKIT LGTRLD L
Sbjct  1    MASSSDPWVKEYNEAVKIADDINGMISDRSSLPASGPETQRHASAIRRKITILGTRLDGL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLS+ PT +PLTEKE+NRRKDM+A LRSKANQMAS  NMSNFA+RDSLLG
Sbjct  61   QSLLSR-PTGRPLTEKEMNRRKDMVANLRSKANQMASAFNMSNFASRDSLLG  111



>ref|XP_003532151.1| PREDICTED: syntaxin-51-like isoform X1 [Glycine max]
 ref|XP_006586106.1| PREDICTED: syntaxin-51-like isoform X2 [Glycine max]
Length=228

 Score =   177 bits (448),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 96/110 (87%), Gaps = 3/110 (3%)
 Frame = +3

Query  213  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLES  392
            AS DSW++EYNEAVKLADDI  MISERSS P +G E QRH+SAIRRKIT LGTRLDSL+S
Sbjct  2    ASSDSWMKEYNEAVKLADDINGMISERSSFPASGPETQRHASAIRRKITILGTRLDSLQS  61

Query  393  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            LLSK+P K   TEKE+NRRKDMLA LR+K NQMASTLNMSNFANRDSLLG
Sbjct  62   LLSKVPAK---TEKEMNRRKDMLANLRTKVNQMASTLNMSNFANRDSLLG  108



>ref|XP_006344878.1| PREDICTED: syntaxin-52-like [Solanum tuberosum]
Length=238

 Score =   177 bits (448),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +3

Query  201  KAMAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLD  380
            + M A GDSW++EYNEA KLADDI  MISER+ LP TG EAQRHSS IRRKIT LG RLD
Sbjct  4    QGMVAFGDSWIQEYNEAGKLADDIIYMISERNLLPATGPEAQRHSSLIRRKITILGFRLD  63

Query  381  SLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
             L+S+ SKLP KQ LTEKE+NRRKDMLA L+SKA +MASTLNMSNFANRDSLLG
Sbjct  64   ILQSIDSKLPGKQHLTEKEMNRRKDMLANLKSKAAEMASTLNMSNFANRDSLLG  117



>ref|XP_008449105.1| PREDICTED: syntaxin-51-like [Cucumis melo]
 ref|XP_008449106.1| PREDICTED: syntaxin-51-like [Cucumis melo]
 ref|XP_008449108.1| PREDICTED: syntaxin-51-like [Cucumis melo]
 ref|XP_008449109.1| PREDICTED: syntaxin-51-like [Cucumis melo]
Length=231

 Score =   176 bits (447),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +3

Query  213  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLES  392
            A  D W++EYNEA KL DDI  MISERSS P TG E+QRH+SAIRRKIT LGT++D L+S
Sbjct  2    APSDLWIKEYNEASKLGDDINGMISERSSFPATGPESQRHASAIRRKITILGTKVDGLQS  61

Query  393  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            LLSKLP KQPL+EKEINRRKDML  +RS+  QMASTLNMSNFANRDSLLG
Sbjct  62   LLSKLPVKQPLSEKEINRRKDMLIQMRSEVKQMASTLNMSNFANRDSLLG  111



>gb|AHA84215.1| syntaxin-51 [Phaseolus vulgaris]
Length=359

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S +SW++EYNEA+KLADDI+ M+SE+SS P +G E QRHS+AIRRKIT L TRLDSL
Sbjct  128  MASSSNSWMKEYNEALKLADDISGMVSEQSSFPASGPEIQRHSTAIRRKITILCTRLDSL  187

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSK P KQP++EKE+NRRKDMLA+LRS+ NQMASTLNMSNF+NRDSLLG
Sbjct  188  QSLLSKFPGKQPISEKEMNRRKDMLASLRSRVNQMASTLNMSNFSNRDSLLG  239



>gb|ACJ84463.1| unknown [Medicago truncatula]
Length=194

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 98/112 (88%), Gaps = 3/112 (3%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSWV+EYNEA+KLADDI+ MISE +S P++G E QRH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDSWVKEYNEAMKLADDISGMISEHNSFPSSGPETQRHASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFANRDSLLG
Sbjct  61   QSLLSKLPVK---SEKEMNRRKDNLANLRSKVNQMASTLNMSNFANRDSLLG  109



>gb|AAZ32890.1| syntaxin of plants [Medicago sativa]
Length=133

 Score =   173 bits (438),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 98/112 (88%), Gaps = 3/112 (3%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEA+KLADDI+ MISE +S P++G E QRH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDSWLKEYNEAMKLADDISGMISEHNSFPSSGPETQRHASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFANRDSLLG
Sbjct  61   QSLLSKLPVK---SEKEMNRRKDNLANLRSKVNQMASTLNMSNFANRDSLLG  109



>gb|EPS71742.1| hypothetical protein M569_03017, partial [Genlisea aurea]
Length=245

 Score =   176 bits (446),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +3

Query  210  AASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLE  389
            A  GDSWVREYNEA+KLADDITNMI ERSS+P TG EAQRHSSAIRRKIT LGTRLDSL 
Sbjct  1    AVHGDSWVREYNEAIKLADDITNMIHERSSVPATGPEAQRHSSAIRRKITILGTRLDSLS  60

Query  390  SLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
             + ++ P  Q L+EKE+NRR+D+++ LRSK NQMA++LNMSNFANRDSLLG
Sbjct  61   QVSARSPGNQSLSEKELNRRRDLVSGLRSKVNQMAASLNMSNFANRDSLLG  111



>gb|AFK40910.1| unknown [Lotus japonicus]
Length=229

 Score =   175 bits (444),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 98/112 (88%), Gaps = 3/112 (3%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D+W++EYNEA+KLADDI +MISERSS P +G E QRH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDTWMKEYNEAMKLADDINSMISERSSFPASGPETQRHASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFANRDSLLG
Sbjct  61   QSLLSKLPVK---SEKEMNRRKDTLANLRSKVNQMASTLNMSNFANRDSLLG  109



>ref|XP_004500114.1| PREDICTED: syntaxin-52-like [Cicer arietinum]
Length=229

 Score =   175 bits (444),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 98/112 (88%), Gaps = 3/112 (3%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEA+KLADDI+ MISE +S PT+G E QRH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDSWMKEYNEAMKLADDISGMISEHTSFPTSGPETQRHASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFANRDSLLG
Sbjct  61   QSLLSKLPVK---SEKEMNRRKDNLANLRSKVNQMASTLNMSNFANRDSLLG  109



>gb|KEH18882.1| syntaxin of plants protein [Medicago truncatula]
Length=229

 Score =   175 bits (443),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 98/112 (88%), Gaps = 3/112 (3%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSWV+EYNEA+KLADDI+ MISE +S P++G E QRH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDSWVKEYNEAMKLADDISGMISEHNSFPSSGPETQRHASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFANRDSLLG
Sbjct  61   QSLLSKLPVK---SEKEMNRRKDNLANLRSKVNQMASTLNMSNFANRDSLLG  109



>gb|AFK34675.1| unknown [Medicago truncatula]
Length=229

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 98/112 (88%), Gaps = 3/112 (3%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEA+KLADDI+ MISE +S P++G E QRH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDSWLKEYNEAMKLADDISGMISEHNSFPSSGPETQRHASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFANRDSLLG
Sbjct  61   QSLLSKLPVK---SEKEMNRRKDNLANLRSKVNQMASTLNMSNFANRDSLLG  109



>ref|XP_003600182.1| Syntaxin-52 [Medicago truncatula]
Length=233

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 98/112 (88%), Gaps = 3/112 (3%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEA+KLADDI+ MISE +S P++G E QRH+SAIRRKIT LGTRLDSL
Sbjct  5    MASSSDSWLKEYNEAMKLADDISGMISEHNSFPSSGPETQRHASAIRRKITILGTRLDSL  64

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFANRDSLLG
Sbjct  65   QSLLSKLPVK---SEKEMNRRKDNLANLRSKVNQMASTLNMSNFANRDSLLG  113



>gb|AES70433.2| syntaxin of plants protein [Medicago truncatula]
Length=261

 Score =   173 bits (439),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 98/112 (88%), Gaps = 3/112 (3%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEA+KLADDI+ MISE +S P++G E QRH+SAIRRKIT LGTRLDSL
Sbjct  33   MASSSDSWLKEYNEAMKLADDISGMISEHNSFPSSGPETQRHASAIRRKITILGTRLDSL  92

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFANRDSLLG
Sbjct  93   QSLLSKLPVK---SEKEMNRRKDNLANLRSKVNQMASTLNMSNFANRDSLLG  141



>gb|AFK35227.1| unknown [Medicago truncatula]
Length=229

 Score =   172 bits (436),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 97/112 (87%), Gaps = 3/112 (3%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSWV+EYNEA+KLADDI+ MISE +S P++G E QRH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDSWVKEYNEAMKLADDISGMISEHNSFPSSGPETQRHASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP K   +EKE+NR KD LA LRSK NQMASTLNMSNFANRDSLLG
Sbjct  61   QSLLSKLPVK---SEKEMNRCKDNLANLRSKVNQMASTLNMSNFANRDSLLG  109



>gb|ABI84247.1| syntaxin [Arachis hypogaea]
Length=152

 Score =   169 bits (429),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 97/112 (87%), Gaps = 3/112 (3%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEAVKLADDI  MISERSSL T+G EAQRH+SAIRRKIT LG RLDSL
Sbjct  1    MASSSDSWMKEYNEAVKLADDINGMISERSSLSTSGPEAQRHASAIRRKITILGIRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSK+P K   +EKE+NRR++ L TLRSK NQMASTLNMSNFANRDSL G
Sbjct  61   QSLLSKVPGK---SEKEMNRRRETLTTLRSKVNQMASTLNMSNFANRDSLFG  109



>gb|KJB11950.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
Length=140

 Score =   169 bits (428),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  213  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLES  392
            AS D+W++EYNEA ++ADDI  MISER SLP +G E QRH+SAIRRKIT LGTRLD L+S
Sbjct  2    ASSDTWIKEYNEAARIADDINGMISERISLPASGPETQRHASAIRRKITILGTRLDGLQS  61

Query  393  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            LLS+ PT +PLT+KE+NRRKDM+A LRSKANQMAS  NMSNFANR+SLLG
Sbjct  62   LLSR-PTGKPLTDKEMNRRKDMVANLRSKANQMASAFNMSNFANRESLLG  110



>gb|KJB11948.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
Length=142

 Score =   169 bits (428),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  213  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLES  392
            AS D+W++EYNEA ++ADDI  MISER SLP +G E QRH+SAIRRKIT LGTRLD L+S
Sbjct  2    ASSDTWIKEYNEAARIADDINGMISERISLPASGPETQRHASAIRRKITILGTRLDGLQS  61

Query  393  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            LLS+ PT +PLT+KE+NRRKDM+A LRSKANQMAS  NMSNFANR+SLLG
Sbjct  62   LLSR-PTGKPLTDKEMNRRKDMVANLRSKANQMASAFNMSNFANRESLLG  110



>gb|KHG00459.1| Syntaxin-51 -like protein [Gossypium arboreum]
Length=237

 Score =   172 bits (436),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  213  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLES  392
            AS D+W++EYNEA ++ADDI  MISER SLP +G E QRH+SAIRRKIT LGTRLD L+S
Sbjct  2    ASSDTWIKEYNEAARIADDINGMISERISLPASGPETQRHASAIRRKITILGTRLDGLQS  61

Query  393  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            LLS+ PT +PLTEKE+NRRKDM+A LRSKANQMAS  NMSNFANR+SLLG
Sbjct  62   LLSR-PTGKPLTEKEMNRRKDMVANLRSKANQMASAFNMSNFANRESLLG  110



>gb|KJB11949.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
Length=149

 Score =   169 bits (428),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  213  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLES  392
            AS D+W++EYNEA ++ADDI  MISER SLP +G E QRH+SAIRRKIT LGTRLD L+S
Sbjct  2    ASSDTWIKEYNEAARIADDINGMISERISLPASGPETQRHASAIRRKITILGTRLDGLQS  61

Query  393  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            LLS+ PT +PLT+KE+NRRKDM+A LRSKANQMAS  NMSNFANR+SLLG
Sbjct  62   LLSR-PTGKPLTDKEMNRRKDMVANLRSKANQMASAFNMSNFANRESLLG  110



>ref|XP_010909005.1| PREDICTED: syntaxin-52-like [Elaeis guineensis]
Length=232

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW+RE NEA KLADDI+ MISER SLP +G + QRH+SAIRRKIT LGT+LDSL
Sbjct  1    MASSSDSWLRELNEASKLADDISAMISERGSLPPSGPDTQRHTSAIRRKITILGTKLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            ESLLSKLP+KQP+++KE+ +R+DML+ LRSKA QMASTLNMSNFANR+ LLG
Sbjct  61   ESLLSKLPSKQPISDKELLKRQDMLSNLRSKAKQMASTLNMSNFANREDLLG  112



>gb|KJB11947.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
Length=151

 Score =   169 bits (427),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  213  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLES  392
            AS D+W++EYNEA ++ADDI  MISER SLP +G E QRH+SAIRRKIT LGTRLD L+S
Sbjct  2    ASSDTWIKEYNEAARIADDINGMISERISLPASGPETQRHASAIRRKITILGTRLDGLQS  61

Query  393  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            LLS+ PT +PLT+KE+NRRKDM+A LRSKANQMAS  NMSNFANR+SLLG
Sbjct  62   LLSR-PTGKPLTDKEMNRRKDMVANLRSKANQMASAFNMSNFANRESLLG  110



>ref|XP_003617659.1| Syntaxin-51 [Medicago truncatula]
 gb|AET00618.1| syntaxin of plants protein [Medicago truncatula]
Length=167

 Score =   169 bits (428),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +3

Query  213  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLES  392
            AS D+WV+EYNEA KLA+DI++M+SE SS P +G EAQR SS+ R+KIT LGTRLDSL+S
Sbjct  2    ASSDAWVKEYNEATKLAEDISSMVSEWSSCPASGPEAQRQSSSTRKKITILGTRLDSLQS  61

Query  393  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            LLSKLP KQPL+EKE NRR DMLA LRSK NQMASTLNMSNFAN+D L+G
Sbjct  62   LLSKLPGKQPLSEKEENRRMDMLANLRSKVNQMASTLNMSNFANKDRLVG  111



>ref|XP_008787642.1| PREDICTED: syntaxin-52-like [Phoenix dactylifera]
Length=232

 Score =   170 bits (431),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW+RE NEA KLADDI+ MISER SLP +G + QRH+SAIRRKIT LGT+LDSL
Sbjct  1    MASSSDSWLRELNEASKLADDISAMISERGSLPPSGPDTQRHTSAIRRKITILGTKLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            ESLLSKLP+KQP++ KE+++R+DML+ LRSKA QMASTLNMSNFA R+ LLG
Sbjct  61   ESLLSKLPSKQPISNKELHKRRDMLSNLRSKAKQMASTLNMSNFAKREDLLG  112



>gb|KJB11954.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
Length=192

 Score =   169 bits (428),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  213  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLES  392
            AS D+W++EYNEA ++ADDI  MISER SLP +G E QRH+SAIRRKIT LGTRLD L+S
Sbjct  2    ASSDTWIKEYNEAARIADDINGMISERISLPASGPETQRHASAIRRKITILGTRLDGLQS  61

Query  393  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            LLS+ PT +PLT+KE+NRRKDM+A LRSKANQMAS  NMSNFANR+SLLG
Sbjct  62   LLSR-PTGKPLTDKEMNRRKDMVANLRSKANQMASAFNMSNFANRESLLG  110



>gb|KJB11946.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
 gb|KJB11951.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
 gb|KJB11952.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
 gb|KJB11953.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
Length=230

 Score =   170 bits (430),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  213  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLES  392
            AS D+W++EYNEA ++ADDI  MISER SLP +G E QRH+SAIRRKIT LGTRLD L+S
Sbjct  2    ASSDTWIKEYNEAARIADDINGMISERISLPASGPETQRHASAIRRKITILGTRLDGLQS  61

Query  393  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            LLS+ PT +PLT+KE+NRRKDM+A LRSKANQMAS  NMSNFANR+SLLG
Sbjct  62   LLSR-PTGKPLTDKEMNRRKDMVANLRSKANQMASAFNMSNFANRESLLG  110



>ref|XP_010675821.1| PREDICTED: syntaxin-52-like [Beta vulgaris subsp. vulgaris]
Length=234

 Score =   167 bits (422),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +3

Query  210  AASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLE  389
            + SGDSW++EYN+A KLADDI  MISE++++  +G ++QRH SA+RRKIT LGTRLDSLE
Sbjct  3    STSGDSWMKEYNDATKLADDINGMISEKTAMSGSGPDSQRHFSAVRRKITILGTRLDSLE  62

Query  390  SLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            SLLSK P+K+ +TEKE+N RKDML+ LR+K NQMA+TLNMSNFANRDSLLG
Sbjct  63   SLLSKPPSKKSITEKELNHRKDMLSNLRTKTNQMATTLNMSNFANRDSLLG  113



>ref|XP_007211870.1| hypothetical protein PRUPE_ppa010128mg [Prunus persica]
 gb|EMJ13069.1| hypothetical protein PRUPE_ppa010128mg [Prunus persica]
Length=232

 Score =   166 bits (421),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 97/112 (87%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEA KLADDI  MISERS+LP +G +AQR+ SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDSWMKEYNEATKLADDINGMISERSTLPASGPDAQRYVSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP KQP++EKE+NRRKDM+ TLRSK  QM++TL  S+ ANRDSLLG
Sbjct  61   QSLLSKLPGKQPISEKELNRRKDMIGTLRSKVLQMSTTLT-SHSANRDSLLG  111



>ref|XP_004151390.1| PREDICTED: syntaxin-51-like [Cucumis sativus]
 ref|XP_004156357.1| PREDICTED: syntaxin-51-like [Cucumis sativus]
 gb|KGN43995.1| hypothetical protein Csa_7G084710 [Cucumis sativus]
Length=233

 Score =   166 bits (420),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA + +SW +EYNEA+KL++DI  MISERSSL  +G EAQRH+SAIRRKIT LGTRLD+L
Sbjct  1    MAYTLESWTKEYNEALKLSEDINGMISERSSLAASGPEAQRHASAIRRKITILGTRLDTL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +S L KL  KQP+ EKE+NRR+DM+  LRSKA QMASTLNMSNFANRDSLLG
Sbjct  61   QSQLPKLQGKQPIPEKEMNRRRDMIGNLRSKAKQMASTLNMSNFANRDSLLG  112



>emb|CDX88551.1| BnaC06g39950D [Brassica napus]
Length=233

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D+W+REYNEA+KL++DI  M+SER+S   TG +AQR +SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDAWMREYNEALKLSEDINGMMSERNSSGVTGPDAQRRASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL K+P KQ ++EKE+NRRKDM+  LRSKANQ+AS LNMSNFANRDSLLG
Sbjct  61   QSLLVKVPGKQHVSEKEMNRRKDMVGNLRSKANQVASALNMSNFANRDSLLG  112



>ref|XP_006302763.1| hypothetical protein CARUB_v10020885mg [Capsella rubella]
 gb|EOA35661.1| hypothetical protein CARUB_v10020885mg [Capsella rubella]
Length=233

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D+WVREYNEA+KL++DI  M+SER++   TG +AQR +SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDAWVREYNEALKLSEDINGMMSERNAAGLTGPDAQRRASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL K+P KQ +++KE+NRRKDM+A LRSK NQ+ASTLNMSNFANRDSLLG
Sbjct  61   QSLLVKVPGKQNVSDKEMNRRKDMVANLRSKTNQVASTLNMSNFANRDSLLG  112



>gb|ABK23110.1| unknown [Picea sitchensis]
Length=233

 Score =   165 bits (417),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSWV+E+NEA KLADDI   + ERSSLP +G E QRH SAIRRKIT LGTRLDSL
Sbjct  1    MASSADSWVKEFNEASKLADDINARLGERSSLPPSGPETQRHLSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            E+LL KLP++QP++EKE++RR+DML  LRSK+NQMAS LNMS F NR  LLG
Sbjct  61   ENLLPKLPSRQPISEKELHRRQDMLVNLRSKSNQMASALNMSRFGNRSDLLG  112



>ref|XP_008447706.1| PREDICTED: syntaxin-51-like [Cucumis melo]
Length=233

 Score =   164 bits (415),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA + +SW +EYNEA+KL++DI  MISERSSL  +G EAQRH+SAIRRKIT LGTRLD+L
Sbjct  1    MAYTLESWTKEYNEALKLSEDINGMISERSSLAASGPEAQRHASAIRRKITILGTRLDTL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +S L KL  KQP+ EKE+NRR+DM+  LRSKA QMAS LNMSNFANRDSLLG
Sbjct  61   QSQLPKLQGKQPIPEKEMNRRRDMIGNLRSKAKQMASALNMSNFANRDSLLG  112



>ref|XP_002887794.1| hypothetical protein ARALYDRAFT_477131 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64053.1| hypothetical protein ARALYDRAFT_477131 [Arabidopsis lyrata subsp. 
lyrata]
Length=233

 Score =   164 bits (415),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW+REYNEA+KL++DI  M+SER++   TG +AQR +SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDSWIREYNEALKLSEDINGMMSERNASGLTGPDAQRRASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL K+P KQ ++EKE+NRRKDM+  LRSK NQ+AS LNMSNFANRDSLLG
Sbjct  61   QSLLVKIPGKQHVSEKEMNRRKDMVGNLRSKTNQVASALNMSNFANRDSLLG  112



>ref|XP_010940839.1| PREDICTED: syntaxin-52-like [Elaeis guineensis]
 ref|XP_010940848.1| PREDICTED: syntaxin-52-like [Elaeis guineensis]
 ref|XP_010940854.1| PREDICTED: syntaxin-52-like [Elaeis guineensis]
Length=233

 Score =   164 bits (415),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D W++E+NEA KLADDIT MISER SLP +G E QRH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSVDPWMKEFNEASKLADDITVMISERGSLPPSGPETQRHTSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            ESLLSK P+ QP  +KE+ +R+DM+A L+SKA QMASTLNMSNF+ R+ LLG
Sbjct  61   ESLLSKHPSTQPKMQKELQKRQDMVANLKSKAKQMASTLNMSNFSKREDLLG  112



>ref|XP_008227024.1| PREDICTED: syntaxin-52-like [Prunus mume]
Length=232

 Score =   164 bits (414),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEA KLADDI  MISER +LP +G + QR+ SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDSWMKEYNEATKLADDINGMISERITLPASGPDTQRYVSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP KQP++EKE+NRRKDM+ TLRSK  QM+STL  S+ ANRDSLLG
Sbjct  61   QSLLSKLPGKQPISEKELNRRKDMIGTLRSKVVQMSSTLT-SHSANRDSLLG  111



>ref|XP_006389870.1| hypothetical protein EUTSA_v10019084mg [Eutrema salsugineum]
 ref|XP_006389871.1| hypothetical protein EUTSA_v10019084mg [Eutrema salsugineum]
 gb|ESQ27156.1| hypothetical protein EUTSA_v10019084mg [Eutrema salsugineum]
 gb|ESQ27157.1| hypothetical protein EUTSA_v10019084mg [Eutrema salsugineum]
Length=233

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D+W+REYNEA+KL++DI  M+SER+S   TG +AQR +SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDAWIREYNEALKLSEDINAMMSERNSSALTGPDAQRRASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL KLP KQ ++EKE+NRRKDM+  LR KANQ+AS LNMSNFANRDSL G
Sbjct  61   QSLLVKLPGKQHVSEKEMNRRKDMVGNLRIKANQVASALNMSNFANRDSLFG  112



>ref|XP_009106789.1| PREDICTED: syntaxin-52-like [Brassica rapa]
Length=232

 Score =   162 bits (410),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +3

Query  213  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLES  392
            AS D+W+REYNEA+KL++DI  M+SER+S   TG +AQR +SAIRRKIT LGTRLDSL+S
Sbjct  2    ASSDAWMREYNEALKLSEDINGMMSERNSSGVTGPDAQRRASAIRRKITILGTRLDSLQS  61

Query  393  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            LL K+P KQ ++EKE+NRRKDM+ +LRSKAN++AS LNMSNFANRDSLLG
Sbjct  62   LLVKVPGKQHVSEKEMNRRKDMVGSLRSKANKVASALNMSNFANRDSLLG  111



>emb|CDY68585.1| BnaAnng27700D [Brassica napus]
Length=236

 Score =   162 bits (410),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +3

Query  204  AMAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDS  383
            A ++S D+W+REYNEA+KL++DI  M+SER+S   TG +AQR +SAIRRKIT LGTRLDS
Sbjct  2    ASSSSSDTWMREYNEALKLSEDINGMMSERNSSALTGPDAQRRASAIRRKITILGTRLDS  61

Query  384  LESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            L+SLL K+P KQ ++EKE+NRRKDM+  LRSKANQ+AS LNMSNFANRDSLLG
Sbjct  62   LQSLLVKVPGKQHVSEKEMNRRKDMVGNLRSKANQVASALNMSNFANRDSLLG  114



>ref|XP_009117773.1| PREDICTED: syntaxin-51-like [Brassica rapa]
Length=233

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 95/111 (86%), Gaps = 1/111 (1%)
 Frame = +3

Query  210  AASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLE  389
            ++S DSW+REYNEA+KLA+DI  MISERS    TG +AQR +SAIRRKIT  GTRLDSL+
Sbjct  3    SSSSDSWMREYNEALKLAEDINGMISERSKSALTGPDAQRRASAIRRKITIFGTRLDSLQ  62

Query  390  SLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            SLLSK+  K P++EKE+NRRKDM+  LRS+ANQMA+TLNMSNFANRDSLLG
Sbjct  63   SLLSKIHGK-PISEKEMNRRKDMIGNLRSQANQMANTLNMSNFANRDSLLG  112



>ref|XP_009128371.1| PREDICTED: syntaxin-52 isoform X1 [Brassica rapa]
 ref|XP_009128374.1| PREDICTED: syntaxin-52 isoform X3 [Brassica rapa]
Length=236

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +3

Query  210  AASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLE  389
            ++S D+W+REYNEA+KL++DI  M+SER+S   TG +AQR +SAIRRKIT LGTRLDSL+
Sbjct  5    SSSSDTWMREYNEALKLSEDINGMMSERNSSGLTGPDAQRRASAIRRKITILGTRLDSLQ  64

Query  390  SLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            SLL K+P KQ ++EKE+NRRKDM+  LRSKANQ+AS LNMSNFANRDSLLG
Sbjct  65   SLLVKVPGKQHVSEKEMNRRKDMVGNLRSKANQVASALNMSNFANRDSLLG  115



>emb|CDY52847.1| BnaA09g56390D [Brassica napus]
Length=233

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 95/111 (86%), Gaps = 1/111 (1%)
 Frame = +3

Query  210  AASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLE  389
            ++S DSW+REYNEA+KLA+DI  MISERS    TG +AQR +SAIRRKIT  GTRLDSL+
Sbjct  3    SSSSDSWMREYNEALKLAEDINGMISERSKSALTGPDAQRRASAIRRKITIFGTRLDSLQ  62

Query  390  SLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            SLLSK+  K P++EKE+NRRKDM+  LRS+ANQMA+TLNMSNFANRDSLLG
Sbjct  63   SLLSKIHGK-PISEKEMNRRKDMIGNLRSQANQMANTLNMSNFANRDSLLG  112



>ref|XP_009128372.1| PREDICTED: syntaxin-52 isoform X2 [Brassica rapa]
 ref|XP_009128373.1| PREDICTED: syntaxin-52 isoform X2 [Brassica rapa]
 emb|CDY49743.1| BnaA02g19290D [Brassica napus]
Length=234

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +3

Query  210  AASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLE  389
            ++S D+W+REYNEA+KL++DI  M+SER+S   TG +AQR +SAIRRKIT LGTRLDSL+
Sbjct  3    SSSSDTWMREYNEALKLSEDINGMMSERNSSGLTGPDAQRRASAIRRKITILGTRLDSLQ  62

Query  390  SLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            SLL K+P KQ ++EKE+NRRKDM+  LRSKANQ+AS LNMSNFANRDSLLG
Sbjct  63   SLLVKVPGKQHVSEKEMNRRKDMVGNLRSKANQVASALNMSNFANRDSLLG  113



>ref|XP_006304162.1| hypothetical protein CARUB_v10010186mg [Capsella rubella]
 ref|XP_006304163.1| hypothetical protein CARUB_v10010186mg [Capsella rubella]
 gb|EOA37060.1| hypothetical protein CARUB_v10010186mg [Capsella rubella]
 gb|EOA37061.1| hypothetical protein CARUB_v10010186mg [Capsella rubella]
Length=232

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW+REYNEA+KL++DI  MISE SS   TG +AQRH+S IRRKIT  GTRLDSL
Sbjct  1    MASSSDSWMREYNEALKLSEDINGMISEISSSAATGPDAQRHASLIRRKITMFGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +S+L+K+  K P++EKE+NRRKDM+  LRSKANQMA+ LNMSNFANRDSLLG
Sbjct  61   QSILAKIHGK-PISEKEMNRRKDMVGNLRSKANQMATALNMSNFANRDSLLG  111



>emb|CDY33349.1| BnaC05g12340D [Brassica napus]
Length=232

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 94/112 (84%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW+REYNEA+KLA+DI  MISER+    TG +AQR +SAIRRKIT  GTRL+SL
Sbjct  1    MASSSDSWMREYNEALKLAEDINGMISERNKSSLTGPDAQRRASAIRRKITIFGTRLESL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
             SLLSK+  K P++EKE+NRRKDM+  LRS+ANQMAS LNMSNFANRDSLLG
Sbjct  61   HSLLSKIHGK-PISEKEMNRRKDMIGNLRSQANQMASVLNMSNFANRDSLLG  111



>gb|AAM64357.1| unknown [Arabidopsis thaliana]
Length=233

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D W+REYNEA+KL++DI  M+SER++   TG +AQR +SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDPWIREYNEALKLSEDINGMMSERNASGLTGPDAQRRASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL K+P KQ ++EKE+NRRKDM+  LRSK NQ+AS LNMSNFANRDSL G
Sbjct  61   QSLLVKVPGKQHVSEKEMNRRKDMVGNLRSKTNQVASALNMSNFANRDSLFG  112



>ref|XP_009149057.1| PREDICTED: syntaxin-51 [Brassica rapa]
 emb|CDY35073.1| BnaA06g10830D [Brassica napus]
Length=232

 Score =   160 bits (405),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW+REYNEA+KLA+DI  MISER+    TG +AQR +SAIRRKIT  GTRL+SL
Sbjct  1    MASSSDSWMREYNEALKLAEDINGMISERNKSSLTGPDAQRRASAIRRKITIFGTRLESL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL+K+  K P++EKE+NRRKDM+  LRS+ANQMAS LNMSNFANRDSLLG
Sbjct  61   QSLLAKIHGK-PISEKEMNRRKDMIGNLRSQANQMASALNMSNFANRDSLLG  111



>ref|XP_010472824.1| PREDICTED: syntaxin-52 [Camelina sativa]
Length=233

 Score =   160 bits (405),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D+W+REYNEA+KL++DI  M+SER++   TG +AQR +SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDAWMREYNEALKLSEDINGMMSERNASGLTGPDAQRRASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL K+P KQ +++KE+NRRKDM+  LRSK NQ+AS LNMSNFANRDSLLG
Sbjct  61   QSLLVKVPGKQNVSDKEMNRRKDMVGNLRSKTNQVASALNMSNFANRDSLLG  112



>ref|XP_002892898.1| hypothetical protein ARALYDRAFT_471821 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69157.1| hypothetical protein ARALYDRAFT_471821 [Arabidopsis lyrata subsp. 
lyrata]
Length=228

 Score =   160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 96/112 (86%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW+REYN+A+KL+++I  MISERSS   TG +AQR +SAIRRKIT  GTRLDSL
Sbjct  1    MASSSDSWMREYNDALKLSEEINGMISERSSSAVTGPDAQRRASAIRRKITIFGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL+K+  K P++EKE+NRRKDM+  LRSKANQMA+ LNMSNFANRDSLLG
Sbjct  61   QSLLAKIHGK-PISEKEMNRRKDMVGNLRSKANQMANALNMSNFANRDSLLG  111



>ref|XP_008784838.1| PREDICTED: syntaxin-52-like [Phoenix dactylifera]
 ref|XP_008784839.1| PREDICTED: syntaxin-52-like [Phoenix dactylifera]
 ref|XP_008784840.1| PREDICTED: syntaxin-52-like [Phoenix dactylifera]
 ref|XP_008784841.1| PREDICTED: syntaxin-52-like [Phoenix dactylifera]
Length=233

 Score =   160 bits (404),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D W++E+NEA KLADDIT MISE  SLP +G E QRH+SAIRRKIT LGTRLD+L
Sbjct  1    MASSVDPWIKEFNEASKLADDITVMISESGSLPPSGPETQRHTSAIRRKITILGTRLDTL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            ESLLSK P+ QP  +KE+ +R+DM+A L+SKANQMAS LNMS+F+ R+ LLG
Sbjct  61   ESLLSKHPSTQPKMQKELQKRQDMVANLKSKANQMASALNMSSFSKREDLLG  112



>ref|XP_008775700.1| PREDICTED: syntaxin-52-like isoform X2 [Phoenix dactylifera]
Length=222

 Score =   159 bits (403),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW+ E NEA +LA+DI+ MISER SLP +G + Q H+S+IRRKIT LGTRLDSL
Sbjct  1    MASSSDSWLWELNEASRLANDISAMISERGSLPPSGPDIQHHTSSIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            ESLLSKLP+KQP+++KE+++ +DML+ LRSKA QMASTLNMS+FANR+ LLG
Sbjct  61   ESLLSKLPSKQPISDKELHKCQDMLSNLRSKAKQMASTLNMSSFANREDLLG  112



>ref|XP_008345031.1| PREDICTED: syntaxin-52-like isoform X3 [Malus domestica]
 ref|XP_008355319.1| PREDICTED: syntaxin-52-like isoform X2 [Malus domestica]
Length=231

 Score =   159 bits (403),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 93/112 (83%), Gaps = 2/112 (2%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW+REYNEA KLADDI+ MISE S+LP  G + QRH SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDSWIREYNEATKLADDISGMISELSTLPA-GPDTQRHVSAIRRKITILGTRLDSL  59

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP KQ ++EKE+NRRKDM+  LRSK  QMASTL  SN +NRDSLLG
Sbjct  60   QSLLSKLPGKQHISEKEMNRRKDMIGNLRSKVKQMASTLT-SNSSNRDSLLG  110



>ref|XP_008775698.1| PREDICTED: syntaxin-52-like isoform X1 [Phoenix dactylifera]
 ref|XP_008775699.1| PREDICTED: syntaxin-52-like isoform X1 [Phoenix dactylifera]
Length=232

 Score =   159 bits (403),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW+ E NEA +LA+DI+ MISER SLP +G + Q H+S+IRRKIT LGTRLDSL
Sbjct  1    MASSSDSWLWELNEASRLANDISAMISERGSLPPSGPDIQHHTSSIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            ESLLSKLP+KQP+++KE+++ +DML+ LRSKA QMASTLNMS+FANR+ LLG
Sbjct  61   ESLLSKLPSKQPISDKELHKCQDMLSNLRSKAKQMASTLNMSSFANREDLLG  112



>emb|CDX81754.1| BnaC08g38470D [Brassica napus]
Length=233

 Score =   159 bits (403),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 96/113 (85%), Gaps = 2/113 (2%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNM-ISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDS  383
            MA+S DSW+REYNEA+KLA+DI  M ISERS    TG +AQR +SAIRRKIT  GTRLDS
Sbjct  1    MASSSDSWMREYNEALKLAEDINGMMISERSKSAVTGPDAQRRASAIRRKITIFGTRLDS  60

Query  384  LESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            L+SLL+K+  K P++EKE+NRRKDM+  LRS+ANQMA+TLNMSNFANRDSLLG
Sbjct  61   LQSLLAKIHGK-PISEKEMNRRKDMIGNLRSQANQMANTLNMSNFANRDSLLG  112



>ref|NP_565213.1| syntaxin-52 [Arabidopsis thaliana]
 ref|NP_001031301.1| syntaxin-52 [Arabidopsis thaliana]
 sp|Q94KK7.1|SYP52_ARATH RecName: Full=Syntaxin-52; Short=AtSYP52 [Arabidopsis thaliana]
 gb|AAK40224.1|AF355756_1 syntaxin of plants 52 [Arabidopsis thaliana]
 gb|AAO41986.1| unknown protein [Arabidopsis thaliana]
 gb|AAP04091.1| unknown protein [Arabidopsis thaliana]
 gb|AEE36269.1| syntaxin-52 [Arabidopsis thaliana]
 gb|AEE36270.1| syntaxin-52 [Arabidopsis thaliana]
Length=233

 Score =   159 bits (403),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D W+REYNEA+KL++DI  M+SER++   TG +AQR +SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDPWMREYNEALKLSEDINGMMSERNASGLTGPDAQRRASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL K+P KQ ++EKE+NRRKDM+  LRSK NQ+AS LNMSNFANRDSL G
Sbjct  61   QSLLVKVPGKQHVSEKEMNRRKDMVGNLRSKTNQVASALNMSNFANRDSLFG  112



>ref|XP_008345029.1| PREDICTED: syntaxin-52-like isoform X1 [Malus domestica]
 ref|XP_008345030.1| PREDICTED: syntaxin-52-like isoform X2 [Malus domestica]
 ref|XP_008355318.1| PREDICTED: syntaxin-52-like isoform X1 [Malus domestica]
Length=240

 Score =   160 bits (404),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 93/112 (83%), Gaps = 2/112 (2%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW+REYNEA KLADDI+ MISE S+LP  G + QRH SAIRRKIT LGTRLDSL
Sbjct  10   MASSSDSWIREYNEATKLADDISGMISELSTLPA-GPDTQRHVSAIRRKITILGTRLDSL  68

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP KQ ++EKE+NRRKDM+  LRSK  QMASTL  SN +NRDSLLG
Sbjct  69   QSLLSKLPGKQHISEKEMNRRKDMIGNLRSKVKQMASTLT-SNSSNRDSLLG  119



>gb|AAF68106.1|AC010793_1 F20B17.2 [Arabidopsis thaliana]
Length=260

 Score =   160 bits (404),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D W+REYNEA+KL++DI  M+SER++   TG +AQR +SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDPWMREYNEALKLSEDINGMMSERNASGLTGPDAQRRASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL K+P KQ ++EKE+NRRKDM+  LRSK NQ+AS LNMSNFANRDSL G
Sbjct  61   QSLLVKVPGKQHVSEKEMNRRKDMVGNLRSKTNQVASALNMSNFANRDSLFG  112



>ref|XP_010429855.1| PREDICTED: syntaxin-52-like [Camelina sativa]
Length=233

 Score =   159 bits (401),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D+W+R+YNEA+KL++DI  M+SER++   TG +AQR +SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDAWMRDYNEALKLSEDINGMMSERNASGLTGPDAQRRASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL K+P KQ +++KE+NRRKDM+  LRSK NQ+AS LNMSNFANRDSLLG
Sbjct  61   QSLLVKVPGKQNVSDKEMNRRKDMVGNLRSKTNQVASALNMSNFANRDSLLG  112



>ref|XP_009361063.1| PREDICTED: syntaxin-52-like isoform X1 [Pyrus x bretschneideri]
Length=240

 Score =   159 bits (401),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 93/112 (83%), Gaps = 2/112 (2%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEA KLADDI+ MISE S+LP  G + QRH SAIRRKIT LGTRLDSL
Sbjct  10   MASSSDSWIKEYNEATKLADDISGMISELSTLPA-GPDTQRHVSAIRRKITILGTRLDSL  68

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP KQ ++EKE+NRRKDM+  LRSK  QMASTL  SN +NRDSLLG
Sbjct  69   QSLLSKLPGKQHISEKEMNRRKDMIGNLRSKVKQMASTLT-SNSSNRDSLLG  119



>ref|XP_009361064.1| PREDICTED: syntaxin-52-like isoform X2 [Pyrus x bretschneideri]
Length=231

 Score =   159 bits (401),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 93/112 (83%), Gaps = 2/112 (2%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEA KLADDI+ MISE S+LP  G + QRH SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDSWIKEYNEATKLADDISGMISELSTLPA-GPDTQRHVSAIRRKITILGTRLDSL  59

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP KQ ++EKE+NRRKDM+  LRSK  QMASTL  SN +NRDSLLG
Sbjct  60   QSLLSKLPGKQHISEKEMNRRKDMIGNLRSKVKQMASTLT-SNSSNRDSLLG  110



>ref|XP_011461087.1| PREDICTED: syntaxin-52-like [Fragaria vesca subsp. vesca]
Length=232

 Score =   158 bits (400),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 93/112 (83%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEAVKL+DDI+ MISERSS P +G E QRH SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDSWMKEYNEAVKLSDDISGMISERSSFPASGPETQRHVSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +S LS LP KQ +T KE+NRRKDM+A L+SK +QM+STL  S+  NRDSLLG
Sbjct  61   QSELSTLPGKQHITAKEMNRRKDMIANLKSKVSQMSSTLT-SHSGNRDSLLG  111



>ref|XP_004249335.1| PREDICTED: syntaxin-51 [Solanum lycopersicum]
Length=231

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW+RE+NEA KLAD++++MIS +SSLP++G E+QRH SA RRKIT L TRLD+L
Sbjct  1    MASSADSWMREFNEASKLADEVSSMISAKSSLPSSGPESQRHLSAARRKITILRTRLDTL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL  LP+KQPL++KE+ RR DML  + +KANQMASTLNM+N ANRDSLLG
Sbjct  61   QSLLQTLPSKQPLSKKEMKRRHDMLDNMITKANQMASTLNMNNLANRDSLLG  112



>emb|CDX87371.1| BnaA07g35020D [Brassica napus]
Length=526

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D+W+REYNEA+KL++DI  M+SER+S   TG +AQR +SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDAWMREYNEALKLSEDINGMMSERNSSGVTGPDAQRRASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL K+P KQ ++EKE+NRRKDM+  LRSKANQ+AS LNMSNFANRDSLLG
Sbjct  61   QSLLVKVPGKQHVSEKEMNRRKDMVGNLRSKANQVASALNMSNFANRDSLLG  112



>ref|XP_009606725.1| PREDICTED: syntaxin-52-like [Nicotiana tomentosiformis]
 ref|XP_009606726.1| PREDICTED: syntaxin-52-like [Nicotiana tomentosiformis]
Length=231

 Score =   157 bits (397),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW+RE+NEA KLAD+I +MIS R+SLP++G E QRH SA RRKIT L TRLD+L
Sbjct  1    MASSADSWMREFNEASKLADEIGSMISARNSLPSSGPETQRHLSAARRKITILKTRLDTL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL  LP+KQPLT+KE+ RR DML  + +KANQMA+TLNM+N ANRDSLLG
Sbjct  61   QSLLPTLPSKQPLTKKEMKRRHDMLDNMITKANQMATTLNMNNLANRDSLLG  112



>ref|XP_010417628.1| PREDICTED: syntaxin-52-like [Camelina sativa]
Length=233

 Score =   157 bits (396),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D+W+R+YNEA+KL+DDI  M+SER++   TG +AQR +SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDAWMRDYNEALKLSDDIHGMMSERNASGLTGPDAQRRASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL K+P K  +++KE+NRRKDM+  LRSK NQ+AS LNMSNFANRDSLLG
Sbjct  61   QSLLVKVPGKLNVSDKEMNRRKDMVGNLRSKTNQVASALNMSNFANRDSLLG  112



>ref|XP_009773941.1| PREDICTED: syntaxin-52-like [Nicotiana sylvestris]
Length=231

 Score =   156 bits (395),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW+RE+NEA KLAD++ +MIS R+SLP++G E QRH SA RRKIT L TRLD+L
Sbjct  1    MASSADSWMREFNEASKLADEVGSMISARNSLPSSGPETQRHLSAARRKITILKTRLDTL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL  LP+KQPLT+KE+ RR DML  + +KANQMA+TLNM+N ANRDSLLG
Sbjct  61   QSLLPTLPSKQPLTKKEMKRRHDMLDNMITKANQMATTLNMNNLANRDSLLG  112



>gb|KCW66898.1| hypothetical protein EUGRSUZ_F00647 [Eucalyptus grandis]
Length=175

 Score =   154 bits (390),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 98/112 (88%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+SGDSW++EYN+AVKLA++I++MI+ER ++PT+G E+ RH+SA+RRKIT L TRLDSL
Sbjct  1    MASSGDSWIKEYNDAVKLAEEISSMIAERGTMPTSGPESMRHASAVRRKITILNTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +++L+K P  +P+TEKEINRRKD+L+ LR++ NQM STL MS+ A RDSLLG
Sbjct  61   QNILTK-PFSRPITEKEINRRKDLLSNLRTRVNQMDSTLKMSHSATRDSLLG  111



>ref|XP_007211871.1| hypothetical protein PRUPE_ppa010128mg [Prunus persica]
 gb|EMJ13070.1| hypothetical protein PRUPE_ppa010128mg [Prunus persica]
Length=262

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  228  WVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLESLLSKL  407
            W++EYNEA KLADDI  MISERS+LP +G +AQR+ SAIRRKIT LGTRLDSL+SLLSKL
Sbjct  38   WMKEYNEATKLADDINGMISERSTLPASGPDAQRYVSAIRRKITILGTRLDSLQSLLSKL  97

Query  408  PTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            P KQP++EKE+NRRKDM+ TLRSK  QM++TL  S+ ANRDSLLG
Sbjct  98   PGKQPISEKELNRRKDMIGTLRSKVLQMSTTLT-SHSANRDSLLG  141



>gb|AFW61957.1| hypothetical protein ZEAMMB73_963395 [Zea mays]
Length=192

 Score =   155 bits (391),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 104/139 (75%), Gaps = 6/139 (4%)
 Frame = +3

Query  141  PTRLSHLSN*VSFPPPI-----PIQKAMAASGDSWVREYNEAVKLADDITNMISERSSLP  305
            P R    S  V F  P+     P   AMA+S D W++EYNEA +LADDI++MI++R SLP
Sbjct  18   PKRGGGDSAEVRFRTPVLRFARPDLPAMASSSDPWMKEYNEASRLADDISSMIADRGSLP  77

Query  306  TTGTEAQRHSSAIRRKITXLGTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKAN  485
             +G E  RH+SAIRRKIT LGTRLDSLESLL ++P K  +T+KE+++R+DM ++L+SKA 
Sbjct  78   QSGPEIMRHTSAIRRKITILGTRLDSLESLLGRIPPKS-ITDKEMHKRQDMFSSLKSKAK  136

Query  486  QMASTLNMSNFANRDSLLG  542
            QMA++ NMSNFANR+ LLG
Sbjct  137  QMATSFNMSNFANREDLLG  155



>ref|XP_006339244.1| PREDICTED: syntaxin-51-like [Solanum tuberosum]
Length=231

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW+RE+NEA KLAD++++MIS +SSLP++G E+QRH SA RRKIT L TRLD+L
Sbjct  1    MASSADSWMREFNEASKLADEVSSMISAKSSLPSSGPESQRHLSAARRKITILKTRLDTL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL  LP+KQPL++KE+ RR DML  + +KANQ+A+TLNM+N ANRDSLLG
Sbjct  61   QSLLQTLPSKQPLSKKEMKRRHDMLDNMITKANQLATTLNMNNLANRDSLLG  112



>ref|XP_010060271.1| PREDICTED: syntaxin-51-like isoform X2 [Eucalyptus grandis]
Length=232

 Score =   155 bits (393),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 98/112 (88%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+SGDSW++EYN+AVKLA++I++MI+ER ++PT+G E+ RH+SA+RRKIT L TRLDSL
Sbjct  1    MASSGDSWIKEYNDAVKLAEEISSMIAERGTMPTSGPESMRHASAVRRKITILNTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +++L+K P  +P+TEKEINRRKD+L+ LR++ NQM STL MS+ A RDSLLG
Sbjct  61   QNILTK-PFSRPITEKEINRRKDLLSNLRTRVNQMDSTLKMSHSATRDSLLG  111



>gb|KCW66897.1| hypothetical protein EUGRSUZ_F00647 [Eucalyptus grandis]
Length=200

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 98/112 (88%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+SGDSW++EYN+AVKLA++I++MI+ER ++PT+G E+ RH+SA+RRKIT L TRLDSL
Sbjct  1    MASSGDSWIKEYNDAVKLAEEISSMIAERGTMPTSGPESMRHASAVRRKITILNTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +++L+K P  +P+TEKEINRRKD+L+ LR++ NQM STL MS+ A RDSLLG
Sbjct  61   QNILTK-PFSRPITEKEINRRKDLLSNLRTRVNQMDSTLKMSHSATRDSLLG  111



>gb|KCW66896.1| hypothetical protein EUGRSUZ_F00647 [Eucalyptus grandis]
Length=234

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 98/112 (88%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+SGDSW++EYN+AVKLA++I++MI+ER ++PT+G E+ RH+SA+RRKIT L TRLDSL
Sbjct  3    MASSGDSWIKEYNDAVKLAEEISSMIAERGTMPTSGPESMRHASAVRRKITILNTRLDSL  62

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +++L+K P  +P+TEKEINRRKD+L+ LR++ NQM STL MS+ A RDSLLG
Sbjct  63   QNILTK-PFSRPITEKEINRRKDLLSNLRTRVNQMDSTLKMSHSATRDSLLG  113



>gb|ACF80713.1| unknown [Zea mays]
Length=148

 Score =   152 bits (385),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D W++EYNEA +LADDI++MI++R SLP +G E  RH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDPWMKEYNEASRLADDISSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            ESL  ++P K  +T+KE+++R+DML++L+SKA QMA++ NMSNFANR+ LLG
Sbjct  61   ESLFGRIPPKS-ITDKEMHKRQDMLSSLKSKAKQMATSFNMSNFANREDLLG  111



>ref|XP_004976388.1| PREDICTED: syntaxin-52-like [Setaria italica]
Length=231

 Score =   155 bits (391),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 96/112 (86%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D WV+EYNEA +LADDI++MI++R SLP +G E  RH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDPWVKEYNEASRLADDISSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            ESLL+++P K  +T+KE+++R+DML+ L+SKA QMA++ NMSNFANR+ LLG
Sbjct  61   ESLLTRIPPK-SITDKEMHKRQDMLSNLKSKAKQMATSFNMSNFANREDLLG  111



>ref|XP_006416838.1| hypothetical protein EUTSA_v10008662mg [Eutrema salsugineum]
 ref|XP_006416839.1| hypothetical protein EUTSA_v10008662mg [Eutrema salsugineum]
 gb|ESQ35191.1| hypothetical protein EUTSA_v10008662mg [Eutrema salsugineum]
 gb|ESQ35192.1| hypothetical protein EUTSA_v10008662mg [Eutrema salsugineum]
Length=232

 Score =   154 bits (390),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 93/112 (83%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW+REYNEA+KL++DI  MISERS    TG +AQR +SAIRRKIT   TRL+SL
Sbjct  1    MASSSDSWMREYNEALKLSEDINGMISERSKSAVTGPDAQRRASAIRRKITIFSTRLESL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL+KL  K P++EKE+NRRKDM+  LRS+ANQMA+ LNMSN ANRDSLLG
Sbjct  61   QSLLAKLHGK-PISEKEMNRRKDMIGNLRSQANQMANALNMSNLANRDSLLG  111



>ref|XP_010060270.1| PREDICTED: syntaxin-51-like isoform X1 [Eucalyptus grandis]
Length=242

 Score =   155 bits (391),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 98/112 (88%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+SGDSW++EYN+AVKLA++I++MI+ER ++PT+G E+ RH+SA+RRKIT L TRLDSL
Sbjct  11   MASSGDSWIKEYNDAVKLAEEISSMIAERGTMPTSGPESMRHASAVRRKITILNTRLDSL  70

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +++L+K P  +P+TEKEINRRKD+L+ LR++ NQM STL MS+ A RDSLLG
Sbjct  71   QNILTK-PFSRPITEKEINRRKDLLSNLRTRVNQMDSTLKMSHSATRDSLLG  121



>gb|AFW61961.1| hypothetical protein ZEAMMB73_963395 [Zea mays]
Length=177

 Score =   153 bits (386),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D W++EYNEA +LADDI++MI++R SLP +G E  RH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDPWMKEYNEASRLADDISSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            ESLL ++P K  +T+KE+++R+DM ++L+SKA QMA++ NMSNFANR+ LLG
Sbjct  61   ESLLGRIPPKS-ITDKEMHKRQDMFSSLKSKAKQMATSFNMSNFANREDLLG  111



>gb|ACN36591.1| unknown [Zea mays]
Length=177

 Score =   152 bits (385),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D W++EYNEA +LADDI++MI++R SLP +G E  RH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDPWMKEYNEASRLADDISSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            ESL  ++P K  +T+KE+++R+DML++L+SKA QMA++ NMSNFANR+ LLG
Sbjct  61   ESLFGRIPPKS-ITDKEMHKRQDMLSSLKSKAKQMATSFNMSNFANREDLLG  111



>gb|EAY84230.1| hypothetical protein OsI_05611 [Oryza sativa Indica Group]
Length=232

 Score =   154 bits (389),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 96/112 (86%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D WVREY+EA +LADD+T+MI++R SLP +G E  RH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDPWVREYSEASRLADDVTSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            E+LLS++P K  +T+KE+++R+DML+ L+S+A QMA++ NMSNFANR+ LLG
Sbjct  61   EALLSRIPPK-SITDKELHKRQDMLSNLKSRAKQMATSFNMSNFANREDLLG  111



>ref|NP_563994.1| syntaxin-51 [Arabidopsis thaliana]
 ref|NP_001031054.1| syntaxin-51 [Arabidopsis thaliana]
 sp|Q9SA23.1|SYP51_ARATH RecName: Full=Syntaxin-51; Short=AtSYP51 [Arabidopsis thaliana]
 gb|AAD34675.1|AC006341_3 ESTs gb|F15498, gb|H37515, gb|T41906, gb|T22448, gb|W43356 and 
gb|T20739 come from this gene [Arabidopsis thaliana]
 gb|AAK40223.1|AF355755_1 syntaxin of plants 51 [Arabidopsis thaliana]
 gb|AAL75885.1| At1g16240/F3O9_4 [Arabidopsis thaliana]
 gb|AAM19898.1| At1g16240/F3O9_4 [Arabidopsis thaliana]
 gb|AAM62551.1| unknown [Arabidopsis thaliana]
 dbj|BAH20194.1| AT1G16240 [Arabidopsis thaliana]
 gb|AEE29423.1| syntaxin-51 [Arabidopsis thaliana]
 gb|AEE29424.1| syntaxin-51 [Arabidopsis thaliana]
Length=232

 Score =   154 bits (389),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 94/112 (84%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW+R YNEA+KL+++I  MISERSS   TG +AQR +SAIRRKIT  G +LDSL
Sbjct  1    MASSSDSWMRAYNEALKLSEEINGMISERSSSAVTGPDAQRRASAIRRKITIFGNKLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL+++  K P++EKE+NRRKDM+  LRSKANQMA+ LNMSNFANRDSLLG
Sbjct  61   QSLLAEIHGK-PISEKEMNRRKDMVGNLRSKANQMANALNMSNFANRDSLLG  111



>ref|NP_001045701.1| Os02g0119400 [Oryza sativa Japonica Group]
 dbj|BAD08125.1| putative syntaxin of plants 52 [Oryza sativa Japonica Group]
 dbj|BAD07621.1| putative syntaxin of plants 52 [Oryza sativa Japonica Group]
 dbj|BAF07615.1| Os02g0119400 [Oryza sativa Japonica Group]
 gb|EAZ21521.1| hypothetical protein OsJ_05145 [Oryza sativa Japonica Group]
 dbj|BAG95712.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87292.1| unnamed protein product [Oryza sativa Japonica Group]
Length=232

 Score =   154 bits (389),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 96/112 (86%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D WVREY+EA +LADD+T+MI++R SLP +G E  RH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDPWVREYSEASRLADDVTSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            E+LLS++P K  +T+KE+++R+DML+ L+S+A QMA++ NMSNFANR+ LLG
Sbjct  61   EALLSRIPPK-SITDKELHKRQDMLSNLKSRAKQMATSFNMSNFANREDLLG  111



>ref|XP_009416129.1| PREDICTED: syntaxin-52-like [Musa acuminata subsp. malaccensis]
 ref|XP_009416130.1| PREDICTED: syntaxin-52-like [Musa acuminata subsp. malaccensis]
Length=233

 Score =   154 bits (389),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D W+RE+NEA KL++DI+ M+SER SLP +G + QRH +A+RRKIT L TRLDSL
Sbjct  1    MASSLDQWMREFNEASKLSEDISAMMSERGSLPPSGPDTQRHLTAMRRKITILRTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            ESLLSKLP+ QP+ +K++++R++MLA ++SKANQMASTLNMSNF NR+ L G
Sbjct  61   ESLLSKLPSMQPIKDKDLHKRQEMLANMKSKANQMASTLNMSNFGNREDLFG  112



>ref|XP_008385825.1| PREDICTED: syntaxin-52-like [Malus domestica]
 ref|XP_008385826.1| PREDICTED: syntaxin-52-like [Malus domestica]
 ref|XP_008385827.1| PREDICTED: syntaxin-52-like [Malus domestica]
 ref|XP_008359248.1| PREDICTED: syntaxin-52-like [Malus domestica]
Length=231

 Score =   154 bits (389),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEA KLADDI  MISE S+LP  G + QRH SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDSWMKEYNEATKLADDINGMISEWSTLPA-GPDTQRHVSAIRRKITILGTRLDSL  59

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP KQ +TEKE+NRRKDM+  LR K  QMASTL  SN ANRD LLG
Sbjct  60   QSLLSKLPGKQHITEKEMNRRKDMIGNLRLKVKQMASTLT-SNTANRDILLG  110



>ref|NP_001077546.1| syntaxin-51 [Arabidopsis thaliana]
 gb|AEE29425.1| syntaxin-51 [Arabidopsis thaliana]
Length=228

 Score =   154 bits (388),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 94/112 (84%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW+R YNEA+KL+++I  MISERSS   TG +AQR +SAIRRKIT  G +LDSL
Sbjct  1    MASSSDSWMRAYNEALKLSEEINGMISERSSSAVTGPDAQRRASAIRRKITIFGNKLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL+++  K P++EKE+NRRKDM+  LRSKANQMA+ LNMSNFANRDSLLG
Sbjct  61   QSLLAEIHGK-PISEKEMNRRKDMVGNLRSKANQMANALNMSNFANRDSLLG  111



>ref|XP_008676698.1| PREDICTED: uncharacterized protein LOC100217094 isoform X1 [Zea 
mays]
 gb|ACN34822.1| unknown [Zea mays]
 gb|AFW61959.1| hypothetical protein ZEAMMB73_963395 [Zea mays]
Length=196

 Score =   153 bits (386),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D W++EYNEA +LADDI++MI++R SLP +G E  RH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDPWMKEYNEASRLADDISSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            ESLL ++P K  +T+KE+++R+DM ++L+SKA QMA++ NMSNFANR+ LLG
Sbjct  61   ESLLGRIPPKS-ITDKEMHKRQDMFSSLKSKAKQMATSFNMSNFANREDLLG  111



>gb|AFW61956.1| SNARE domain containing protein [Zea mays]
Length=275

 Score =   155 bits (391),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 101/129 (78%), Gaps = 6/129 (5%)
 Frame = +3

Query  171  VSFPPPI-----PIQKAMAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHS  335
            V F  P+     P   AMA+S D W++EYNEA +LADDI++MI++R SLP +G E  RH+
Sbjct  28   VRFRTPVLRFARPDLPAMASSSDPWMKEYNEASRLADDISSMIADRGSLPQSGPEIMRHT  87

Query  336  SAIRRKITXLGTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSN  515
            SAIRRKIT LGTRLDSLESLL ++P K  +T+KE+++R+DM ++L+SKA QMA++ NMSN
Sbjct  88   SAIRRKITILGTRLDSLESLLGRIPPKS-ITDKEMHKRQDMFSSLKSKAKQMATSFNMSN  146

Query  516  FANRDSLLG  542
            FANR+ LLG
Sbjct  147  FANREDLLG  155



>ref|XP_009343645.1| PREDICTED: syntaxin-52-like isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343646.1| PREDICTED: syntaxin-52-like isoform X2 [Pyrus x bretschneideri]
Length=231

 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEA KLADDI  MISE S+LP  G + QRH SAIRRK T LGTRLDSL
Sbjct  1    MASSSDSWMKEYNEATKLADDINGMISEWSTLPA-GPDTQRHVSAIRRKNTILGTRLDSL  59

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP KQ +TEKE+NRRKDM+  LR K  QMASTL  SN ANRDSLLG
Sbjct  60   QSLLSKLPEKQHITEKEMNRRKDMIGNLRLKVKQMASTLT-SNTANRDSLLG  110



>ref|XP_009343644.1| PREDICTED: syntaxin-52-like isoform X1 [Pyrus x bretschneideri]
Length=240

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEA KLADDI  MISE S+LP  G + QRH SAIRRK T LGTRLDSL
Sbjct  10   MASSSDSWMKEYNEATKLADDINGMISEWSTLPA-GPDTQRHVSAIRRKNTILGTRLDSL  68

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP KQ +TEKE+NRRKDM+  LR K  QMASTL  SN ANRDSLLG
Sbjct  69   QSLLSKLPEKQHITEKEMNRRKDMIGNLRLKVKQMASTLT-SNTANRDSLLG  119



>ref|XP_009334172.1| PREDICTED: syntaxin-52-like isoform X2 [Pyrus x bretschneideri]
Length=240

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEA KLADDI  MISE S+LP  G + QRH SAIRRK T LGTRLDSL
Sbjct  10   MASSSDSWMKEYNEATKLADDINGMISEWSTLPA-GPDTQRHVSAIRRKNTILGTRLDSL  68

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP KQ +TEKE+NRRKDM+  LR K  QMASTL  SN ANRDSLLG
Sbjct  69   QSLLSKLPEKQHITEKEMNRRKDMIGNLRLKVKQMASTLT-SNTANRDSLLG  119



>ref|XP_009334173.1| PREDICTED: syntaxin-52-like isoform X3 [Pyrus x bretschneideri]
Length=231

 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEA KLADDI  MISE S+LP  G + QRH SAIRRK T LGTRLDSL
Sbjct  1    MASSSDSWMKEYNEATKLADDINGMISEWSTLPA-GPDTQRHVSAIRRKNTILGTRLDSL  59

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP KQ +TEKE+NRRKDM+  LR K  QMASTL  SN ANRDSLLG
Sbjct  60   QSLLSKLPEKQHITEKEMNRRKDMIGNLRLKVKQMASTLT-SNTANRDSLLG  110



>ref|XP_006646793.1| PREDICTED: syntaxin-52-like [Oryza brachyantha]
Length=232

 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 94/112 (84%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D WVREY EA +LADD+T+MI+ER SLP +G E  RH+S IRRKIT LGTRLDSL
Sbjct  1    MASSPDPWVREYGEASRLADDVTSMIAERGSLPQSGPEIMRHTSGIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            E+LLS++P K  +T+KE+++R+DML+ L+S+A QMA++ NMSNFANR+ LLG
Sbjct  61   EALLSRVPPKS-ITDKELHKRQDMLSNLKSRAKQMATSFNMSNFANREDLLG  111



>ref|NP_001136935.1| uncharacterized protein LOC100217094 [Zea mays]
 gb|ACF82924.1| unknown [Zea mays]
 gb|AFW61960.1| SNARE domain containing protein [Zea mays]
Length=231

 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D W++EYNEA +LADDI++MI++R SLP +G E  RH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDPWMKEYNEASRLADDISSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            ESLL ++P K  +T+KE+++R+DM ++L+SKA QMA++ NMSNFANR+ LLG
Sbjct  61   ESLLGRIPPK-SITDKEMHKRQDMFSSLKSKAKQMATSFNMSNFANREDLLG  111



>gb|KCW70251.1| hypothetical protein EUGRSUZ_F03509 [Eucalyptus grandis]
 gb|KCW70252.1| hypothetical protein EUGRSUZ_F03509 [Eucalyptus grandis]
Length=177

 Score =   151 bits (381),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA S DSW++EYNEA KLADDI  MISE     ++G E QRH+S+IRRKIT LGTRLDSL
Sbjct  1    MAYSADSWMKEYNEAAKLADDIGGMISEHDKSVSSGPENQRHASSIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +S+L+K+P  +P++EKE+NRR+DML++LR+K +QMAS LNMSN   RDSLLG
Sbjct  61   QSVLTKMPGNRPISEKEMNRRRDMLSSLRTKKDQMASALNMSNSRIRDSLLG  112



>ref|NP_001131944.1| uncharacterized protein LOC100193337 [Zea mays]
 gb|ACF80577.1| unknown [Zea mays]
Length=231

 Score =   152 bits (385),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D W++EYNEA +LADDI++MI++R SLP +G E  RH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDPWMKEYNEASRLADDISSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            ESL  ++P K  +T+KE+++R+DML++L+SKA QMA++ NMSNFANR+ LLG
Sbjct  61   ESLFGRIPPKS-ITDKEMHKRQDMLSSLKSKAKQMATSFNMSNFANREDLLG  111



>gb|ACG48507.1| SNARE domain containing protein [Zea mays]
Length=231

 Score =   152 bits (384),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D W++EYNEA +LADDI++MI++R SLP +G E  RH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDPWMKEYNEASRLADDISSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            ESL  ++P K  +T+KE+++R+DML++L+SKA QMA++ NMSNFANR+ LLG
Sbjct  61   ESLFGRIPPKS-ITDKEMHKRQDMLSSLKSKAKQMATSFNMSNFANREDLLG  111



>ref|XP_010063061.1| PREDICTED: syntaxin-52-like [Eucalyptus grandis]
 ref|XP_010063062.1| PREDICTED: syntaxin-52-like [Eucalyptus grandis]
 gb|KCW70249.1| hypothetical protein EUGRSUZ_F03509 [Eucalyptus grandis]
 gb|KCW70250.1| hypothetical protein EUGRSUZ_F03509 [Eucalyptus grandis]
Length=233

 Score =   152 bits (384),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA S DSW++EYNEA KLADDI  MISE     ++G E QRH+S+IRRKIT LGTRLDSL
Sbjct  1    MAYSADSWMKEYNEAAKLADDIGGMISEHDKSVSSGPENQRHASSIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +S+L+K+P  +P++EKE+NRR+DML++LR+K +QMAS LNMSN   RDSLLG
Sbjct  61   QSVLTKMPGNRPISEKEMNRRRDMLSSLRTKKDQMASALNMSNSRIRDSLLG  112



>ref|XP_006659260.1| PREDICTED: syntaxin-52-like [Oryza brachyantha]
Length=232

 Score =   152 bits (383),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 94/112 (84%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D W++EYNEA +LADDI +MI++R SLP +G E  RH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDPWMKEYNEASRLADDINSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            E+LLSK+P K  LT+KE+++R+D L+ L+SKA QMA++ NMSNFANR+ LLG
Sbjct  61   EALLSKIPPK-TLTDKELHKRQDTLSNLKSKAKQMATSFNMSNFANREDLLG  111



>ref|XP_010459159.1| PREDICTED: syntaxin-51-like [Camelina sativa]
Length=232

 Score =   152 bits (383),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 94/112 (84%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            M +S DSW++ YNEA+KL+++I  M+SERSS   TG +AQR +SAIRRKIT  GT+LDSL
Sbjct  1    MGSSSDSWMKAYNEALKLSEEINGMMSERSSSAETGPDAQRRASAIRRKITMFGTKLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL+++  K P++EKE+NRRKDM+  LRSKANQMA+ LNMSNFANRDSLLG
Sbjct  61   QSLLAQVHGK-PISEKEMNRRKDMVGNLRSKANQMANALNMSNFANRDSLLG  111



>ref|XP_010497722.1| PREDICTED: syntaxin-51-like [Camelina sativa]
 ref|XP_010497725.1| PREDICTED: syntaxin-51-like [Camelina sativa]
Length=232

 Score =   152 bits (383),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++ YNEA+KL+++I  M+SERSS   TG +AQR +SAIRRKIT  GT+LDSL
Sbjct  1    MASSSDSWMKSYNEALKLSEEINGMMSERSSSAETGPDAQRRASAIRRKITMFGTKLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL+++  K P++EKE+NRRKDM+  LRSK+NQMA+ LNMSNFANRDSLLG
Sbjct  61   QSLLAQIHGK-PVSEKEMNRRKDMVGNLRSKSNQMANALNMSNFANRDSLLG  111



>ref|XP_006406341.1| hypothetical protein EUTSA_v10021502mg [Eutrema salsugineum]
 gb|ESQ47794.1| hypothetical protein EUTSA_v10021502mg [Eutrema salsugineum]
Length=215

 Score =   151 bits (381),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 91/112 (81%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW+REYNEA+KL++DI  MISERS    TG +AQR +SAIRRKIT    RL+SL
Sbjct  1    MASSSDSWMREYNEALKLSEDINGMISERSKSAVTGPDAQRRASAIRRKITIFSIRLESL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL+KL  K P++EKE+NRRKDM+  LRS+ANQM + LNMSN ANRDSLLG
Sbjct  61   QSLLAKLHGK-PISEKEMNRRKDMIGNLRSQANQMVNALNMSNLANRDSLLG  111



>ref|XP_009334171.1| PREDICTED: syntaxin-52-like isoform X1 [Pyrus x bretschneideri]
Length=287

 Score =   153 bits (386),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EYNEA KLADDI  MISE S+LP  G + QRH SAIRRK T LGTRLDSL
Sbjct  57   MASSSDSWMKEYNEATKLADDINGMISEWSTLPA-GPDTQRHVSAIRRKNTILGTRLDSL  115

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP KQ +TEKE+NRRKDM+  LR K  QMASTL  SN ANRDSLLG
Sbjct  116  QSLLSKLPEKQHITEKEMNRRKDMIGNLRLKVKQMASTLT-SNTANRDSLLG  166



>gb|ACG31926.1| SNARE domain containing protein [Zea mays]
Length=231

 Score =   151 bits (382),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 94/112 (84%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D W++EYNEA +LADDI++MI++R SLP +G E  RH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDPWMKEYNEASRLADDISSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            ESL  ++P K  +T+KE+++R+DML++ +SKA QMA++ NMSNFANR+ LLG
Sbjct  61   ESLFGRIPPKS-ITDKEMHKRQDMLSSFKSKAKQMATSFNMSNFANREDLLG  111



>ref|XP_010476728.1| PREDICTED: syntaxin-51 [Camelina sativa]
Length=232

 Score =   150 bits (380),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 94/112 (84%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            M +S DSW++ YNEA+KL+++I  MISERSS   TG +AQR +SA+RRKIT  GT+LDSL
Sbjct  1    MGSSSDSWMKAYNEALKLSEEINGMISERSSSAETGPDAQRRASALRRKITIFGTKLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL+++  K P++EKE+NRRKDM+  LRSK+NQMA+ LNMSNFANRDSLLG
Sbjct  61   QSLLAQIHGK-PISEKEMNRRKDMVGNLRSKSNQMANALNMSNFANRDSLLG  111



>ref|XP_009407478.1| PREDICTED: syntaxin-52-like [Musa acuminata subsp. malaccensis]
Length=233

 Score =   150 bits (378),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA S D W RE NEA KLA+DI+ MISER SLP +G + QRH +A+RRKIT L TRL+SL
Sbjct  1    MATSLDQWTRELNEASKLAEDISVMISERGSLPPSGPDTQRHLTAMRRKITILRTRLESL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            ES+LSKLP+ QP+ +KE+N+R++MLA L+SKA+QMAS LNMSNF+NR  L G
Sbjct  61   ESILSKLPSLQPIKDKELNKRQEMLANLKSKADQMASELNMSNFSNRKDLFG  112



>gb|EAZ06340.1| hypothetical protein OsI_28572 [Oryza sativa Indica Group]
Length=146

 Score =   145 bits (365),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 92/112 (82%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D W++EYNEA +LADDI +MI++R SLP +G E  RH+SAIRRKIT L TRLDSL
Sbjct  1    MASSSDPWMKEYNEASRLADDINSMIADRGSLPQSGPEIIRHTSAIRRKITILCTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            E+LLSK+P K  L++KE+++R+D L+ L+SK  QMA++ NMSNFANR+ LLG
Sbjct  61   EALLSKIPPKS-LSDKELHKRQDTLSNLKSKTKQMATSFNMSNFANREDLLG  111



>dbj|BAJ97107.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=232

 Score =   146 bits (369),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 93/112 (83%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D WVRE+ EA +LADD+ +M+++R++LP +G EA RH+SAIRRKIT LGTRLD+L
Sbjct  1    MASSADPWVREHGEAARLADDVASMVADRAALPQSGPEAMRHTSAIRRKITILGTRLDTL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            E +L++LP K  +T+KE+++R+DML+ L+S+A QMA + NMS FANR+ LLG
Sbjct  61   EGMLARLPPK-SITDKELHKRRDMLSNLKSRAKQMAESFNMSTFANREDLLG  111



>ref|XP_008240610.1| PREDICTED: syntaxin-51-like [Prunus mume]
Length=230

 Score =   146 bits (369),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +3

Query  213  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLES  392
            AS DSW+RE+N+A KLAD+I  MIS RSSLP +G E QRH SA RRK+T L T+L++L+S
Sbjct  2    ASPDSWMREFNDASKLADEINGMISGRSSLPPSGPETQRHMSATRRKVTILRTKLETLQS  61

Query  393  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            LLSKLP KQ +T KEINRRKDML  L SKA+QMA  LNMS+ ANR +LLG
Sbjct  62   LLSKLPNKQSITGKEINRRKDMLKNLSSKADQMAIALNMSSLANRQNLLG  111



>gb|EMS60104.1| Syntaxin-51 [Triticum urartu]
Length=241

 Score =   146 bits (369),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D WVREY EA +LADD+ +M+++R++LP +G E  RH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSADPWVREYGEAARLADDVASMVADRAALPQSGPEVMRHTSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            E +L++LP K  +T+KE+N+R+D L+ L+S+A QMA + NMS FANR+ LLG
Sbjct  61   EGMLARLPPKS-ITDKELNKRRDTLSNLKSRAKQMAESFNMSTFANREDLLG  111



>ref|NP_001061436.1| Os08g0277900 [Oryza sativa Japonica Group]
 dbj|BAC99744.1| putative syntaxin of plants 52 [Oryza sativa Japonica Group]
 dbj|BAF23350.1| Os08g0277900 [Oryza sativa Japonica Group]
 dbj|BAG93077.1| unnamed protein product [Oryza sativa Japonica Group]
Length=232

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 92/112 (82%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D W++EYNEA +LADDI +MI++R SLP +G E  RH+SAIRRKIT L TRLDSL
Sbjct  1    MASSSDPWMKEYNEASRLADDINSMIADRGSLPQSGPEIIRHTSAIRRKITILCTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            E+LLSK+P K  L++KE+++R+D L+ L+SK  QMA++ NMSNFANR+ LLG
Sbjct  61   EALLSKIPPK-SLSDKELHKRQDTLSNLKSKTKQMATSFNMSNFANREDLLG  111



>ref|XP_007202519.1| hypothetical protein PRUPE_ppa010912mg [Prunus persica]
 gb|EMJ03718.1| hypothetical protein PRUPE_ppa010912mg [Prunus persica]
Length=230

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +3

Query  213  ASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLES  392
            AS DSW+RE+N+A KLAD+I  MIS RSSLP +G E QRH SA RRK+T L T+L++L+S
Sbjct  2    ASPDSWMREFNDASKLADEINGMISGRSSLPPSGPETQRHMSATRRKVTILRTKLETLQS  61

Query  393  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            LLSKLP KQ +T KEINRRKDML  L SKA+QMA  LNMS+ AN+ +LLG
Sbjct  62   LLSKLPNKQSITGKEINRRKDMLTNLSSKADQMAIALNMSSLANKQNLLG  111



>ref|XP_010673197.1| PREDICTED: syntaxin-52-like [Beta vulgaris subsp. vulgaris]
Length=231

 Score =   144 bits (364),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+  +SW+REYNEA KLADDI +M+SE S+LP TGT+ QRH SA RRKIT L T+L++L
Sbjct  1    MASLSESWMREYNEASKLADDINSMVSEASTLPATGTQTQRHFSATRRKITILNTKLENL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            ESLL+KLP+ Q +T KEINRR D+L  ++SK NQMA+TLN  + A RD LLG
Sbjct  61   ESLLAKLPSMQAITGKEINRRNDLLTNMKSKVNQMANTLNSYSAAYRDRLLG  112



>gb|EEE68383.1| hypothetical protein OsJ_26713 [Oryza sativa Japonica Group]
Length=346

 Score =   147 bits (370),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 98/125 (78%), Gaps = 5/125 (4%)
 Frame = +3

Query  180  PPPI----PIQKAMAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIR  347
            P PI    P + AMA+S D W++EYNEA +LADDI +MI++R SLP +G E  RH+SAIR
Sbjct  102  PVPIDLRFPDRPAMASSSDPWMKEYNEASRLADDINSMIADRGSLPQSGPEIIRHTSAIR  161

Query  348  RKITXLGTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANR  527
            RKIT L TRLDSLE+LLSK+P K  L++KE+++R+D L+ L+SK  QMA++ NMSNFANR
Sbjct  162  RKITILCTRLDSLEALLSKIPPK-SLSDKELHKRQDTLSNLKSKTKQMATSFNMSNFANR  220

Query  528  DSLLG  542
            + LLG
Sbjct  221  EDLLG  225



>dbj|BAJ85147.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95155.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS45154.1| Syntaxin-52 [Triticum urartu]
Length=232

 Score =   144 bits (363),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 92/112 (82%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D W++EY EA KL DDI++MI++RSSLP +G E  RH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDPWMKEYTEASKLVDDISSMIADRSSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
             +LLS++P K  LT+KE+++R+D L+ L+SKA QM ++ N+SNFANR+ LLG
Sbjct  61   VTLLSRIPPK-SLTDKEMHKRQDALSNLKSKAKQMGTSFNVSNFANREDLLG  111



>gb|EMT28389.1| hypothetical protein F775_28894 [Aegilops tauschii]
Length=258

 Score =   144 bits (363),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 92/112 (82%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D W++EY EA KL DDI++MI++RSSLP +G E  RH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDPWMKEYTEASKLVDDISSMIADRSSLPQSGPEIMRHTSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
             +LLS++P K  LT+KE+++R+D L+ L+SKA QM ++ N+SNFANR+ LLG
Sbjct  61   VTLLSRIPPKS-LTDKEMHKRQDALSNLKSKAKQMGTSFNVSNFANREDLLG  111



>ref|XP_008668816.1| PREDICTED: syntaxin-52-like [Zea mays]
Length=231

 Score =   143 bits (361),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 91/112 (81%), Gaps = 1/112 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D W++EYNEA +LADDI++MI++R SLP +G E  RH+SAIR   T LGTRLDSL
Sbjct  1    MASSSDPWMKEYNEASRLADDISSMIADRGSLPQSGPEIMRHTSAIRXXXTILGTRLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            ESL  ++P K  +T+KE+++R+DML++L+SKA QMA++ NMSNF NR+ LLG
Sbjct  61   ESLFGRIPPKS-ITDKEMHKRQDMLSSLKSKAKQMATSFNMSNFTNREDLLG  111



>gb|EEC83251.1| hypothetical protein OsI_28573 [Oryza sativa Indica Group]
Length=396

 Score =   147 bits (371),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 98/125 (78%), Gaps = 7/125 (6%)
 Frame = +3

Query  186  PIPI------QKAMAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIR  347
            P+PI      + AMA+S D W++EYNEA +LADDI +MI++R SLP +G E  RH+SAIR
Sbjct  152  PVPIDLRFPDRPAMASSSDPWMKEYNEASRLADDINSMIADRGSLPQSGPEIIRHTSAIR  211

Query  348  RKITXLGTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANR  527
            RKIT L TRLDSLE+LLSK+P K  L++KE+++R+D L+ L+SK  QMA++ NMSNFANR
Sbjct  212  RKITILCTRLDSLEALLSKIPPKS-LSDKELHKRQDTLSNLKSKTKQMATSFNMSNFANR  270

Query  528  DSLLG  542
            + LLG
Sbjct  271  EDLLG  275



>ref|XP_009377637.1| PREDICTED: syntaxin-51-like [Pyrus x bretschneideri]
 ref|XP_009377638.1| PREDICTED: syntaxin-51-like [Pyrus x bretschneideri]
Length=234

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 93/114 (82%), Gaps = 4/114 (4%)
 Frame = +3

Query  213  ASGDSWVREYNEAVKLADDITNMISERSSLPTT--GTEAQRHSSAIRRKITXLGTRLDSL  386
            AS DSW+RE+N+A KLAD+I  MIS RSSLP +  G E QRH SA RRK+T L T+L++L
Sbjct  2    ASPDSWMREFNDASKLADEINGMISGRSSLPVSPSGPETQRHMSATRRKVTILRTKLETL  61

Query  387  ESLLSKLPTKQP--LTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
             SLLSKLPTKQ   +T KE+NRRKDMLA+L SKA+QMA+TLNMS+ ANR++LLG
Sbjct  62   HSLLSKLPTKQKESITGKEMNRRKDMLASLSSKADQMATTLNMSSLANRNNLLG  115



>ref|XP_006373682.1| hypothetical protein POPTR_0016s02990g [Populus trichocarpa]
 gb|ERP51479.1| hypothetical protein POPTR_0016s02990g [Populus trichocarpa]
Length=243

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +3

Query  195  IQKAMAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTR  374
            I+ AM+    SW++E+NEA KL D+I  MIS ++SLP++G E QRH SA RRKIT L T+
Sbjct  9    IRGAMSTPSASWMQEFNEASKLGDEINGMISGKNSLPSSGPETQRHLSASRRKITILRTK  68

Query  375  LDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            LD L+SLLS+LP+KQP+T KE+NRR+DML  L +K NQMAS LNMS+ ANR++LLG
Sbjct  69   LDILQSLLSELPSKQPITGKEMNRRQDMLKNLSTKVNQMASILNMSSAANRENLLG  124



>ref|XP_011041363.1| PREDICTED: syntaxin-52-like [Populus euphratica]
Length=231

 Score =   141 bits (355),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            M+    SW++E+NEA KL D+I  MIS ++SLP++G E QRH SA RRKIT L T+LD L
Sbjct  1    MSTPSASWMQEFNEASKLGDEINGMISGKNSLPSSGPETQRHLSASRRKITILRTKLDIL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLS+LP+KQP+T KE+NRR+DML  L +K NQMAS LNMS+ ANR++LLG
Sbjct  61   QSLLSELPSKQPITGKEMNRRQDMLKNLSTKVNQMASILNMSSVANRENLLG  112



>ref|XP_007020672.1| Syntaxin of plants 51 isoform 2 [Theobroma cacao]
 ref|XP_007020674.1| Syntaxin of plants 51 isoform 2 [Theobroma cacao]
 gb|EOY12197.1| Syntaxin of plants 51 isoform 2 [Theobroma cacao]
 gb|EOY12199.1| Syntaxin of plants 51 isoform 2 [Theobroma cacao]
Length=207

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 78/88 (89%), Gaps = 1/88 (1%)
 Frame = +3

Query  279  MISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLESLLSKLPTKQPLTEKEINRRKDM  458
            MIS+RSSLP +G E QRH+SAIRRKIT LGTRLD L+SLLS+ PT +PLTEKE+NRRKDM
Sbjct  1    MISDRSSLPASGPETQRHASAIRRKITILGTRLDGLQSLLSR-PTGRPLTEKEMNRRKDM  59

Query  459  LATLRSKANQMASTLNMSNFANRDSLLG  542
            +A LRSKANQMAS  NMSNFA+RDSLLG
Sbjct  60   VANLRSKANQMASAFNMSNFASRDSLLG  87



>ref|XP_006373681.1| hypothetical protein POPTR_0016s02990g [Populus trichocarpa]
 gb|ERP51478.1| hypothetical protein POPTR_0016s02990g [Populus trichocarpa]
Length=231

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            M+    SW++E+NEA KL D+I  MIS ++SLP++G E QRH SA RRKIT L T+LD L
Sbjct  1    MSTPSASWMQEFNEASKLGDEINGMISGKNSLPSSGPETQRHLSASRRKITILRTKLDIL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLS+LP+KQP+T KE+NRR+DML  L +K NQMAS LNMS+ ANR++LLG
Sbjct  61   QSLLSELPSKQPITGKEMNRRQDMLKNLSTKVNQMASILNMSSAANRENLLG  112



>ref|XP_006373683.1| hypothetical protein POPTR_0016s03000g [Populus trichocarpa]
 gb|ERP51480.1| hypothetical protein POPTR_0016s03000g [Populus trichocarpa]
Length=231

 Score =   136 bits (343),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+  + W++E+NEA KL D+I+NMIS ++SLP +G E QRH SAIRRK T L T+LDSL
Sbjct  1    MASPSELWMQEFNEASKLGDEISNMISGKNSLPQSGPETQRHLSAIRRKATILTTKLDSL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL  LP KQP++ KEINRR++ML  L +K NQM++ LNM+  ANR++LLG
Sbjct  61   QSLLLALPGKQPISGKEINRRQEMLKNLSTKVNQMSTALNMAGAANRENLLG  112



>gb|ABK92777.1| unknown [Populus trichocarpa]
Length=146

 Score =   133 bits (335),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA    SW++E+NEA KL D+I  MI+ ++SLP +G E QRH SA RRKI  L T+LD L
Sbjct  1    MATPSGSWMQEFNEASKLGDEINGMINGKNSLPPSGPETQRHLSATRRKIAILRTKLDIL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL+ LP+KQP+T KE+NR +DML  L +K NQMA+TLN+S+ ANR++LLG
Sbjct  61   QSLLTALPSKQPITGKEMNRLQDMLKNLSTKVNQMATTLNISSAANRENLLG  112



>ref|XP_011040715.1| PREDICTED: syntaxin-52-like [Populus euphratica]
 ref|XP_011040716.1| PREDICTED: syntaxin-52-like [Populus euphratica]
Length=231

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA    SW++E+NEA KL D+I  MI+ ++SLP +G E QRH SA RRKI  L T+LD L
Sbjct  1    MATPSGSWMQEFNEASKLGDEINGMINGKNSLPPSGPETQRHLSATRRKIAILRTKLDIL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL+ LP+KQP+T KE+NR +DML  L +K NQMA+TLNMS+ ANR++LLG
Sbjct  61   QSLLTALPSKQPITGKEMNRLQDMLKNLSTKVNQMATTLNMSSAANRENLLG  112



>ref|XP_002307951.1| hypothetical protein POPTR_0006s03120g [Populus trichocarpa]
 gb|EEE91474.1| hypothetical protein POPTR_0006s03120g [Populus trichocarpa]
Length=221

 Score =   133 bits (334),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA    SW++E+NEA KL D+I  MI+ ++SLP +G E QRH SA RRKI  L T+LD L
Sbjct  1    MATPSGSWMQEFNEASKLGDEINGMINGKNSLPPSGPETQRHLSATRRKIAILRTKLDIL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLL+ LP+KQP+T KE+NR +DML  L +K NQMA+TLN+S+ ANR++LLG
Sbjct  61   QSLLTALPSKQPITGKEMNRLQDMLKNLSTKVNQMATTLNISSAANRENLLG  112



>gb|ABK92902.1| unknown [Populus trichocarpa]
Length=231

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+  +SW++E+NEA KL D+I+ MIS ++SLP +G E QR  SA RRK T L T+LD L
Sbjct  1    MASPSESWMQEFNEASKLGDEISAMISGKNSLPQSGPETQRQFSAARRKATILRTKLDIL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLS LP+KQPL+ KE+NRR++ML  L +K NQMAS LNM + ANR++LLG
Sbjct  61   QSLLSALPSKQPLSGKEMNRRQEMLKNLSTKVNQMASALNMFSAANRENLLG  112



>ref|XP_011041367.1| PREDICTED: syntaxin-52-like [Populus euphratica]
 ref|XP_011041368.1| PREDICTED: syntaxin-52-like [Populus euphratica]
Length=231

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+  +SW++E+NEA KL D+I++MIS ++SLP +G E QRH SAIRRK T L T+LD L
Sbjct  1    MASPSESWMQEFNEASKLGDEISDMISGKNSLPQSGPETQRHLSAIRRKATILTTKLDIL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLS LP+KQ ++ KEINRR++ML  L +K NQM++ L M+  ANR++LLG
Sbjct  61   QSLLSALPSKQSISGKEINRRQEMLKNLSTKVNQMSTALKMAGAANRENLLG  112



>gb|KJB62826.1| hypothetical protein B456_009G444600 [Gossypium raimondii]
Length=218

 Score =   130 bits (328),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 82/112 (73%), Gaps = 14/112 (13%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+  D+W++EYN+A+K+ADDI  MIS + SLP++G E QR             TRLD L
Sbjct  1    MASPSDTWIKEYNDAIKIADDINGMISGKGSLPSSGPETQR-------------TRLDGL  47

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSK  T +PLT+KE+NR KDM+  LRSK+NQMAS  NMSNFANRDSLLG
Sbjct  48   QSLLSK-HTGKPLTDKEMNRCKDMVTNLRSKSNQMASAFNMSNFANRDSLLG  98



>ref|XP_011040717.1| PREDICTED: syntaxin-52-like [Populus euphratica]
Length=231

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            M++  +SW++E+NEA KL D+I+ MIS ++SLP +G + QR  SA RRK T L T+LD L
Sbjct  1    MSSPSESWMQEFNEASKLGDEISAMISGKNSLPQSGPDTQRQFSAARRKATILRTKLDIL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLS LP+KQPL+ KE+NRR++ML  L +K NQMAS LNM + ANR++LLG
Sbjct  61   QSLLSALPSKQPLSGKEMNRRQEMLKNLSTKVNQMASALNMFSAANRENLLG  112



>ref|XP_010111270.1| hypothetical protein L484_027923 [Morus notabilis]
 gb|EXC30748.1| hypothetical protein L484_027923 [Morus notabilis]
Length=182

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S D W+RE ++A KLAD++ +MIS+RSSL  +G + QRH S  RRK+T L T+L++L
Sbjct  1    MASSSDPWMRELSDASKLADEVRDMISQRSSLLPSGPQTQRHMSTARRKMTILRTKLETL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +SLLSKLP+KQ L+ KE NRR+DML  L  +A +MA TLNMS  A+RD+L G
Sbjct  61   QSLLSKLPSKQILSAKETNRRRDMLDKLSVQAGEMAPTLNMSMSADRDNLFG  112



>emb|CBI29594.3| unnamed protein product [Vitis vinifera]
Length=73

 Score =   115 bits (287),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+S DSW++EY EA KLADDI  MIS+R SLPT+G+E QRH+SAIRRKIT LGTRLDSL
Sbjct  1    MASSSDSWIKEYYEASKLADDINGMISQRISLPTSGSETQRHASAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPTKQPL  425
            +SLL KLP KQP+
Sbjct  61   QSLLLKLPGKQPM  73



>ref|XP_003573428.1| PREDICTED: syntaxin-52-like [Brachypodium distachyon]
 ref|XP_010233716.1| PREDICTED: syntaxin-52-like [Brachypodium distachyon]
 ref|XP_010233717.1| PREDICTED: syntaxin-52-like [Brachypodium distachyon]
Length=231

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 83/113 (73%), Gaps = 4/113 (4%)
 Frame = +3

Query  207  MAASG-DSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDS  383
            MA+S  D W REY EA +LADD+  M++        G EA RH+SAIRRKIT LGTRLDS
Sbjct  1    MASSPPDPWAREYGEAARLADDVGAMVAVGGG--GGGPEAMRHASAIRRKITILGTRLDS  58

Query  384  LESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            LE  LS++P K  +T+KE+++R+DML+ LRS+A QMAS+ NMS  ANR+ LLG
Sbjct  59   LEGSLSRVPPKS-ITDKELHKRQDMLSNLRSRAKQMASSFNMSTSANREDLLG  110



>ref|XP_006836711.1| hypothetical protein AMTR_s00088p00114370 [Amborella trichopoda]
 gb|ERM99564.1| hypothetical protein AMTR_s00088p00114370 [Amborella trichopoda]
Length=83

 Score =   106 bits (265),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+  DSW+RE+NEA KLADDI   I+ERSSLP +G E QRH SAIRRKIT LGTRLDSL
Sbjct  1    MASPSDSWMREFNEASKLADDIGARIAERSSLPPSGPETQRHVSAIRRKITILGTRLDSL  60

Query  387  ESLLSKLPT  413
            ESLL+KLPT
Sbjct  61   ESLLAKLPT  69



>gb|EYU33678.1| hypothetical protein MIMGU_mgv1a021393mg [Erythranthe guttata]
Length=230

 Score =   109 bits (273),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 78/110 (71%), Gaps = 5/110 (5%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MAAS DSW +E +EA +LA++I+NMISERSS+P + TE+Q+H SAIR KI  LGT L+SL
Sbjct  1    MAASVDSWTKECDEAERLANEISNMISERSSMPNSSTESQQHLSAIRAKIVILGTMLESL  60

Query  387  ESLLSKLPT--KQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRD  530
            +     LP+   +  T +E+  RKDM+  LR   N++   LNMSNFANRD
Sbjct  61   Q---HSLPSALNESSTAEEMKIRKDMVTKLRLNVNEINYALNMSNFANRD  107



>gb|AFW61958.1| hypothetical protein ZEAMMB73_963395 [Zea mays]
Length=124

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +3

Query  192  PIQKAMAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGT  371
            P   AMA+S D W++EYNEA +LADDI++MI++R SLP +G E  RH+SAIRRKIT LGT
Sbjct  40   PDLPAMASSSDPWMKEYNEASRLADDISSMIADRGSLPQSGPEIMRHTSAIRRKITILGT  99

Query  372  RLDSLESLLSKLPTK  416
            RLDSLESLL ++P K
Sbjct  100  RLDSLESLLGRIPPK  114



>ref|NP_173073.2| Target SNARE coiled-coil domain protein [Arabidopsis thaliana]
 gb|AEE29422.1| Target SNARE coiled-coil domain protein [Arabidopsis thaliana]
Length=193

 Score =   106 bits (264),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 79/111 (71%), Gaps = 1/111 (1%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+  DSW+RE NE +KL+++I  MI ERSSL  T + A RH+S++RRKIT L TR+ +L
Sbjct  1    MASLCDSWIREQNETLKLSEEIDGMILERSSLAETSSYALRHASSMRRKITILATRVQTL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLL  539
            + LL++   K  ++ KE++RRK     LRSKANQMAS L+M  F+N D LL
Sbjct  61   KYLLAESQGK-SISGKEMSRRKGTFENLRSKANQMASALDMLKFSNIDILL  110



>ref|XP_006380963.1| hypothetical protein POPTR_0006s03130g [Populus trichocarpa]
 gb|ERP58760.1| hypothetical protein POPTR_0006s03130g [Populus trichocarpa]
Length=164

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA+  +SW++E+NEA KL D+I+ MIS ++SLP +G E QR  SA RRK T L T+LD L
Sbjct  1    MASPSESWMQEFNEASKLGDEISAMISGKNSLPQSGPETQRQFSAARRKATILRTKLDIL  60

Query  387  ESLLSKLPTKQPLTEKE  437
            +SLLS LP+KQPL   E
Sbjct  61   QSLLSALPSKQPLERDE  77



>ref|XP_006399472.1| hypothetical protein EUTSA_v10015786mg [Eutrema salsugineum]
 gb|ESQ40925.1| hypothetical protein EUTSA_v10015786mg [Eutrema salsugineum]
Length=169

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +3

Query  351  KITXLGTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRD  530
            +IT    RL+SL+SLL+KL  K P++EKE+NRRKDM+  LRS+ANQMA+ LNMSN ANRD
Sbjct  3    EITIFSIRLESLQSLLAKLHGK-PISEKEMNRRKDMIGNLRSQANQMANALNMSNLANRD  61

Query  531  SLLG  542
            SLLG
Sbjct  62   SLLG  65



>ref|XP_001778077.1| predicted protein [Physcomitrella patens]
 gb|EDQ57083.1| predicted protein [Physcomitrella patens]
Length=223

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 63/95 (66%), Gaps = 0/95 (0%)
 Frame = +3

Query  219  GDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLESLL  398
             DSW +E+ EAV+L +DI   I+E+++LP   +E+ R  S  RRK+  L  +LD LESLL
Sbjct  2    ADSWTKEFQEAVRLTEDIEGRIAEKNALPPHSSESIRIVSVTRRKLAMLNNKLDRLESLL  61

Query  399  SKLPTKQPLTEKEINRRKDMLATLRSKANQMASTL  503
                 K  L+EKE+ RR++ML  +R K+ QM+++L
Sbjct  62   QNGSLKSSLSEKELYRRQNMLVDIRYKSKQMSASL  96



>ref|XP_004987204.1| PREDICTED: syntaxin-52-like [Setaria italica]
Length=221

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 68/108 (63%), Gaps = 1/108 (1%)
 Frame = +3

Query  222  DSWVREYNEAVKLADDITNMISERSSLPTT-GTEAQRHSSAIRRKITXLGTRLDSLESLL  398
            D W + + EA +L DD+   I+ER S+P +   + QR ++ IRRK+T LGTRLD L+  L
Sbjct  24   DQWTKRFQEAERLVDDVVERIAERDSVPPSLPRKLQRRTAEIRRKVTILGTRLDMLQEDL  83

Query  399  SKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            S LP KQ ++ K++N+  + L+ L SKA ++     M++ ++ + L G
Sbjct  84   SDLPKKQNISLKQLNKLAEKLSGLSSKAKEVGGQFTMNHSSDGNDLCG  131



>ref|XP_001751913.1| Qc-SNARE, SYP5 family [Physcomitrella patens]
 gb|EDQ83348.1| Qc-SNARE, SYP5 family [Physcomitrella patens]
Length=225

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 66/107 (62%), Gaps = 1/107 (1%)
 Frame = +3

Query  219  GDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLESLL  398
             D+W RE++E   L ++I   I+E+++LP   +E+ R  S  RRK+  L  +LD LESLL
Sbjct  2    ADAWAREFHETALLTEEIDGRIAEKNALPAHSSESIRVVSVSRRKLAVLNNKLDRLESLL  61

Query  399  SKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLL  539
                 K  L EKE+NRR++ML  +R K  QM+ +L+ S   NR SL+
Sbjct  62   QSDSLKSSLNEKELNRRQNMLVDIRFKFKQMSESLS-STRDNRASLM  107



>gb|AAM52319.1|AC105363_8 Hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ25394.1| hypothetical protein OsJ_09212 [Oryza sativa Japonica Group]
Length=324

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 65/108 (60%), Gaps = 1/108 (1%)
 Frame = +3

Query  222  DSWVREYNEAVKLADDITNMISERSSL-PTTGTEAQRHSSAIRRKITXLGTRLDSLESLL  398
            + W++ + EA +L  D+   I+ER S+ P+   E QR ++ IRRK+  L TRLD ++  L
Sbjct  96   EQWMKRFEEAERLVADVVERIAERESVSPSLPQELQRRTAEIRRKVAILETRLDMMQEDL  155

Query  399  SKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            S+LP KQ ++ KE+N+     +TL SK  ++ +      F+NR  LLG
Sbjct  156  SQLPNKQRISLKELNKLAAKHSTLSSKVKEVGAPFTRKRFSNRSDLLG  203



>ref|NP_683311.2| putative syntaxin-type t-SNARE protein [Arabidopsis thaliana]
 gb|AEE29421.1| putative syntaxin-type t-SNARE protein [Arabidopsis thaliana]
Length=199

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = +3

Query  279  MISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLESLLSKLPTKQPLTEKEINRRKDM  458
            MI ERSSL  T + A+ H+S +RRKIT L   + +L++LL++   K  ++ KE++R KDM
Sbjct  1    MILERSSLAETSSYARGHASYMRRKITILANGVQTLKNLLAESQGK-SISAKEMSRCKDM  59

Query  459  LATLRSKANQMASTLNMSNFANRDSLLG  542
            +  LRSKA QMAS L+M  F+N  SLLG
Sbjct  60   VEDLRSKAYQMASALDMLKFSNIGSLLG  87



>ref|XP_002465967.1| hypothetical protein SORBIDRAFT_01g049130 [Sorghum bicolor]
 gb|EER92965.1| hypothetical protein SORBIDRAFT_01g049130 [Sorghum bicolor]
Length=251

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 64/108 (59%), Gaps = 1/108 (1%)
 Frame = +3

Query  222  DSWVREYNEAVKLADDITNMISERSSLPTT-GTEAQRHSSAIRRKITXLGTRLDSLESLL  398
            D W +   EA +L D++   ++ER S+P +   E QR ++ IRRK+  +GTRLD L+  L
Sbjct  26   DQWTKRLQEAQRLVDEVAERVAERESVPPSLPRELQRRTAEIRRKVAIVGTRLDMLKEDL  85

Query  399  SKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            S LP +Q ++ K++ +  + LA + SKA ++     M   ++R+ L G
Sbjct  86   SDLPKRQNISLKQLGKLAEKLAGVCSKAQEVGGQFTMKYSSDRNDLCG  133



>ref|XP_006650984.1| PREDICTED: syntaxin-52-like [Oryza brachyantha]
Length=176

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 64/109 (59%), Gaps = 2/109 (2%)
 Frame = +3

Query  222  DSWVREYNEAVKLADDITNMISERSSLPTT--GTEAQRHSSAIRRKITXLGTRLDSLESL  395
            D W++ ++EA +L       I+ER S+  +    E QR ++ IRRK+  L TRLD ++  
Sbjct  34   DEWLKRFDEAERLGGGGGGRIAERESVSPSLLPHELQRRTAEIRRKVAILETRLDMMQEY  93

Query  396  LSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            LS+LP KQ +  +E+N+    L+TL SK  ++ +   M   +NR+ LLG
Sbjct  94   LSQLPNKQRINLRELNKLAAKLSTLSSKVKEVGAPFTMKRSSNRNELLG  142



>ref|XP_010646520.1| PREDICTED: syntaxin-52-like [Vitis vinifera]
Length=334

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 47/66 (71%), Gaps = 9/66 (14%)
 Frame = +3

Query  372  RLDSLESL---------LSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN  524
            R+++LE+L            LP     TEKE+NRRKDML+ LRSK +QMASTLNMSNFAN
Sbjct  148  RVENLEALALEYYYYLKFFMLPFVSHRTEKEMNRRKDMLSNLRSKVSQMASTLNMSNFAN  207

Query  525  RDSLLG  542
            RDSLLG
Sbjct  208  RDSLLG  213



>ref|XP_011398897.1| Syntaxin-52 [Auxenochlorella protothecoides]
 gb|KFM26001.1| Syntaxin-52 [Auxenochlorella protothecoides]
Length=240

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 65/111 (59%), Gaps = 6/111 (5%)
 Frame = +3

Query  216  SGDSWVREYNEAVKLADDITNMISERS-SLPTTGTEAQRHSSAIRRKITXLGTRLDSLES  392
            S DSW  EY +A + A ++ N+I ER+   P  G  A R ++  RRK+  LGT+LD+L S
Sbjct  2    SSDSWAEEYEQAKQAAGEVLNLIQERNLEHPDGGPGASRLTATARRKLGSLGTKLDALRS  61

Query  393  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTL--NMSNFANRDSLL  539
             +   P    LTE E NRR+D +A LR+K   M ++L  +  + A R +LL
Sbjct  62   GIEAAPD---LTENERNRRRDQVAALRNKREGMLTSLRRDGGHSAARAALL  109



>gb|EAY88317.1| hypothetical protein OsI_09776 [Oryza sativa Indica Group]
Length=325

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 62/109 (57%), Gaps = 2/109 (2%)
 Frame = +3

Query  222  DSWVREYNEAVKLADDITNMISERSSL-PTTGTEAQRHSSAIRRKITXLGTRLDSLESLL  398
            + W++ + EA +L  D+   I+ER S+ P+   E QR ++ IRRK+  L TRLD ++  L
Sbjct  96   EQWMKRFEEAERLVADVVERIAERESVSPSLPQELQRRTAEIRRKVAILETRLDMMQEDL  155

Query  399  SKLPTKQPLTE-KEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            S+LP K      KE+N+     +TL SK  ++ +      F+NR  LLG
Sbjct  156  SQLPNKHACKSLKELNKLAAKHSTLSSKVKEVGAPFTRKRFSNRSDLLG  204



>ref|XP_005649717.1| Qc-snare protein, Syn8/Syntaxin8-family [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25173.1| Qc-snare protein, Syn8/Syntaxin8-family [Coccomyxa subellipsoidea 
C-169]
Length=236

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 64/111 (58%), Gaps = 3/111 (3%)
 Frame = +3

Query  213  ASGDSWVREYNEAVKLADDITNMISERS-SLPTTGTEAQRHSSAIRRKITXLGTRLDSLE  389
            A  D W  EY++A +LADD   +I ER+   P  G EA R ++  RRK+  LG  +DS+ 
Sbjct  2    AGTDRWTNEYDDAKQLADDTLALIQERNLKFPHGGQEASRVTATARRKLGTLGAAVDSMR  61

Query  390  SLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNM-SNFANRDSLL  539
            S L      + +TE E NRR+D++  L+S+  QM  +L    N ANR +L+
Sbjct  62   SSLES-SALENITENERNRRRDLVNALKSRREQMLQSLRRDQNSANRTALM  111



>ref|XP_005850452.1| hypothetical protein CHLNCDRAFT_59611 [Chlorella variabilis]
 gb|EFN58350.1| hypothetical protein CHLNCDRAFT_59611 [Chlorella variabilis]
Length=242

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 64/110 (58%), Gaps = 3/110 (3%)
 Frame = +3

Query  216  SGDSWVREYNEAVKLADDITNMISERS-SLPTTGTEAQRHSSAIRRKITXLGTRLDSLES  392
              D WV +Y  A + A++   +I ER+   P  G EA R ++  RRK+  LG+ LD+L S
Sbjct  3    GADQWVSDYEAAKQTANETLQLIQERNLKYPEGGPEASRITATSRRKLGTLGSLLDALRS  62

Query  393  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSN-FANRDSLL  539
             L + P    LTE E NRR+D++A+LR +  QM ++L      A RD+LL
Sbjct  63   SL-EAPQYAGLTENERNRRRDLVASLRMRREQMLASLKREQPRAARDTLL  111



>gb|ABR25694.1| syntaxin 51 [Oryza sativa Indica Group]
Length=174

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 45/54 (83%), Gaps = 1/54 (2%)
 Frame = +3

Query  381  SLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            SLE+LLSK+P K  L++KE+++R+D L+ L+SK  QMA++ NMSNFANR+ LLG
Sbjct  1    SLEALLSKIPPK-SLSDKELHKRQDTLSNLKSKTKQMATSFNMSNFANREDLLG  53



>ref|XP_004363668.1| hypothetical protein CAOG_03940 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE93100.1| hypothetical protein CAOG_003940 [Capsaspora owczarzaki ATCC 
30864]
Length=250

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 65/111 (59%), Gaps = 5/111 (5%)
 Frame = +3

Query  222  DSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLESLLS  401
            DSW+ +++     AD+I   I+ER+ +   GT A   +S IRRK+  L T + SLE  L 
Sbjct  17   DSWLLDHDNVTHAADEIMADINERNKVVRQGTNAATLNSGIRRKLGQLTTSIASLEQALD  76

Query  402  KLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMS-----NFANRDSLL  539
            +   +  +T+KE++RR+ + + LRS+ +Q+ S  N +       A+RD+LL
Sbjct  77   RAGRQYTITDKELSRRQGLTSALRSRRDQLNSMFNKNMEPGQAEASRDTLL  127



>gb|KIZ07812.1| Syntaxin-51 [Monoraphidium neglectum]
Length=239

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 63/109 (58%), Gaps = 3/109 (3%)
 Frame = +3

Query  222  DSWVREYNEAVKLADDITNMISERS-SLPTTGTEAQRHSSAIRRKITXLGTRLDSLESLL  398
            DSW++EY    +L  +I  +I +R+ + P  G EA R ++A RRK+  LGT LDSL   L
Sbjct  4    DSWLKEYGVCKELTQEIVQLIQDRNVNHPDGGPEASRMTAAARRKLGTLGTTLDSLYRWL  63

Query  399  SKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLN-MSNFANRDSLLG  542
                    L+E+E  RR+D+L  L+++  Q+  +L      ++R+SL+ 
Sbjct  64   DS-DDANSLSEQERFRRRDLLHVLKNRREQIQESLKRQQQHSDRESLMA  111



>ref|XP_002531208.1| syntaxin, putative [Ricinus communis]
 gb|EEF31185.1| syntaxin, putative [Ricinus communis]
Length=147

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  438  INRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +NRRKDM+  LR+K NQMA+TLNMSNFANRDSL G
Sbjct  1    MNRRKDMVTNLRTKVNQMATTLNMSNFANRDSLFG  35



>ref|XP_002730935.1| PREDICTED: syntaxin-8-like [Saccoglossus kowalevskii]
Length=237

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 63/113 (56%), Gaps = 2/113 (2%)
 Frame = +3

Query  207  MAASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSL  386
            MA SGD W+ +Y+   + A +I   I+ER+ L  TG+   + S  IR  +      L++L
Sbjct  1    MAPSGDVWLSDYDVCAREAQEIIEKINERNRLLRTGSSHSKISGEIRLALRQFSRYLNNL  60

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQM-ASTLNMSNF-ANRDSLL  539
            +  L +  T   LT++E +RR+DML  L SK  Q+  + LN S+  A R SLL
Sbjct  61   KQDLMRASTSYHLTQREFDRRQDMLDNLISKEKQLNDAFLNDSHGNAGRTSLL  113



>gb|KJB62825.1| hypothetical protein B456_009G444600 [Gossypium raimondii]
Length=155

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  438  INRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +NR KDM+  LRSK+NQMAS  NMSNFANRDSLLG
Sbjct  1    MNRCKDMVTNLRSKSNQMASAFNMSNFANRDSLLG  35



>ref|XP_004206098.1| PREDICTED: syntaxin-8-like [Hydra vulgaris]
Length=238

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 62/107 (58%), Gaps = 1/107 (1%)
 Frame = +3

Query  222  DSWVREYNEAVKLADDITNMISERSSLPTTGTE-AQRHSSAIRRKITXLGTRLDSLESLL  398
            DSW ++Y++A ++  DI  +I+ER+SL  TG++ + +    IR+KIT     + S++  L
Sbjct  5    DSWQQDYDDANQIGQDIMELINERNSLQRTGSKNSAQIQCTIRKKITDFSNIIKSMKVQL  64

Query  399  SKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLL  539
             K      +T KE+ RR++ + TL S+  Q+A   N    ++R  +L
Sbjct  65   LKSAGGNVVTSKELERRQNQIDTLISREKQIAELFNKPLNSSRHGVL  111



>gb|KJB26468.1| hypothetical protein B456_004G245700 [Gossypium raimondii]
Length=200

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 55/98 (56%), Gaps = 13/98 (13%)
 Frame = +3

Query  210  AASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAI-----RRKITXLGTR  374
            A   D+W+RE  EA+KL +DI N ++ ++         Q H + +     R K+  +G +
Sbjct  5    ALMADAWIREAEEALKLVEDIENRVNNKNP------SLQHHGNCVIDIAARSKLLDVGIK  58

Query  375  LDSLESLLSKLPTKQPLTEKEINRRKDMLA--TLRSKA  482
            +D LESLL   P+K  LT ++I+ R  ML+   LR+KA
Sbjct  59   IDRLESLLRNPPSKPILTNEDIDYRWKMLSDMQLRTKA  96



>gb|KDD75355.1| hypothetical protein H632_c726p1, partial [Helicosporidium sp. 
ATCC 50920]
Length=191

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 54/103 (52%), Gaps = 6/103 (6%)
 Frame = +3

Query  216  SGDSWVREYNEAVKLADDITNMISERSS-LPTTGTEAQRHSSAIRRKITXLGTRLDSLES  392
            S D W+ E+    + A++   +I ER++     G EA R ++A RRK+  LGT LD L+ 
Sbjct  2    SKDQWLEEFEAVRESANETHKLIQERNTQYGGEGPEASRITAAARRKLGTLGTILDRLKH  61

Query  393  LLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFA  521
             L       P +E E NRR+D+++ LR +  QM   L     A
Sbjct  62   GLDG-----PESENERNRRRDLISALRGRREQMLQALKRDGAA  99



>gb|KHG02271.1| Syntaxin-52 -like protein [Gossypium arboreum]
Length=200

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 55/100 (55%), Gaps = 11/100 (11%)
 Frame = +3

Query  210  AASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAI-----RRKITXLGTR  374
            A   D+W+RE  EA+KL +DI N ++ ++         Q H + +     R K+  +G +
Sbjct  5    ALMADAWLREAEEALKLVEDIENRVNNKNP------SLQNHGNCVIDIAARSKLLDVGIK  58

Query  375  LDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMA  494
            +D LESLL   P+K  LT ++I+ R  ML+ ++ +   +A
Sbjct  59   IDRLESLLRNPPSKPILTNEDIDYRWKMLSDMQLRIKALA  98



>ref|XP_007030625.1| Syntaxin of plants 52, putative isoform 2 [Theobroma cacao]
 gb|EOY11127.1| Syntaxin of plants 52, putative isoform 2 [Theobroma cacao]
Length=200

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 54/99 (55%), Gaps = 3/99 (3%)
 Frame = +3

Query  210  AASGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAI-RRKITXLGTRLDSL  386
            A  GD+W+RE  EA KL +DI   +  ++  P+   +  R      R K+   G +LD L
Sbjct  5    ALMGDAWIREAQEASKLVEDIETRVKNKN--PSLKHQENRLVDITARSKLLEAGIKLDRL  62

Query  387  ESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTL  503
            ESLL   P+K  LT ++++ R  ML+ L+ +   +A +L
Sbjct  63   ESLLRNPPSKPILTNEDLDYRWKMLSELQLRTKALALSL  101



>ref|XP_002951465.1| Qc-SNARE, Syn8/Syntaxin8-family [Volvox carteri f. nagariensis]
 gb|EFJ47641.1| Qc-SNARE, Syn8/Syntaxin8-family [Volvox carteri f. nagariensis]
Length=234

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 60/112 (54%), Gaps = 11/112 (10%)
 Frame = +3

Query  213  ASGDSWVREYNEAVKLADDITNMISERS-SLPTTGTEAQRHSSAIRRKITXLGTRLDSLE  389
            ++G  W+ E  E ++L       I ER+   P  G EA R S+A R+K+  LG +LD L 
Sbjct  5    SAGTCWI-ENRETLQL-------IQERNLRYPNGGPEASRLSAAARKKLGTLGVQLDRLL  56

Query  390  SLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNF-ANRDSLLG  542
              L      + L+E E NRR+D+L  LR++  QM   +  S   ++RD+L G
Sbjct  57   RWLDT-SDAEALSEPEKNRRRDLLYDLRNRREQMQLAIKRSQGQSDRDALFG  107



>ref|XP_010041363.1| PREDICTED: uncharacterized protein LOC104430313 [Eucalyptus grandis]
Length=191

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 58/102 (57%), Gaps = 5/102 (5%)
 Frame = +3

Query  222  DSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLESLLS  401
            D+W+RE  EA +L  ++ + +  ++       E  R S+A + K+  LGT+LD LESLL 
Sbjct  9    DAWMREAEEASELLKELESKVRNKNP-----QEMCRLSNATKSKLLELGTKLDRLESLLH  63

Query  402  KLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANR  527
              P+K  LT++++  R  ML  ++ +  ++A +L M    +R
Sbjct  64   NPPSKPVLTDEDLGWRWKMLLDIQLRTREVAVSLLMPASPSR  105



>ref|XP_003064731.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51065.1| predicted protein [Micromonas pusilla CCMP1545]
Length=246

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 52/95 (55%), Gaps = 4/95 (4%)
 Frame = +3

Query  222  DSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLESLLS  401
            D+W++E++EA ++ ++   ++ ER      G    + + A+  K   L  +LD LE+LL 
Sbjct  10   DAWLKEFDEAEQILNEAFEIVYEREDGLMEGKNVSKLTEAVNAKARALDGKLDKLENLL-  68

Query  402  KLPTKQPLTEKEINRRKDMLATLRSKANQMASTLN  506
               T+  + EKE  RR+D++  LR +  ++ S L 
Sbjct  69   ---TETRINEKETTRRRDLMRGLRVRGEEVVSLLG  100



>ref|XP_011005693.1| PREDICTED: uncharacterized protein LOC105111906 [Populus euphratica]
 ref|XP_011005694.1| PREDICTED: uncharacterized protein LOC105111906 [Populus euphratica]
Length=195

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 49/97 (51%), Gaps = 5/97 (5%)
 Frame = +3

Query  222  DSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLESLLS  401
            D+W+RE  EA KL +DI + I  +        E  R     + K+   G +LD LESLL 
Sbjct  11   DAWIREAQEATKLVEDIESRIKNKDL-----AEENRLRDIAQSKLIEAGVKLDRLESLLH  65

Query  402  KLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMS  512
              P+K  LT+++   R  ML+ L+ +   +A  L  S
Sbjct  66   NPPSKPALTKEDAEFRWKMLSDLQLRTRALALRLYTS  102



>gb|KDP23638.1| hypothetical protein JCGZ_23471 [Jatropha curcas]
Length=374

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 49/91 (54%), Gaps = 1/91 (1%)
 Frame = +3

Query  222  DSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLESLLS  401
            D+W+RE  E   L +DI + I  ++ L        R     + K+  +G +LD LESLL 
Sbjct  9    DAWIREAQEVSILVEDIESRIKNKN-LELELELGHRLKEIAKSKLFEVGIKLDRLESLLH  67

Query  402  KLPTKQPLTEKEINRRKDMLATLRSKANQMA  494
              P+K  LT++++  R +ML+  RS+   +A
Sbjct  68   NPPSKPILTKEDVEFRWEMLSDFRSRTRVLA  98



>ref|XP_011418529.1| PREDICTED: syntaxin-8-like [Crassostrea gigas]
Length=239

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 54/107 (50%), Gaps = 0/107 (0%)
 Frame = +3

Query  222  DSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLESLLS  401
            D+W+ EY+   +L   +   I+ER+    T ++  + S+ IR  +      L+ L+  L 
Sbjct  4    DTWLAEYDACARLGQTLMENITERNKHNRTSSQYTKLSAQIRVSMKQFTQSLNKLKQSLI  63

Query  402  KLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLLG  542
            +  +   +T++E+ RR+ M+  L +K  Q+       N  +R SL+G
Sbjct  64   RASSSYHITQREVERRQMMMDNLITKEKQLDQAFKNENTESRSSLMG  110



>ref|XP_002970090.1| hypothetical protein SELMODRAFT_441012 [Selaginella moellendorffii]
 gb|EFJ29214.1| hypothetical protein SELMODRAFT_441012 [Selaginella moellendorffii]
Length=227

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 57/106 (54%), Gaps = 3/106 (3%)
 Frame = +3

Query  222  DSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLESLLS  401
            D+W +E +EA +LA+++   I   +S   +  E  R  S  +RKI  L  +++ L S L 
Sbjct  3    DAWAKELDEATRLAEEVKGSIVNANSGGMSRGERSRLLSTTKRKILILDNKVNRLTSTLE  62

Query  402  KLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDSLL  539
             L  +  L+EKE  RR+D + +L  +  Q+ S+   S  A RD LL
Sbjct  63   TL--RGQLSEKEFFRRQDAIISLGLRVKQLDSSYKSSQNA-RDDLL  105



>ref|XP_005093027.1| PREDICTED: syntaxin-8-like [Aplysia californica]
Length=190

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/91 (29%), Positives = 47/91 (52%), Gaps = 0/91 (0%)
 Frame = +3

Query  219  GDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLESLL  398
            GD+W+ EY    +L  D+   I+ER+    T +   + S+ IR K     + L+ L+  L
Sbjct  3    GDTWLSEYEACSRLGQDLMEQINERNKHARTSSAYTKLSAQIRSKTRQFTSDLNRLKQNL  62

Query  399  SKLPTKQPLTEKEINRRKDMLATLRSKANQM  491
             +      +T++E+ RR+ M+  L +K  Q+
Sbjct  63   MRASASYHITQREVERRQGMMDVLVTKEKQI  93



>ref|XP_011005695.1| PREDICTED: uncharacterized protein LOC105111907 [Populus euphratica]
 ref|XP_011005696.1| PREDICTED: uncharacterized protein LOC105111907 [Populus euphratica]
Length=195

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 49/97 (51%), Gaps = 5/97 (5%)
 Frame = +3

Query  222  DSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLESLLS  401
            D+W+RE  EA KL +DI + I  +        E  R     + K+   G +LD LESLL 
Sbjct  11   DAWIREAQEATKLVEDIESRIKNKDL-----AEENRLRDIAQSKLIEAGVKLDRLESLLH  65

Query  402  KLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMS  512
              P+K  LT+++   R  ML+ L+ +   +A  L  S
Sbjct  66   NPPSKPALTKEDSEFRWKMLSDLQLRTRALALRLYTS  102



>ref|XP_006836710.1| hypothetical protein AMTR_s00088p00114030 [Amborella trichopoda]
 gb|ERM99563.1| hypothetical protein AMTR_s00088p00114030 [Amborella trichopoda]
Length=63

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +3

Query  456  MLATLRSKANQMASTLNMSNFANRDSLL  539
            M   LRSKA+QMASTLNMSNF NR++LL
Sbjct  1    MFVNLRSKASQMASTLNMSNFGNRNNLL  28



>ref|XP_799247.2| PREDICTED: syntaxin-8-like, partial [Strongylocentrotus purpuratus]
Length=181

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 48/88 (55%), Gaps = 0/88 (0%)
 Frame = +3

Query  216  SGDSWVREYNEAVKLADDITNMISERSSLPTTGTEAQRHSSAIRRKITXLGTRLDSLESL  395
             GDSW+ +++  +++   I  MI+ER  L   G+   + ++ IR +I      +  L+  
Sbjct  5    GGDSWMTDHDACMRMGQTIIEMINERDGLQRNGSNYSKINAEIRSRIRRYQQDIQLLDQN  64

Query  396  LSKLPTKQPLTEKEINRRKDMLATLRSK  479
            L K  +   LT++E +RR+ ++  L++K
Sbjct  65   LKKASSSFHLTQREADRRRALVDNLKAK  92



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565229601645