BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF009N12

Length=564
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ADX99209.1|  zeaxanthin epoxidase                                    388   2e-128   Ipomoea nil [qian niu]
gb|AFA36620.1|  zeaxanthin epoxidase enzyme                             310   7e-104   Lolium perenne [perennial ryegrass]
ref|XP_008457782.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     324   8e-104   
gb|KDP31935.1|  hypothetical protein JCGZ_12396                         323   8e-104   Jatropha curcas
gb|ADP69105.1|  zeaxanthin epoxidase                                    323   2e-103   Cucumis sativus [cucumbers]
ref|XP_004149704.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    323   2e-103   
ref|XP_011099134.1|  PREDICTED: LOW QUALITY PROTEIN: zeaxanthin e...    320   4e-102   
gb|ADI56522.1|  zeaxanthin epoxidase                                    320   4e-102   Citrullus lanatus [wild melon]
ref|XP_010093641.1|  Zeaxanthin epoxidase                               318   1e-101   Morus notabilis
ref|XP_002523587.1|  zeaxanthin epoxidase, putative                     318   2e-101   Ricinus communis
ref|XP_007047261.1|  Zeaxanthin epoxidase (ZEP) (ABA1) isoform 2        317   4e-101   
dbj|BAB11934.1|  CpABA1                                                 315   5e-101   Vigna unguiculata
ref|XP_007047260.1|  Zeaxanthin epoxidase (ZEP) (ABA1) isoform 1        317   5e-101   
gb|AJB84624.1|  zeaxanthin epoxidase                                    317   5e-101   Camellia sinensis [black tea]
gb|ABC87737.1|  zeaxanthin epoxidase                                    306   1e-100   Coffea canephora [robusta coffee]
gb|AIU94746.1|  zeaxanthin epoxidase                                    315   2e-100   Morus alba var. multicaulis
gb|AGN03858.1|  zeaxanthin epoxidase                                    314   7e-100   Scutellaria baicalensis [Baikal skullcap]
ref|XP_002307265.1|  zeaxanthin epoxidase family protein                315   8e-100   
gb|EYU44400.1|  hypothetical protein MIMGU_mgv1a003436mg                311   2e-99    Erythranthe guttata [common monkey flower]
ref|NP_001268202.1|  zeaxanthin epoxidase                               312   2e-99    Vitis vinifera
ref|XP_007047262.1|  Zeaxanthin epoxidase (ZEP) (ABA1) isoform 3        313   3e-99    
gb|AGU91434.1|  zeaxanthin epoxidase                                    312   3e-99    Chrysanthemum boreale
dbj|BAE79556.1|  zeaxanthin epoxidase                                   312   3e-99    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|KDO79217.1|  hypothetical protein CISIN_1g005770mg                   303   5e-99    Citrus sinensis [apfelsine]
gb|AEN94901.1|  zeaxanthin epoxidase                                    311   6e-99    Cucurbita moschata [ayote]
gb|AIX87505.1|  zeaxanthin epoxidase                                    311   9e-99    Lycium barbarum [Duke of Argyll's teatree]
ref|XP_007155924.1|  hypothetical protein PHAVU_003G243800g             311   1e-98    Phaseolus vulgaris [French bean]
ref|XP_010028248.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    311   1e-98    Eucalyptus grandis [rose gum]
ref|XP_011043539.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    310   2e-98    Populus euphratica
emb|CBI21425.3|  unnamed protein product                                310   2e-98    Vitis vinifera
gb|AAR11195.1|  zeaxanthin epoxidase                                    310   2e-98    Vitis vinifera
gb|KDO79216.1|  hypothetical protein CISIN_1g005770mg                   303   2e-98    Citrus sinensis [apfelsine]
ref|XP_009767383.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     310   2e-98    Nicotiana sylvestris
gb|AIX87529.1|  zeaxanthin epoxidase                                    310   4e-98    Lycium ruthenicum
ref|XP_011005864.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    309   6e-98    Populus euphratica
sp|Q40412.1|ABA2_NICPL  RecName: Full=Zeaxanthin epoxidase, chlor...    309   7e-98    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|KDO79214.1|  hypothetical protein CISIN_1g005770mg                   303   7e-98    Citrus sinensis [apfelsine]
ref|XP_003579861.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     309   8e-98    Brachypodium distachyon [annual false brome]
ref|XP_006393902.1|  hypothetical protein EUTSA_v10003769mg             308   9e-98    
ref|XP_006393901.1|  hypothetical protein EUTSA_v10003769mg             308   9e-98    Eutrema salsugineum [saltwater cress]
gb|KJB43726.1|  hypothetical protein B456_007G213500                    308   9e-98    Gossypium raimondii
gb|KHN26473.1|  Zeaxanthin epoxidase, chloroplastic                     308   9e-98    Glycine soja [wild soybean]
ref|NP_001276261.1|  zeaxanthin epoxidase                               308   1e-97    Glycine max [soybeans]
ref|XP_009343160.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    308   1e-97    Pyrus x bretschneideri [bai li]
ref|XP_011078061.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    308   1e-97    
emb|CAX36916.1|  zeaxanthin epoxidase enzyme                            299   1e-97    Triticum aestivum [Canadian hard winter wheat]
gb|KDO79213.1|  hypothetical protein CISIN_1g005770mg                   303   1e-97    Citrus sinensis [apfelsine]
gb|ADF28630.1|  zeaxanthin epoxidase                                    308   2e-97    Solanum tuberosum [potatoes]
ref|XP_004232029.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     307   3e-97    
gb|ADF28629.1|  zeaxanthin epoxidase                                    307   3e-97    Solanum tuberosum [potatoes]
sp|Q96375.1|ABA2_CAPAN  RecName: Full=Zeaxanthin epoxidase, chlor...    307   4e-97    Capsicum annuum
ref|XP_009345968.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    307   4e-97    Pyrus x bretschneideri [bai li]
ref|XP_009345967.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    307   4e-97    
ref|NP_001274839.1|  zeaxanthin epoxidase, chloroplastic-like           306   6e-97    Solanum tuberosum [potatoes]
dbj|BAF49058.1|  zeaxanthin epoxidase                                   301   7e-97    Prunus mume [ume]
gb|AAV85824.1|  zeaxanthin epoxidase                                    306   8e-97    Eutrema halophilum
gb|ABB52077.1|  putative zeaxanthin epoxidase                           305   1e-96    Daucus carota subsp. sativus
ref|XP_009610655.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     305   2e-96    Nicotiana tomentosiformis
ref|XP_008338315.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    305   2e-96    Malus domestica [apple tree]
gb|KDO79212.1|  hypothetical protein CISIN_1g005770mg                   305   2e-96    Citrus sinensis [apfelsine]
sp|O81360.1|ABA2_PRUAR  RecName: Full=Zeaxanthin epoxidase, chlor...    305   2e-96    Prunus armeniaca
ref|XP_008338316.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    305   2e-96    
ref|XP_008338317.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    305   2e-96    Malus domestica [apple tree]
ref|XP_006842967.1|  hypothetical protein AMTR_s00076p00039590          302   2e-96    
ref|XP_004975770.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    305   2e-96    Setaria italica
sp|P93236.1|ABA2_SOLLC  RecName: Full=Zeaxanthin epoxidase, chlor...    305   2e-96    Solanum lycopersicum
ref|XP_006425899.1|  hypothetical protein CICLE_v10025089mg             305   3e-96    Citrus clementina [clementine]
dbj|BAI79257.1|  zeaxanthin epoxidase                                   305   3e-96    Citrus unshiu [satsuma mandarin]
gb|KHG01019.1|  Zeaxanthin epoxidase, chloroplastic -like protein       302   3e-96    Gossypium arboreum [tree cotton]
gb|KDO79210.1|  hypothetical protein CISIN_1g005770mg                   305   3e-96    Citrus sinensis [apfelsine]
ref|XP_003611740.1|  Zeaxanthin epoxidase                               295   3e-96    
dbj|BAE72089.1|  Lactuca sativa zeaxantin epoxidase 1                   304   4e-96    Lactuca sativa [cultivated lettuce]
ref|XP_006466600.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     304   4e-96    Citrus sinensis [apfelsine]
dbj|BAB78733.1|  zeaxanthin epoxidase                                   304   4e-96    Citrus unshiu [satsuma mandarin]
ref|XP_006653464.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    301   6e-96    
ref|XP_009103460.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     304   6e-96    Brassica rapa
gb|AAN63502.2|AF384103_1  zeaxanthin epoxidase                          295   6e-96    Triticum aestivum [Canadian hard winter wheat]
ref|XP_007204247.1|  hypothetical protein PRUPE_ppa002248mg             304   7e-96    
emb|CDY01444.1|  BnaA07g12170D                                          304   7e-96    
gb|ADC29517.1|  zeaxanthin epoxidase                                    303   8e-96    Brassica napus [oilseed rape]
dbj|BAK08085.1|  predicted protein                                      303   9e-96    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008340140.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    305   1e-95    
emb|CAN61301.1|  hypothetical protein VITISV_011317                     291   1e-95    Vitis vinifera
gb|AIP98334.1|  ZEP                                                     302   2e-95    Medicago sativa [alfalfa]
emb|CDY12798.1|  BnaC07g16350D                                          304   2e-95    Brassica napus [oilseed rape]
gb|KCW54949.1|  hypothetical protein EUGRSUZ_I00922                     300   2e-95    Eucalyptus grandis [rose gum]
ref|XP_004509142.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    302   3e-95    Cicer arietinum [garbanzo]
dbj|BAN15741.1|  zeaxanthin epoxydase                                   302   3e-95    Dianthus caryophyllus [carnation]
dbj|BAJ93704.1|  predicted protein                                      303   4e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACM68704.1|  zeaxanthin epoxidase                                    302   4e-95    Brassica rapa subsp. pekinensis [bai cai]
ref|XP_008241462.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     301   4e-95    Prunus mume [ume]
ref|XP_003638746.1|  Zeaxanthin epoxidase                               301   5e-95    
ref|XP_010269709.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     301   6e-95    Nelumbo nucifera [Indian lotus]
ref|XP_007156802.1|  hypothetical protein PHAVU_002G018700g             301   6e-95    Phaseolus vulgaris [French bean]
ref|XP_006280131.1|  hypothetical protein CARUB_v10026026mg             301   7e-95    Capsella rubella
dbj|BAA88841.1|  zea-xanthin epoxidase                                  301   8e-95    Gentiana lutea
gb|KEH27528.1|  zeaxanthin epoxidase                                    297   2e-94    Medicago truncatula
dbj|BAB39765.1|  zeaxanthin epoxidase                                   299   2e-94    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010444704.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     300   2e-94    Camelina sativa [gold-of-pleasure]
ref|NP_001052926.1|  Os04g0448900                                       300   2e-94    
gb|EAZ30898.1|  hypothetical protein OsJ_14973                          299   2e-94    Oryza sativa Japonica Group [Japonica rice]
emb|CAD40867.2|  OSJNBa0064H22.16                                       299   2e-94    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002865032.1|  hypothetical protein ARALYDRAFT_496897             300   2e-94    Arabidopsis lyrata subsp. lyrata
gb|EMS59958.1|  Zeaxanthin epoxidase, chloroplastic                     300   3e-94    Triticum urartu
ref|XP_010484561.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    298   8e-94    Camelina sativa [gold-of-pleasure]
ref|XP_004511928.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    298   1e-93    Cicer arietinum [garbanzo]
gb|KEH27527.1|  zeaxanthin epoxidase                                    297   3e-93    Medicago truncatula
ref|XP_010666612.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     297   3e-93    Beta vulgaris subsp. vulgaris [field beet]
gb|AFR11774.2|  zeaxanthin epoxidase                                    296   6e-93    Fragaria x ananassa
gb|ACE79170.1|  zeaxanthin epoxidase                                    295   1e-92    Citrus maxima [buntan]
gb|KDO79209.1|  hypothetical protein CISIN_1g005770mg                   295   2e-92    Citrus sinensis [apfelsine]
gb|AHI87686.1|  zeaxanthin epoxidase                                    295   2e-92    Lupinus luteus
ref|XP_010939417.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    291   2e-92    
gb|KFK28343.1|  hypothetical protein AALP_AA8G503900                    294   2e-92    Arabis alpina [alpine rockcress]
tpg|DAA37569.1|  TPA: hypothetical protein ZEAMMB73_483204              292   3e-92    
gb|EPS62910.1|  zeaxanthin epoxidase, chloroplastic                     290   4e-92    Genlisea aurea
ref|XP_010939416.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    291   7e-92    
ref|XP_010939415.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    292   1e-91    Elaeis guineensis
ref|XP_008668109.1|  PREDICTED: zeaxanthin epoxidase isoform X1         292   2e-91    Zea mays [maize]
tpg|DAA37570.1|  TPA: zeaxanthin epoxidase                              291   3e-91    
ref|NP_001151443.1|  zeaxanthin epoxidase                               291   3e-91    Zea mays [maize]
ref|XP_008797271.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     291   4e-91    Phoenix dactylifera
dbj|BAA88842.1|  zea-Xanthin epoxidase                                  290   7e-91    Gentiana lutea
gb|KEH27529.1|  zeaxanthin epoxidase                                    291   9e-91    Medicago truncatula
ref|XP_009410101.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     290   9e-91    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY63427.1|  BnaC08g48380D                                          281   1e-90    Brassica napus [oilseed rape]
ref|NP_001241348.1|  zeaxanthin epoxidase, chloroplastic-like           289   3e-90    Glycine max [soybeans]
ref|XP_010547517.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    286   6e-89    Tarenaya hassleriana [spider flower]
dbj|BAI79260.1|  zeaxanthin epoxidase                                   285   6e-89    Citrus sinensis [apfelsine]
dbj|BAI79258.1|  zeaxanthin epoxidase                                   285   6e-89    Citrus unshiu [satsuma mandarin]
ref|XP_008663244.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    273   1e-88    
ref|XP_009112353.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    281   4e-88    
ref|XP_009112352.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    282   1e-87    Brassica rapa
ref|XP_006494451.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    281   2e-87    Citrus sinensis [apfelsine]
emb|CDY18634.1|  BnaA09g07610D                                          281   2e-87    Brassica napus [oilseed rape]
ref|NP_201504.2|  zeaxanthin epoxidase                                  280   4e-87    Arabidopsis thaliana [mouse-ear cress]
gb|AAG17703.1|AF281655_1  zeaxanthin epoxidase                          281   4e-87    Arabidopsis thaliana [mouse-ear cress]
dbj|BAB11935.1|  AtABA1                                                 280   5e-87    Arabidopsis thaliana [mouse-ear cress]
ref|NP_851285.1|  zeaxanthin epoxidase                                  280   6e-87    Arabidopsis thaliana [mouse-ear cress]
gb|AAF82390.1|AF134577_1  zeaxanthin epoxidase                          280   7e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010939418.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    277   7e-87    
sp|C3VEQ2.1|ZEP_ONCHC  RecName: Full=Zeaxanthin epoxidase, chloro...    280   1e-86    Oncidium hybrid cultivar
emb|CDX81344.1|  BnaC09g07550D                                          278   3e-86    
gb|ACL27574.1|  zeaxanthin epoxidase                                    261   3e-85    Cucumis melo [Oriental melon]
emb|CDP02496.1|  unnamed protein product                                271   1e-83    Coffea canephora [robusta coffee]
ref|XP_002310139.1|  zeaxanthin epoxidase family protein                265   4e-81    
ref|XP_010558547.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     264   8e-81    Tarenaya hassleriana [spider flower]
gb|KHN42080.1|  Zeaxanthin epoxidase, chloroplastic                     263   2e-80    Glycine soja [wild soybean]
gb|AES94698.2|  zeaxanthin epoxidase                                    254   3e-78    Medicago truncatula
ref|XP_002972237.1|  zeaxanthin epoxidase                               256   2e-77    
ref|XP_002984150.1|  hypothetical protein SELMODRAFT_234460             255   3e-77    Selaginella moellendorffii
gb|EAY94319.1|  hypothetical protein OsI_16086                          250   1e-75    Oryza sativa Indica Group [Indian rice]
ref|XP_008358098.1|  PREDICTED: LOW QUALITY PROTEIN: zeaxanthin e...    247   6e-75    
gb|EYU39329.1|  hypothetical protein MIMGU_mgv1a005544mg                244   7e-75    Erythranthe guttata [common monkey flower]
ref|XP_010028251.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    243   2e-74    
ref|XP_004975774.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    247   2e-74    Setaria italica
ref|XP_010028249.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    244   3e-73    Eucalyptus grandis [rose gum]
ref|XP_001767201.1|  predicted protein                                  244   3e-73    
ref|XP_010028250.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    243   1e-72    Eucalyptus grandis [rose gum]
gb|AGK25933.1|  zeaxanthin epoxidase                                    233   8e-72    Eriobotrya japonica [loquat]
gb|AHE41420.1|  zeaxanthin epoxidase                                    219   6e-69    Lycium chinense [Chinese boxthorn]
gb|EYU39330.1|  hypothetical protein MIMGU_mgv1a005544mg                228   9e-69    Erythranthe guttata [common monkey flower]
gb|AGS79171.1|  zeaxanthin epoxidase                                    216   4e-68    Fagopyrum tataricum [Kangra buckwheat]
ref|XP_006425928.1|  hypothetical protein CICLE_v10027323mg             223   3e-65    
gb|AFW58424.1|  hypothetical protein ZEAMMB73_168386                    210   4e-64    
ref|XP_011457329.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    209   2e-63    Fragaria vesca subsp. vesca
gb|AAL91193.1|  zeaxanthin epoxidase precursor                          212   2e-62    Arabidopsis thaliana [mouse-ear cress]
gb|ABK55738.1|  zeaxanthin epoxidase                                    201   1e-61    Cucumis sativus [cucumbers]
gb|KDO79163.1|  hypothetical protein CISIN_1g0151672mg                  195   5e-58    Citrus sinensis [apfelsine]
ref|XP_005646300.1|  FAD/NAD(P)-binding domain-containing protein       197   9e-56    Coccomyxa subellipsoidea C-169
gb|ABK54291.1|  zeaxanthin epoxidase                                    191   1e-55    Solanum tuberosum [potatoes]
gb|AFK33361.1|  unknown                                                 184   2e-54    Lotus japonicus
emb|CCI79384.1|  zeaxanthin epoxidase                                   174   1e-47    Chromochloris zofingiensis
gb|AAO48941.1|  zeaxanthin epoxidase precursor                          170   6e-46    Chlamydomonas sp. W80
gb|AAS48098.1|  zexanthin epoxidase                                     155   3e-45    Citrus sinensis [apfelsine]
ref|XP_005844735.1|  hypothetical protein CHLNCDRAFT_138731             166   2e-44    Chlorella variabilis
ref|XP_011399382.1|  Zeaxanthin epoxidase, chloroplastic                161   7e-43    Auxenochlorella protothecoides
gb|ADJ55718.1|  zeaxanthin epoxidase                                    149   1e-42    Musa beccarii
gb|AEK69513.1|  zeaxanthin epoxidase 3                                  159   4e-42    Glycine max [soybeans]
gb|ADJ55711.1|  zeaxanthin epoxidase                                    147   4e-42    Musa balbisiana [starchy banana]
gb|ADJ55721.1|  zeaxanthin epoxidase                                    147   6e-42    Ensete ventricosum
ref|XP_001701701.1|  zeaxanthin epoxidase                               159   7e-42    Chlamydomonas reinhardtii
gb|ADJ55713.1|  zeaxanthin epoxidase                                    146   2e-41    Musa ornata [flowering banana]
gb|ADJ55720.1|  zeaxanthin epoxidase                                    145   3e-41    Musella lasiocarpa
gb|ADJ55709.1|  zeaxanthin epoxidase                                    145   4e-41    Musa acuminata [banana]
gb|ADJ55715.1|  zeaxanthin epoxidase                                    145   4e-41    Musa troglodytarum [fe'i banana]
ref|XP_010257461.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    146   3e-38    Nelumbo nucifera [Indian lotus]
ref|XP_010257458.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    147   4e-38    Nelumbo nucifera [Indian lotus]
ref|XP_010257459.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    147   4e-38    Nelumbo nucifera [Indian lotus]
dbj|BAG68957.1|  zeaxanthin epoxidase                                   144   4e-38    Brassica napus [oilseed rape]
ref|XP_002953670.1|  hypothetical protein VOLCADRAFT_75879              147   1e-37    Volvox carteri f. nagariensis
gb|KIZ01704.1|  zeaxanthin epoxidase                                    133   7e-34    Monoraphidium neglectum
dbj|BAD07276.1|  zeaxanthin epoxidase                                   131   3e-33    Citrus unshiu [satsuma mandarin]
gb|ABW97847.1|  ABA2                                                    131   1e-32    Nicotiana tabacum [American tobacco]
ref|XP_008350906.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    131   2e-32    
ref|XP_002268367.2|  PREDICTED: zeaxanthin epoxidase, chloroplast...    129   1e-31    Vitis vinifera
ref|XP_010659557.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    129   1e-31    Vitis vinifera
ref|XP_002512157.1|  zeaxanthin epoxidase, putative                     125   2e-30    
gb|AFK39661.1|  unknown                                                 119   7e-30    Lotus japonicus
ref|XP_008231370.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    122   3e-29    
ref|XP_011002325.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    122   4e-29    Populus euphratica
ref|XP_006369457.1|  hypothetical protein POPTR_0001s23620g             121   7e-29    
ref|XP_011002324.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    120   1e-28    Populus euphratica
gb|KEH29085.1|  antheraxanthin epoxidase/zeaxanthin epoxidase           119   2e-28    Medicago truncatula
gb|KDP20392.1|  hypothetical protein JCGZ_05275                         120   2e-28    Jatropha curcas
ref|XP_008375252.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    119   2e-28    
ref|XP_009354804.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    119   4e-28    
ref|XP_009356317.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    119   4e-28    
ref|XP_003605012.1|  Zeaxanthin epoxidase                               119   4e-28    Medicago truncatula
emb|CAN75880.1|  hypothetical protein VITISV_024453                     122   4e-28    Vitis vinifera
ref|XP_003534337.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    118   6e-28    Glycine max [soybeans]
ref|XP_006586729.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    118   6e-28    Glycine max [soybeans]
gb|KHN05293.1|  Zeaxanthin epoxidase, chloroplastic                     118   7e-28    Glycine soja [wild soybean]
gb|KEH29084.1|  antheraxanthin epoxidase/zeaxanthin epoxidase           115   6e-27    Medicago truncatula
ref|XP_008231369.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    115   7e-27    Prunus mume [ume]
gb|KEH29086.1|  antheraxanthin epoxidase/zeaxanthin epoxidase           115   7e-27    Medicago truncatula
ref|XP_007133854.1|  hypothetical protein PHAVU_011G214600g             114   2e-26    Phaseolus vulgaris [French bean]
ref|XP_006850014.1|  hypothetical protein AMTR_s00022p00182600          115   2e-26    
ref|XP_007221074.1|  hypothetical protein PRUPE_ppa016605mg             113   4e-26    
ref|XP_006586730.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    110   4e-25    Glycine max [soybeans]
ref|XP_010257460.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    109   6e-25    Nelumbo nucifera [Indian lotus]
ref|XP_007219109.1|  hypothetical protein PRUPE_ppa015657mg             109   8e-25    
gb|EYU27117.1|  hypothetical protein MIMGU_mgv1a020551mg                104   3e-23    Erythranthe guttata [common monkey flower]
ref|XP_011087105.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    103   2e-22    Sesamum indicum [beniseed]
ref|XP_011087095.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  95.5    1e-19    
ref|XP_002502759.1|  zeaxanthin epoxidase                             95.1    2e-19    Micromonas commoda
ref|XP_003060868.1|  zeaxanthin epoxidase                             93.2    9e-19    Micromonas pusilla CCMP1545
ref|XP_003083516.1|  zeaxanthin epoxidase precursor (ISS)             91.3    4e-18    
emb|CEG00292.1|  Monooxygenase, FAD-binding                           91.3    6e-18    Ostreococcus tauri
gb|EYU27115.1|  hypothetical protein MIMGU_mgv1a007399mg              89.0    1e-17    Erythranthe guttata [common monkey flower]
ref|XP_006586731.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  86.7    1e-16    
ref|XP_011468712.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  86.7    1e-16    Fragaria vesca subsp. vesca
ref|XP_007512298.1|  zeaxanthin epoxidase                             87.0    2e-16    Bathycoccus prasinos
ref|XP_001421564.1|  zeaxanthin epoxidase (ABA1) (NPQ2)               84.7    6e-16    Ostreococcus lucimarinus CCE9901
gb|KHN36228.1|  Zeaxanthin epoxidase, chloroplastic                   75.1    2e-12    Glycine soja [wild soybean]
gb|EWM27076.1|  zeaxanthin epoxidase                                  73.6    7e-12    Nannochloropsis gaditana
ref|XP_002178367.1|  zeaxanthin epoxidase                             68.2    4e-10    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_009040452.1|  hypothetical protein AURANDRAFT_31758            67.8    4e-10    Aureococcus anophagefferens
ref|XP_002506632.1|  predicted protein                                66.6    6e-10    Micromonas commoda
ref|XP_002291549.1|  predicted protein                                67.4    9e-10    Thalassiosira pseudonana CCMP1335
ref|XP_002180238.1|  zeaxanthin epoxidase                             67.0    1e-09    Phaeodactylum tricornutum CCAP 1055/1
emb|CAH25347.1|  zeaxanthin epoxidase                                 64.3    1e-09    Guillardia theta
emb|CBJ27312.1|  zeaxanthin epoxidase, chloroplast precursor          65.5    3e-09    Ectocarpus siliculosus
ref|XP_005836989.1|  zeaxanthin epoxidase, plastid-targeted           64.7    5e-09    Guillardia theta CCMP2712
ref|XP_002952254.1|  hypothetical protein VOLCADRAFT_92803            64.7    5e-09    Volvox carteri f. nagariensis
ref|WP_040935469.1|  Zeaxanthin epoxidase                             63.9    5e-09    
ref|WP_027336971.1|  monooxygenase                                    63.9    7e-09    Halomonas sp. HL-48
ref|WP_040945347.1|  Zeaxanthin epoxidase                             63.5    9e-09    
gb|KIE13607.1|  Zeaxanthin epoxidase                                  63.5    1e-08    Tolypothrix bouteillei VB521301
ref|WP_030054615.1|  monooxygenase                                    63.2    1e-08    
ref|WP_017747777.1|  hypothetical protein                             63.2    1e-08    Scytonema hofmannii
gb|EJK56707.1|  hypothetical protein THAOC_23352                      63.2    2e-08    Thalassiosira oceanica
gb|EFL17226.1|  predicted protein                                     62.8    2e-08    Streptomyces sp. C
ref|WP_035150325.1|  Zeaxanthin epoxidase                             62.8    2e-08    Calothrix sp. 336/3
ref|WP_042801652.1|  hypothetical protein                             62.8    2e-08    
ref|XP_009037524.1|  hypothetical protein AURANDRAFT_71741            63.2    2e-08    Aureococcus anophagefferens
ref|XP_002176935.1|  precursor of protein zeaxanthin epoxidase-li...  62.8    2e-08    Phaeodactylum tricornutum CCAP 1055/1
ref|WP_019354320.1|  monooxygenase                                    62.4    3e-08    Streptomyces sp. AA1529
gb|AFC31731.1|  hypothetical protein PM3016_4999                      60.8    3e-08    Paenibacillus mucilaginosus 3016
ref|XP_005782375.1|  zeaxanthin epoxidase                             62.0    4e-08    Emiliania huxleyi CCMP1516
ref|XP_005773665.1|  hypothetical protein EMIHUDRAFT_444553           62.0    5e-08    Emiliania huxleyi CCMP1516
ref|XP_005790220.1|  hypothetical protein EMIHUDRAFT_440259           62.0    5e-08    Emiliania huxleyi CCMP1516
ref|XP_002287317.1|  zeaxanthin epoxidase                             61.6    5e-08    Thalassiosira pseudonana CCMP1335
ref|WP_036050198.1|  hypothetical protein                             61.2    7e-08    Bradyrhizobium sp. Tv2a-2
ref|WP_027761307.1|  FAD-dependent oxidoreductase                     60.8    7e-08    Streptomyces sp. CNT318
ref|WP_012873808.1|  Zeaxanthin epoxidase                             60.8    7e-08    Sphaerobacter thermophilus
ref|WP_025849891.1|  2-polyprenyl-6-methoxyphenol hydroxylase         60.8    8e-08    Paenibacillus ehimensis
ref|WP_016362849.1|  2-polyprenyl-6-methoxyphenol hydroxylase         60.8    8e-08    Paenibacillus mucilaginosus
ref|WP_013919332.1|  2-polyprenyl-6-methoxyphenol hydroxylase         60.8    9e-08    Paenibacillus mucilaginosus
ref|WP_034681042.1|  hypothetical protein                             60.1    1e-07    Bacillus mannanilyticus
gb|ETA70988.1|  2-polyprenyl-6-methoxyphenol hydroxylase-like oxi...  60.1    1e-07    Actinospica robiniae DSM 44927
ref|XP_005779995.1|  zeaxanthin epoxidase                             60.5    1e-07    Emiliania huxleyi CCMP1516
ref|WP_034272273.1|  hypothetical protein                             60.1    1e-07    
ref|WP_030075101.1|  monooxygenase                                    60.1    2e-07    Streptomyces decoyicus
ref|WP_020130856.1|  hypothetical protein                             59.7    2e-07    Streptomyces sp. 303MFCol5.2
gb|EMR86752.1|  putative fad binding domain protein                   59.7    2e-07    Botrytis cinerea BcDW1
ref|WP_037816129.1|  FAD-dependent oxidoreductase                     59.3    2e-07    Streptomyces sp. NRRL F-3213
emb|CDQ32764.1|  FAD-dependent urate hydroxylase                      58.9    3e-07    Virgibacillus halodenitrificans
ref|XP_001545609.1|  hypothetical protein BC1G_15836                  59.3    3e-07    
emb|CBX87031.1|  BcBOA8 protein                                       59.3    3e-07    
ref|WP_024874071.1|  FAD-dependent oxidoreductase                     58.9    3e-07    
ref|WP_033319686.1|  monooxygenase                                    58.9    4e-07    
ref|WP_030802287.1|  monooxygenase                                    58.9    4e-07    
ref|WP_030969949.1|  FAD-dependent oxidoreductase                     57.8    4e-07    
ref|WP_030410232.1|  monooxygenase                                    58.5    4e-07    
ref|WP_017641848.1|  monooxygenase                                    58.5    5e-07    
ref|WP_007654691.1|  FAD-dependent oxidoreductase                     58.2    5e-07    
ref|WP_038518718.1|  FAD-dependent oxidoreductase                     58.2    6e-07    
ref|WP_037697987.1|  monooxygenase                                    58.2    6e-07    
ref|XP_005783385.1|  hypothetical protein EMIHUDRAFT_462793           58.5    6e-07    
ref|WP_007034332.1|  FAD-dependent oxidoreductase                     58.2    6e-07    
ref|WP_030872945.1|  monooxygenase                                    58.2    6e-07    
ref|WP_036269262.1|  Zeaxanthin epoxidase                             58.2    6e-07    
ref|WP_040243496.1|  monooxygenase                                    58.2    7e-07    
ref|WP_035974617.1|  2-polyprenyl-6-methoxyphenol hydroxylase         57.8    7e-07    
ref|WP_030991665.1|  monooxygenase                                    57.8    8e-07    
gb|EHR00203.1|  2-polyprenyl-6-methoxyphenol hydroxylase-like oxi...  57.8    8e-07    
ref|WP_005168444.1|  hypothetical protein                             57.8    8e-07    
ref|WP_036009579.1|  monooxygenase                                    57.8    9e-07    
ref|WP_027743469.1|  monooxygenase                                    57.4    9e-07    
ref|WP_007026282.1|  FAD-dependent oxidoreductase                     57.8    9e-07    
ref|XP_005642676.1|  FAD/NAD(P)-binding domain-containing protein     57.4    9e-07    
ref|WP_036692954.1|  2-polyprenyl-6-methoxyphenol hydroxylase         57.8    9e-07    
ref|WP_037798968.1|  monooxygenase                                    57.4    1e-06    
ref|WP_037345994.1|  FAD-dependent oxidoreductase                     57.4    1e-06    
ref|WP_019324443.1|  monooxygenase                                    57.4    1e-06    
ref|WP_034322102.1|  FAD-dependent oxidoreductase                     57.4    1e-06    
ref|WP_043847926.1|  FAD-dependent oxidoreductase                     57.0    1e-06    
ref|WP_036443449.1|  salicylate hydroxylase                           57.4    1e-06    
ref|WP_043777351.1|  hypothetical protein                             57.0    1e-06    
emb|CDO27092.1|  putative salicylate hydroxylase                      57.4    1e-06    
ref|WP_043818507.1|  hypothetical protein                             57.0    1e-06    
ref|WP_031156300.1|  monooxygenase                                    57.0    1e-06    
ref|WP_031147641.1|  monooxygenase                                    57.0    1e-06    
ref|WP_014397527.1|  FAD-dependent oxidoreductase                     57.0    1e-06    
ref|WP_020576161.1|  hypothetical protein                             57.0    1e-06    
ref|WP_035412830.1|  monooxygenase                                    57.0    1e-06    
ref|WP_011958891.1|  FAD-binding monooxygenase                        56.6    2e-06    
ref|WP_033363407.1|  hypothetical protein                             56.6    2e-06    
ref|WP_033333595.1|  FAD-dependent oxidoreductase                     56.6    2e-06    
ref|WP_037866143.1|  monooxygenase                                    56.6    2e-06    
ref|XP_007509238.1|  zeaxanthin epoxidase                             56.6    2e-06    
ref|WP_042254150.1|  monooxygenase                                    56.6    2e-06    
ref|XP_006477108.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  56.6    2e-06    
ref|WP_037849223.1|  monooxygenase                                    56.6    2e-06    
ref|WP_030209116.1|  monooxygenase                                    56.6    2e-06    
gb|EPS35034.1|  hypothetical protein PDE_09999                        56.6    2e-06    
ref|XP_010258756.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  56.2    2e-06    
ref|WP_033437274.1|  hypothetical protein                             56.2    2e-06    
ref|WP_037650064.1|  hypothetical protein                             56.2    2e-06    
ref|WP_036047974.1|  2-polyprenyl-6-methoxyphenol hydroxylase         56.2    3e-06    
ref|WP_015098984.1|  Monooxygenase, FAD-binding protein               56.2    3e-06    
ref|XP_003555852.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  56.2    3e-06    
ref|XP_010258755.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  56.2    3e-06    
ref|XP_006477107.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  56.2    3e-06    
ref|XP_010030694.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  56.2    3e-06    
ref|WP_033087847.1|  hypothetical protein                             56.2    3e-06    
dbj|GAM47023.1|  hypothetical protein NS07_v2contig00042-0014         56.2    3e-06    
ref|WP_015607109.1|  monooxygenase (secreted protein)                 55.8    3e-06    
ref|WP_033254600.1|  FAD-dependent oxidoreductase                     55.8    3e-06    
ref|WP_031121891.1|  monooxygenase                                    55.8    3e-06    
ref|WP_024800599.1|  monooxygenase                                    55.8    3e-06    
ref|WP_039823632.1|  monooxygenase                                    55.8    4e-06    
ref|WP_020633872.1|  hypothetical protein                             55.8    4e-06    
ref|WP_041562992.1|  monooxygenase                                    55.8    4e-06    
gb|KIA61948.1|  monooxygenase                                         55.8    4e-06    
ref|WP_043676538.1|  monooxygenase                                    55.8    4e-06    
dbj|BAO90544.1|  3-hydroxybenzoate-6-hydroxylase                      55.8    4e-06    
ref|WP_041965023.1|  2-polyprenyl-6-methoxyphenol hydroxylase         55.5    4e-06    
ref|WP_013795891.1|  monooxygenase                                    55.5    4e-06    
ref|WP_007197502.1|  salicylate hydroxylase                           55.5    4e-06    
gb|AFU04221.1|  FAD-dependent oxidoreductase                          55.5    4e-06    
ref|WP_030523975.1|  monooxygenase                                    55.5    4e-06    
ref|WP_035596087.1|  monooxygenase                                    55.5    5e-06    
ref|XP_008466952.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  53.9    5e-06    
ref|WP_032755515.1|  monooxygenase                                    55.5    5e-06    
ref|WP_037680129.1|  hypothetical protein                             55.5    5e-06    
ref|XP_010057481.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  54.7    5e-06    
ref|XP_010028762.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  55.5    5e-06    
ref|XP_002973417.1|  hypothetical protein SELMODRAFT_98780            55.5    6e-06    
ref|XP_010042929.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  54.7    6e-06    
ref|WP_037769678.1|  monooxygenase                                    55.5    6e-06    
ref|XP_011465237.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  55.1    6e-06    
ref|WP_028093566.1|  salicylate hydroxylase                           55.1    6e-06    
gb|AET92426.1|  3-hydroxybenzoate-6-hydroxylase                       55.1    6e-06    
ref|WP_041732868.1|  salicylate hydroxylase                           55.1    6e-06    
ref|WP_020300857.1|  salicylate hydroxylase                           55.1    6e-06    
ref|XP_006829013.1|  hypothetical protein AMTR_s00001p00248220        54.7    6e-06    
ref|WP_019764509.1|  hypothetical protein                             55.1    6e-06    
ref|XP_008352527.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  55.1    7e-06    
ref|WP_026682533.1|  hypothetical protein                             55.1    7e-06    
ref|WP_002633480.1|  FAD-dependent oxidoreductase                     55.1    7e-06    
ref|WP_018476755.1|  FAD-dependent oxidoreductase                     55.1    7e-06    
ref|WP_044856343.1|  FAD-dependent oxidoreductase                     55.1    7e-06    
ref|WP_030525514.1|  monooxygenase                                    55.1    7e-06    
ref|WP_013017779.1|  monooxygenase                                    55.1    7e-06    
ref|WP_030174010.1|  monooxygenase                                    55.1    7e-06    
ref|WP_043688728.1|  monooxygenase                                    55.1    7e-06    
gb|KCW74691.1|  hypothetical protein EUGRSUZ_E03421                   54.7    7e-06    
ref|WP_037947658.1|  hypothetical protein                             54.7    7e-06    
ref|WP_030243798.1|  FAD-dependent oxidoreductase                     55.1    7e-06    
ref|WP_030408207.1|  monooxygenase                                    54.7    7e-06    
ref|WP_018698515.1|  hypothetical protein                             54.7    8e-06    
ref|XP_008386052.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  55.1    8e-06    
ref|WP_014143998.1|  FAD-dependent monooxygenase                      54.7    8e-06    
ref|XP_003536718.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  54.7    8e-06    
ref|XP_008386051.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  55.1    8e-06    
ref|WP_006518593.1|  2-polyprenyl-6-methoxyphenol hydroxylase-lik...  54.7    8e-06    
ref|XP_004170307.1|  PREDICTED: LOW QUALITY PROTEIN: zeaxanthin e...  55.1    8e-06    
gb|KHN37394.1|  6-hydroxynicotinate 3-monooxygenase                   54.7    8e-06    
gb|KGN60465.1|  hypothetical protein Csa_3G912970                     54.7    8e-06    
ref|XP_010041421.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  54.7    8e-06    
ref|XP_009343924.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  54.7    8e-06    
ref|XP_008373660.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  54.7    8e-06    
ref|XP_004148358.1|  PREDICTED: FAD-dependent urate hydroxylase-like  54.7    8e-06    
gb|AEI66848.1|  FAD-dependent oxidoreductase                          54.7    9e-06    
ref|XP_004301737.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  54.7    9e-06    
ref|XP_009355537.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  54.7    9e-06    
ref|XP_002976490.1|  hypothetical protein SELMODRAFT_416512           54.7    9e-06    
gb|ETW99989.1|  hypothetical protein ETSY1_12985                      54.7    9e-06    
gb|KCW74669.1|  hypothetical protein EUGRSUZ_E034002                  54.7    9e-06    
ref|WP_035898541.1|  salicylate hydroxylase                           54.7    9e-06    
ref|WP_020417681.1|  FAD-dependent oxidoreductase                     54.7    9e-06    
ref|WP_010496419.1|  2-polyprenyl-6-methoxyphenol hydroxylase         54.7    9e-06    
ref|WP_043711131.1|  FAD-dependent oxidoreductase                     54.7    9e-06    
ref|WP_037322633.1|  FAD-dependent oxidoreductase                     54.7    9e-06    
ref|XP_009349776.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  54.7    9e-06    
gb|KFK36463.1|  hypothetical protein AALP_AA4G127900                  54.7    9e-06    
ref|XP_008373658.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  54.7    9e-06    
ref|WP_012892046.1|  monooxygenase                                    54.7    9e-06    
ref|XP_005854040.1|  ctf2a like oxidoreductase                        54.7    9e-06    
ref|WP_035475388.1|  monooxygenase                                    54.7    9e-06    
ref|XP_009355536.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  54.7    9e-06    
ref|WP_030723546.1|  monooxygenase                                    54.7    9e-06    
gb|ABS68460.1|  monooxygenase FAD-binding                             54.7    1e-05    
ref|WP_034416989.1|  hypothetical protein                             54.7    1e-05    
ref|WP_027348999.1|  monooxygenase                                    54.7    1e-05    
ref|WP_040674534.1|  hypothetical protein                             54.7    1e-05    
ref|XP_008386050.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  54.3    1e-05    
ref|WP_033295932.1|  FAD-dependent oxidoreductase                     54.3    1e-05    
gb|EFL05295.1|  predicted protein                                     54.3    1e-05    
ref|XP_001022740.1|  Monooxygenase family protein                     54.7    1e-05    
ref|WP_006633800.1|  Zeaxanthin epoxidase                             54.3    1e-05    
ref|XP_010057477.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  54.3    1e-05    
gb|EHA21661.1|  hypothetical protein ASPNIDRAFT_131431                54.3    1e-05    
emb|CAK42732.1|  unnamed protein product                              54.3    1e-05    
ref|WP_041577170.1|  hypothetical protein                             54.3    1e-05    
ref|WP_019950370.1|  hypothetical protein                             54.3    1e-05    
ref|WP_037716589.1|  FAD-dependent oxidoreductase                     54.3    1e-05    
ref|XP_001397366.2|  hypothetical protein ANI_1_1352144               54.3    1e-05    
ref|WP_035537188.1|  monooxygenase                                    54.3    1e-05    
ref|WP_002626842.1|  FAD-dependent oxidoreductase                     54.3    1e-05    
ref|XP_002531782.1|  monoxygenase, putative                           54.3    1e-05    
ref|WP_040700173.1|  hypothetical protein                             54.3    1e-05    
ref|WP_039638336.1|  monooxygenase                                    54.3    1e-05    
ref|WP_014151945.1|  monooxygenase                                    54.3    1e-05    
ref|XP_003611372.1|  Zeaxanthin epoxidase                             54.3    1e-05    
ref|WP_030787508.1|  hypothetical protein                             54.3    1e-05    
ref|XP_001700534.1|  FAD-dependent monooxygenase                      53.9    1e-05    
ref|WP_037824855.1|  FAD-dependent monooxygenase                      54.3    1e-05    
gb|EAS50233.1|  putative salicylate 1-monooxygenase                   53.9    2e-05    
ref|XP_001589518.1|  hypothetical protein SS1G_09239                  53.9    2e-05    
ref|WP_038120433.1|  salicylate 1-monooxygenase                       53.9    2e-05    
ref|XP_001217733.1|  predicted protein                                54.3    2e-05    
ref|WP_013865897.1|  oxidoreductase                                   53.9    2e-05    
ref|WP_040325599.1|  hypothetical protein                             53.9    2e-05    
ref|WP_007357836.1|  MULTISPECIES: monooxygenase                      53.9    2e-05    
ref|WP_018698097.1|  hypothetical protein                             53.9    2e-05    
ref|XP_004288322.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  53.9    2e-05    
ref|WP_035731290.1|  MULTISPECIES: hypothetical protein               53.9    2e-05    
ref|WP_031156881.1|  monooxygenase                                    53.9    2e-05    
ref|WP_037847522.1|  MULTISPECIES: monooxygenase                      53.9    2e-05    
ref|XP_007372976.1|  salicylate hydroxylase                           53.9    2e-05    
ref|WP_018916959.1|  hypothetical protein                             53.9    2e-05    
ref|XP_006851406.1|  hypothetical protein AMTR_s00040p00065120        53.9    2e-05    
ref|WP_030083379.1|  monooxygenase                                    51.2    2e-05    
ref|WP_030067355.1|  monooxygenase                                    53.5    2e-05    
ref|WP_033040437.1|  2-polyprenyl-6-methoxyphenol hydroxylase         53.5    2e-05    
ref|WP_030587150.1|  monooxygenase                                    53.5    2e-05    
ref|WP_039826870.1|  monooxygenase                                    53.5    2e-05    
emb|CEL21119.1|  Salicylate hydroxylase                               53.5    2e-05    
ref|XP_011081273.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  53.5    2e-05    
ref|WP_030759575.1|  monooxygenase                                    53.5    2e-05    
ref|XP_003056003.1|  zeaxanthin epoxidase                             53.5    2e-05    
ref|WP_019046460.1|  MULTISPECIES: hypothetical protein               53.5    2e-05    
ref|XP_009608102.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  53.5    2e-05    
ref|WP_024022645.1|  monooxygenase                                    53.5    2e-05    
ref|WP_034740744.1|  monooxygenase                                    53.5    2e-05    
ref|WP_040732884.1|  monooxygenase                                    53.5    2e-05    
ref|WP_028924670.1|  hypothetical protein                             53.1    2e-05    
ref|XP_007142787.1|  hypothetical protein PHAVU_007G016700g           52.4    2e-05    
ref|WP_040088373.1|  salicylate 1-monooxygenase                       53.5    3e-05    
ref|WP_042194144.1|  monooxygenase                                    53.1    3e-05    
ref|WP_038216728.1|  salicylate 1-monooxygenase                       53.1    3e-05    
ref|WP_037839027.1|  monooxygenase                                    51.2    3e-05    
ref|XP_002881066.1|  hypothetical protein ARALYDRAFT_481889           53.1    3e-05    
ref|XP_002945716.1|  hypothetical protein VOLCADRAFT_102693           53.1    3e-05    
ref|WP_015191032.1|  Zeaxanthin epoxidase                             53.1    3e-05    
ref|XP_003535754.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  53.1    3e-05    
ref|XP_010028755.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  53.1    3e-05    
ref|WP_037818417.1|  FAD-dependent oxidoreductase                     53.1    3e-05    
gb|KCW74677.1|  hypothetical protein EUGRSUZ_E03410                   53.1    3e-05    
ref|XP_011457616.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  53.1    3e-05    
gb|KCW74679.1|  hypothetical protein EUGRSUZ_E03410                   53.1    3e-05    
ref|XP_010057480.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  53.1    3e-05    
ref|WP_028223105.1|  hypothetical protein                             53.1    3e-05    
ref|WP_043830373.1|  2-polyprenyl-6-methoxyphenol hydroxylase         53.1    3e-05    
ref|WP_037902403.1|  hypothetical protein                             53.1    3e-05    
gb|KCW74678.1|  hypothetical protein EUGRSUZ_E03410                   52.8    3e-05    
ref|XP_010028754.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  53.1    3e-05    
ref|WP_030848935.1|  monooxygenase                                    52.8    3e-05    
ref|WP_031470328.1|  monooxygenase                                    52.8    3e-05    
gb|AHW57726.1|  humulone synthase 2                                   53.1    3e-05    
ref|XP_011092960.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  53.1    3e-05    
ref|WP_020416850.1|  monooxygenase                                    52.8    3e-05    
ref|XP_009772156.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  53.1    3e-05    
ref|WP_040598267.1|  hypothetical protein                             53.1    3e-05    
ref|WP_030923478.1|  FAD-dependent oxidoreductase                     52.8    4e-05    
gb|KCW74688.1|  hypothetical protein EUGRSUZ_E03418                   52.8    4e-05    
ref|WP_029640661.1|  hypothetical protein                             52.8    4e-05    



>gb|ADX99209.1| zeaxanthin epoxidase [Ipomoea nil]
Length=672

 Score =   388 bits (996),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 187/187 (100%), Positives = 187/187 (100%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE
Sbjct  372  RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  431

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM
Sbjct  432  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  491

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS
Sbjct  492  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  551

Query  543  EPILLRR  563
            EPILLRR
Sbjct  552  EPILLRR  558



>gb|AFA36620.1| zeaxanthin epoxidase enzyme, partial [Lolium perenne]
Length=240

 Score =   310 bits (795),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+KAW +SV+S  P+D+ SSL+SYEKE
Sbjct  2    RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKAWEESVKSRTPVDVVSSLRSYEKE  61

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHGLARMAA+MA TY+ YLGVGLGPLSFLT  RIPHPGRVGGRFFI + MPLM
Sbjct  62   RRLRVAIIHGLARMAAIMATTYRPYLGVGLGPLSFLTSLRIPHPGRVGGRFFIKIGMPLM  121

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGRP  CRLSDKANDQL +WF DDDALE+AM GEWFL P+ +  ++AS
Sbjct  122  LSWVLGGNSSKLEGRPLSCRLSDKANDQLGQWFQDDDALEQAMGGEWFLFPMSSGDNSAS  181

Query  543  EPILLRR  563
            +PI L R
Sbjct  182  QPIRLIR  188



>ref|XP_008457782.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Cucumis melo]
 gb|AID51469.1| zeaxanthin epoxidase [Cucumis melo var. makuwa]
Length=665

 Score =   324 bits (831),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 168/187 (90%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIEDGYQLALELDKAW +SV SG+PIDI SSLKSYE  
Sbjct  371  RVTLLGDSVHAMQPNMGQGGCMAIEDGYQLALELDKAWNESVASGSPIDIVSSLKSYESS  430

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RR+RV +IHG+ARMAALMA+TYKAYLGVGLGPLSFLTQFRIPHPG  GGRFFIDLAMPLM
Sbjct  431  RRIRVAVIHGMARMAALMASTYKAYLGVGLGPLSFLTQFRIPHPGTFGGRFFIDLAMPLM  490

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLGGN  KLEGRP  CRLSDKANDQLRKWF+DDDALERA+NG+WFL P +   ++ S
Sbjct  491  LNWVLGGNSSKLEGRPPACRLSDKANDQLRKWFEDDDALERAINGDWFLLP-QGGKASVS  549

Query  543  EPILLRR  563
            +PI LRR
Sbjct  550  QPICLRR  556



>gb|KDP31935.1| hypothetical protein JCGZ_12396 [Jatropha curcas]
Length=633

 Score =   323 bits (829),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 168/187 (90%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIEDGYQLALE++KAW+QS+ESG PIDI SSLKSYE+ 
Sbjct  336  RVTLLGDSVHAMQPNMGQGGCMAIEDGYQLALEIEKAWKQSIESGTPIDIVSSLKSYERA  395

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFLT++RIPHPGRVGGRFFID+AMP+M
Sbjct  396  RRLRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLTKYRIPHPGRVGGRFFIDIAMPVM  455

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR + CRLSDKA+DQLR WF+DDDALERA+N EWFL PL N     S
Sbjct  456  LSWVLGGNSSKLEGRSQCCRLSDKASDQLRTWFEDDDALERALNAEWFLLPLGNKV-VVS  514

Query  543  EPILLRR  563
            EPI L R
Sbjct  515  EPICLSR  521



>gb|ADP69105.1| zeaxanthin epoxidase [Cucumis sativus]
Length=665

 Score =   323 bits (829),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 169/187 (90%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIEDGYQLALELDKAW +SV SG+PIDI SSLKSYE  
Sbjct  371  RVTLLGDSVHAMQPNMGQGGCMAIEDGYQLALELDKAWNESVASGSPIDIVSSLKSYESS  430

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RR+RV +IHG+ARMAALMA+TYKAYLGVGLGPLSFLTQFRIPHPG +GGRFFIDLAMPLM
Sbjct  431  RRIRVAVIHGMARMAALMASTYKAYLGVGLGPLSFLTQFRIPHPGTLGGRFFIDLAMPLM  490

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLGGN  KLEGRP  CRLSDKANDQLRKWF+DDDALERA+NG+WFL P +   ++ S
Sbjct  491  LNWVLGGNSSKLEGRPPACRLSDKANDQLRKWFEDDDALERAINGDWFLLP-QGGEASVS  549

Query  543  EPILLRR  563
            +PI LR+
Sbjct  550  QPICLRK  556



>ref|XP_004149704.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004163276.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN61963.1| hypothetical protein Csa_2G277050 [Cucumis sativus]
Length=665

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 168/187 (90%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIEDGYQLALELDKAW +SV SG+PIDI SSLKSYE  
Sbjct  371  RVTLLGDSVHAMQPNMGQGGCMAIEDGYQLALELDKAWNESVASGSPIDIVSSLKSYESS  430

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RR+RV +IHG+ARMAALMA+TYKAYLGVGLGPLSFLTQFRIPHPG  GGRFFIDLAMPLM
Sbjct  431  RRIRVAVIHGMARMAALMASTYKAYLGVGLGPLSFLTQFRIPHPGTFGGRFFIDLAMPLM  490

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLGGN  KLEGRP  CRLSDKANDQLRKWF+DDDALERA+NG+WFL P +   ++ S
Sbjct  491  LNWVLGGNSSKLEGRPPACRLSDKANDQLRKWFEDDDALERAINGDWFLLP-QGGEASVS  549

Query  543  EPILLRR  563
            +PI LR+
Sbjct  550  QPICLRK  556



>ref|XP_011099134.1| PREDICTED: LOW QUALITY PROTEIN: zeaxanthin epoxidase, chloroplastic 
[Sesamum indicum]
Length=656

 Score =   320 bits (819),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 168/187 (90%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESG PID+ SSLK YE  
Sbjct  358  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGNPIDVVSSLKRYENA  417

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRV IIHGLARMAA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGR FID+ MPLM
Sbjct  418  RKLRVAIIHGLARMAAIMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRLFIDIGMPLM  477

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGNG +LEGR + CRLSDKANDQLR+WF DD+ALERA++ +WFL P+ ++T+ AS
Sbjct  478  LSWVLGGNGSELEGRVQHCRLSDKANDQLRRWFTDDEALERALDADWFLFPIGDSTA-AS  536

Query  543  EPILLRR  563
            E I L R
Sbjct  537  ETIFLSR  543



>gb|ADI56522.1| zeaxanthin epoxidase [Citrullus lanatus]
Length=665

 Score =   320 bits (820),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 166/187 (89%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIEDGYQLALELDKAW +SV SG+PIDI SSLKSYE  
Sbjct  371  RVTLLGDSVHAMQPNMGQGGCMAIEDGYQLALELDKAWNKSVVSGSPIDIVSSLKSYESS  430

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RR+RV +IHG+ARMAALMA+TYKAYLGVGLGPLSFLTQFRIPHPG  GGRFFIDLAMPLM
Sbjct  431  RRIRVAVIHGMARMAALMASTYKAYLGVGLGPLSFLTQFRIPHPGTFGGRFFIDLAMPLM  490

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLGGN  KLEGRP  CRLSDKANDQLRKWF+DDDALERA+NG+WFL P +   ++ S
Sbjct  491  LNWVLGGNSSKLEGRPPACRLSDKANDQLRKWFEDDDALERAINGDWFLLP-QGGEASVS  549

Query  543  EPILLRR  563
             PI L R
Sbjct  550  HPICLPR  556



>ref|XP_010093641.1| Zeaxanthin epoxidase [Morus notabilis]
 gb|EXB54402.1| Zeaxanthin epoxidase [Morus notabilis]
Length=666

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 166/187 (89%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED YQLALELDKAW +S++SG P+DI SSLK YEK 
Sbjct  367  RVTLLGDSIHAMQPNMGQGGCMAIEDSYQLALELDKAWEESIKSGTPVDIVSSLKRYEKA  426

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV +IHG+ARMAALMA+TYKAYLGVGLGPLSFLT++RIPHPG  GGRFFIDLAMPLM
Sbjct  427  RRLRVAVIHGMARMAALMASTYKAYLGVGLGPLSFLTKYRIPHPGTFGGRFFIDLAMPLM  486

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLGGN  KLEGRP+ CRLSDKA+DQLRKWF+DDDALERAM GEWF+ P  NAT T  
Sbjct  487  LNWVLGGNSSKLEGRPQSCRLSDKASDQLRKWFEDDDALERAMKGEWFILPHGNATGTL-  545

Query  543  EPILLRR  563
            +PI L R
Sbjct  546  QPIRLNR  552



>ref|XP_002523587.1| zeaxanthin epoxidase, putative [Ricinus communis]
 gb|EEF38782.1| zeaxanthin epoxidase, putative [Ricinus communis]
Length=665

 Score =   318 bits (814),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 166/187 (89%), Gaps = 2/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED YQLALELDKAW+QS+ESG P+D+ SSLKSYE+ 
Sbjct  369  RVTLLGDSIHAMQPNMGQGGCMAIEDSYQLALELDKAWKQSIESGTPVDVVSSLKSYERT  428

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFLT++RIPHPGRVGGRFFID+AMP+M
Sbjct  429  RRLRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLTKYRIPHPGRVGGRFFIDIAMPVM  488

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLGGN  KLEGRP  CRLSDKA+DQL+ WF+DD+ALERA+NGEWFL P  +      
Sbjct  489  LNWVLGGNSSKLEGRPLSCRLSDKASDQLQTWFEDDNALERALNGEWFLLPFGD--DAVQ  546

Query  543  EPILLRR  563
            EPI L R
Sbjct  547  EPICLSR  553



>ref|XP_007047261.1| Zeaxanthin epoxidase (ZEP) (ABA1) isoform 2 [Theobroma cacao]
 gb|EOX91418.1| Zeaxanthin epoxidase (ZEP) (ABA1) isoform 2 [Theobroma cacao]
Length=665

 Score =   317 bits (812),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 166/187 (89%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED YQLAL+LDKAW+QSVESG  +D+ SSLKSYE+ 
Sbjct  369  RVTLLGDSIHAMQPNMGQGGCMAIEDSYQLALDLDKAWKQSVESGTAVDVVSSLKSYERA  428

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFL++FRIPHPGRVGGRFFIDLAMPLM
Sbjct  429  RRLRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLSKFRIPHPGRVGGRFFIDLAMPLM  488

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   CRLSDKA+DQLR WF+D+DALE+ +NGEWFL P+ N    AS
Sbjct  489  LSWVLGGNSSKLEGRSLSCRLSDKASDQLRTWFEDNDALEQTINGEWFLFPVGNEV-VAS  547

Query  543  EPILLRR  563
            +PI L R
Sbjct  548  QPICLSR  554



>dbj|BAB11934.1| CpABA1 [Vigna unguiculata]
Length=612

 Score =   315 bits (808),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 167/187 (89%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIED YQLALELD AW QSV+SG+PIDI SSL+SYE+E
Sbjct  316  RVTLLGDSVHAMQPNMGQGGCMAIEDSYQLALELDNAWEQSVKSGSPIDIDSSLRSYERE  375

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRV IIHG+ARMAALMA+TYKAYLGVGLGPL FLT+FRIPHPGRVGGRFF+D+ MP M
Sbjct  376  RKLRVAIIHGMARMAALMASTYKAYLGVGLGPLEFLTKFRIPHPGRVGGRFFVDIMMPSM  435

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGRP  CRLSDKANDQLR+WF+DD+ALERA+NGEW L P  + TS  S
Sbjct  436  LSWVLGGNSSKLEGRPLSCRLSDKANDQLRQWFEDDEALERAINGEWILIPHGDGTSL-S  494

Query  543  EPILLRR  563
            +PI+L R
Sbjct  495  KPIVLSR  501



>ref|XP_007047260.1| Zeaxanthin epoxidase (ZEP) (ABA1) isoform 1 [Theobroma cacao]
 gb|EOX91417.1| Zeaxanthin epoxidase (ZEP) (ABA1) isoform 1 [Theobroma cacao]
Length=671

 Score =   317 bits (812),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 166/187 (89%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED YQLAL+LDKAW+QSVESG  +D+ SSLKSYE+ 
Sbjct  369  RVTLLGDSIHAMQPNMGQGGCMAIEDSYQLALDLDKAWKQSVESGTAVDVVSSLKSYERA  428

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFL++FRIPHPGRVGGRFFIDLAMPLM
Sbjct  429  RRLRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLSKFRIPHPGRVGGRFFIDLAMPLM  488

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   CRLSDKA+DQLR WF+D+DALE+ +NGEWFL P+ N    AS
Sbjct  489  LSWVLGGNSSKLEGRSLSCRLSDKASDQLRTWFEDNDALEQTINGEWFLFPVGNEV-VAS  547

Query  543  EPILLRR  563
            +PI L R
Sbjct  548  QPICLSR  554



>gb|AJB84624.1| zeaxanthin epoxidase [Camellia sinensis]
Length=667

 Score =   317 bits (812),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 165/187 (88%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIED YQLA+ELDKAW +SVESG+PID+ SSL+SYE  
Sbjct  368  RVTLLGDSVHAMQPNLGQGGCMAIEDSYQLAMELDKAWERSVESGSPIDVVSSLRSYEDA  427

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV +IHGLARMAA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGRFFIDLAMPLM
Sbjct  428  RRLRVAVIHGLARMAAIMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLM  487

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGNG  L+GR   CRLSDKANDQLR WF+DDDALERA+NGEW L P  NA   A 
Sbjct  488  LSWVLGGNGSNLDGRSLSCRLSDKANDQLRNWFEDDDALERAVNGEWCLLPYGNADG-AL  546

Query  543  EPILLRR  563
            +PI L R
Sbjct  547  KPIFLSR  553



>gb|ABC87737.1| zeaxanthin epoxidase [Coffea canephora]
Length=343

 Score =   306 bits (784),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPNLGQGGCMAIED YQLALELDKAW QS++SG+P+D+ S+LKSYE  
Sbjct  47   RVTLLGDSIHAMQPNLGQGGCMAIEDSYQLALELDKAWEQSIKSGSPMDVVSALKSYESA  106

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRV IIHGLAR+AA+MA+TYK YLGVGLGPLSFLT+FRIPHPGRVGGR FID+ MPLM
Sbjct  107  RKLRVAIIHGLARLAAIMASTYKPYLGVGLGPLSFLTKFRIPHPGRVGGRIFIDIGMPLM  166

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNAT  530
            LSWVLGGNG KLEGRP  CRL+DKA+DQL+KWF DDD+LERA+NGEWFL P+  A 
Sbjct  167  LSWVLGGNGSKLEGRPLHCRLTDKASDQLQKWFQDDDSLERALNGEWFLFPIGQAN  222



>gb|AIU94746.1| zeaxanthin epoxidase [Morus alba var. multicaulis]
Length=666

 Score =   315 bits (808),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 165/187 (88%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED YQLALELDKAW +S++SG P+DI SSLK YEK 
Sbjct  367  RVTLLGDSIHAMQPNMGQGGCMAIEDSYQLALELDKAWEESIKSGTPVDIVSSLKRYEKA  426

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV +IHG+ARMAALMA+TYKAYLGVGLGPLSFLT++RIPHPG  GGRFFIDLAMPLM
Sbjct  427  RRLRVAVIHGMARMAALMASTYKAYLGVGLGPLSFLTKYRIPHPGTFGGRFFIDLAMPLM  486

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLGGN  KLEGRP+ CRLSDKA+D LRKWF+D+DALERAM GEWF+ P  NAT T  
Sbjct  487  LNWVLGGNSSKLEGRPQSCRLSDKASDHLRKWFEDNDALERAMKGEWFILPHGNATGTL-  545

Query  543  EPILLRR  563
            +PI L R
Sbjct  546  QPIRLNR  552



>gb|AGN03858.1| zeaxanthin epoxidase [Scutellaria baicalensis]
Length=661

 Score =   314 bits (804),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 167/187 (89%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLALELDKA  +S+ESG+PID+ SSL+ YE  
Sbjct  363  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLALELDKARSRSIESGSPIDVVSSLRRYENA  422

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRV +IHGLARMAA+MA TYKAYLGVGLGPLSFLT+FRIPHPGRVGGR FID+ MPLM
Sbjct  423  RKLRVAVIHGLARMAAIMATTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRVFIDIGMPLM  482

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGNG KLEGR  QCRLSDKA+DQLRKWFDDDDALERA++ EW+L P+ ++T+ AS
Sbjct  483  LSWVLGGNGSKLEGRALQCRLSDKASDQLRKWFDDDDALERALDAEWYLFPIGDSTA-AS  541

Query  543  EPILLRR  563
            E I L R
Sbjct  542  ETIFLSR  548



>ref|XP_002307265.1| zeaxanthin epoxidase family protein [Populus trichocarpa]
 gb|EEE94261.1| zeaxanthin epoxidase family protein [Populus trichocarpa]
Length=692

 Score =   315 bits (806),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 167/187 (89%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIED YQLALELDKAW+QSVESG  +D+ SSL+SYE  
Sbjct  364  RVTLLGDSVHAMQPNMGQGGCMAIEDSYQLALELDKAWKQSVESGTSVDVISSLRSYENA  423

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGRFF+D+AMP+M
Sbjct  424  RRLRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFVDIAMPVM  483

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLGGN  KLEGR   CRLSDKA+DQLR+WF+DDDALERA++GEWFL P  N  + AS
Sbjct  484  LNWVLGGNSSKLEGRSLSCRLSDKASDQLRRWFEDDDALERALDGEWFLLPCGN-EAVAS  542

Query  543  EPILLRR  563
            +PI L R
Sbjct  543  QPIGLSR  549



>gb|EYU44400.1| hypothetical protein MIMGU_mgv1a003436mg [Erythranthe guttata]
Length=585

 Score =   311 bits (796),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 165/187 (88%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+ELDKAW QSVE+G  ID+ SSLK YE  
Sbjct  287  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAMELDKAWAQSVETGTQIDVVSSLKRYENA  346

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRV +IHGLARMAA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGR FID+ MPLM
Sbjct  347  RKLRVAVIHGLARMAAIMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRVFIDIGMPLM  406

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGNG KLEGR  QCRLSDKA+DQLR WF DD+ALERA++ +WFL P+ ++T+ AS
Sbjct  407  LSWVLGGNGSKLEGRALQCRLSDKASDQLRTWFSDDEALERALDADWFLFPIGDSTA-AS  465

Query  543  EPILLRR  563
            E I L R
Sbjct  466  ETIFLSR  472



>ref|NP_001268202.1| zeaxanthin epoxidase [Vitis vinifera]
 gb|AFP28801.1| zeaxanthin epoxidase 1 [Vitis vinifera]
Length=658

 Score =   312 bits (800),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 164/187 (88%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIED YQLA+ELDKAW QS++SG PID+ S LKSYEK 
Sbjct  363  RVTLLGDSVHAMQPNMGQGGCMAIEDSYQLAMELDKAWEQSIKSGTPIDVVSCLKSYEKA  422

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RR+RV +IHG+ARMAA+MA+TYKAYLGVGLGPLSFLT+ RIPHPGRVGGRFFID+AMPLM
Sbjct  423  RRIRVAVIHGMARMAAIMASTYKAYLGVGLGPLSFLTKLRIPHPGRVGGRFFIDIAMPLM  482

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGRP  CRLSDKANDQLR+WF+DDDALERA+ GEWFL P   +  +  
Sbjct  483  LSWVLGGNSSKLEGRPPSCRLSDKANDQLRRWFEDDDALERAIGGEWFLLP---SGESGL  539

Query  543  EPILLRR  563
            +PI L +
Sbjct  540  QPICLSK  546



>ref|XP_007047262.1| Zeaxanthin epoxidase (ZEP) (ABA1) isoform 3 [Theobroma cacao]
 gb|EOX91419.1| Zeaxanthin epoxidase (ZEP) (ABA1) isoform 3 [Theobroma cacao]
Length=666

 Score =   313 bits (801),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 166/188 (88%), Gaps = 2/188 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED YQLAL+LDKAW+QSVESG  +D+ SSLKSYE+ 
Sbjct  369  RVTLLGDSIHAMQPNMGQGGCMAIEDSYQLALDLDKAWKQSVESGTAVDVVSSLKSYERA  428

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFL++FRIPHPGRVGGRFFIDLAMPLM
Sbjct  429  RRLRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLSKFRIPHPGRVGGRFFIDLAMPLM  488

Query  363  LSWVLGGN-GEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTA  539
            LSWVLGGN   KLEGR   CRLSDKA+DQLR WF+D+DALE+ +NGEWFL P+ N    A
Sbjct  489  LSWVLGGNSSSKLEGRSLSCRLSDKASDQLRTWFEDNDALEQTINGEWFLFPVGNEV-VA  547

Query  540  SEPILLRR  563
            S+PI L R
Sbjct  548  SQPICLSR  555



>gb|AGU91434.1| zeaxanthin epoxidase [Chrysanthemum boreale]
Length=658

 Score =   312 bits (800),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 164/187 (88%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            R+TLLGDS+HAMQPNLGQGGCMAIED YQLALELDKAW QS +SGAPIDI SSL+ YE  
Sbjct  361  RITLLGDSVHAMQPNLGQGGCMAIEDSYQLALELDKAWIQSTKSGAPIDIQSSLRRYENA  420

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV +IHGLARMAA+MA+TYKAYLGVGLGPLSFLT FRIPHPGRVGGRFFID+ MPLM
Sbjct  421  RRLRVAVIHGLARMAAIMASTYKAYLGVGLGPLSFLTNFRIPHPGRVGGRFFIDIGMPLM  480

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGNG KLEGRP+ CRL+DKAND+L+ WF DDDALERA+ GEWFL P+  +++  S
Sbjct  481  LSWVLGGNGSKLEGRPQSCRLTDKANDELQNWFRDDDALERALTGEWFLLPI-GSSNADS  539

Query  543  EPILLRR  563
             P+ L R
Sbjct  540  APVSLSR  546



>dbj|BAE79556.1| zeaxanthin epoxidase [Chrysanthemum x morifolium]
Length=658

 Score =   312 bits (799),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 164/187 (88%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            R+TLLGDS+HAMQPNLGQGGCMAIED YQLALELDKAW QS +SGAPIDI SSL+ YE  
Sbjct  361  RITLLGDSVHAMQPNLGQGGCMAIEDSYQLALELDKAWIQSTKSGAPIDIQSSLRRYENA  420

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV +IHGLARMAA+MA+TYKAYLGVGLGPLSFLT FRIPHPGRVGGRFFID+ MPLM
Sbjct  421  RRLRVAVIHGLARMAAIMASTYKAYLGVGLGPLSFLTNFRIPHPGRVGGRFFIDIGMPLM  480

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGNG KLEGRP+ CRL+DKAND+L+ WF DDDALERA+ GEWFL P+  +++  S
Sbjct  481  LSWVLGGNGSKLEGRPQSCRLTDKANDELQNWFRDDDALERALTGEWFLLPI-GSSNADS  539

Query  543  EPILLRR  563
             P+ L R
Sbjct  540  APVSLSR  546



>gb|KDO79217.1| hypothetical protein CISIN_1g005770mg [Citrus sinensis]
Length=365

 Score =   303 bits (775),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 161/185 (87%), Gaps = 1/185 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+KA ++S ES  PIDI S+LKSYE+ 
Sbjct  65   RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERA  124

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV +IHGLAR AA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGRFFIDLAMPLM
Sbjct  125  RRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLM  184

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   C+LSDKA+D LR WF DDDALERAMNGEWFL P   + +  S
Sbjct  185  LSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVP-SGSENVVS  243

Query  543  EPILL  557
            +PI L
Sbjct  244  QPIYL  248



>gb|AEN94901.1| zeaxanthin epoxidase [Cucurbita moschata]
Length=665

 Score =   311 bits (798),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 164/187 (88%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            R+TLLGDS+HAMQPN+GQGGCMAIED YQLALELDKAW +SV S +PIDI SS+K YE  
Sbjct  371  RITLLGDSVHAMQPNMGQGGCMAIEDAYQLALELDKAWNESVVSRSPIDIVSSMKRYEST  430

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RR++V +IHG+ARMAA MA+TYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM
Sbjct  431  RRIQVAVIHGMARMAATMASTYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  490

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLGGN  KLEGRP  CRLSDKAND+LRKWF+DDDAL+RA+NGEWFL P  +  S  S
Sbjct  491  LNWVLGGNSSKLEGRPPACRLSDKANDELRKWFEDDDALQRAINGEWFLLPQGDEASV-S  549

Query  543  EPILLRR  563
            +PI L R
Sbjct  550  QPIRLSR  556



>gb|AIX87505.1| zeaxanthin epoxidase [Lycium barbarum]
Length=662

 Score =   311 bits (797),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 166/187 (89%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIED YQLALELDKAW +S E+G+P+DI SSL+SYE  
Sbjct  365  RVTLLGDSVHAMQPNLGQGGCMAIEDSYQLALELDKAWSRSAEAGSPVDIISSLRSYESA  424

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRVG+IHGLARMAA+MA+TYKAYLGVGLGPLSFLT++RIPHPGRVGGR FIDL MPLM
Sbjct  425  RKLRVGVIHGLARMAAIMASTYKAYLGVGLGPLSFLTKYRIPHPGRVGGRVFIDLGMPLM  484

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGNG+KLEGR + CRLS+KANDQLRKWF+DDDALERA + EW L P  N  + A 
Sbjct  485  LSWVLGGNGDKLEGRIQHCRLSEKANDQLRKWFEDDDALERATDAEWLLLPAGNGNA-AL  543

Query  543  EPILLRR  563
            +PI+L R
Sbjct  544  QPIVLSR  550



>ref|XP_007155924.1| hypothetical protein PHAVU_003G243800g [Phaseolus vulgaris]
 gb|ESW27918.1| hypothetical protein PHAVU_003G243800g [Phaseolus vulgaris]
Length=667

 Score =   311 bits (796),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 166/187 (89%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIED YQLALEL+ AW QS++SG+PID+ SSL+SYE+E
Sbjct  371  RVTLLGDSVHAMQPNMGQGGCMAIEDSYQLALELETAWEQSIKSGSPIDVDSSLRSYERE  430

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAALMA+TYKAYLGVGLGPL FLT+FRIPHPGRVGGRFF+D+ MP M
Sbjct  431  RRLRVAIIHGMARMAALMASTYKAYLGVGLGPLEFLTKFRIPHPGRVGGRFFVDIMMPSM  490

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGRP  CRLSDKANDQLR+WF+DD+ALERA+NGEW L P  + TS   
Sbjct  491  LSWVLGGNSSKLEGRPLSCRLSDKANDQLRQWFEDDEALERAINGEWILLPHGDGTSLL-  549

Query  543  EPILLRR  563
            +PI+L R
Sbjct  550  KPIVLSR  556



>ref|XP_010028248.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW54948.1| hypothetical protein EUGRSUZ_I00922 [Eucalyptus grandis]
Length=667

 Score =   311 bits (796),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 164/187 (88%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED YQL+LEL+KAW+ +VESG  I++  +L+SYE  
Sbjct  370  RVTLLGDSIHAMQPNMGQGGCMAIEDSYQLSLELEKAWKNNVESGTAINVIDALRSYENA  429

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV  IHG+ARMAA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGRFFID+AMPLM
Sbjct  430  RRLRVAAIHGMARMAAIMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDIAMPLM  489

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLGGN  KLEGRP  CRLSDKANDQLR+WF+DDDALERAMNGEW L P  N TS  S
Sbjct  490  LNWVLGGNSSKLEGRPPSCRLSDKANDQLRRWFEDDDALERAMNGEWLLLPSGNKTS-PS  548

Query  543  EPILLRR  563
            +PI L R
Sbjct  549  QPIGLSR  555



>ref|XP_011043539.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Populus 
euphratica]
Length=661

 Score =   310 bits (795),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 164/187 (88%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIED YQLA EL++AW+QS+ESG P+D+ SSL+SYE  
Sbjct  363  RVTLLGDSVHAMQPNMGQGGCMAIEDSYQLASELERAWKQSIESGTPVDVLSSLRSYENA  422

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFLT FRIPHPGRVGGRFFID+AMP+M
Sbjct  423  RRLRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLTNFRIPHPGRVGGRFFIDIAMPVM  482

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L WVLGGN  KLEGR   CRLSDKA+DQLR+WF DDDALER++NGEWFL P  N  + AS
Sbjct  483  LDWVLGGNSSKLEGRSLSCRLSDKASDQLRRWFVDDDALERSLNGEWFLLPCGN-DAVAS  541

Query  543  EPILLRR  563
            +PI L R
Sbjct  542  QPIGLSR  548



>emb|CBI21425.3| unnamed protein product [Vitis vinifera]
Length=658

 Score =   310 bits (795),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 164/187 (88%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIED YQLA+ELDKAW QS++SG PID+ S LKSYEK 
Sbjct  363  RVTLLGDSVHAMQPNMGQGGCMAIEDSYQLAMELDKAWEQSIKSGTPIDVVSCLKSYEKA  422

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RR+RV +IHG+ARMAA+MA+TYKAYLGVGLGPLSFLT+ RIPHPGRVGGRFFID+AMPLM
Sbjct  423  RRIRVAVIHGMARMAAIMASTYKAYLGVGLGPLSFLTKLRIPHPGRVGGRFFIDIAMPLM  482

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGRP  CRLSDKA+DQLR+WF+DDDALERA+ GEWFL P   +  +  
Sbjct  483  LSWVLGGNSSKLEGRPPSCRLSDKASDQLRRWFEDDDALERAIGGEWFLLP---SGESGL  539

Query  543  EPILLRR  563
            +PI L +
Sbjct  540  QPICLSK  546



>gb|AAR11195.1| zeaxanthin epoxidase [Vitis vinifera]
Length=658

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 164/187 (88%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIED YQLA+ELDKAW QS++SG PID+ S LKSYEK 
Sbjct  363  RVTLLGDSVHAMQPNMGQGGCMAIEDSYQLAMELDKAWEQSIKSGTPIDVVSCLKSYEKA  422

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RR+RV +IHG+ARMAA+MA+TYKAYLGVGLGPLSFLT+ RIPHPGRVGGRFFID+AMPLM
Sbjct  423  RRIRVAVIHGMARMAAIMASTYKAYLGVGLGPLSFLTKLRIPHPGRVGGRFFIDIAMPLM  482

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGRP  CRLSDKA+DQLR+WF+DDDALERA+ GEWFL P   +  +  
Sbjct  483  LSWVLGGNSSKLEGRPPSCRLSDKASDQLRRWFEDDDALERAIGGEWFLLP---SGESGL  539

Query  543  EPILLRR  563
            +PI L +
Sbjct  540  QPICLSK  546



>gb|KDO79216.1| hypothetical protein CISIN_1g005770mg [Citrus sinensis]
Length=420

 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 161/185 (87%), Gaps = 1/185 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+KA ++S ES  PIDI S+LKSYE+ 
Sbjct  120  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERA  179

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV +IHGLAR AA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGRFFIDLAMPLM
Sbjct  180  RRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLM  239

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   C+LSDKA+D LR WF DDDALERAMNGEWFL P   + +  S
Sbjct  240  LSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVP-SGSENVVS  298

Query  543  EPILL  557
            +PI L
Sbjct  299  QPIYL  303



>ref|XP_009767383.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Nicotiana sylvestris]
Length=664

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLALELDKA  +S ESG P+DI SSL+SYE  
Sbjct  366  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLALELDKALSRSAESGTPVDIISSLRSYESS  425

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRVG+IHGLARMAA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGRFFIDL MPLM
Sbjct  426  RKLRVGVIHGLARMAAIMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLGMPLM  485

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGNGEKLEGR + CRLS+KANDQLR WF+DDDALERA + EW L P  N+ +   
Sbjct  486  LSWVLGGNGEKLEGRIQHCRLSEKANDQLRNWFEDDDALERATDAEWLLLPAGNSNADLE  545

Query  543  EPILLR  560
              +L R
Sbjct  546  TLVLSR  551



>gb|AIX87529.1| zeaxanthin epoxidase [Lycium ruthenicum]
Length=661

 Score =   310 bits (793),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 165/187 (88%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIED YQLALELDKAW +S E+G+P+DI SSL+SYE  
Sbjct  364  RVTLLGDSVHAMQPNLGQGGCMAIEDSYQLALELDKAWSRSAEAGSPVDIISSLRSYESA  423

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRVG+IHGLARMAA+MA+TYKAYLGVGLGPLSFLT++RIPHPGRVGGR FIDL MPLM
Sbjct  424  RKLRVGVIHGLARMAAIMASTYKAYLGVGLGPLSFLTKYRIPHPGRVGGRVFIDLGMPLM  483

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGNG+KLEGR + CRLS+K NDQLRKWF+DDDALERA + EW L P  N  + A 
Sbjct  484  LSWVLGGNGDKLEGRIQHCRLSEKVNDQLRKWFEDDDALERATDAEWLLLPAGNGNA-AL  542

Query  543  EPILLRR  563
            +PI+L R
Sbjct  543  QPIVLSR  549



>ref|XP_011005864.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Populus 
euphratica]
Length=662

 Score =   309 bits (791),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 165/187 (88%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAM PN+GQGGCMAIED YQLALELDKAW+QSVESG  +D+ SSL+SYE  
Sbjct  364  RVTLLGDSVHAMPPNMGQGGCMAIEDSYQLALELDKAWKQSVESGTSVDVISSLRSYENA  423

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV  IHG+ARMAA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGRFF+D+AMP+M
Sbjct  424  RRLRVANIHGMARMAAIMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFVDIAMPVM  483

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLGGN  KLEGR   CRLSDKA+DQL++WF+DDDALERA+NGEWFL P  N  + AS
Sbjct  484  LNWVLGGNSSKLEGRSLNCRLSDKASDQLQRWFEDDDALERALNGEWFLLPCGN-EAVAS  542

Query  543  EPILLRR  563
            +PI L R
Sbjct  543  QPIGLSR  549



>sp|Q40412.1|ABA2_NICPL RecName: Full=Zeaxanthin epoxidase, chloroplastic; Flags: Precursor 
[Nicotiana plumbaginifolia]
 emb|CAA65048.1| zeaxanthin epoxidase [Nicotiana plumbaginifolia]
Length=663

 Score =   309 bits (791),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 164/187 (88%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIED YQLALELDKA  +S ESG P+DI SSL+SYE  
Sbjct  366  RVTLLGDSVHAMQPNLGQGGCMAIEDSYQLALELDKALSRSAESGTPVDIISSLRSYESS  425

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRVG+IHGLARMAA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGRFFIDL MPLM
Sbjct  426  RKLRVGVIHGLARMAAIMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLGMPLM  485

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGNGEKLEGR + CRLS+KANDQLR WF+DDDALERA + EW L P  N+ + A 
Sbjct  486  LSWVLGGNGEKLEGRIQHCRLSEKANDQLRNWFEDDDALERATDAEWLLLPAGNSNA-AL  544

Query  543  EPILLRR  563
            E ++L R
Sbjct  545  ETLVLSR  551



>gb|KDO79214.1| hypothetical protein CISIN_1g005770mg [Citrus sinensis]
 gb|KDO79215.1| hypothetical protein CISIN_1g005770mg [Citrus sinensis]
Length=475

 Score =   303 bits (777),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 161/185 (87%), Gaps = 1/185 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+KA ++S ES  PIDI S+LKSYE+ 
Sbjct  175  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERA  234

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV +IHGLAR AA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGRFFIDLAMPLM
Sbjct  235  RRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLM  294

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   C+LSDKA+D LR WF DDDALERAMNGEWFL P   + +  S
Sbjct  295  LSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVP-SGSENVVS  353

Query  543  EPILL  557
            +PI L
Sbjct  354  QPIYL  358



>ref|XP_003579861.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Brachypodium 
distachyon]
Length=667

 Score =   309 bits (791),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+KAW++S++S  P+DI SSL+SYEKE
Sbjct  369  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKAWQESIKSRTPVDIVSSLRSYEKE  428

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHGLARMAA+MA TY+ YLGVGLGPLSFLT+ RIPHPGRVGGRFFI   MPLM
Sbjct  429  RRLRVAIIHGLARMAAIMATTYRPYLGVGLGPLSFLTKLRIPHPGRVGGRFFIKYGMPLM  488

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGRP  CRLSDKANDQL +WF DDDALE+AM GEW+L P+ +   +AS
Sbjct  489  LSWVLGGNSSKLEGRPLSCRLSDKANDQLGQWFQDDDALEQAMGGEWYLFPVSSGNDSAS  548

Query  543  EPILLRR  563
            +PI L R
Sbjct  549  QPIRLIR  555



>ref|XP_006393902.1| hypothetical protein EUTSA_v10003769mg [Eutrema salsugineum]
 gb|ESQ31188.1| hypothetical protein EUTSA_v10003769mg [Eutrema salsugineum]
Length=667

 Score =   308 bits (790),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 166/187 (89%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED YQLALEL++AW +SVE+ AP+D+ SSL+ YE+ 
Sbjct  367  RVTLLGDSIHAMQPNMGQGGCMAIEDSYQLALELEEAWERSVETNAPVDVVSSLRRYEES  426

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFLT+FR+PHPGRVGGRFFID+AMPLM
Sbjct  427  RRLRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRFFIDIAMPLM  486

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLGGN EKLEGRP  CRL+DKA+D+LR+WF+DDDALER +NGEW+L P  N  S  S
Sbjct  487  LNWVLGGNSEKLEGRPPSCRLTDKADDRLREWFEDDDALERTINGEWYLIPYGNECSV-S  545

Query  543  EPILLRR  563
            E + L +
Sbjct  546  ETLCLTK  552



>ref|XP_006393901.1| hypothetical protein EUTSA_v10003769mg [Eutrema salsugineum]
 gb|ESQ31187.1| hypothetical protein EUTSA_v10003769mg [Eutrema salsugineum]
Length=666

 Score =   308 bits (790),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 166/187 (89%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED YQLALEL++AW +SVE+ AP+D+ SSL+ YE+ 
Sbjct  366  RVTLLGDSIHAMQPNMGQGGCMAIEDSYQLALELEEAWERSVETNAPVDVVSSLRRYEES  425

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFLT+FR+PHPGRVGGRFFID+AMPLM
Sbjct  426  RRLRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRFFIDIAMPLM  485

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLGGN EKLEGRP  CRL+DKA+D+LR+WF+DDDALER +NGEW+L P  N  S  S
Sbjct  486  LNWVLGGNSEKLEGRPPSCRLTDKADDRLREWFEDDDALERTINGEWYLIPYGNECSV-S  544

Query  543  EPILLRR  563
            E + L +
Sbjct  545  ETLCLTK  551



>gb|KJB43726.1| hypothetical protein B456_007G213500 [Gossypium raimondii]
Length=667

 Score =   308 bits (790),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 164/187 (88%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED YQLALELD AW+Q VESG PID+ SSL+SYE+ 
Sbjct  371  RVTLLGDSIHAMQPNMGQGGCMAIEDSYQLALELDNAWKQGVESGTPIDVVSSLRSYERA  430

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGRFFI+LAMP+M
Sbjct  431  RRLRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFINLAMPIM  490

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLGGN   LEGR   CRLSDKA+DQL+ WF+D+DALE+ +NGEWFL  + N  +T S
Sbjct  491  LNWVLGGNSSNLEGRSLSCRLSDKASDQLQTWFEDNDALEQTINGEWFLLSVGNEAAT-S  549

Query  543  EPILLRR  563
            +PI L R
Sbjct  550  QPICLSR  556



>gb|KHN26473.1| Zeaxanthin epoxidase, chloroplastic [Glycine soja]
Length=669

 Score =   308 bits (790),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 165/187 (88%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIED YQLA EL+ AW QS++SG+PIDI SSL+SYE+E
Sbjct  373  RVTLLGDSVHAMQPNMGQGGCMAIEDSYQLAWELENAWEQSIKSGSPIDIDSSLRSYERE  432

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAALMA+TYKAYLGVGLGPL FLT+FRIPHPGRVGGRFF+D+ MP M
Sbjct  433  RRLRVAIIHGMARMAALMASTYKAYLGVGLGPLEFLTKFRIPHPGRVGGRFFVDIMMPSM  492

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN +KLEGRP  CRL+DKANDQLR+WF+DD+ALERA+NGEW L P  + T   S
Sbjct  493  LSWVLGGNSDKLEGRPLSCRLTDKANDQLRRWFEDDEALERAINGEWILLPHGDGTGL-S  551

Query  543  EPILLRR  563
            +PI L R
Sbjct  552  KPISLSR  558



>ref|NP_001276261.1| zeaxanthin epoxidase [Glycine max]
 gb|ADK26569.1| zeaxanthin epoxidase [Glycine max]
Length=669

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 165/187 (88%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIED YQLA EL+ AW QS++SG+PIDI SSL+SYE+E
Sbjct  373  RVTLLGDSVHAMQPNMGQGGCMAIEDSYQLAWELENAWEQSIKSGSPIDIDSSLRSYERE  432

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAALMA+TYKAYLGVGLGPL FLT+FRIPHPGRVGGRFF+D+ MP M
Sbjct  433  RRLRVAIIHGMARMAALMASTYKAYLGVGLGPLEFLTKFRIPHPGRVGGRFFVDIMMPSM  492

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN +KLEGRP  CRL+DKANDQLR+WF+DD+ALERA+NGEW L P  + T   S
Sbjct  493  LSWVLGGNSDKLEGRPLSCRLTDKANDQLRRWFEDDEALERAINGEWILLPHGDGTGL-S  551

Query  543  EPILLRR  563
            +PI L R
Sbjct  552  KPISLSR  558



>ref|XP_009343160.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Pyrus x 
bretschneideri]
Length=664

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 163/187 (87%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIEDGYQLA+ELDKAW++S ESG PIDI SSL+SYE  
Sbjct  370  RVTLLGDSVHAMQPNMGQGGCMAIEDGYQLAMELDKAWQKSSESGTPIDINSSLRSYENS  429

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAALMA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGR FID AMPLM
Sbjct  430  RRLRVAIIHGMARMAALMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRVFIDKAMPLM  489

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   CRLSDKA+DQLR WF+DDDALERA++GEW+L P     + AS
Sbjct  490  LSWVLGGNSSKLEGRSPSCRLSDKASDQLRTWFEDDDALERAIDGEWYLIPC-GQDNDAS  548

Query  543  EPILLRR  563
            + I L R
Sbjct  549  QLICLNR  555



>ref|XP_011078061.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Sesamum 
indicum]
Length=656

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 166/187 (89%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLALELDKAWRQSV++G  IDI SSLK YE  
Sbjct  357  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVKAGNTIDIVSSLKRYENA  416

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R++RV IIHGLARMAA+MA+TYKAYLGVGLGPLSFLT+++IPHPGRVGGR FID+AMPLM
Sbjct  417  RKVRVAIIHGLARMAAMMASTYKAYLGVGLGPLSFLTKYKIPHPGRVGGRIFIDVAMPLM  476

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGNG KLEGR   CRLSDKA+DQLR+WF D+DALERA++ +WFL P+  +TS AS
Sbjct  477  LSWVLGGNGSKLEGRVLHCRLSDKASDQLRRWFTDNDALERALDADWFLLPVGGSTS-AS  535

Query  543  EPILLRR  563
            E  +L R
Sbjct  536  EIFVLSR  542



>emb|CAX36916.1| zeaxanthin epoxidase enzyme [Triticum aestivum]
Length=364

 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+KAW +SV+S  P+D+ SSL+SYEKE
Sbjct  66   RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKAWEESVKSRTPVDVISSLRSYEKE  125

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRV IIHGLARMAA+MA TY+ YLGVGLGPLSFLT+ RIPHPGRVGGRFFI + MPLM
Sbjct  126  RKLRVAIIHGLARMAAIMATTYRPYLGVGLGPLSFLTKLRIPHPGRVGGRFFIKVGMPLM  185

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSW+LGGN  KLEGRP  CRLSDKA++QL +WF DDDALE+AM GEW+L P+ +   +A 
Sbjct  186  LSWILGGNSSKLEGRPLSCRLSDKASNQLGRWFQDDDALEQAMGGEWYLFPMSSGGDSAL  245

Query  543  EPILLRR  563
            +PI L R
Sbjct  246  QPIRLIR  252



>gb|KDO79213.1| hypothetical protein CISIN_1g005770mg [Citrus sinensis]
Length=502

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 161/185 (87%), Gaps = 1/185 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+KA ++S ES  PIDI S+LKSYE+ 
Sbjct  202  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERA  261

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV +IHGLAR AA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGRFFIDLAMPLM
Sbjct  262  RRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLM  321

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   C+LSDKA+D LR WF DDDALERAMNGEWFL P   + +  S
Sbjct  322  LSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVP-SGSENVVS  380

Query  543  EPILL  557
            +PI L
Sbjct  381  QPIYL  385



>gb|ADF28630.1| zeaxanthin epoxidase [Solanum tuberosum]
Length=669

 Score =   308 bits (789),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 163/187 (87%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
             VTLLGDS+HAMQPNLGQGGCMAIED YQLALELDKA  +S ESG+P+DI SSL+SYE  
Sbjct  372  HVTLLGDSVHAMQPNLGQGGCMAIEDSYQLALELDKACSRSAESGSPVDIISSLRSYESA  431

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRVG+IHGLARMAA+MA+TYKAYLGVGLGPLSFLTQ+RIPHPGRVGGR FIDL MPLM
Sbjct  432  RKLRVGVIHGLARMAAIMASTYKAYLGVGLGPLSFLTQYRIPHPGRVGGRVFIDLGMPLM  491

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGNG+KLEGR K CRLS+KANDQLRKWF+DDDALERA + EW L P  N TS   
Sbjct  492  LSWVLGGNGDKLEGRIKHCRLSEKANDQLRKWFEDDDALERATDAEWLLLPAGNGTS-GL  550

Query  543  EPILLRR  563
            E I+L R
Sbjct  551  EAIVLSR  557



>ref|XP_004232029.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Solanum lycopersicum]
 gb|ABQ52698.1| zeaxanthin epoxidase [Solanum lycopersicum]
 gb|ABS82068.1| chloroplast zeaxanthin epoxidase precursor [Solanum lycopersicum]
Length=669

 Score =   307 bits (787),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 164/187 (88%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIED YQLALEL+KA  +S ESG+P+DI SSL+SYE  
Sbjct  372  RVTLLGDSVHAMQPNLGQGGCMAIEDSYQLALELEKACSRSAESGSPVDIISSLRSYESA  431

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRVG+IHGLARMAA+MA+TYKAYLGVGLGPLSFLTQ+RIPHPGRVGGR FIDL MPLM
Sbjct  432  RKLRVGVIHGLARMAAIMASTYKAYLGVGLGPLSFLTQYRIPHPGRVGGRVFIDLGMPLM  491

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGNG+KLEGR K CRLS+KANDQLRKWF+DDDALERA + EW L P  N  S+  
Sbjct  492  LSWVLGGNGDKLEGRIKHCRLSEKANDQLRKWFEDDDALERATDAEWLLLPAGNG-SSGL  550

Query  543  EPILLRR  563
            E I+L R
Sbjct  551  EAIVLSR  557



>gb|ADF28629.1| zeaxanthin epoxidase [Solanum tuberosum]
Length=669

 Score =   307 bits (787),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 163/187 (87%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIED YQLALELDKA  +S ESG+P+DI SSL+SYE  
Sbjct  372  RVTLLGDSVHAMQPNLGQGGCMAIEDSYQLALELDKACSRSAESGSPVDIISSLRSYESA  431

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRVG+IHGLARMAA+MA+TYKAYLGVGLGPLSFLTQ+RIPHPGRVGGR FIDL MPLM
Sbjct  432  RKLRVGVIHGLARMAAIMASTYKAYLGVGLGPLSFLTQYRIPHPGRVGGRVFIDLGMPLM  491

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGNG+KLEGR   CRLS+KANDQLRKWF+DDDALERA + EW L P  N TS   
Sbjct  492  LSWVLGGNGDKLEGRIIHCRLSEKANDQLRKWFEDDDALERATDAEWLLLPAGNGTS-GL  550

Query  543  EPILLRR  563
            E I+L R
Sbjct  551  EAIVLSR  557



>sp|Q96375.1|ABA2_CAPAN RecName: Full=Zeaxanthin epoxidase, chloroplastic; AltName: Full=Beta-cyclohexenyl 
epoxidase; AltName: Full=Xanthophyll epoxidase; 
Flags: Precursor [Capsicum annuum]
 emb|CAA62795.1| Xanthophyll epoxidase [Capsicum annuum]
Length=660

 Score =   307 bits (786),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 165/187 (88%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIED YQLALEL+KAW +S ESG+P+D+ SSL+SYE  
Sbjct  364  RVTLLGDSVHAMQPNLGQGGCMAIEDSYQLALELEKAWSRSAESGSPMDVISSLRSYESA  423

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRVG+IHGLARMAA+MA+ YKAYLGVGLGPLSF+T+FRIPHPGRVGGRFFIDL MPLM
Sbjct  424  RKLRVGVIHGLARMAAIMASAYKAYLGVGLGPLSFITKFRIPHPGRVGGRFFIDLGMPLM  483

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGNGEKLEGR + CRLS+KANDQLR WF+DDDALERA + EW L P  N ++ A 
Sbjct  484  LSWVLGGNGEKLEGRIQHCRLSEKANDQLRNWFEDDDALERATDAEWLLLPAGN-SNAAL  542

Query  543  EPILLRR  563
            E ++L R
Sbjct  543  ETLVLSR  549



>ref|XP_009345968.1| PREDICTED: zeaxanthin epoxidase, chloroplastic isoform X2 [Pyrus 
x bretschneideri]
Length=664

 Score =   307 bits (786),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 162/187 (87%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIEDGYQLA+ELDKAW++S ESG P DI SSL+SYE  
Sbjct  370  RVTLLGDSVHAMQPNMGQGGCMAIEDGYQLAMELDKAWQKSSESGTPFDINSSLRSYENS  429

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAALMA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGR FID AMPLM
Sbjct  430  RRLRVAIIHGMARMAALMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRVFIDKAMPLM  489

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   CRLSDKA+DQLR WF+DDDALERA++GEW+L P     + AS
Sbjct  490  LSWVLGGNSSKLEGRSPSCRLSDKASDQLRTWFEDDDALERAIDGEWYLIPC-GQDNDAS  548

Query  543  EPILLRR  563
            + I L R
Sbjct  549  QLICLNR  555



>ref|XP_009345967.1| PREDICTED: zeaxanthin epoxidase, chloroplastic isoform X1 [Pyrus 
x bretschneideri]
Length=666

 Score =   307 bits (786),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 162/187 (87%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIEDGYQLA+ELDKAW++S ESG P DI SSL+SYE  
Sbjct  370  RVTLLGDSVHAMQPNMGQGGCMAIEDGYQLAMELDKAWQKSSESGTPFDINSSLRSYENS  429

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAALMA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGR FID AMPLM
Sbjct  430  RRLRVAIIHGMARMAALMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRVFIDKAMPLM  489

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   CRLSDKA+DQLR WF+DDDALERA++GEW+L P     + AS
Sbjct  490  LSWVLGGNSSKLEGRSPSCRLSDKASDQLRTWFEDDDALERAIDGEWYLIPC-GQDNDAS  548

Query  543  EPILLRR  563
            + I L R
Sbjct  549  QLICLNR  555



>ref|NP_001274839.1| zeaxanthin epoxidase, chloroplastic-like [Solanum tuberosum]
 gb|ABA55731.1| zeaxanthin epoxidase [Solanum tuberosum]
Length=670

 Score =   306 bits (785),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 162/187 (87%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            R TLLGDS+HAMQPNLGQGGCMAIED YQLALELDKA  +S ESG+P+DI SSL+SYE  
Sbjct  372  RATLLGDSVHAMQPNLGQGGCMAIEDSYQLALELDKACSRSAESGSPVDIISSLRSYESA  431

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRVG+IHGLARMAA+MA+TYKAYLGVGL PLSFLTQ+RIPHPGRVGGR FIDL MPLM
Sbjct  432  RKLRVGVIHGLARMAAIMASTYKAYLGVGLSPLSFLTQYRIPHPGRVGGRVFIDLGMPLM  491

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGNG+KLEGR K CRLS+KANDQLRKWF+DDDALERA + EW L P  N TS   
Sbjct  492  LSWVLGGNGDKLEGRIKHCRLSEKANDQLRKWFEDDDALERATDAEWLLLPAGNGTS-GL  550

Query  543  EPILLRR  563
            E I+L R
Sbjct  551  EAIVLSR  557



>dbj|BAF49058.1| zeaxanthin epoxidase [Prunus mume]
Length=492

 Score =   301 bits (771),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 161/187 (86%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
             VTLLGDS+HAMQPN+GQGGCMAIEDGYQLALELDKAW++S E+G P+D+ SSL+SYE  
Sbjct  234  HVTLLGDSVHAMQPNMGQGGCMAIEDGYQLALELDKAWKKSSETGTPVDVASSLRSYENS  293

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAALMA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGR FID AMPLM
Sbjct  294  RRLRVAIIHGMARMAALMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRVFIDKAMPLM  353

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   CRLSDKA+D LR WF+DDDALERA++GEW+L P     S AS
Sbjct  354  LSWVLGGNSSKLEGRSPSCRLSDKASDLLRTWFEDDDALERAIDGEWYLIPC-GQDSDAS  412

Query  543  EPILLRR  563
            + I L R
Sbjct  413  QLICLNR  419



>gb|AAV85824.1| zeaxanthin epoxidase [Eutrema halophilum]
Length=666

 Score =   306 bits (784),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 165/187 (88%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED YQLALEL++AW +SVE+ AP+D+ SSL+ YE+ 
Sbjct  366  RVTLLGDSIHAMQPNMGQGGCMAIEDSYQLALELEEAWERSVETNAPVDVVSSLRRYEES  425

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFLT+FR+PHPGRVGGRFFID+AMPLM
Sbjct  426  RRLRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRFFIDIAMPLM  485

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLG N EKLEGRP  CRL+DKA+D+LR+WF+DDDALER +NGEW+L P  N  S  S
Sbjct  486  LNWVLGXNSEKLEGRPPSCRLTDKADDRLREWFEDDDALERTINGEWYLIPYGNECSV-S  544

Query  543  EPILLRR  563
            E + L +
Sbjct  545  ETLCLTK  551



>gb|ABB52077.1| putative zeaxanthin epoxidase [Daucus carota subsp. sativus]
Length=668

 Score =   305 bits (782),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 162/187 (87%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            R+TLLGDS+HAMQPNLGQGGCMAIED YQLA+ELDKA+ +S ESG PIDI SSL+SYE  
Sbjct  370  RITLLGDSVHAMQPNLGQGGCMAIEDSYQLAMELDKAYNRSAESGNPIDIESSLRSYESS  429

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R++RV +IHGLARMAA+MA+TYKAYLGVGLGPLSFLT+ RIPHPGRVGGRFFID+ MPLM
Sbjct  430  RKIRVSVIHGLARMAAIMASTYKAYLGVGLGPLSFLTKLRIPHPGRVGGRFFIDIGMPLM  489

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGNG  LEGRP QCRLSD+AN  L++WF+DDDALERA  GEW L P+ N TS +S
Sbjct  490  LSWVLGGNGSNLEGRPLQCRLSDRANSDLKRWFEDDDALERATKGEWVLFPVGN-TSASS  548

Query  543  EPILLRR  563
            E I L +
Sbjct  549  EAIFLSK  555



>ref|XP_009610655.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Nicotiana tomentosiformis]
Length=664

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 161/187 (86%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIED YQLALELDKA  +S ESG+ +DI SSL+SYE  
Sbjct  366  RVTLLGDSVHAMQPNLGQGGCMAIEDSYQLALELDKALSRSAESGSAVDIISSLRSYESS  425

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRVG+IHGLARMAA+MA+TYKAYLGVGLGPLSFLT FRIPHPGRVGGRFFIDL MPLM
Sbjct  426  RKLRVGVIHGLARMAAIMASTYKAYLGVGLGPLSFLTNFRIPHPGRVGGRFFIDLGMPLM  485

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGNGEKLEGR K CRLS+KANDQLR WF DDDALERA + EW L P  N  + A 
Sbjct  486  LSWVLGGNGEKLEGRIKHCRLSEKANDQLRNWFVDDDALERATDAEWLLLPAGNGNA-AV  544

Query  543  EPILLRR  563
            E ++L R
Sbjct  545  EALVLSR  551



>ref|XP_008338315.1| PREDICTED: zeaxanthin epoxidase, chloroplastic isoform X1 [Malus 
domestica]
Length=667

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 162/187 (87%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIEDGYQLA+ELDKAW++S ESG PIDI SSL+SYE  
Sbjct  370  RVTLLGDSVHAMQPNMGQGGCMAIEDGYQLAMELDKAWQKSSESGTPIDINSSLRSYENS  429

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAALMA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGR FID AMPLM
Sbjct  430  RRLRVAIIHGMARMAALMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRVFIDKAMPLM  489

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   CRLSDKA+DQLR WF+DDDALE A++GEW+L P     + AS
Sbjct  490  LSWVLGGNSSKLEGRSPSCRLSDKASDQLRTWFEDDDALECAIDGEWYLIPC-GQDNDAS  548

Query  543  EPILLRR  563
            + I L R
Sbjct  549  QLICLNR  555



>gb|KDO79212.1| hypothetical protein CISIN_1g005770mg [Citrus sinensis]
Length=645

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 161/185 (87%), Gaps = 1/185 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+KA ++S ES  PIDI S+LKSYE+ 
Sbjct  364  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERA  423

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV +IHGLAR AA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGRFFIDLAMPLM
Sbjct  424  RRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLM  483

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   C+LSDKA+D LR WF DDDALERAMNGEWFL P   + +  S
Sbjct  484  LSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVP-SGSENVVS  542

Query  543  EPILL  557
            +PI L
Sbjct  543  QPIYL  547



>sp|O81360.1|ABA2_PRUAR RecName: Full=Zeaxanthin epoxidase, chloroplastic; AltName: Full=PA-ZE; 
Flags: Precursor [Prunus armeniaca]
 gb|AAD42899.1|AF159948_1 zeaxanthin epoxidase [Prunus armeniaca]
 gb|AAC24582.1| zeaxanthin epoxidase [Prunus armeniaca]
Length=661

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 162/187 (87%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
             VTLLGDS+HAMQPN+GQGGCMAIEDGYQLALELDKAW++S E+G P+D+ SSL+SYE  
Sbjct  367  HVTLLGDSVHAMQPNMGQGGCMAIEDGYQLALELDKAWKKSSETGTPVDVASSLRSYENS  426

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAALMA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGR FID AMPLM
Sbjct  427  RRLRVAIIHGMARMAALMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRVFIDKAMPLM  486

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   CRLSDKA+DQLR WF+DDDALERA++GEW+L P     + AS
Sbjct  487  LSWVLGGNSSKLEGRSPSCRLSDKASDQLRNWFEDDDALERAIDGEWYLIPC-GQDNDAS  545

Query  543  EPILLRR  563
            + I L R
Sbjct  546  QLICLNR  552



>ref|XP_008338316.1| PREDICTED: zeaxanthin epoxidase, chloroplastic isoform X2 [Malus 
domestica]
Length=665

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 162/187 (87%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIEDGYQLA+ELDKAW++S ESG PIDI SSL+SYE  
Sbjct  370  RVTLLGDSVHAMQPNMGQGGCMAIEDGYQLAMELDKAWQKSSESGTPIDINSSLRSYENS  429

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAALMA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGR FID AMPLM
Sbjct  430  RRLRVAIIHGMARMAALMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRVFIDKAMPLM  489

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   CRLSDKA+DQLR WF+DDDALE A++GEW+L P     + AS
Sbjct  490  LSWVLGGNSSKLEGRSPSCRLSDKASDQLRTWFEDDDALECAIDGEWYLIPC-GQDNDAS  548

Query  543  EPILLRR  563
            + I L R
Sbjct  549  QLICLNR  555



>ref|XP_008338317.1| PREDICTED: zeaxanthin epoxidase, chloroplastic isoform X3 [Malus 
domestica]
Length=664

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 162/187 (87%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIEDGYQLA+ELDKAW++S ESG PIDI SSL+SYE  
Sbjct  370  RVTLLGDSVHAMQPNMGQGGCMAIEDGYQLAMELDKAWQKSSESGTPIDINSSLRSYENS  429

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAALMA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGR FID AMPLM
Sbjct  430  RRLRVAIIHGMARMAALMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRVFIDKAMPLM  489

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   CRLSDKA+DQLR WF+DDDALE A++GEW+L P     + AS
Sbjct  490  LSWVLGGNSSKLEGRSPSCRLSDKASDQLRTWFEDDDALECAIDGEWYLIPC-GQDNDAS  548

Query  543  EPILLRR  563
            + I L R
Sbjct  549  QLICLNR  555



>ref|XP_006842967.1| hypothetical protein AMTR_s00076p00039590, partial [Amborella 
trichopoda]
 gb|ERN04642.1| hypothetical protein AMTR_s00076p00039590, partial [Amborella 
trichopoda]
Length=550

 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLALEL++AW++S +SG PIDITSS+K YEKE
Sbjct  337  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLALELERAWKESADSGKPIDITSSIKRYEKE  396

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RR+RV +I+GLARMAA+MA+TYK YLGVGLGPLSFLT+FRIPHPGRVGGRF   L MPLM
Sbjct  397  RRVRVAVIYGLARMAAIMASTYKPYLGVGLGPLSFLTKFRIPHPGRVGGRFVFKLVMPLM  456

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLGGN  KLEGR   CR+SDKA+D+L++WF DDDALERA++GEWFL P  N      
Sbjct  457  LNWVLGGNSSKLEGRSLSCRISDKASDELKRWFQDDDALERALSGEWFLLPANNEGKDVM  516

Query  543  EPILLRR  563
            EPI L +
Sbjct  517  EPIHLSK  523



>ref|XP_004975770.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Setaria 
italica]
Length=661

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+ AW++SV+SG P+DI SSLK YEKE
Sbjct  358  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELENAWQESVKSGTPMDIVSSLKRYEKE  417

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHGLARMAA+MA TY+ YLGVGLGPLSFLT+ RIPHPGRVGGRFFI + MP M
Sbjct  418  RRLRVAIIHGLARMAAIMATTYRPYLGVGLGPLSFLTKLRIPHPGRVGGRFFIMIGMPAM  477

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGRP  CRLSDKANDQL +WF+DDDALE+AM GEW+L P+    S + 
Sbjct  478  LSWVLGGNSSKLEGRPLSCRLSDKANDQLYRWFEDDDALEQAMGGEWYLFPISEGNSNSL  537

Query  543  EPILLRR  563
            +P+ L R
Sbjct  538  QPVRLIR  544



>sp|P93236.1|ABA2_SOLLC RecName: Full=Zeaxanthin epoxidase, chloroplastic; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAB06084.1| zeaxanthin epoxidase [Solanum lycopersicum]
Length=669

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 163/187 (87%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIED YQLALEL+KA  +S E G+P+DI SSL+SYE  
Sbjct  372  RVTLLGDSVHAMQPNLGQGGCMAIEDSYQLALELEKACSRSAEFGSPVDIISSLRSYESA  431

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRVG+IHGLARMAA+MA+TYKAYLGVGLGPLSFLTQ+RIPHPGRVGGR FIDL MPLM
Sbjct  432  RKLRVGVIHGLARMAAIMASTYKAYLGVGLGPLSFLTQYRIPHPGRVGGRVFIDLGMPLM  491

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGNG+KLEGR K CRLS+KANDQLRKWF+DDDALERA + EW L P  N  S+  
Sbjct  492  LSWVLGGNGDKLEGRIKHCRLSEKANDQLRKWFEDDDALERATDAEWLLLPAGNG-SSGL  550

Query  543  EPILLRR  563
            E I+L R
Sbjct  551  EAIVLSR  557



>ref|XP_006425899.1| hypothetical protein CICLE_v10025089mg [Citrus clementina]
 gb|ESR39139.1| hypothetical protein CICLE_v10025089mg [Citrus clementina]
Length=664

 Score =   305 bits (780),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 161/185 (87%), Gaps = 1/185 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+KA ++S ES  PIDI S+LKSYE+ 
Sbjct  364  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERA  423

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV +IHGLAR AA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGRFFIDLAMPLM
Sbjct  424  RRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLM  483

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   C+LSDKA+D LR WF DDDALERAMNGEWFL P   + +  S
Sbjct  484  LSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVP-SGSENVVS  542

Query  543  EPILL  557
            +PI L
Sbjct  543  QPIYL  547



>dbj|BAI79257.1| zeaxanthin epoxidase [Citrus unshiu]
Length=664

 Score =   305 bits (780),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 161/185 (87%), Gaps = 1/185 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+KA ++S ES  PIDI S+LKSYE+ 
Sbjct  364  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERA  423

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV +IHGLAR AA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGRFFIDLAMPLM
Sbjct  424  RRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLM  483

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   C+LSDKA+D LR WF DDDALERAMNGEWFL P   + +  S
Sbjct  484  LSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVP-SGSENVVS  542

Query  543  EPILL  557
            +PI L
Sbjct  543  QPIYL  547



>gb|KHG01019.1| Zeaxanthin epoxidase, chloroplastic -like protein [Gossypium 
arboreum]
Length=589

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 162/187 (87%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED YQLALELD AW+Q VESG PID+ SSL+SYE+ 
Sbjct  293  RVTLLGDSIHAMQPNMGQGGCMAIEDSYQLALELDNAWKQGVESGTPIDVVSSLRSYERA  352

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAA+MA+TYKAYLGVGLGP SFLT+FRIPHPGRVGGRFFI+LAMP+M
Sbjct  353  RRLRVAIIHGMARMAAIMASTYKAYLGVGLGPFSFLTKFRIPHPGRVGGRFFINLAMPIM  412

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLGGN   LEGR   CRLSDKA+DQLR WF+D+DALE+ +NGEWFL  + +  + AS
Sbjct  413  LNWVLGGNSSNLEGRSLSCRLSDKASDQLRTWFEDNDALEQTINGEWFLLSVGD-EAAAS  471

Query  543  EPILLRR  563
            + I L R
Sbjct  472  QHICLSR  478



>gb|KDO79210.1| hypothetical protein CISIN_1g005770mg [Citrus sinensis]
 gb|KDO79211.1| hypothetical protein CISIN_1g005770mg [Citrus sinensis]
Length=664

 Score =   305 bits (780),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 161/185 (87%), Gaps = 1/185 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+KA ++S ES  PIDI S+LKSYE+ 
Sbjct  364  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERA  423

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV +IHGLAR AA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGRFFIDLAMPLM
Sbjct  424  RRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLM  483

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   C+LSDKA+D LR WF DDDALERAMNGEWFL P   + +  S
Sbjct  484  LSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVP-SGSENVVS  542

Query  543  EPILL  557
            +PI L
Sbjct  543  QPIYL  547



>ref|XP_003611740.1| Zeaxanthin epoxidase [Medicago truncatula]
Length=350

 Score =   295 bits (755),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIEDGYQLA ELD AW+QS +SG+ IDI SSLKSYE+E
Sbjct  49   RVTLLGDSVHAMQPNMGQGGCMAIEDGYQLAFELDNAWQQSAKSGSTIDIASSLKSYERE  108

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV  +HG+ARMAALMA+TYKAYLGVGLGP  FLT+FRIPHPGRVGGRFFI  +MPLM
Sbjct  109  RRLRVTFVHGMARMAALMASTYKAYLGVGLGPFEFLTKFRIPHPGRVGGRFFIQKSMPLM  168

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSP  515
            L+WVLGGN  KLEGRP  CRLSDKA+DQL  WF+DDDALER +NGEW L P
Sbjct  169  LNWVLGGNSSKLEGRPLCCRLSDKASDQLHTWFEDDDALERTINGEWILLP  219



>dbj|BAE72089.1| Lactuca sativa zeaxantin epoxidase 1
Length=663

 Score =   304 bits (779),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 162/187 (87%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIED YQLALELDKAW +S+ESGA +DI +SL+ YE  
Sbjct  366  RVTLLGDSVHAMQPNLGQGGCMAIEDSYQLALELDKAWSRSIESGARVDIATSLRRYEDA  425

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV +IHGLARMAA+MA+TYKAYLGVGLGPLSFLT FRIPHPGRVGGRFFI + MPLM
Sbjct  426  RRLRVAVIHGLARMAAIMASTYKAYLGVGLGPLSFLTNFRIPHPGRVGGRFFITIGMPLM  485

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGNG  LEGRP+QCRL+DKAND+L+ WF DDDA+ER + GEWFL P+  + +  S
Sbjct  486  LSWVLGGNGANLEGRPQQCRLTDKANDELQNWFRDDDAIERILGGEWFLLPV-GSQNVGS  544

Query  543  EPILLRR  563
            +PI L R
Sbjct  545  DPISLSR  551



>ref|XP_006466600.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Citrus sinensis]
 dbj|BAI79259.1| zeaxanthin epoxidase [Citrus sinensis]
Length=664

 Score =   304 bits (779),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 161/185 (87%), Gaps = 1/185 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+KA ++S ES  PIDI S+LKSYE+ 
Sbjct  364  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERA  423

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV +IHGLAR AA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGRFFIDLAMPLM
Sbjct  424  RRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLM  483

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   C+LSDKA+D LR WF DDDALERAMNGEWFL P   + +  S
Sbjct  484  LSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVP-SGSENVVS  542

Query  543  EPILL  557
            +PI L
Sbjct  543  QPIYL  547



>dbj|BAB78733.1| zeaxanthin epoxidase [Citrus unshiu]
Length=664

 Score =   304 bits (779),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 161/185 (87%), Gaps = 1/185 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+KA ++S ES  PIDI S+LKSYE+ 
Sbjct  364  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERA  423

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV +IHGLAR AA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGRFFIDLAMPLM
Sbjct  424  RRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLM  483

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   C+LSDKA+D LR WF DDDALERAMNGEWFL P   + +  S
Sbjct  484  LSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVP-SGSENVVS  542

Query  543  EPILL  557
            +PI L
Sbjct  543  QPIYL  547



>ref|XP_006653464.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Oryza brachyantha]
Length=553

 Score =   301 bits (770),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+KA ++SV+SG P+D+ SSL+ YEKE
Sbjct  255  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKARQESVKSGTPMDVVSSLRRYEKE  314

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R LRV +IHGLARMAA+MA TY+ YLGVGLGPLSFLT+ RIPHPGRVGGRFFI   MPLM
Sbjct  315  RILRVSVIHGLARMAAIMATTYRPYLGVGLGPLSFLTKLRIPHPGRVGGRFFIKYGMPLM  374

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLGGN  KLEGRP  CRLSDKANDQLR+WF+DDDALE+AM GEWFL    +  + AS
Sbjct  375  LTWVLGGNSSKLEGRPLSCRLSDKANDQLRQWFEDDDALEQAMGGEWFLFSTSSGNTYAS  434

Query  543  EPILLRR  563
            +PI L R
Sbjct  435  QPIRLIR  441



>ref|XP_009103460.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Brassica rapa]
Length=668

 Score =   304 bits (778),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED +QL LEL++AW+QSVE+  P+D+ SSL+ YE+ 
Sbjct  368  RVTLLGDSIHAMQPNMGQGGCMAIEDSFQLGLELEQAWKQSVETNTPVDVVSSLRRYEES  427

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFLT+FR+PHPGRVGGRFFID+AMPLM
Sbjct  428  RRLRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRFFIDIAMPLM  487

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTA  539
            L+WVLGGN EKLEGRP  CRL+DKA+D+LR+WF+DD+ALER +NGEW+L P  N  S +
Sbjct  488  LNWVLGGNSEKLEGRPPSCRLTDKADDRLREWFEDDEALERTINGEWYLIPHGNECSVS  546



>gb|AAN63502.2|AF384103_1 zeaxanthin epoxidase [Triticum aestivum]
Length=363

 Score =   295 bits (754),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 162/187 (87%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+KAW +SV+S  P+D+ SSL+SYEKE
Sbjct  66   RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKAWEESVKSRTPVDVISSLRSYEKE  125

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRV IIHGLARMAA+MA TY+ YLGVGLGPLSFLT+ RIPHPGRVGGRFFI + MPLM
Sbjct  126  RKLRVAIIHGLARMAAIMATTYRPYLGVGLGPLSFLTKLRIPHPGRVGGRFFIKVGMPLM  185

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSW+LGGN  KLEGRP  CRLSDKAN+QL +WF +DDALE+AM GEW+L P+ +   +A 
Sbjct  186  LSWILGGNSSKLEGRPLSCRLSDKANNQLGRWF-EDDALEQAMGGEWYLFPMSSGGDSAL  244

Query  543  EPILLRR  563
            +PI L R
Sbjct  245  QPIRLIR  251



>ref|XP_007204247.1| hypothetical protein PRUPE_ppa002248mg [Prunus persica]
 gb|EMJ05446.1| hypothetical protein PRUPE_ppa002248mg [Prunus persica]
Length=696

 Score =   304 bits (779),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 162/187 (87%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
             VTLLGDS+HAMQPN+GQGGCMAIEDGYQLALELDKAW++S E+G P+D+ SSL+SYE  
Sbjct  402  HVTLLGDSVHAMQPNMGQGGCMAIEDGYQLALELDKAWKKSSETGIPVDVASSLRSYENS  461

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAALMA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGR FID AMPLM
Sbjct  462  RRLRVAIIHGMARMAALMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRVFIDKAMPLM  521

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   CRLSDKA+DQLR WF+DDDALERA++GEW+L P     + AS
Sbjct  522  LSWVLGGNSSKLEGRSPSCRLSDKASDQLRTWFEDDDALERAIDGEWYLIPC-GQDNDAS  580

Query  543  EPILLRR  563
            + I L R
Sbjct  581  QLICLNR  587



>emb|CDY01444.1| BnaA07g12170D [Brassica napus]
Length=687

 Score =   304 bits (779),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED +QL LEL++AW+QSVE+  P+D+ SSL+ YE+ 
Sbjct  387  RVTLLGDSIHAMQPNMGQGGCMAIEDSFQLGLELEQAWKQSVETNTPVDVVSSLRRYEES  446

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFLT+FR+PHPGRVGGRFFID+AMPLM
Sbjct  447  RRLRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRFFIDIAMPLM  506

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTA  539
            L+WVLGGN EKLEGRP  CRL+DKA+D+LR+WF+DD+ALER +NGEW+L P  N  S +
Sbjct  507  LNWVLGGNSEKLEGRPPSCRLTDKADDRLREWFEDDEALERTINGEWYLIPHGNECSVS  565



>gb|ADC29517.1| zeaxanthin epoxidase [Brassica napus]
 gb|ADD62493.1| zeaxanthin epoxidase [Brassica napus]
Length=669

 Score =   303 bits (777),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED +QL LEL++AW+QSVE+  P+D+ SSL+ YE+ 
Sbjct  369  RVTLLGDSIHAMQPNMGQGGCMAIEDSFQLGLELEQAWKQSVETNTPVDVVSSLRRYEES  428

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFLT+FR+PHPGRVGGRFFID+AMPLM
Sbjct  429  RRLRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRFFIDIAMPLM  488

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTA  539
            L+WVLGGN EKLEGRP  CRL+DKA+D+LR+WF+DD+ALER +NGEW+L P  N  S +
Sbjct  489  LNWVLGGNSEKLEGRPPSCRLTDKADDRLREWFEDDEALERTINGEWYLIPHGNECSVS  547



>dbj|BAK08085.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=659

 Score =   303 bits (776),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+KAW +SV+S  P+D+ SSL+SYEKE
Sbjct  361  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKAWEESVKSRTPVDVISSLRSYEKE  420

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRV IIHGLARMAA+MA TY+ YLGVGLGPLSFLT+ RIPHPGRVGGRFFI + MPLM
Sbjct  421  RKLRVAIIHGLARMAAIMATTYRPYLGVGLGPLSFLTKLRIPHPGRVGGRFFIKVGMPLM  480

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGRP  CRLSDKA+DQL +WF DDDALE+AM GEW+L P+ +   +A 
Sbjct  481  LSWVLGGNSSKLEGRPLSCRLSDKASDQLGRWFQDDDALEQAMGGEWYLFPMSSGDDSAL  540

Query  543  EPILLRR  563
            +PI L R
Sbjct  541  QPIRLIR  547



>ref|XP_008340140.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Malus domestica]
Length=731

 Score =   305 bits (780),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 162/187 (87%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
             VTLLGDS+HAMQPN+GQGGCMAIEDGYQLA+ELDKAW++S ESG PI+I SSL+SYE  
Sbjct  437  HVTLLGDSVHAMQPNMGQGGCMAIEDGYQLAMELDKAWQKSSESGTPIBINSSLRSYENS  496

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAALMA+TYKAYLGVGLGP SFLT+FRIPHPGRVGGR FID AMPLM
Sbjct  497  RRLRVAIIHGMARMAALMASTYKAYLGVGLGPFSFLTKFRIPHPGRVGGRVFIDKAMPLM  556

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR  +CRLSDKA+DQLR WF+DDDALERA++GEW+L P     + AS
Sbjct  557  LSWVLGGNSSKLEGRSPRCRLSDKASDQLRTWFEDDDALERAIDGEWYLIPC-GQDNDAS  615

Query  543  EPILLRR  563
            + I L R
Sbjct  616  QLICLNR  622



>emb|CAN61301.1| hypothetical protein VITISV_011317 [Vitis vinifera]
Length=285

 Score =   291 bits (745),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 153/176 (87%), Gaps = 3/176 (2%)
 Frame = +3

Query  36   MQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKERRLRVGIIHGL  215
            MQPN+GQGGCMAIED YQLA+ELDKAW QS++SG PID+ S LKSYEK RR+RV +IHG+
Sbjct  1    MQPNMGQGGCMAIEDSYQLAMELDKAWEQSIKSGTPIDVVSCLKSYEKARRIRVAVIHGM  60

Query  216  ARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEK  395
            ARMAA+MA+TYKAYLGVGLGPLSFLT+ RIPHPGRVGGRFFID+AMPLMLSWVLGGN  K
Sbjct  61   ARMAAIMASTYKAYLGVGLGPLSFLTKLRIPHPGRVGGRFFIDIAMPLMLSWVLGGNSSK  120

Query  396  LEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTASEPILLRR  563
            LEGRP  CRLSDKANDQLR+WF+DDDALERA+ GEWFL P   +  +  +PI L +
Sbjct  121  LEGRPPSCRLSDKANDQLRRWFEDDDALERAIGGEWFLLP---SGESGLQPICLSK  173



>gb|AIP98334.1| ZEP [Medicago sativa]
Length=663

 Score =   302 bits (774),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 160/187 (86%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIED YQLA ELD AW QS++SG PI + S+L+SYE E
Sbjct  367  RVTLLGDSVHAMQPNMGQGGCMAIEDSYQLAKELDNAWEQSIKSGNPIKVDSALRSYESE  426

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRV +IHG+ARMAALMA+TYKAYLGVGLGPL FLT FRIPHPGRVGGRFF+D+ MP M
Sbjct  427  RKLRVAVIHGMARMAALMASTYKAYLGVGLGPLEFLTNFRIPHPGRVGGRFFVDILMPSM  486

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSW+LGGN +KLEGRP  CRLSDKAN QLR+WF+DDDALERA+NGEWFL P    T   S
Sbjct  487  LSWILGGNSDKLEGRPISCRLSDKANGQLRQWFEDDDALERAINGEWFLLPCGEETGL-S  545

Query  543  EPILLRR  563
            +PI L +
Sbjct  546  KPIRLTQ  552



>emb|CDY12798.1| BnaC07g16350D [Brassica napus]
Length=723

 Score =   304 bits (778),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED +QL LEL++AW+QSVE+  P+D+ SSL+ YE+ 
Sbjct  423  RVTLLGDSIHAMQPNMGQGGCMAIEDSFQLGLELEQAWKQSVETNTPVDVVSSLRRYEES  482

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFLT+FR+PHPGRVGGRFFID+AMPLM
Sbjct  483  RRLRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRFFIDIAMPLM  542

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTA  539
            L+WVLGGN EKLEGRP  CRL+DKA+D+LR+WF+DD+ALER +NGEW+L P  N  S +
Sbjct  543  LNWVLGGNSEKLEGRPPSCRLTDKADDRLREWFEDDEALERTINGEWYLIPHGNECSVS  601



>gb|KCW54949.1| hypothetical protein EUGRSUZ_I00922 [Eucalyptus grandis]
Length=586

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED YQL+LEL+KAW+ +VESG  I++  +L+SYE  
Sbjct  370  RVTLLGDSIHAMQPNMGQGGCMAIEDSYQLSLELEKAWKNNVESGTAINVIDALRSYENA  429

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV  IHG+ARMAA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGRFFID+AMPLM
Sbjct  430  RRLRVAAIHGMARMAAIMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDIAMPLM  489

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSP  515
            L+WVLGGN  KLEGRP  CRLSDKANDQLR+WF+DDDALERAMNGE+   P
Sbjct  490  LNWVLGGNSSKLEGRPPSCRLSDKANDQLRRWFEDDDALERAMNGEYVFEP  540



>ref|XP_004509142.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Cicer arietinum]
Length=662

 Score =   302 bits (773),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 161/185 (87%), Gaps = 1/185 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIED YQLA ELD AW QS++SG PI+I SSL+ YE+E
Sbjct  366  RVTLLGDSVHAMQPNMGQGGCMAIEDSYQLAWELDNAWEQSIKSGNPIEIDSSLRRYERE  425

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRV +IHG+ARMAALMA+TYKAYLGVGLGPL FLT FRIPHPGRVGGRFF+D+ MP M
Sbjct  426  RKLRVAVIHGMARMAALMASTYKAYLGVGLGPLEFLTNFRIPHPGRVGGRFFVDILMPSM  485

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+W+LGGN +KLEGRP  CRLSDKAN +LR+WF+DDDALERA+NGEWFL P  + T   S
Sbjct  486  LNWILGGNSDKLEGRPLSCRLSDKANGELRRWFEDDDALERAINGEWFLLPCGDGTGL-S  544

Query  543  EPILL  557
            +PI L
Sbjct  545  KPIRL  549



>dbj|BAN15741.1| zeaxanthin epoxydase [Dianthus caryophyllus]
Length=664

 Score =   302 bits (773),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 165/187 (88%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED YQLAL+L+KAW +SVESG P+D+ SSL+SYE  
Sbjct  368  RVTLLGDSIHAMQPNMGQGGCMAIEDSYQLALDLEKAWNKSVESGTPVDVVSSLRSYEGS  427

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRV +IHG+ARMAA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGR FI  AMPLM
Sbjct  428  RKLRVAVIHGMARMAAIMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRVFISQAMPLM  487

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSW+LGGN E+LEGR  QCRLS++A+ QL++WF+DDDALERA++GEWFL PL+  + T S
Sbjct  488  LSWILGGNSERLEGRTPQCRLSERASTQLQRWFEDDDALERAISGEWFLFPLEKNSQT-S  546

Query  543  EPILLRR  563
            E I L R
Sbjct  547  ESISLNR  553



>dbj|BAJ93704.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=695

 Score =   303 bits (775),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+KAW +SV+S  P+D+ SSL+SYEKE
Sbjct  397  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKAWEESVKSRTPVDVISSLRSYEKE  456

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRV IIHGLARMAA+MA TY+ YLGVGLGPLSFLT+ RIPHPGRVGGRFFI + MPLM
Sbjct  457  RKLRVAIIHGLARMAAIMATTYRPYLGVGLGPLSFLTKLRIPHPGRVGGRFFIKVGMPLM  516

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGRP  CRLSDKA+DQL +WF DDDALE+AM GEW+L P+ +   +A 
Sbjct  517  LSWVLGGNSSKLEGRPLSCRLSDKASDQLGRWFQDDDALEQAMGGEWYLFPMSSGDDSAL  576

Query  543  EPILLRR  563
            +PI L R
Sbjct  577  QPIRLIR  583



>gb|ACM68704.1| zeaxanthin epoxidase [Brassica rapa subsp. pekinensis]
Length=668

 Score =   302 bits (773),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED +QL LEL++AW+QSVE+  P+D+ SSL+ YE+ 
Sbjct  368  RVTLLGDSIHAMQPNMGQGGCMAIEDSFQLGLELEQAWKQSVETNTPVDVVSSLRRYEES  427

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFLT+FR+PHPGRVGGRFFID+AMPLM
Sbjct  428  RRLRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRFFIDIAMPLM  487

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTA  539
            L+WVLG N EKLEGRP  CRL+DKA+D+LR+WF+DD+ALER +NGEW+L P  N  S +
Sbjct  488  LNWVLGSNSEKLEGRPPSCRLTDKADDRLREWFEDDEALERTINGEWYLIPHGNECSVS  546



>ref|XP_008241462.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Prunus mume]
Length=661

 Score =   301 bits (772),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 161/187 (86%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
             VTLLGDS+HAMQPN+GQGGCMAIEDGYQLALELDKAW++S E+G P+D+ SSL+SYE  
Sbjct  367  HVTLLGDSVHAMQPNMGQGGCMAIEDGYQLALELDKAWKKSSETGTPVDVASSLRSYENS  426

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAALMA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGR FID AMPLM
Sbjct  427  RRLRVAIIHGMARMAALMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRVFIDKAMPLM  486

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   CRLSDKA+D LR WF+DDDALERA++GEW+L P     + AS
Sbjct  487  LSWVLGGNSSKLEGRSPSCRLSDKASDLLRTWFEDDDALERAIDGEWYLIPC-GQDNDAS  545

Query  543  EPILLRR  563
            + I L R
Sbjct  546  QLICLNR  552



>ref|XP_003638746.1| Zeaxanthin epoxidase [Medicago truncatula]
Length=663

 Score =   301 bits (771),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 160/187 (86%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIED YQLA ELD AW QS++SG PI + S+L+SYE E
Sbjct  367  RVTLLGDSVHAMQPNMGQGGCMAIEDSYQLAKELDNAWEQSIKSGNPIKVDSALRSYESE  426

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRV +IHG+ARMAALMA+TYKAYLGVGLGPL FLT FRIPHPGRVGGRFF+D+ MP M
Sbjct  427  RKLRVAVIHGMARMAALMASTYKAYLGVGLGPLEFLTNFRIPHPGRVGGRFFVDILMPSM  486

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+W+LGGN +KLEGRP  CRLSDKAN QLR+WF+DDDALERA+NGEWFL P    T   S
Sbjct  487  LNWILGGNSDKLEGRPISCRLSDKANGQLRQWFEDDDALERAINGEWFLLPCGEETGL-S  545

Query  543  EPILLRR  563
            +PI L +
Sbjct  546  KPIRLTQ  552



>ref|XP_010269709.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Nelumbo nucifera]
Length=665

 Score =   301 bits (771),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIED YQLALEL+KAW  SVESG P+DITSSLK YE+ 
Sbjct  366  RVTLLGDSVHAMQPNLGQGGCMAIEDSYQLALELEKAWIHSVESGTPLDITSSLKRYEEA  425

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV II+GLARMAA+MA+TYK YLGVGLGPLSFLT+F+IPHPGRVGGRFFI  AMPLM
Sbjct  426  RRLRVTIIYGLARMAAVMASTYKPYLGVGLGPLSFLTKFKIPHPGRVGGRFFIHFAMPLM  485

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            +SWVLGGN  KLEGR   CRL+DKAN+QL+KWF+DDDALERA+N EWFL P ++  +   
Sbjct  486  MSWVLGGNSSKLEGRSLCCRLTDKANNQLQKWFEDDDALERALNAEWFLFPSESEANGDL  545

Query  543  EPILLRR  563
            +PI L R
Sbjct  546  QPIHLGR  552



>ref|XP_007156802.1| hypothetical protein PHAVU_002G018700g [Phaseolus vulgaris]
 gb|ESW28796.1| hypothetical protein PHAVU_002G018700g [Phaseolus vulgaris]
Length=664

 Score =   301 bits (771),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 158/187 (84%), Gaps = 2/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED YQLALELD AW QS++SG PIDI  SLKSYE+E
Sbjct  369  RVTLLGDSIHAMQPNMGQGGCMAIEDSYQLALELDNAWEQSIKSGYPIDIDCSLKSYERE  428

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV I+HG+ARMAALMA TYKAYLGVGLG L FLT+FRIPHPGRVGGRFFID  MPLM
Sbjct  429  RRLRVAIVHGMARMAALMATTYKAYLGVGLGRLEFLTKFRIPHPGRVGGRFFIDKMMPLM  488

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLGGN  KLEGRP  CRLSDKANDQL  WF+D+DALERA+NGEW L P   A S   
Sbjct  489  LNWVLGGNSSKLEGRPICCRLSDKANDQLHTWFEDNDALERAINGEWMLLPCDEAGSV--  546

Query  543  EPILLRR  563
            +PI L +
Sbjct  547  KPISLSQ  553



>ref|XP_006280131.1| hypothetical protein CARUB_v10026026mg [Capsella rubella]
 gb|EOA13029.1| hypothetical protein CARUB_v10026026mg [Capsella rubella]
Length=669

 Score =   301 bits (771),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED +QLALEL++AW+QSVE+   +D+ SSLK YE+ 
Sbjct  370  RVTLLGDSIHAMQPNMGQGGCMAIEDSFQLALELEEAWKQSVETNTSVDVVSSLKKYEES  429

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFLT+FR+PHPGRVGGRFFID+AMPLM
Sbjct  430  RRLRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRFFIDIAMPLM  489

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSP  515
            L+WVLGGN EKLEGRP  CRL+DKA+D+LR+WF++DDALER +NGEW+L P
Sbjct  490  LNWVLGGNSEKLEGRPPSCRLTDKADDRLREWFENDDALERTINGEWYLIP  540



>dbj|BAA88841.1| zea-xanthin epoxidase [Gentiana lutea]
Length=663

 Score =   301 bits (770),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 158/187 (84%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            R TLLGDS+HAMQPNLGQGGCMAIEDGYQLA EL+K W QS +SG PIDI S L+SYE+ 
Sbjct  368  RTTLLGDSVHAMQPNLGQGGCMAIEDGYQLAQELEKGWNQSEKSGDPIDIGSCLRSYERS  427

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R LRV IIHGLARMAA+MA TYK YLGVGLGPLSFLT+ RIPHPGRVGGR FID+ MPLM
Sbjct  428  RILRVSIIHGLARMAAIMATTYKPYLGVGLGPLSFLTKLRIPHPGRVGGRVFIDIGMPLM  487

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGNG KLEGRP QCRLSDKANDQL+ WF DDD++ERA+N EWFL P+   T T+S
Sbjct  488  LSWVLGGNGSKLEGRPLQCRLSDKANDQLQTWFVDDDSMERALNAEWFLFPIGPLT-TSS  546

Query  543  EPILLRR  563
            + I L R
Sbjct  547  QTIFLNR  553



>gb|KEH27528.1| zeaxanthin epoxidase [Medicago truncatula]
Length=561

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIEDGYQLA ELD AW+QS +SG+ IDI SSLKSYE+E
Sbjct  362  RVTLLGDSVHAMQPNMGQGGCMAIEDGYQLAFELDNAWQQSAKSGSTIDIASSLKSYERE  421

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV  +HG+ARMAALMA+TYKAYLGVGLGP  FLT+FRIPHPGRVGGRFFI  +MPLM
Sbjct  422  RRLRVTFVHGMARMAALMASTYKAYLGVGLGPFEFLTKFRIPHPGRVGGRFFIQKSMPLM  481

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSP  515
            L+WVLGGN  KLEGRP  CRLSDKA+DQL  WF+DDDALER +NGEW L P
Sbjct  482  LNWVLGGNSSKLEGRPLCCRLSDKASDQLHTWFEDDDALERTINGEWILLP  532



>dbj|BAB39765.1| zeaxanthin epoxidase [Oryza sativa Japonica Group]
Length=626

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 161/187 (86%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+K+W++S +SG P+DI SSL+ YEKE
Sbjct  364  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKSWQESAKSGTPMDIVSSLRRYEKE  423

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R LRV +IHGLARMAA+MA TY+ YLGVGLGPLSFLT+ RIPHPGRVGGRFFI   MPLM
Sbjct  424  RILRVSVIHGLARMAAIMATTYRPYLGVGLGPLSFLTKLRIPHPGRVGGRFFIKYGMPLM  483

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGRP  CRLSDKANDQLR+WF+DDDALE+AM GEW+L P    +S  S
Sbjct  484  LSWVLGGNSTKLEGRPLSCRLSDKANDQLRRWFEDDDALEQAMGGEWYLLP---TSSGDS  540

Query  543  EPILLRR  563
            +PI L R
Sbjct  541  QPIRLIR  547



>ref|XP_010444704.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Camelina sativa]
Length=665

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED +QLALELD+AW+QSVE+  P+D+ SSLK YE+ 
Sbjct  366  RVTLLGDSIHAMQPNMGQGGCMAIEDSFQLALELDEAWKQSVETKTPVDVVSSLKRYEES  425

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV +IHG+ARMAA+MA+TYKAYLGVGLGPLSFLT+FR+PHPGRVGGRFFID+AMP+M
Sbjct  426  RRLRVALIHGMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRFFIDIAMPMM  485

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSP  515
            L+WVLGGN EKLEGR   CRL+DKA+D+LR+WF+DDDALER + GEW+L P
Sbjct  486  LNWVLGGNSEKLEGRSPSCRLTDKADDRLREWFEDDDALERTIKGEWYLIP  536



>ref|NP_001052926.1| Os04g0448900 [Oryza sativa Japonica Group]
 sp|Q0JCU7.1|ZEP_ORYSJ RecName: Full=Zeaxanthin epoxidase, chloroplastic; Short=OsZEP1; 
AltName: Full=Protein ABA DEFICIENT 1; Short=OsABA1; Flags: 
Precursor [Oryza sativa Japonica Group]
 dbj|BAF14840.1| Os04g0448900 [Oryza sativa Japonica Group]
Length=659

 Score =   300 bits (767),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 161/187 (86%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+K+W++S +SG P+DI SSL+ YEKE
Sbjct  364  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKSWQESAKSGTPMDIVSSLRRYEKE  423

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R LRV +IHGLARMAA+MA TY+ YLGVGLGPLSFLT+ RIPHPGRVGGRFFI   MPLM
Sbjct  424  RILRVSVIHGLARMAAIMATTYRPYLGVGLGPLSFLTKLRIPHPGRVGGRFFIKYGMPLM  483

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGRP  CRLSDKANDQLR+WF+DDDALE+AM GEW+L P    +S  S
Sbjct  484  LSWVLGGNSTKLEGRPLSCRLSDKANDQLRRWFEDDDALEQAMGGEWYLLP---TSSGDS  540

Query  543  EPILLRR  563
            +PI L R
Sbjct  541  QPIRLIR  547



>gb|EAZ30898.1| hypothetical protein OsJ_14973 [Oryza sativa Japonica Group]
Length=629

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 161/187 (86%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+K+W++S +SG P+DI SSL+ YEKE
Sbjct  334  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKSWQESAKSGTPMDIVSSLRRYEKE  393

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R LRV +IHGLARMAA+MA TY+ YLGVGLGPLSFLT+ RIPHPGRVGGRFFI   MPLM
Sbjct  394  RILRVSVIHGLARMAAIMATTYRPYLGVGLGPLSFLTKLRIPHPGRVGGRFFIKYGMPLM  453

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGRP  CRLSDKANDQLR+WF+DDDALE+AM GEW+L P    +S  S
Sbjct  454  LSWVLGGNSTKLEGRPLSCRLSDKANDQLRRWFEDDDALEQAMGGEWYLLP---TSSGDS  510

Query  543  EPILLRR  563
            +PI L R
Sbjct  511  QPIRLIR  517



>emb|CAD40867.2| OSJNBa0064H22.16 [Oryza sativa Japonica Group]
 emb|CAH67090.1| H0818E04.7 [Oryza sativa Indica Group]
 emb|CAH67204.1| OSIGBa0152K17.16 [Oryza sativa Indica Group]
Length=652

 Score =   299 bits (766),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 161/187 (86%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+K+W++S +SG P+DI SSL+ YEKE
Sbjct  357  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKSWQESAKSGTPMDIVSSLRRYEKE  416

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R LRV +IHGLARMAA+MA TY+ YLGVGLGPLSFLT+ RIPHPGRVGGRFFI   MPLM
Sbjct  417  RILRVSVIHGLARMAAIMATTYRPYLGVGLGPLSFLTKLRIPHPGRVGGRFFIKYGMPLM  476

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGRP  CRLSDKANDQLR+WF+DDDALE+AM GEW+L P    +S  S
Sbjct  477  LSWVLGGNSTKLEGRPLSCRLSDKANDQLRRWFEDDDALEQAMGGEWYLLP---TSSGDS  533

Query  543  EPILLRR  563
            +PI L R
Sbjct  534  QPIRLIR  540



>ref|XP_002865032.1| hypothetical protein ARALYDRAFT_496897 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41291.1| hypothetical protein ARALYDRAFT_496897 [Arabidopsis lyrata subsp. 
lyrata]
Length=667

 Score =   300 bits (767),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED +QLALEL++AW+QSV +  P+D+ SSLK YE+ 
Sbjct  368  RVTLLGDSIHAMQPNMGQGGCMAIEDSFQLALELEEAWKQSVGTNTPVDVVSSLKRYEES  427

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFLT+FR+PHPGRVGGRFF+D+AMPLM
Sbjct  428  RRLRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRFFVDIAMPLM  487

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSP  515
            L WVLGGN EKLEGRP  CRL+DKA+D+LR+WF+DDDALER + GEW+L P
Sbjct  488  LDWVLGGNSEKLEGRPPSCRLTDKADDRLREWFEDDDALERTIKGEWYLIP  538



>gb|EMS59958.1| Zeaxanthin epoxidase, chloroplastic [Triticum urartu]
Length=676

 Score =   300 bits (768),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+KAW +SV+S  P+D+ SSL+SYEKE
Sbjct  378  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKAWEESVKSRTPVDVISSLRSYEKE  437

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRV IIHGLARMAA+MA TY+ YLGVGLGPLSFLT+ RIPHPGRVGGRFFI + MPLM
Sbjct  438  RKLRVAIIHGLARMAAIMATTYRPYLGVGLGPLSFLTKLRIPHPGRVGGRFFIKVGMPLM  497

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSW+LGGN  KLEGRP  CRLSDKA++QL +WF DDDALE+AM GEW+L P+ +   +A 
Sbjct  498  LSWILGGNSSKLEGRPLSCRLSDKASNQLGRWFQDDDALEQAMGGEWYLFPMSSGGDSAL  557

Query  543  EPILLRR  563
            +PI L R
Sbjct  558  QPIRLIR  564



>ref|XP_010484561.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Camelina 
sativa]
Length=668

 Score =   298 bits (764),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED +QLALELD+AW+QSV++  P+D+ SSLK YE+ 
Sbjct  369  RVTLLGDSIHAMQPNMGQGGCMAIEDSFQLALELDEAWKQSVKTKTPVDVVSSLKRYEES  428

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV +IHG+ARMAA+MA+TYKAYLGVGLGPLSFLT+FR+PHPGRVGGRFFID+AMP+M
Sbjct  429  RRLRVALIHGMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRFFIDIAMPMM  488

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSP  515
            L+WVLGGN EKLEGR   CRL+DKA+D+LR+WF+DDDALER + GEW+L P
Sbjct  489  LNWVLGGNSEKLEGRSPSCRLTDKADDRLREWFEDDDALERTIKGEWYLIP  539



>ref|XP_004511928.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Cicer arietinum]
Length=661

 Score =   298 bits (762),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 158/187 (84%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIEDGYQLA ELD AW+QS +S +PIDI SSLK YE+E
Sbjct  365  RVTLLGDSVHAMQPNMGQGGCMAIEDGYQLAWELDNAWQQSTKSASPIDIDSSLKRYERE  424

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAALMA+TYKAYLGVGLGPL FLT+FRIPHPGRVGG F ID  MPLM
Sbjct  425  RRLRVAIIHGMARMAALMASTYKAYLGVGLGPLEFLTKFRIPHPGRVGGMFLIDKVMPLM  484

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLGGN  KLEGRP  CRLSDKA+DQL +WF+DDDALER +NGEW L P ++      
Sbjct  485  LNWVLGGNSSKLEGRPICCRLSDKASDQLHRWFEDDDALERTINGEWNLLPCRDEAGFL-  543

Query  543  EPILLRR  563
            +PI L R
Sbjct  544  KPICLSR  550



>gb|KEH27527.1| zeaxanthin epoxidase [Medicago truncatula]
Length=663

 Score =   297 bits (760),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIEDGYQLA ELD AW+QS +SG+ IDI SSLKSYE+E
Sbjct  362  RVTLLGDSVHAMQPNMGQGGCMAIEDGYQLAFELDNAWQQSAKSGSTIDIASSLKSYERE  421

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV  +HG+ARMAALMA+TYKAYLGVGLGP  FLT+FRIPHPGRVGGRFFI  +MPLM
Sbjct  422  RRLRVTFVHGMARMAALMASTYKAYLGVGLGPFEFLTKFRIPHPGRVGGRFFIQKSMPLM  481

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSP  515
            L+WVLGGN  KLEGRP  CRLSDKA+DQL  WF+DDDALER +NGEW L P
Sbjct  482  LNWVLGGNSSKLEGRPLCCRLSDKASDQLHTWFEDDDALERTINGEWILLP  532



>ref|XP_010666612.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=675

 Score =   297 bits (760),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 159/187 (85%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            R+TLLGDS+HAMQPNLGQGGCMAIED Y+LA  L+KAW+ SVESG P+D+ SSL+SYE  
Sbjct  377  RITLLGDSVHAMQPNLGQGGCMAIEDSYELARGLEKAWQTSVESGKPVDVVSSLRSYESA  436

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRV IIHGLARMAA+MA TYK +LGVGLGPLSFLT+F+IPHPGRVGGR FI  AMPLM
Sbjct  437  RKLRVAIIHGLARMAAVMATTYKPFLGVGLGPLSFLTKFKIPHPGRVGGRVFISPAMPLM  496

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN EKLEGR   CRLS+KAN+QLR+WF+DDDALERA++GEWFL P  N   T  
Sbjct  497  LSWVLGGNSEKLEGRVPHCRLSEKANNQLRRWFEDDDALERALSGEWFLLPQGNDAETL-  555

Query  543  EPILLRR  563
            EPI L R
Sbjct  556  EPICLSR  562



>gb|AFR11774.2| zeaxanthin epoxidase [Fragaria x ananassa]
Length=660

 Score =   296 bits (757),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 160/186 (86%), Gaps = 1/186 (1%)
 Frame = +3

Query  6    VTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKER  185
            VTLLGDS+HAMQPNLGQGGCMAIEDGYQLALEL+KA ++S E G P DI +SL+SYE  R
Sbjct  368  VTLLGDSVHAMQPNLGQGGCMAIEDGYQLALELEKALKKSRELGTPPDIAASLRSYETSR  427

Query  186  RLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLML  365
            +LRV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGR FID AMPLML
Sbjct  428  KLRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRIFIDKAMPLML  487

Query  366  SWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTASE  545
            SWVLGGN  KLEGRP  CRLSDKA+DQLR WF+DDDALERA++GEW+L P  +    AS+
Sbjct  488  SWVLGGNSSKLEGRPPSCRLSDKADDQLRSWFEDDDALERAIDGEWYLIPCGHENG-ASQ  546

Query  546  PILLRR  563
             I L R
Sbjct  547  LIRLNR  552



>gb|ACE79170.1| zeaxanthin epoxidase [Citrus maxima]
Length=664

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 159/185 (86%), Gaps = 1/185 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+ AMQPNLGQGGC+AIEDG+QLA+EL KA ++S ES  PIDI S+LKSYE+ 
Sbjct  364  RVTLLGDSVPAMQPNLGQGGCLAIEDGHQLAVELGKACKKSNESKTPIDIVSALKSYERA  423

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV +IHGLAR AA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGRFFIDLAMPLM
Sbjct  424  RRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLM  483

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   C+LSDKA+D LR WF DDDALERAMNGEWFL P   + +  S
Sbjct  484  LSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVP-SGSENVVS  542

Query  543  EPILL  557
            +PI L
Sbjct  543  QPIYL  547



>gb|KDO79209.1| hypothetical protein CISIN_1g005770mg [Citrus sinensis]
Length=678

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 161/199 (81%), Gaps = 15/199 (8%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+KA ++S ES  PIDI S+LKSYE+ 
Sbjct  364  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERA  423

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV +IHGLAR AA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGRFFIDLAMPLM
Sbjct  424  RRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLM  483

Query  363  LSWVLGGN--------------GEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGE  500
            LSWVLGGN                KLEGR   C+LSDKA+D LR WF DDDALERAMNGE
Sbjct  484  LSWVLGGNSIGQLVISYDHICISSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGE  543

Query  501  WFLSPLKNATSTASEPILL  557
            WFL P   + +  S+PI L
Sbjct  544  WFLVP-SGSENVVSQPIYL  561



>gb|AHI87686.1| zeaxanthin epoxidase [Lupinus luteus]
Length=689

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 162/204 (79%), Gaps = 18/204 (9%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESG---------------  137
            RVTLLGDS+HAMQPN+GQGGCMAIED YQLALE+D AW QS++SG               
Sbjct  375  RVTLLGDSVHAMQPNMGQGGCMAIEDSYQLALEVDNAWEQSIKSGQLALEVDNAWEQSIK  434

Query  138  --APIDITSSLKSYEKERRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPH  311
              +PID+ SSL+SYE+ERRLRV IIHG+ARMAALMA+TYKAYLG GLGPL FLT+FRIPH
Sbjct  435  SGSPIDVDSSLRSYERERRLRVAIIHGMARMAALMASTYKAYLGDGLGPLEFLTKFRIPH  494

Query  312  PGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAM  491
            PGRVGGRFF+D+ MP MLSWVLGGN  KLEGRP  CRLSDKANDQLR+WF+DDDALERA 
Sbjct  495  PGRVGGRFFVDMFMPSMLSWVLGGNSSKLEGRPLSCRLSDKANDQLRRWFEDDDALERAN  554

Query  492  NGEWFLSPLKNATSTASEPILLRR  563
            +GEW L P    T   S+PI L R
Sbjct  555  SGEWTLLPQGEETG-HSKPISLSR  577



>ref|XP_010939417.1| PREDICTED: zeaxanthin epoxidase, chloroplastic isoform X3 [Elaeis 
guineensis]
Length=554

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 160/185 (86%), Gaps = 4/185 (2%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
             VTLLGDS+HAMQPN+GQGGCMAIED YQLALEL+KAW +S  +GAP+DITS LK YEKE
Sbjct  363  HVTLLGDSVHAMQPNMGQGGCMAIEDSYQLALELEKAWIESARTGAPMDITSPLKRYEKE  422

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV II+G+ARMAA+MA+TY+ YLGVGLGPLSFLT+FRIPHPG+VGGRFFI LAMP M
Sbjct  423  RRLRVAIIYGMARMAAIMASTYRPYLGVGLGPLSFLTKFRIPHPGKVGGRFFIKLAMPSM  482

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   CRLSDKA+DQL++WF+DDDA+ERA+ GEW+L P    TS + 
Sbjct  483  LSWVLGGNSSKLEGRSLSCRLSDKASDQLKRWFNDDDAMERALTGEWYLFP----TSGSL  538

Query  543  EPILL  557
            +PI L
Sbjct  539  QPIHL  543



>gb|KFK28343.1| hypothetical protein AALP_AA8G503900 [Arabis alpina]
Length=663

 Score =   294 bits (753),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 162/187 (87%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED YQLA EL+ AW+QSV++  P+D+ SSLK YE+ 
Sbjct  364  RVTLLGDSIHAMQPNMGQGGCMAIEDSYQLASELEDAWKQSVDTNRPVDVVSSLKRYEES  423

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFLT+FR+PHPGRVGGRFFID+AMPLM
Sbjct  424  RRLRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRFFIDIAMPLM  483

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLGGN EKLEGR   CRL+D+A+D+LR+WFDD++ALER ++GEW+L P +      S
Sbjct  484  LNWVLGGNSEKLEGRAPSCRLTDRADDRLREWFDDNEALERTISGEWYLIP-QGDDCCVS  542

Query  543  EPILLRR  563
            E + L +
Sbjct  543  ETLCLTK  549



>tpg|DAA37569.1| TPA: hypothetical protein ZEAMMB73_483204 [Zea mays]
Length=570

 Score =   292 bits (747),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+ AW++SV++  PIDI SSL+ YEKE
Sbjct  268  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELENAWQESVKTETPIDIVSSLRRYEKE  327

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHGLARMAA+MA TY+ YLGVGLGPLSFLT+ RIPHPGRVGGRFFI   MP M
Sbjct  328  RRLRVAIIHGLARMAAIMATTYRPYLGVGLGPLSFLTKLRIPHPGRVGGRFFIKYGMPTM  387

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   CRLSDKANDQL +WF+DDDALE AM GEW+L         + 
Sbjct  388  LSWVLGGNSSKLEGRLLSCRLSDKANDQLYQWFEDDDALEEAMGGEWYLIATSEGNCNSL  447

Query  543  EPILLRR  563
            +PI L R
Sbjct  448  QPIHLIR  454



>gb|EPS62910.1| zeaxanthin epoxidase, chloroplastic, partial [Genlisea aurea]
Length=514

 Score =   290 bits (741),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 157/188 (84%), Gaps = 2/188 (1%)
 Frame = +3

Query  6    VTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKER  185
            VTLLGDSIHAMQPNLGQGGCMAIEDGYQLALEL KA  +  ESG PIDI +SL  YE  R
Sbjct  299  VTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELGKAVGRCAESGKPIDIAASLTRYEDAR  358

Query  186  RLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLML  365
            ++RV +IHGLAR AA+MA+TYKAYLGVGLGPLSFLTQFRIPHPGRVGGR FID+AMPLML
Sbjct  359  KVRVAVIHGLARFAAIMASTYKAYLGVGLGPLSFLTQFRIPHPGRVGGRLFIDIAMPLML  418

Query  366  SWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS-  542
            SWVLGGNG  LEGR  QCRLSDKA+DQLR WF DDDALERA++ +WF+ P  + T++ + 
Sbjct  419  SWVLGGNGSNLEGRALQCRLSDKADDQLRTWFTDDDALERALDADWFMLPNGDRTTSGAE  478

Query  543  -EPILLRR  563
             E I L R
Sbjct  479  METIFLSR  486



>ref|XP_010939416.1| PREDICTED: zeaxanthin epoxidase, chloroplastic isoform X2 [Elaeis 
guineensis]
Length=606

 Score =   291 bits (746),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 160/185 (86%), Gaps = 4/185 (2%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
             VTLLGDS+HAMQPN+GQGGCMAIED YQLALEL+KAW +S  +GAP+DITS LK YEKE
Sbjct  363  HVTLLGDSVHAMQPNMGQGGCMAIEDSYQLALELEKAWIESARTGAPMDITSPLKRYEKE  422

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV II+G+ARMAA+MA+TY+ YLGVGLGPLSFLT+FRIPHPG+VGGRFFI LAMP M
Sbjct  423  RRLRVAIIYGMARMAAIMASTYRPYLGVGLGPLSFLTKFRIPHPGKVGGRFFIKLAMPSM  482

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   CRLSDKA+DQL++WF+DDDA+ERA+ GEW+L P    TS + 
Sbjct  483  LSWVLGGNSSKLEGRSLSCRLSDKASDQLKRWFNDDDAMERALTGEWYLFP----TSGSL  538

Query  543  EPILL  557
            +PI L
Sbjct  539  QPIHL  543



>ref|XP_010939415.1| PREDICTED: zeaxanthin epoxidase, chloroplastic isoform X1 [Elaeis 
guineensis]
Length=657

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 160/185 (86%), Gaps = 4/185 (2%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
             VTLLGDS+HAMQPN+GQGGCMAIED YQLALEL+KAW +S  +GAP+DITS LK YEKE
Sbjct  363  HVTLLGDSVHAMQPNMGQGGCMAIEDSYQLALELEKAWIESARTGAPMDITSPLKRYEKE  422

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV II+G+ARMAA+MA+TY+ YLGVGLGPLSFLT+FRIPHPG+VGGRFFI LAMP M
Sbjct  423  RRLRVAIIYGMARMAAIMASTYRPYLGVGLGPLSFLTKFRIPHPGKVGGRFFIKLAMPSM  482

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   CRLSDKA+DQL++WF+DDDA+ERA+ GEW+L P    TS + 
Sbjct  483  LSWVLGGNSSKLEGRSLSCRLSDKASDQLKRWFNDDDAMERALTGEWYLFP----TSGSL  538

Query  543  EPILL  557
            +PI L
Sbjct  539  QPIHL  543



>ref|XP_008668109.1| PREDICTED: zeaxanthin epoxidase isoform X1 [Zea mays]
Length=664

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+ AW++SV++  PIDI SSL+ YEKE
Sbjct  362  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELENAWQESVKTETPIDIVSSLRRYEKE  421

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHGLARMAA+MA TY+ YLGVGLGPLSFLT+ RIPHPGRVGGRFFI   MP M
Sbjct  422  RRLRVAIIHGLARMAAIMATTYRPYLGVGLGPLSFLTKLRIPHPGRVGGRFFIKYGMPTM  481

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   CRLSDKANDQL +WF+DDDALE AM GEW+L         + 
Sbjct  482  LSWVLGGNSSKLEGRLLSCRLSDKANDQLYQWFEDDDALEEAMGGEWYLIATSEGNCNSL  541

Query  543  EPILLRR  563
            +PI L R
Sbjct  542  QPIHLIR  548



>tpg|DAA37570.1| TPA: zeaxanthin epoxidase [Zea mays]
Length=669

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+ AW++SV++  PIDI SSL+ YEKE
Sbjct  367  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELENAWQESVKTETPIDIVSSLRRYEKE  426

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHGLARMAA+MA TY+ YLGVGLGPLSFLT+ RIPHPGRVGGRFFI   MP M
Sbjct  427  RRLRVAIIHGLARMAAIMATTYRPYLGVGLGPLSFLTKLRIPHPGRVGGRFFIKYGMPTM  486

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   CRLSDKANDQL +WF+DDDALE AM GEW+L         + 
Sbjct  487  LSWVLGGNSSKLEGRLLSCRLSDKANDQLYQWFEDDDALEEAMGGEWYLIATSEGNCNSL  546

Query  543  EPILLRR  563
            +PI L R
Sbjct  547  QPIHLIR  553



>ref|NP_001151443.1| zeaxanthin epoxidase [Zea mays]
 gb|ACG42893.1| zeaxanthin epoxidase [Zea mays]
Length=669

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+ AW++SV++  PIDI SSL+ YEKE
Sbjct  367  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELENAWQESVKTETPIDIVSSLRRYEKE  426

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHGLARMAA+MA TY+ YLGVGLGPLSFLT+ RIPHPGRVGGRFFI   MP M
Sbjct  427  RRLRVAIIHGLARMAAIMATTYRPYLGVGLGPLSFLTKLRIPHPGRVGGRFFIKYGMPAM  486

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   CRLSDKANDQL +WF+DDDALE AM GEW+L         + 
Sbjct  487  LSWVLGGNSSKLEGRLLSCRLSDKANDQLYQWFEDDDALEEAMGGEWYLIATSEGNCNSL  546

Query  543  EPILLRR  563
            +PI L R
Sbjct  547  QPIHLIR  553



>ref|XP_008797271.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Phoenix dactylifera]
Length=657

 Score =   291 bits (745),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 160/185 (86%), Gaps = 4/185 (2%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIED YQLALEL+KAW +S  +GAPIDITS LK YE E
Sbjct  363  RVTLLGDSVHAMQPNMGQGGCMAIEDSYQLALELEKAWIESARTGAPIDITSPLKRYENE  422

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV I++G+ARMAA+MA+TY+ YLGVGLGPLSFLT+FRIPHPG+VGGRFFI LAMP M
Sbjct  423  RRLRVAIVYGMARMAAIMASTYRPYLGVGLGPLSFLTKFRIPHPGKVGGRFFIKLAMPAM  482

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   CRLSD+A+DQL++WF DDDALERA++GEW+L P    T+ + 
Sbjct  483  LSWVLGGNSSKLEGRSLSCRLSDRASDQLQRWFKDDDALERALSGEWYLFP----TNGSL  538

Query  543  EPILL  557
            +PI L
Sbjct  539  QPIHL  543



>dbj|BAA88842.1| zea-Xanthin epoxidase [Gentiana lutea]
 gb|ACF21781.1| zeaxanthin epoxidase [Gentiana lutea]
Length=662

 Score =   290 bits (743),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +3

Query  6    VTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKER  185
             TLLGDS+HAMQPNLGQGGCMAIEDGYQLA EL K W  S +SG PIDI S L+SYE+ R
Sbjct  369  TTLLGDSVHAMQPNLGQGGCMAIEDGYQLAQELKKGWEHSEKSGNPIDIGSCLRSYERSR  428

Query  186  RLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLML  365
             LRV IIHGLARMAA+M   YK YLGVGLGPLSFLT+FRIPHPGRVGGR FID+ MPLML
Sbjct  429  ILRVSIIHGLARMAAIMQQLYKPYLGVGLGPLSFLTKFRIPHPGRVGGRVFIDIGMPLML  488

Query  366  SWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTASE  545
            SWVLGGNG KLEGRP QCRLSDKANDQL+ WF DDD++ERA+  EWFL P+   T T+S 
Sbjct  489  SWVLGGNGSKLEGRPLQCRLSDKANDQLQTWFVDDDSMERALKAEWFLFPIGPLT-TSSH  547

Query  546  PILLRR  563
             I L R
Sbjct  548  TIFLNR  553



>gb|KEH27529.1| zeaxanthin epoxidase [Medicago truncatula]
Length=699

 Score =   291 bits (745),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIEDGYQLA ELD AW+QS +SG+ IDI SSLKSYE+E
Sbjct  362  RVTLLGDSVHAMQPNMGQGGCMAIEDGYQLAFELDNAWQQSAKSGSTIDIASSLKSYERE  421

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV  +HG+ARMAALMA+TYKAYLGVGLGP  FLT+FRIPHPGRVGGRFFI  +MPLM
Sbjct  422  RRLRVTFVHGMARMAALMASTYKAYLGVGLGPFEFLTKFRIPHPGRVGGRFFIQKSMPLM  481

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEW  503
            L+WVLGGN  KLEGRP  CRLSDKA+DQL  WF+DDDALER +NGE+
Sbjct  482  LNWVLGGNSSKLEGRPLCCRLSDKASDQLHTWFEDDDALERTINGEY  528



>ref|XP_009410101.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=664

 Score =   290 bits (743),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIED YQLALEL+K+W+ SVE+G P+DI S LK YE+E
Sbjct  366  RVTLLGDSVHAMQPNMGQGGCMAIEDSYQLALELEKSWKHSVETGTPMDIASPLKRYEEE  425

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RR+RV +I+G+ARMAA+MA+TY+ YLGVGLGPLSFLT+F+IPHPGRVGGRF I  AMPLM
Sbjct  426  RRIRVALIYGMARMAAIMASTYRPYLGVGLGPLSFLTKFQIPHPGRVGGRFIIQFAMPLM  485

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLGGN   L GRP  CRL+DKA+DQL++WF+DDDA+ERAM GEW+L P      +A 
Sbjct  486  LNWVLGGNSSNLSGRPLSCRLTDKASDQLQRWFEDDDAMERAMGGEWYLLPAVTGNDSAL  545

Query  543  EPILLRR  563
            +PI L +
Sbjct  546  KPIHLVK  552



>emb|CDY63427.1| BnaC08g48380D [Brassica napus]
Length=346

 Score =   281 bits (718),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 156/187 (83%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED YQLALEL++AW++SV +  P+DI SSLK YE+ 
Sbjct  46   RVTLLGDSIHAMQPNMGQGGCMAIEDSYQLALELEEAWKKSVATNKPVDIVSSLKRYEES  105

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RR+RV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFL + RI HPG +GGRF +D+ MPLM
Sbjct  106  RRVRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLAKLRIQHPGIIGGRFLMDMTMPLM  165

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L WVLGGN EKLEGR   CRL+DKA+D+LR+WF+DD+ALER + GEW+L P  N  S  S
Sbjct  166  LDWVLGGNSEKLEGRSPNCRLTDKADDRLRQWFEDDEALERTIKGEWYLIPHGNKGS-VS  224

Query  543  EPILLRR  563
            E + L +
Sbjct  225  ETLCLTK  231



>ref|NP_001241348.1| zeaxanthin epoxidase, chloroplastic-like [Glycine max]
 gb|AEK69512.1| zeaxanthin epoxidase 2 [Glycine max]
Length=654

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 163/187 (87%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
             VTLLGDSIHAMQPN+GQGGCMAIED YQLALELD AW+QS++SG+PIDI SSLKSYE+E
Sbjct  358  HVTLLGDSIHAMQPNMGQGGCMAIEDSYQLALELDNAWQQSIKSGSPIDIDSSLKSYERE  417

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV I+HG+ARMAA+MA+TYKAYLGVGLGPL FLT+FRIPHPGRVGGRFFID  MPLM
Sbjct  418  RRLRVAIVHGMARMAAMMASTYKAYLGVGLGPLEFLTKFRIPHPGRVGGRFFIDKMMPLM  477

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLGGN  KLEGRP  CRLSDKANDQL +WF+D+DALERA+NGEW L P  +     +
Sbjct  478  LNWVLGGNSSKLEGRPVCCRLSDKANDQLHRWFEDNDALERAINGEWILLPCGDEAG-PT  536

Query  543  EPILLRR  563
            +PI L +
Sbjct  537  KPICLTQ  543



>ref|XP_010547517.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Tarenaya 
hassleriana]
Length=665

 Score =   286 bits (731),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 157/187 (84%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED YQLA EL+ AWR+SVE+  PIDI SSL+SYE+ 
Sbjct  364  RVTLLGDSIHAMQPNMGQGGCMAIEDSYQLAWELEHAWRRSVETDKPIDIVSSLRSYEEA  423

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRV IIHG+ARMAA+MA+TYK YLGVGLGPLSFLT  RIPHPG VGGRFFID+AMPLM
Sbjct  424  RKLRVAIIHGMARMAAIMASTYKGYLGVGLGPLSFLTMLRIPHPGTVGGRFFIDVAMPLM  483

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLGGN  KLEGR   CRLSDKA+DQL++WF D+DALER + G+W+L P  N  S  S
Sbjct  484  LNWVLGGNSSKLEGRLPCCRLSDKADDQLQRWFQDNDALERTVIGDWYLIPYGN-DSIVS  542

Query  543  EPILLRR  563
            E + L +
Sbjct  543  ETVRLDK  549



>dbj|BAI79260.1| zeaxanthin epoxidase [Citrus sinensis]
Length=664

 Score =   285 bits (730),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+KA ++S ES  PIDI S+LKSYE+ 
Sbjct  364  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERA  423

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV +IHGLAR AA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGRFFIDLAMPLM
Sbjct  424  RRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLM  483

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KL+   +      KA+D LR WF DDDALERAMNGEWFL P   + +  S
Sbjct  484  LSWVLGGNSSKLKVGHRVASSRTKASDNLRTWFRDDDALERAMNGEWFLVP-SGSENVVS  542

Query  543  EPILL  557
            +PI L
Sbjct  543  QPIYL  547



>dbj|BAI79258.1| zeaxanthin epoxidase [Citrus unshiu]
Length=664

 Score =   285 bits (730),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+KA ++S ES  PIDI S+LKSYE+ 
Sbjct  364  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERA  423

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV +IHGLAR AA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGRFFIDLAMPLM
Sbjct  424  RRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLM  483

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KL+   +      KA+D LR WF DDDALERAMNGEWFL P   + +  S
Sbjct  484  LSWVLGGNSSKLKVGHRVASSRTKASDNLRTWFRDDDALERAMNGEWFLVP-SGSENVVS  542

Query  543  EPILL  557
            +PI L
Sbjct  543  QPIYL  547



>ref|XP_008663244.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Zea mays]
Length=296

 Score =   273 bits (699),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 148/177 (84%), Gaps = 1/177 (1%)
 Frame = +3

Query  36   MQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKERRLRVGIIHGL  215
            MQPNLGQGGCMAIEDGYQLA+EL+ AW++SV++G P+DI SSL+ YEKERR+RV +IHGL
Sbjct  1    MQPNLGQGGCMAIEDGYQLAVELENAWQESVKTGTPMDIVSSLRRYEKERRVRVAVIHGL  60

Query  216  ARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEK  395
            ARMAA+MA TY+ YLGVGLGPLSFLT+ RIPHPGRVGGRFFI   MP MLSWVLGGN  K
Sbjct  61   ARMAAIMATTYRPYLGVGLGPLSFLTKLRIPHPGRVGGRFFIKYGMPAMLSWVLGGNSSK  120

Query  396  LEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTA-SEPILLRR  563
            LEGRP  CRLSDKA+D+L +WFDDDDALE+AM GEW+L     A + +  +PI L R
Sbjct  121  LEGRPLSCRLSDKAHDELYRWFDDDDALEQAMGGEWYLFATSEANNNSLQQPIRLIR  177



>ref|XP_009112353.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X2 
[Brassica rapa]
Length=590

 Score =   281 bits (720),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +3

Query  6    VTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKER  185
            VTLLGDSIHAMQPN+GQGGCMAIED YQLALEL++AW+QSV +  P+DI SSLK YE+ R
Sbjct  355  VTLLGDSIHAMQPNMGQGGCMAIEDSYQLALELEEAWKQSVVTNKPVDIVSSLKRYEESR  414

Query  186  RLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLML  365
            R+RV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFL + RI HPG +GGRF +D+ MPLML
Sbjct  415  RVRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLAKLRIQHPGIIGGRFLMDMTMPLML  474

Query  366  SWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTASE  545
             WVLGGN EKLEGR   CRL+DKA+D+LR+WF+DD+ALER +NGEW+L P   +  + SE
Sbjct  475  DWVLGGNSEKLEGRSPSCRLTDKADDRLRQWFEDDEALERTINGEWYLIP-HGSKCSVSE  533

Query  546  PILLRR  563
             + L +
Sbjct  534  TLCLTK  539



>ref|XP_009112352.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Brassica rapa]
Length=654

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +3

Query  6    VTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKER  185
            VTLLGDSIHAMQPN+GQGGCMAIED YQLALEL++AW+QSV +  P+DI SSLK YE+ R
Sbjct  355  VTLLGDSIHAMQPNMGQGGCMAIEDSYQLALELEEAWKQSVVTNKPVDIVSSLKRYEESR  414

Query  186  RLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLML  365
            R+RV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFL + RI HPG +GGRF +D+ MPLML
Sbjct  415  RVRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLAKLRIQHPGIIGGRFLMDMTMPLML  474

Query  366  SWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTASE  545
             WVLGGN EKLEGR   CRL+DKA+D+LR+WF+DD+ALER +NGEW+L P   +  + SE
Sbjct  475  DWVLGGNSEKLEGRSPSCRLTDKADDRLRQWFEDDEALERTINGEWYLIP-HGSKCSVSE  533

Query  546  PILLRR  563
             + L +
Sbjct  534  TLCLTK  539



>ref|XP_006494451.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Citrus sinensis]
Length=667

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 152/187 (81%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIED YQLA+EL++A  +S ES  PIDI S+LKSYE  
Sbjct  364  RVTLLGDSVHAMQPNMGQGGCMAIEDAYQLAVELERACNKSFESKTPIDIVSALKSYESA  423

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIH +AR AA+MA+TY  YL VGLGPLSFLT+F IPHPGRV  RFFIDLAMPLM
Sbjct  424  RRLRVAIIHRMARSAAMMASTYNGYLSVGLGPLSFLTKFPIPHPGRVVRRFFIDLAMPLM  483

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLGGN  KLEGR   CRLSDKA+DQLR WF D+DALERAMNGEW L P   + +  S
Sbjct  484  LNWVLGGNSSKLEGRSPCCRLSDKASDQLRTWFRDNDALERAMNGEWLLVP-SGSETVVS  542

Query  543  EPILLRR  563
            +PI L R
Sbjct  543  QPIYLSR  549



>emb|CDY18634.1| BnaA09g07610D [Brassica napus]
Length=654

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 156/187 (83%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED YQLALEL++AW++SV +  P+DI SSLK YE+ 
Sbjct  354  RVTLLGDSIHAMQPNMGQGGCMAIEDSYQLALELEEAWKKSVATNKPVDIVSSLKRYEES  413

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RR+RV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFL + RI HPG +GGRF +D+ MPLM
Sbjct  414  RRVRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLAKLRIQHPGIIGGRFLMDMTMPLM  473

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L WVLGGN EKLEGR   CRL+DKA+D+LR+WF+DD+ALER + GEW+L P  N  S  S
Sbjct  474  LDWVLGGNSEKLEGRSPNCRLTDKADDRLRQWFEDDEALERTIKGEWYLIPHGNKGSV-S  532

Query  543  EPILLRR  563
            E + L +
Sbjct  533  ETLCLTK  539



>ref|NP_201504.2| zeaxanthin epoxidase [Arabidopsis thaliana]
 gb|AED98293.1| zeaxanthin epoxidase (ZEP) (ABA1) [Arabidopsis thaliana]
Length=610

 Score =   280 bits (715),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED +QLALELD+AW+QSVE+  P+D+ SSLK YE+ 
Sbjct  367  RVTLLGDSIHAMQPNMGQGGCMAIEDSFQLALELDEAWKQSVETTTPVDVVSSLKRYEES  426

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIH +ARMAA+MA+TYKAYLGVGLGPLSFLT+FR+PHPGRVGGRFF+D+AMP M
Sbjct  427  RRLRVAIIHAMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRFFVDIAMPSM  486

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSP  515
            L WVLGGN EKL+GRP  CRL+DKA+D+LR+WF+DDDALER + GEW+L P
Sbjct  487  LDWVLGGNSEKLQGRPPSCRLTDKADDRLREWFEDDDALERTIKGEWYLIP  537



>gb|AAG17703.1|AF281655_1 zeaxanthin epoxidase [Arabidopsis thaliana]
 gb|AAG38877.1|AF283761_1 zeaxanthin epoxidase [Arabidopsis thaliana]
Length=667

 Score =   281 bits (718),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED +QLALELD+AW+QSVE+  P+D+ SSLK YE+ 
Sbjct  367  RVTLLGDSIHAMQPNMGQGGCMAIEDSFQLALELDEAWKQSVETTTPVDVVSSLKRYEES  426

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIH +ARMAA+MA+TYKAYLGVGLGPLSFLT+FR+PHPGRVGGRFF+D+AMP M
Sbjct  427  RRLRVAIIHAMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRFFVDIAMPSM  486

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSP  515
            L WVLGGN EKL+GRP  CRL+DKA+D+LR+WF+DDDALER + GEW+L P
Sbjct  487  LDWVLGGNSEKLQGRPPSCRLTDKADDRLREWFEDDDALERTIKGEWYLIP  537



>dbj|BAB11935.1| AtABA1 [Arabidopsis thaliana]
Length=667

 Score =   280 bits (717),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED +QLALELD+AW+QSVE+  P+D+ SSLK YE+ 
Sbjct  367  RVTLLGDSIHAMQPNMGQGGCMAIEDSFQLALELDEAWKQSVETTTPVDVVSSLKRYEES  426

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIH +ARMAA+MA+TYKAYLGVGLGPLSFLT+FR+PHPGRVGGRFF+D+AMP M
Sbjct  427  RRLRVAIIHAMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRFFVDIAMPSM  486

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSP  515
            L WVLGGN EKL+GRP  CRL+DKA+D+LR+WF+DDDALER + GEW+L P
Sbjct  487  LDWVLGGNSEKLQGRPPSCRLTDKADDRLREWFEDDDALERTIKGEWYLIP  537



>ref|NP_851285.1| zeaxanthin epoxidase [Arabidopsis thaliana]
 sp|Q9FGC7.1|ZEP_ARATH RecName: Full=Zeaxanthin epoxidase, chloroplastic; Short=AtZEP; 
AltName: Full=Protein ABA DEFICIENT 1; Short=AtABA1; AltName: 
Full=Protein IMPAIRED IN BABA-INDUCED STERILITY 3; AltName: 
Full=Protein LOW EXPRESSION OF OSMOTIC STRESS-RESPONSIVE 
GENES 6; AltName: Full=Protein NON-PHOTOCHEMICAL QUENCHING 
2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB08942.1| zeaxanthin epoxidase precursor [Arabidopsis thaliana]
 gb|AAM13144.1| zeaxanthin epoxidase precursor [Arabidopsis thaliana]
 gb|AED98292.1| zeaxanthin epoxidase (ZEP) (ABA1) [Arabidopsis thaliana]
Length=667

 Score =   280 bits (717),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED +QLALELD+AW+QSVE+  P+D+ SSLK YE+ 
Sbjct  367  RVTLLGDSIHAMQPNMGQGGCMAIEDSFQLALELDEAWKQSVETTTPVDVVSSLKRYEES  426

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIH +ARMAA+MA+TYKAYLGVGLGPLSFLT+FR+PHPGRVGGRFF+D+AMP M
Sbjct  427  RRLRVAIIHAMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRFFVDIAMPSM  486

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSP  515
            L WVLGGN EKL+GRP  CRL+DKA+D+LR+WF+DDDALER + GEW+L P
Sbjct  487  LDWVLGGNSEKLQGRPPSCRLTDKADDRLREWFEDDDALERTIKGEWYLIP  537



>gb|AAF82390.1|AF134577_1 zeaxanthin epoxidase [Arabidopsis thaliana]
 gb|AAF82391.1|AF134578_1 zeaxanthin epoxidase [Arabidopsis thaliana]
Length=667

 Score =   280 bits (717),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED +QLALELD+AW+QSVE+  P+D+ SSLK YE+ 
Sbjct  367  RVTLLGDSIHAMQPNMGQGGCMAIEDSFQLALELDEAWKQSVETTTPVDVVSSLKRYEES  426

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIH +ARMAA+MA+TYKAYLGVGLGPLSFLT+FR+PHPGRVGGRFF+D+AMP M
Sbjct  427  RRLRVAIIHAMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRFFVDIAMPSM  486

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSP  515
            L WVLGGN EKL+GRP  CRL+DKA+D+LR+WF+DDDALER + GEW+L P
Sbjct  487  LDWVLGGNSEKLQGRPPSCRLTDKADDRLREWFEDDDALERTIKGEWYLIP  537



>ref|XP_010939418.1| PREDICTED: zeaxanthin epoxidase, chloroplastic isoform X4 [Elaeis 
guineensis]
Length=541

 Score =   277 bits (708),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
             VTLLGDS+HAMQPN+GQGGCMAIED YQLALEL+KAW +S  +GAP+DITS LK YEKE
Sbjct  363  HVTLLGDSVHAMQPNMGQGGCMAIEDSYQLALELEKAWIESARTGAPMDITSPLKRYEKE  422

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV II+G+ARMAA+MA+TY+ YLGVGLGPLSFLT+FRIPHPG+VGGRFFI LAMP M
Sbjct  423  RRLRVAIIYGMARMAAIMASTYRPYLGVGLGPLSFLTKFRIPHPGKVGGRFFIKLAMPSM  482

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMN  494
            LSWVLGGN  KLEGR   CRLSDKA+DQL++WF+DDDA+ERA+ 
Sbjct  483  LSWVLGGNSSKLEGRSLSCRLSDKASDQLKRWFNDDDAMERALT  526



>sp|C3VEQ2.1|ZEP_ONCHC RecName: Full=Zeaxanthin epoxidase, chloroplastic; Short=OgZEP; 
Flags: Precursor [Oncidium hybrid cultivar]
 gb|ACP27627.1| zeaxanthin epoxidase [Oncidium hybrid cultivar]
Length=661

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 156/187 (83%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIED YQLA EL+KA ++S++S  P+D+ S+LK YEKE
Sbjct  366  RVTLLGDSVHAMQPNMGQGGCMAIEDSYQLAHELEKARKESIQSRKPMDVKSALKRYEKE  425

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV +I+G+ARMAA+MA+TY+ YLGVGLGPLSFLT+++IPHPGR  GR  I  AMPLM
Sbjct  426  RRLRVAVIYGMARMAAIMASTYRPYLGVGLGPLSFLTKYKIPHPGRTSGRLVIKYAMPLM  485

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGR   CRLSDKA+DQLRKWF+DDDALERA+ GEW+L PL N      
Sbjct  486  LSWVLGGNSSKLEGRSLTCRLSDKASDQLRKWFEDDDALERALGGEWYLFPLNNGD---I  542

Query  543  EPILLRR  563
            +PI L R
Sbjct  543  QPIRLVR  549



>emb|CDX81344.1| BnaC09g07550D [Brassica napus]
Length=657

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 156/187 (83%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED YQLALEL++AW+QSV +   +D+ SSLK YE+ 
Sbjct  357  RVTLLGDSIHAMQPNMGQGGCMAIEDSYQLALELEEAWKQSVVTNKHVDLVSSLKRYEES  416

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RR+RV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFL +FRI HPG +GGRF +D+ MPLM
Sbjct  417  RRVRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLAKFRIQHPGIIGGRFLMDMTMPLM  476

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L WVLGGN EKLEGR   CRL+DKA+D+LR+WF+DD+ALER + GEW+L P  +  S  S
Sbjct  477  LDWVLGGNSEKLEGRSPSCRLTDKADDRLRQWFEDDEALERTIIGEWYLIPYGSKCS-VS  535

Query  543  EPILLRR  563
            E + L +
Sbjct  536  ETLCLTK  542



>gb|ACL27574.1| zeaxanthin epoxidase [Cucumis melo]
Length=202

 Score =   261 bits (668),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIEDGYQLALELDKAW +SV SG+PIDI SSLKSYE  
Sbjct  59   RVTLLGDSVHAMQPNMGQGGCMAIEDGYQLALELDKAWNESVASGSPIDIVSSLKSYESS  118

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RR+RV +IHG+ARMAALMA+TYKAYLGVGLGPLSFLTQFRIPHPG  GGRFFIDLAMPLM
Sbjct  119  RRIRVAVIHGMARMAALMASTYKAYLGVGLGPLSFLTQFRIPHPGTFGGRFFIDLAMPLM  178

Query  363  LSWVLGGNGEKLEGRPKQCRLSDK  434
            L+WVLGGN  KLEGRP  CRLSDK
Sbjct  179  LNWVLGGNSSKLEGRPPACRLSDK  202



>emb|CDP02496.1| unnamed protein product [Coffea canephora]
Length=649

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 147/174 (84%), Gaps = 1/174 (1%)
 Frame = +3

Query  12   LLGDSIHAMQPNLGQG-GCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKERR  188
            +L   I+   P+   G GCMAIED YQLALELDKAW QS++SG+P+D+ S+LKSYE  R+
Sbjct  355  ILRRDIYDRTPSFSWGRGCMAIEDSYQLALELDKAWEQSIKSGSPMDVVSALKSYESARK  414

Query  189  LRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLMLS  368
            LRV IIHGLAR+AA+MA+TYK YLGVGLGPLSFLT+FRIPHPGRVGGR FID+ MPLMLS
Sbjct  415  LRVAIIHGLARLAAIMASTYKPYLGVGLGPLSFLTKFRIPHPGRVGGRIFIDIGMPLMLS  474

Query  369  WVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNAT  530
            WVLGGNG KLEGRP  CRL+DKA+DQL+KWF DDD+LERA+NGEWFL P+  A 
Sbjct  475  WVLGGNGSKLEGRPLHCRLTDKASDQLQKWFQDDDSLERALNGEWFLFPIGQAN  528



>ref|XP_002310139.1| zeaxanthin epoxidase family protein [Populus trichocarpa]
 gb|EEE90589.1| zeaxanthin epoxidase family protein [Populus trichocarpa]
Length=643

 Score =   265 bits (676),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 146/187 (78%), Gaps = 20/187 (11%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIED YQLA EL++AW+QS+ESG P+D+ SSL+SYE  
Sbjct  364  RVTLLGDSVHAMQPNMGQGGCMAIEDSYQLASELERAWKQSIESGTPVDVLSSLRSYENS  423

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFLT FRIPHPGRVGG           
Sbjct  424  RRLRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLTNFRIPHPGRVGG-----------  472

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
                      KLEGR   CRLSDKANDQLR+WF DDDALER++NGEWFL P  N  + AS
Sbjct  473  --------SSKLEGRSLSCRLSDKANDQLRRWFVDDDALERSLNGEWFLLPCGN-DAVAS  523

Query  543  EPILLRR  563
            +PI L R
Sbjct  524  QPIGLSR  530



>ref|XP_010558547.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Tarenaya hassleriana]
Length=665

 Score =   264 bits (675),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 154/187 (82%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RV+LLGDSIHAMQPN+GQGGCMAIED YQLA EL+ AWR SVE+  PID+ SSL+SYE+ 
Sbjct  365  RVSLLGDSIHAMQPNMGQGGCMAIEDSYQLAWELEHAWRHSVETNRPIDVVSSLRSYEQA  424

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R+LRV IIHG+ARMAA+MA+ YK YLGVGLGPLSFLT+ RIPHPG V GRFFIDLA+PLM
Sbjct  425  RKLRVAIIHGMARMAAMMASAYKGYLGVGLGPLSFLTKLRIPHPGTVCGRFFIDLAIPLM  484

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLGGN  KLEGR  +CRLSDKANDQL++WF D+DALERA+ G+W L P  N      
Sbjct  485  LNWVLGGNSSKLEGRLPRCRLSDKANDQLQRWFQDNDALERAIIGDWHLIPCGN-DCIVR  543

Query  543  EPILLRR  563
            E I L R
Sbjct  544  ETICLNR  550



>gb|KHN42080.1| Zeaxanthin epoxidase, chloroplastic [Glycine soja]
Length=654

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 154/187 (82%), Gaps = 1/187 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
             VTLLGDSIHAMQPN+GQGGCMAIED YQLALELD AW+QS++SG+PIDI SSLKS +  
Sbjct  358  HVTLLGDSIHAMQPNMGQGGCMAIEDSYQLALELDNAWQQSIKSGSPIDIDSSLKSTKIL  417

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
              +R    HG+A MAA+MA+TYKAYLGVGLGPL FLT+FRIPHPGRVGGRFFID  MPLM
Sbjct  418  ELMRGLHHHGMATMAAMMASTYKAYLGVGLGPLEFLTKFRIPHPGRVGGRFFIDKMMPLM  477

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+WVLGGN  KLEGRP  CRLSDKANDQL +WF+D+DALERA+NGEW L P  +     +
Sbjct  478  LNWVLGGNSSKLEGRPVCCRLSDKANDQLHRWFEDNDALERAINGEWILLPCGDEAG-PT  536

Query  543  EPILLRR  563
            +PI L +
Sbjct  537  KPICLTQ  543



>gb|AES94698.2| zeaxanthin epoxidase [Medicago truncatula]
Length=507

 Score =   254 bits (648),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIEDGYQLA ELD AW+QS +SG+ IDI SSLKSYE+E
Sbjct  362  RVTLLGDSVHAMQPNMGQGGCMAIEDGYQLAFELDNAWQQSAKSGSTIDIASSLKSYERE  421

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV  +HG+ARMAALMA+TYKAYLGVGLGP  FLT+FRIPHPGRVGGRFFI  +MPLM
Sbjct  422  RRLRVTFVHGMARMAALMASTYKAYLGVGLGPFEFLTKFRIPHPGRVGGRFFIQKSMPLM  481

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKA  437
            L+WVLGGN  KLEGRP  CRLSDK 
Sbjct  482  LNWVLGGNSSKLEGRPLCCRLSDKV  506



>ref|XP_002972237.1| zeaxanthin epoxidase [Selaginella moellendorffii]
 gb|EFJ26323.1| zeaxanthin epoxidase [Selaginella moellendorffii]
Length=679

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 141/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGD+ HAMQPN+GQGGCMAIEDGYQLALE+ KA+++S      +D +  L+SYE +
Sbjct  373  RVTLLGDAAHAMQPNMGQGGCMAIEDGYQLALEIIKAFKESANENKFVDFSRVLQSYESQ  432

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRVG IHG+ARMAA+MA TYK YLGVGLGPLSF+ + RIPHPGRV GRFF+++AMP+M
Sbjct  433  RRLRVGAIHGMARMAAVMATTYKPYLGVGLGPLSFIKKLRIPHPGRVFGRFFVNIAMPMM  492

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSP  515
            LSWVLGGN   LEGR   CRL+DKA+D+L +W  +DDALERA + EW+L P
Sbjct  493  LSWVLGGNSAALEGRTPSCRLTDKASDKLPEWLRNDDALERATSAEWYLVP  543



>ref|XP_002984150.1| hypothetical protein SELMODRAFT_234460 [Selaginella moellendorffii]
 gb|EFJ14660.1| hypothetical protein SELMODRAFT_234460 [Selaginella moellendorffii]
Length=679

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 141/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGD+ HAMQPN+GQGGCMAIEDGYQLALE+ KA+++S      +D +  L+SYE +
Sbjct  373  RVTLLGDAAHAMQPNMGQGGCMAIEDGYQLALEIIKAFKESANENKFVDFSRVLQSYESQ  432

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRVG IHG+ARMAA+MA TYK YLGVGLGPLSF+ + RIPHPGRV GRFF+++AMP+M
Sbjct  433  RRLRVGAIHGMARMAAVMATTYKPYLGVGLGPLSFIKKLRIPHPGRVFGRFFVNIAMPVM  492

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSP  515
            LSWVLGGN   LEGR   CRL+DKA+D+L +W  +DDALERA + EW+L P
Sbjct  493  LSWVLGGNSAALEGRTPSCRLTDKASDKLPEWLRNDDALERATSAEWYLVP  543



>gb|EAY94319.1| hypothetical protein OsI_16086 [Oryza sativa Indica Group]
Length=644

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 147/187 (79%), Gaps = 11/187 (6%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+K+W++S +SG P+DI SSL+ YEKE
Sbjct  357  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKSWQESAKSGTPMDIVSSLRRYEKE  416

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R LRV +IHGLA          +++L + +    FLT+ RIPHPGRVGGRFFI   MPLM
Sbjct  417  RILRVSVIHGLAEWQ-------QSWLPL-IDHTWFLTKLRIPHPGRVGGRFFIKYGMPLM  468

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVLGGN  KLEGRP  CRLSDKANDQLR+WF+DDDALE+AM GEW+L P    +S  S
Sbjct  469  LSWVLGGNSTKLEGRPLSCRLSDKANDQLRRWFEDDDALEQAMGGEWYLLP---TSSGDS  525

Query  543  EPILLRR  563
            +PI L R
Sbjct  526  QPIRLIR  532



>ref|XP_008358098.1| PREDICTED: LOW QUALITY PROTEIN: zeaxanthin epoxidase, chloroplastic-like 
[Malus domestica]
Length=584

 Score =   247 bits (630),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 134/168 (80%), Gaps = 11/168 (7%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
             VTLLGD +HAMQPN+GQGGCMAIEDGYQLA+EL+KAW++S ESG P+ I SSL+SYE  
Sbjct  417  HVTLLGDYVHAMQPNMGQGGCMAIEDGYQLAMELNKAWQKSSESGTPLYINSSLRSYENS  476

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRL V IIHG+ARMA           GVGLGPL FLT+F IPHPGRVGGR FID A+PLM
Sbjct  477  RRLSVAIIHGMARMA-----------GVGLGPLLFLTKFLIPHPGRVGGRVFIDKAIPLM  525

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWF  506
            LSWV GGN  KLEGR   CRL DKA+DQL+ WF+DDDALE A++GEWF
Sbjct  526  LSWVSGGNSSKLEGRSHSCRLLDKASDQLQTWFEDDDALEHAVDGEWF  573



>gb|EYU39329.1| hypothetical protein MIMGU_mgv1a005544mg [Erythranthe guttata]
Length=473

 Score =   244 bits (622),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 134/163 (82%), Gaps = 0/163 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDG+QLA ELDKAW+QS ES + +DI SSLK YE  
Sbjct  305  RVTLLGDSVHAMQPNLGQGGCMAIEDGHQLAEELDKAWKQSFESQSAVDIVSSLKRYEDA  364

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R++RV IIHG ARMAA MA+TYK YLGVGLGPLSF+T++RIPHPGR+ G   +++AMP M
Sbjct  365  RKVRVAIIHGSARMAAYMASTYKGYLGVGLGPLSFITKYRIPHPGRIAGGIMLEIAMPSM  424

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAM  491
            LSWVLGGN  KLEGR   CR+SDKA+DQL     DD AL RA+
Sbjct  425  LSWVLGGNRSKLEGRAPHCRISDKASDQLLTCIRDDYALGRAV  467



>ref|XP_010028251.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X3 
[Eucalyptus grandis]
 ref|XP_010028252.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X3 
[Eucalyptus grandis]
Length=487

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 143/187 (76%), Gaps = 6/187 (3%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQP +GQGGCMAIED YQL+LEL+KAW+ +  SG PID+ ++LKSYEK 
Sbjct  195  RVTLLGDSIHAMQPTMGQGGCMAIEDSYQLSLELEKAWKNNTLSGTPIDVVNALKSYEKA  254

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R LRV  IHG+AR A LMA+ Y+ Y GVGLGPL      +IPH G V GRFFI +AMPL+
Sbjct  255  RWLRVAAIHGMARTATLMASLYRGYSGVGLGPL----LLQIPHAGTV-GRFFIAIAMPLI  309

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+ VL GN  KLEGR   CRLSDKANDQLR+WF+DDDALERAMNGEW L P    TS   
Sbjct  310  LNCVLVGNSLKLEGRTLCCRLSDKANDQLRRWFEDDDALERAMNGEWLLLPSGKETS-PQ  368

Query  543  EPILLRR  563
            +PI L R
Sbjct  369  QPICLGR  375



>ref|XP_004975774.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Setaria 
italica]
Length=635

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 141/187 (75%), Gaps = 9/187 (5%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQ GCMAIEDGYQLA+EL+ AW++SV SG  +DI S+LK YEKE
Sbjct  341  RVTLLGDSVHAMQPNLGQAGCMAIEDGYQLAVELENAWQESVNSGTRVDIVSALKRYEKE  400

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG ARMAA+MA  Y  YLGVG+GPLSFLT++          +F I   + +M
Sbjct  401  RRLRVAIIHGFARMAAIMATIYTPYLGVGMGPLSFLTKWI---------KFSIKYGVDMM  451

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            LSWVL GN  KLEG+P  CRLSDKANDQL +W +DDDALE AM GEW+L P     +T+ 
Sbjct  452  LSWVLSGNSSKLEGKPLSCRLSDKANDQLYRWLEDDDALEEAMCGEWYLFPASGGNNTSL  511

Query  543  EPILLRR  563
            +P+ L R
Sbjct  512  QPVRLFR  518



>ref|XP_010028249.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Eucalyptus grandis]
Length=674

 Score =   244 bits (624),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 143/187 (76%), Gaps = 6/187 (3%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQP +GQGGCMAIED YQL+LEL+KAW+ +  SG PID+ ++LKSYEK 
Sbjct  382  RVTLLGDSIHAMQPTMGQGGCMAIEDSYQLSLELEKAWKNNTLSGTPIDVVNALKSYEKA  441

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R LRV  IHG+AR A LMA+ Y+ Y GVGLGPL      +IPH G V GRFFI +AMPL+
Sbjct  442  RWLRVAAIHGMARTATLMASLYRGYSGVGLGPL----LLQIPHAGTV-GRFFIAIAMPLI  496

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+ VL GN  KLEGR   CRLSDKANDQLR+WF+DDDALERAMNGEW L P    TS   
Sbjct  497  LNCVLVGNSLKLEGRTLCCRLSDKANDQLRRWFEDDDALERAMNGEWLLLPSGKETS-PQ  555

Query  543  EPILLRR  563
            +PI L R
Sbjct  556  QPICLGR  562



>ref|XP_001767201.1| predicted protein [Physcomitrella patens]
 gb|EDQ67882.1| predicted protein [Physcomitrella patens]
Length=668

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 134/171 (78%), Gaps = 5/171 (3%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS HAMQPNLGQGGCMAIEDG+QLAL+L KA +Q        D+   LK+YE +
Sbjct  366  RVTLLGDSAHAMQPNLGQGGCMAIEDGFQLALDLSKAAKQP-----SADLQGVLKTYEGK  420

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RR+RVG+IHGLARMAA+MA TYK YLG GLGPLSF+ Q +IPHPGRVGGRFFI + MP M
Sbjct  421  RRIRVGVIHGLARMAAIMATTYKPYLGEGLGPLSFIKQLKIPHPGRVGGRFFITIGMPTM  480

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSP  515
            LSW+LGGN   LEGR   C L DKA+  L+KWF +DDALERA N +W+L P
Sbjct  481  LSWILGGNSFALEGRAPYCSLEDKADSNLKKWFWNDDALERATNADWYLVP  531



>ref|XP_010028250.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X2 
[Eucalyptus grandis]
 gb|KCW54950.1| hypothetical protein EUGRSUZ_I00923 [Eucalyptus grandis]
Length=672

 Score =   243 bits (620),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 142/187 (76%), Gaps = 8/187 (4%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQP +GQGGCMAIED YQL+LEL+KAW+ +  SG PID+ ++LKSYEK 
Sbjct  382  RVTLLGDSIHAMQPTMGQGGCMAIEDSYQLSLELEKAWKNNTLSGTPIDVVNALKSYEKA  441

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R LRV  IHG+AR A LMA+ Y+ Y GVGLGPL       IPH G V GRFFI +AMPL+
Sbjct  442  RWLRVAAIHGMARTATLMASLYRGYSGVGLGPL------LIPHAGTV-GRFFIAIAMPLI  494

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTAS  542
            L+ VL GN  KLEGR   CRLSDKANDQLR+WF+DDDALERAMNGEW L P    TS   
Sbjct  495  LNCVLVGNSLKLEGRTLCCRLSDKANDQLRRWFEDDDALERAMNGEWLLLPSGKETS-PQ  553

Query  543  EPILLRR  563
            +PI L R
Sbjct  554  QPICLGR  560



>gb|AGK25933.1| zeaxanthin epoxidase, partial [Eriobotrya japonica]
Length=351

 Score =   233 bits (593),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
             VTLLGDS+HAMQPN+GQGGCMAIEDGYQLA+ELDKAW++S +SG PIDI SSL+SYE  
Sbjct  224  HVTLLGDSVHAMQPNMGQGGCMAIEDGYQLAMELDKAWQKSSKSGTPIDINSSLRSYENS  283

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIHG+ARMAALMA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGR FID AMPLM
Sbjct  284  RRLRVAIIHGMARMAALMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRVFIDKAMPLM  343

Query  363  LSWVLGGN  386
            LSWVLGGN
Sbjct  344  LSWVLGGN  351



>gb|AHE41420.1| zeaxanthin epoxidase, partial [Lycium chinense]
Length=178

 Score =   219 bits (558),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 119/136 (88%), Gaps = 1/136 (1%)
 Frame = +3

Query  156  SSLKSYEKERRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRF  335
            SSL+SYE  R+LRVG+IHGLARMAA+MA+TYKAYLGVGLGPLSFLT++RIPHPGRVGGR 
Sbjct  1    SSLRSYESARKLRVGVIHGLARMAAIMASTYKAYLGVGLGPLSFLTKYRIPHPGRVGGRV  60

Query  336  FIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSP  515
            FIDL MPLMLSWVLGGNG+KLEGR + CRLS+KANDQLRKWF+DDDALERA + EW L P
Sbjct  61   FIDLGMPLMLSWVLGGNGDKLEGRIQHCRLSEKANDQLRKWFEDDDALERATDAEWLLLP  120

Query  516  LKNATSTASEPILLRR  563
              N  + A +PI+L R
Sbjct  121  AGNGNA-ALQPIVLSR  135



>gb|EYU39330.1| hypothetical protein MIMGU_mgv1a005544mg [Erythranthe guttata]
Length=479

 Score =   228 bits (582),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDG+QLA ELDKAW+QS ES + +DI SSLK YE  
Sbjct  329  RVTLLGDSVHAMQPNLGQGGCMAIEDGHQLAEELDKAWKQSFESQSAVDIVSSLKRYEDA  388

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R++RV IIHG ARMAA MA+TYK YLGVGLGPLSF+T++RIPHPGR+ G   +++AMP M
Sbjct  389  RKVRVAIIHGSARMAAYMASTYKGYLGVGLGPLSFITKYRIPHPGRIAGGIMLEIAMPSM  448

Query  363  LSWVLGGNGEKLEGRPKQCRLSDK  434
            LSWVLGGN  KLEGR   CR+SDK
Sbjct  449  LSWVLGGNRSKLEGRAPHCRISDK  472



>gb|AGS79171.1| zeaxanthin epoxidase, partial [Fagopyrum tataricum]
Length=149

 Score =   216 bits (551),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 120/149 (81%), Gaps = 0/149 (0%)
 Frame = +3

Query  21   DSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKERRLRVG  200
            DS+HAMQPN+GQGGCMAIED YQLALELDKAW +S  +  PID+ SSLK YE  RRLRV 
Sbjct  1    DSVHAMQPNMGQGGCMAIEDSYQLALELDKAWEESSSNVKPIDVVSSLKRYESARRLRVA  60

Query  201  IIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLMLSWVLG  380
             IHG+ARMAA MA+TYK Y+G GLGPLSFL + RIPHPG VG RF ID  MPLMLSWVLG
Sbjct  61   AIHGMARMAAAMASTYKPYIGEGLGPLSFLMKLRIPHPGIVGARFVIDRVMPLMLSWVLG  120

Query  381  GNGEKLEGRPKQCRLSDKANDQLRKWFDD  467
            GN   LEGR   CRLSDKANDQL +WF+D
Sbjct  121  GNSSNLEGRSLCCRLSDKANDQLGRWFED  149



>ref|XP_006425928.1| hypothetical protein CICLE_v10027323mg [Citrus clementina]
 gb|ESR39168.1| hypothetical protein CICLE_v10027323mg [Citrus clementina]
Length=682

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 138/212 (65%), Gaps = 32/212 (15%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWR---QSVESGAPIDITSSLKSY  173
            RVTLLGDS+HAMQPN+GQGGCMAIE      + L  +W     S++    I   S L SY
Sbjct  361  RVTLLGDSVHAMQPNMGQGGCMAIE------MNLLMSWLLCLSSLKLTTRIVHASKLCSY  414

Query  174  EKERRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAM  353
            E  RRLRV IIH LAR AA+MA+TY  YL VGLGPLSFLT+F IPHPGRV  RFFIDLAM
Sbjct  415  ESARRLRVAIIHRLARSAAMMASTYNGYLSVGLGPLSFLTKFWIPHPGRVVRRFFIDLAM  474

Query  354  PLMLSWVLGGNGEKLEGRPKQCRLSDK----------------------ANDQLRKWFDD  467
            PLML+WVLGGN  KLEGR   CRLSDK                      A+DQLR W  D
Sbjct  475  PLMLNWVLGGNSSKLEGRSPCCRLSDKVHCFVTIIFAFITLRNSEFAVEASDQLRTWLRD  534

Query  468  DDALERAMNGEWFLSPLKNATSTASEPILLRR  563
            +DALERAMNGEW L P   + +  S+PI L R
Sbjct  535  NDALERAMNGEWLLVP-SGSETVVSQPIYLSR  565



>gb|AFW58424.1| hypothetical protein ZEAMMB73_168386 [Zea mays]
 gb|AIB05371.1| FHA transcription factor, partial [Zea mays]
Length=260

 Score =   210 bits (534),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 114/141 (81%), Gaps = 1/141 (1%)
 Frame = +3

Query  144  IDITSSLKSYEKERRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRV  323
            +DI SSL+ YEKERR+RV +IHGLARMAA+MA TY+ YLGVGLGPLSFLT+ RIPHPGRV
Sbjct  1    MDIVSSLRRYEKERRVRVAVIHGLARMAAIMATTYRPYLGVGLGPLSFLTKLRIPHPGRV  60

Query  324  GGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEW  503
            GGRFFI   MP MLSWVLGGN  KLEGRP  CRLSDKA+D+L +WFDDDDALE+AM GEW
Sbjct  61   GGRFFIKYGMPAMLSWVLGGNSSKLEGRPLSCRLSDKAHDELYRWFDDDDALEQAMGGEW  120

Query  504  FLSPLKNATSTA-SEPILLRR  563
            +L     A + +  +PI L R
Sbjct  121  YLFATSEANNNSLQQPIRLIR  141



>ref|XP_011457329.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=283

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +3

Query  168  SYEKERRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDL  347
            SYE  R+LRV IIHG+ARMAA+MA+TYKAYLGVGLGPLSFLT+FRIPHPGRVGGR FID 
Sbjct  45   SYETSRKLRVAIIHGMARMAAIMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRIFIDK  104

Query  348  AMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNA  527
            AMPLMLSWVLGGN  KLEGRP  CRLSDKA+DQLR WF+DDDALERA++GEW+L P    
Sbjct  105  AMPLMLSWVLGGNSSKLEGRPPSCRLSDKADDQLRSWFEDDDALERAIDGEWYLIPCGQE  164

Query  528  TSTASEPILLRR  563
               AS+ I L R
Sbjct  165  NG-ASQLIRLNR  175



>gb|AAL91193.1| zeaxanthin epoxidase precursor [Arabidopsis thaliana]
 gb|AAO00920.1| zeaxanthin epoxidase precursor [Arabidopsis thaliana]
Length=503

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED +QLALELD+AW+QSVE+  P+D+ SSLK YE+ 
Sbjct  367  RVTLLGDSIHAMQPNMGQGGCMAIEDSFQLALELDEAWKQSVETTTPVDVVSSLKRYEES  426

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            RRLRV IIH +ARMAA+MA+TYKAYLGVGLGPLSFLT+FR+PHPGRVGGRFF+D+AMP M
Sbjct  427  RRLRVAIIHAMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRFFVDIAMPSM  486

Query  363  LSWVLGGN  386
            L WVLGGN
Sbjct  487  LDWVLGGN  494



>gb|ABK55738.1| zeaxanthin epoxidase [Cucumis sativus]
Length=189

 Score =   201 bits (512),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPN+GQGGCMAIEDGYQLALELDKAW +SV SG+PIDI SSLKSYE  
Sbjct  82   RVTLLGDSVHAMQPNMGQGGCMAIEDGYQLALELDKAWSESVASGSPIDIVSSLKSYESS  141

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVG  326
            RR+RV +IHG+ARMAALMA+TYKAYLGVGLGPLSFLTQFRIPHPGRVG
Sbjct  142  RRIRVAVIHGMARMAALMASTYKAYLGVGLGPLSFLTQFRIPHPGRVG  189



>gb|KDO79163.1| hypothetical protein CISIN_1g0151672mg, partial [Citrus sinensis]
Length=276

 Score =   195 bits (495),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 105/136 (77%), Gaps = 1/136 (1%)
 Frame = +3

Query  156  SSLKSYEKERRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRF  335
            S L SYE  RRLRV IIH LAR AA+MA+TY  YL VGLGPLSFLT+F IPHPGRV  RF
Sbjct  24   SKLCSYESARRLRVAIIHRLARSAAMMASTYNGYLSVGLGPLSFLTKFWIPHPGRVVRRF  83

Query  336  FIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSP  515
            FIDLAMPLML+WVLGGN  KLEGR   CRLSDKA+DQLR W  D+DALERAMNGEW L P
Sbjct  84   FIDLAMPLMLNWVLGGNSSKLEGRSPCCRLSDKASDQLRTWLRDNDALERAMNGEWLLVP  143

Query  516  LKNATSTASEPILLRR  563
               + +  S+PI L R
Sbjct  144  -SGSETVVSQPIYLSR  158



>ref|XP_005646300.1| FAD/NAD(P)-binding domain-containing protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21756.1| FAD/NAD(P)-binding domain-containing protein [Coccomyxa subellipsoidea 
C-169]
Length=626

 Score =   197 bits (500),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 120/177 (68%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RV LLGDS HAMQPNLGQGGCMAIEDGYQLA++L +A  ++  SG P+D+   LK Y  +
Sbjct  294  RVALLGDSAHAMQPNLGQGGCMAIEDGYQLAVDLSEACEKAENSGRPLDVEGVLKGYFNK  353

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R  R   IHGLA MAA+MA+TYKAYLG GLGPL F+ Q +IPHPGRVGG F +++ MP M
Sbjct  354  RLGRASTIHGLAGMAAIMASTYKAYLGEGLGPLEFIKQLKIPHPGRVGGYFAMNMMMPSM  413

Query  363  LSWVLGGNGEKLEG--RPKQCRLSDKAN----DQLRKWFDDDDALERAMNGEWFLSP  515
            L WVLGGN   L G  R   CR++DK          K+  DD AL RA   +W L P
Sbjct  414  LGWVLGGNTSALRGADRAPHCRVNDKPKAFHEQDFWKFLSDDMALLRAARAKWTLVP  470



>gb|ABK54291.1| zeaxanthin epoxidase [Solanum tuberosum]
Length=334

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
             VTLLGDS+HAMQPNLGQGGCMAIED YQLALELDKA  +S ESG+P+DI SSL+SYE  
Sbjct  228  HVTLLGDSVHAMQPNLGQGGCMAIEDSYQLALELDKACSRSAESGSPVDIISSLRSYESA  287

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRV  323
            R+LRVG+IHGLARMAA+MA+TYKAYLGVGLGPLSFLTQ+RIPHPGRV
Sbjct  288  RKLRVGVIHGLARMAAIMASTYKAYLGVGLGPLSFLTQYRIPHPGRV  334



>gb|AFK33361.1| unknown [Lotus japonicus]
Length=223

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = +3

Query  213  LARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGE  392
            +ARMAALMA+TYKAYLGVGLGPL FLT+FRIPHPGRVGGRFF+D+ MP ML W+LGGN  
Sbjct  1    MARMAALMASTYKAYLGVGLGPLEFLTKFRIPHPGRVGGRFFVDIFMPYMLDWILGGNSS  60

Query  393  KLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTASEPI  551
            KLEGRP  CRLSDKANDQLR+WF+DDDALE A+NGEW L P  + T   SEPI
Sbjct  61   KLEGRPLSCRLSDKANDQLRRWFEDDDALESAINGEWTLLPCGDETG-HSEPI  112



>emb|CCI79384.1| zeaxanthin epoxidase [Chromochloris zofingiensis]
 emb|CCI79385.1| zeaxanthin epoxidase [Chromochloris zofingiensis]
Length=596

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 105/146 (72%), Gaps = 2/146 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGA-PIDITSSLKSYEK  179
             V LLGDS HAMQPNLGQGGCMAIED YQLA +L  A  Q     A  +D+ + LK+Y+ 
Sbjct  440  HVALLGDSAHAMQPNLGQGGCMAIEDAYQLAADLADAMEQQAAGNADQLDVNAVLKAYQN  499

Query  180  ERRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPL  359
            ER +R   IHG+A MAA+MA+TYKAY G GLGPLS++ +++IPHPGRV GR  + L MP 
Sbjct  500  ERMMRASTIHGMAGMAAIMASTYKAYFGEGLGPLSWIQKYQIPHPGRVAGRIAMTLTMPA  559

Query  360  MLSWVLGGNGEKLE-GRPKQCRLSDK  434
            +L WVLGGN +K+E  R   CR+ DK
Sbjct  560  VLQWVLGGNTDKIEKARVGSCRIEDK  585



>gb|AAO48941.1| zeaxanthin epoxidase precursor [Chlamydomonas sp. W80]
Length=727

 Score =   170 bits (431),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 119/187 (64%), Gaps = 6/187 (3%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            R  LLGDS+HAMQPNLGQGGCMAIED Y+LA  L      + +  A +D+  +  +Y+  
Sbjct  390  RTVLLGDSVHAMQPNLGQGGCMAIEDAYELANNLSDGMDAAGQQPAHLDVKKAFSTYQSH  449

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGL-GPLSFLTQFRIPHPGRVGGRFFIDLAMPL  359
            R +R   IHG+A MAA MA+TYKAYLG GL GPL  LT+ +I HPGRV GR  ++L MP 
Sbjct  450  RMIRASAIHGMAGMAAFMASTYKAYLGEGLPGPLQQLTKLKIHHPGRVVGRLVMNLTMPQ  509

Query  360  MLSWVLGGNGEKLE-GRPKQCRLSDKAN----DQLRKWFDDDDALERAMNGEWFLSPLKN  524
            +L WVLGGN E L+  R   CR++D+       Q     ++D+A+ ++ + +W L   + 
Sbjct  510  VLGWVLGGNTENLDKSRVGHCRIADQPKAFHESQFSYLMENDEAIIQSSHADWMLMTSRE  569

Query  525  ATSTASE  545
            A S +S+
Sbjct  570  AGSGSSD  576



>gb|AAS48098.1| zexanthin epoxidase [Citrus sinensis]
Length=91

 Score =   155 bits (393),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +3

Query  54   QGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKERRLRVGIIHGLARMAAL  233
            QGGCMAIEDGYQLA+EL+KA ++S ES  PIDI S+LKSYE+ RRLRV +IHGLAR AA+
Sbjct  1    QGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVAVIHGLARSAAV  60

Query  234  MAATYKAYLGVGLGPLSFLTQFRIPHPGRVG  326
            +A+TYKAYLGVGLGPLSFLT+FRIPHPGRVG
Sbjct  61   VASTYKAYLGVGLGPLSFLTKFRIPHPGRVG  91



>ref|XP_005844735.1| hypothetical protein CHLNCDRAFT_138731 [Chlorella variabilis]
 gb|EFN52633.1| hypothetical protein CHLNCDRAFT_138731 [Chlorella variabilis]
Length=705

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 120/196 (61%), Gaps = 11/196 (6%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAP-----IDITSSLK  167
            RV LLGDS HAMQPNLGQGGCMAIED YQL L+L +   +  +  A      ID+   L 
Sbjct  383  RVALLGDSAHAMQPNLGQGGCMAIEDAYQLVLDLCREADEVDKEAAAGPRRDIDVEGVLN  442

Query  168  SYEKERRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDL  347
             Y  +R +R   IHG+A MAA MA+TYKAYLG GLGPL ++T+F+IPHPGRV G+  +  
Sbjct  443  GYMMKRVVRAASIHGMAGMAAYMASTYKAYLGEGLGPLEWITKFKIPHPGRVVGQVIMKA  502

Query  348  AMPLMLSWVLGGNGEKL--EGRPKQCRLSDKANDQLRKWF----DDDDALERAMNGEWFL  509
             MP  +S VLGG  + L    R   C L+D+        F    +DDDAL RA +  W L
Sbjct  503  TMPGTMSRVLGGYRKSLAQSDRVPVCHLADQPRGFPESLFPLYMEDDDALLRASHAYWVL  562

Query  510  SPLKNATSTASEPILL  557
            +P+ + +S + E + L
Sbjct  563  TPVTDGSSASPEALHL  578



>ref|XP_011399382.1| Zeaxanthin epoxidase, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM26450.1| Zeaxanthin epoxidase, chloroplastic [Auxenochlorella protothecoides]
Length=617

 Score =   161 bits (407),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 111/178 (62%), Gaps = 14/178 (8%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RV LLGDS HAMQPNLGQGG MAIED +Q+  EL  +  +SV           L+ Y+  
Sbjct  308  RVVLLGDSAHAMQPNLGQGGGMAIEDSFQMVQELRSSGSRSV--------AHILRQYQLR  359

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R LR  ++HG+A MAA MA+TYKAYLG GLGPLS +T +RIPHPGRV G+  +  +MP +
Sbjct  360  RMLRSSVVHGMAGMAAFMASTYKAYLGEGLGPLSRMTAWRIPHPGRVMGQVVMKASMPAV  419

Query  363  LSWVLGGNGEKLEG--RPKQCRLSDKANDQLRKWFD----DDDALERAMNGEWFLSPL  518
            L WVLGGNG  L    R  +C L D+ +      FD    DD AL RA    W L+P+
Sbjct  420  LGWVLGGNGSSLASAERVPRCMLRDRPSGFEPGQFDTLLRDDAALLRAAKAHWVLAPM  477



>gb|ADJ55718.1| zeaxanthin epoxidase, partial [Musa beccarii]
 gb|ADJ55719.1| zeaxanthin epoxidase, partial [Musa coccinea]
Length=88

 Score =   149 bits (376),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +3

Query  171  YEKERRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLA  350
            YEKERRLRV +I+G+ARMAA+MA+TY+ YLGVGLGPLSFLT+FRIPHPGRVGGRF I  A
Sbjct  1    YEKERRLRVALIYGMARMAAIMASTYRPYLGVGLGPLSFLTKFRIPHPGRVGGRFVIQFA  60

Query  351  MPLMLSWVLGGNGEKLEGRPKQCRLSDK  434
            MPLML+WVLGGN   L GRP  CRL+DK
Sbjct  61   MPLMLNWVLGGNSSNLSGRPLSCRLTDK  88



>gb|AEK69513.1| zeaxanthin epoxidase 3 [Glycine max]
Length=564

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +3

Query  69   AIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKERRLRVGIIHGLARMAALMAATY  248
             ++D YQLALELD AW++S++SG+PIDI SSLKSYE+ERRLRV I+HG+ARMAA+MA+TY
Sbjct  379  VVQDSYQLALELDNAWQRSIKSGSPIDIDSSLKSYERERRLRVAIVHGMARMAAMMASTY  438

Query  249  KAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLMLSWVLGG  383
            KAYLGVGLGPL FLT+F IPHPGRVGGRFF D  +PLML+W+LGG
Sbjct  439  KAYLGVGLGPLEFLTKFWIPHPGRVGGRFFTDKMIPLMLNWILGG  483



>gb|ADJ55711.1| zeaxanthin epoxidase, partial [Musa balbisiana]
 gb|ADJ55712.1| zeaxanthin epoxidase, partial [Musa balbisiana]
 gb|ADJ55714.1| zeaxanthin epoxidase, partial [Musa mannii]
Length=88

 Score =   147 bits (372),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +3

Query  171  YEKERRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLA  350
            YEKERRLRV +I+G+ARMAA+MA+TY+ YLGVGLGPLSFLT+F+IPHPGRVGGRF I  A
Sbjct  1    YEKERRLRVALIYGMARMAAIMASTYRPYLGVGLGPLSFLTKFQIPHPGRVGGRFIIQFA  60

Query  351  MPLMLSWVLGGNGEKLEGRPKQCRLSDK  434
            MPLML+WVLGGN   L GRP  CRL+DK
Sbjct  61   MPLMLNWVLGGNSSNLSGRPLSCRLTDK  88



>gb|ADJ55721.1| zeaxanthin epoxidase, partial [Ensete ventricosum]
Length=88

 Score =   147 bits (371),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +3

Query  171  YEKERRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLA  350
            YE+ERRLRV +I+G+ARMAA+MA+TY+ YLGVGLGP SFLT+FRIPHPGRVGGRF I   
Sbjct  1    YERERRLRVALIYGMARMAAIMASTYRPYLGVGLGPFSFLTKFRIPHPGRVGGRFLIQFT  60

Query  351  MPLMLSWVLGGNGEKLEGRPKQCRLSDK  434
            MPLML+WVLGGN  KL GRP  CRL+DK
Sbjct  61   MPLMLNWVLGGNSSKLSGRPLSCRLTDK  88



>ref|XP_001701701.1| zeaxanthin epoxidase [Chlamydomonas reinhardtii]
 gb|AAO34404.1| zeaxanthin epoxidase precursor [Chlamydomonas reinhardtii]
 gb|AAO48940.1| zeaxanthin epoxidase precursor [Chlamydomonas reinhardtii]
 gb|EDP06676.1| zeaxanthin epoxidase [Chlamydomonas reinhardtii]
Length=763

 Score =   159 bits (403),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 110/174 (63%), Gaps = 7/174 (4%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RV LLGDS HAMQPNLGQGGCMAIED Y+LA++L +A      + A +D+   L+SY+  
Sbjct  383  RVALLGDSAHAMQPNLGQGGCMAIEDAYELAIDLSRAVSDKAGNAAAVDVEGVLRSYQDS  442

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R LRV  IHG+A MAA MA+TYK YLG G     ++   RIPHPGRV GR  + L MP +
Sbjct  443  RILRVSAIHGMAGMAAFMASTYKCYLGEGWS--KWVEGLRIPHPGRVVGRLVMLLTMPSV  500

Query  363  LSWVLGGNGEKLE-GRPKQCRLSDKAN----DQLRKWFDDDDALERAMNGEWFL  509
            L WVLGGN + +   R   C L DK       +  ++ ++D ++ R+ + +W L
Sbjct  501  LEWVLGGNTDHVAPHRTSYCSLGDKPKAFPESRFPEFMNNDASIIRSSHADWLL  554



>gb|ADJ55713.1| zeaxanthin epoxidase, partial [Musa ornata]
Length=88

 Score =   146 bits (368),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +3

Query  171  YEKERRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLA  350
            YE+ERRLRV +I+G+ARMAA+MA+TY+ YLGVGLGPLSFLT+F+IPHPGRVGGRF I  A
Sbjct  1    YEEERRLRVALIYGMARMAAIMASTYRPYLGVGLGPLSFLTKFQIPHPGRVGGRFIIQFA  60

Query  351  MPLMLSWVLGGNGEKLEGRPKQCRLSDK  434
            MPLML+WVLGGN   L GRP  CRL+DK
Sbjct  61   MPLMLNWVLGGNSSNLSGRPLSCRLTDK  88



>gb|ADJ55720.1| zeaxanthin epoxidase, partial [Musella lasiocarpa]
Length=88

 Score =   145 bits (367),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +3

Query  171  YEKERRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLA  350
            YE+ERRLRV +I+G+ARMAA+MA+TY+ YLGVGLGP SFLT+FRIPHPGRVGGRF I   
Sbjct  1    YERERRLRVALIYGMARMAAIMASTYRPYLGVGLGPFSFLTKFRIPHPGRVGGRFLIQFT  60

Query  351  MPLMLSWVLGGNGEKLEGRPKQCRLSDK  434
            MPLML+WVLGGN   L GRP  CRL+DK
Sbjct  61   MPLMLNWVLGGNSSNLSGRPLSCRLTDK  88



>gb|ADJ55709.1| zeaxanthin epoxidase, partial [Musa acuminata]
 gb|ADJ55710.1| zeaxanthin epoxidase, partial [Musa acuminata var. zebrina]
Length=88

 Score =   145 bits (366),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +3

Query  171  YEKERRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLA  350
            YE+ERR+RV +I+G+ARMAA+MA+TY+ YLGVGLGPLSFLT+F+IPHPGRVGGRF I  A
Sbjct  1    YEEERRIRVALIYGMARMAAIMASTYRPYLGVGLGPLSFLTKFQIPHPGRVGGRFIIQFA  60

Query  351  MPLMLSWVLGGNGEKLEGRPKQCRLSDK  434
            MPLML+WVLGGN   L GRP  CRL+DK
Sbjct  61   MPLMLNWVLGGNSSNLSGRPLSCRLTDK  88



>gb|ADJ55715.1| zeaxanthin epoxidase, partial [Musa troglodytarum]
 gb|ADJ55716.1| zeaxanthin epoxidase, partial [Musa textilis]
 gb|ADJ55717.1| zeaxanthin epoxidase, partial [Musa maclayi]
Length=88

 Score =   145 bits (366),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +3

Query  171  YEKERRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLA  350
            YEKERRLRV +I+G+ARMAA+MA+TY+ YLGVGLGPLSFLT+FRIPHPGRVGGRF I  A
Sbjct  1    YEKERRLRVALIYGMARMAAIMASTYRPYLGVGLGPLSFLTKFRIPHPGRVGGRFVIQFA  60

Query  351  MPLMLSWVLGGNGEKLEGRPKQCRLSDK  434
            MPLML+WVLGGN   L GR   CRL+DK
Sbjct  61   MPLMLNWVLGGNSSNLSGRLLSCRLTDK  88



>ref|XP_010257461.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X4 
[Nelumbo nucifera]
Length=413

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 88/129 (68%), Gaps = 0/129 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGD+ H MQPNLGQGGCMAIED YQL LEL+K +    ++    +I S+LK YEK+
Sbjct  284  RVTLLGDAAHPMQPNLGQGGCMAIEDCYQLILELEKVFEHINDAQVFEEIASALKRYEKK  343

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R  RV +IH L+RMA+ M   Y+ YL    GPLSFLT  RI HP   G R F  L MP +
Sbjct  344  RMFRVSVIHTLSRMASRMVTKYQPYLNFSPGPLSFLTTLRITHPAFHGVRLFSQLGMPQL  403

Query  363  LSWVLGGNG  389
            ++W+L G+G
Sbjct  404  MTWMLSGHG  412



>ref|XP_010257458.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Nelumbo nucifera]
Length=468

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 88/129 (68%), Gaps = 0/129 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGD+ H MQPNLGQGGCMAIED YQL LEL+K +    ++    +I S+LK YEK+
Sbjct  339  RVTLLGDAAHPMQPNLGQGGCMAIEDCYQLILELEKVFEHINDAQVFEEIASALKRYEKK  398

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R  RV +IH L+RMA+ M   Y+ YL    GPLSFLT  RI HP   G R F  L MP +
Sbjct  399  RMFRVSVIHTLSRMASRMVTKYQPYLNFSPGPLSFLTTLRITHPAFHGVRLFSQLGMPQL  458

Query  363  LSWVLGGNG  389
            ++W+L G+G
Sbjct  459  MTWMLSGHG  467



>ref|XP_010257459.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X2 
[Nelumbo nucifera]
Length=446

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 88/129 (68%), Gaps = 0/129 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGD+ H MQPNLGQGGCMAIED YQL LEL+K +    ++    +I S+LK YEK+
Sbjct  317  RVTLLGDAAHPMQPNLGQGGCMAIEDCYQLILELEKVFEHINDAQVFEEIASALKRYEKK  376

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R  RV +IH L+RMA+ M   Y+ YL    GPLSFLT  RI HP   G R F  L MP +
Sbjct  377  RMFRVSVIHTLSRMASRMVTKYQPYLNFSPGPLSFLTTLRITHPAFHGVRLFSQLGMPQL  436

Query  363  LSWVLGGNG  389
            ++W+L G+G
Sbjct  437  MTWMLSGHG  445



>dbj|BAG68957.1| zeaxanthin epoxidase [Brassica napus]
Length=328

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDSIHAMQPN+GQGGCMAIED +QL LEL++AW+Q VE+  P+D+ SSL+ YE+ 
Sbjct  242  RVTLLGDSIHAMQPNMGQGGCMAIEDSFQLGLELEQAWKQXVETNTPVDVVSSLRRYEES  301

Query  183  RRLRVGIIHGLARMAALMAATYKAYLG  263
            RRLRV IIHG+ARMAA+MA+ YKAYLG
Sbjct  302  RRLRVAIIHGMARMAAIMASXYKAYLG  328



>ref|XP_002953670.1| hypothetical protein VOLCADRAFT_75879 [Volvox carteri f. nagariensis]
 gb|EFJ45294.1| hypothetical protein VOLCADRAFT_75879 [Volvox carteri f. nagariensis]
Length=727

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 111/174 (64%), Gaps = 7/174 (4%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            +V LLGDS HAMQPNLGQGGCMAIED Y+LA++L KA   +  + A +++   L  Y+  
Sbjct  380  KVALLGDSAHAMQPNLGQGGCMAIEDAYELAIDLSKAVAAAGGNAAAVNVDGVLNQYQAN  439

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R +RV  IHG+A MAA MA+TYK YLG G     ++  FRIPHPGRV GR  + L MP +
Sbjct  440  RMMRVSAIHGMAGMAAFMASTYKCYLGEGWS--KWVESFRIPHPGRVIGRLVMLLTMPAV  497

Query  363  LSWVLGGNGEKLE-GRPKQCRLSD--KANDQLR--KWFDDDDALERAMNGEWFL  509
            L WVLGGN + +   R   C L D  KA D+ R  ++  +D ++  + + +W L
Sbjct  498  LDWVLGGNTDHVAPNRVPYCSLGDKPKAFDESRFGEFMSNDASIVYSSHADWIL  551



>gb|KIZ01704.1| zeaxanthin epoxidase [Monoraphidium neglectum]
Length=330

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 108/166 (65%), Gaps = 10/166 (6%)
 Frame = +3

Query  36   MQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAP--IDITSSLKSYEKERRLRVGIIH  209
            MQPNLGQGGCMAIED   LA EL  A  Q+   G P  +D+ + L+ Y+  R +R   IH
Sbjct  1    MQPNLGQGGCMAIEDALTLAEELTLA--QAGAEGRPHKVDMDAVLQKYQDSRMMRAAAIH  58

Query  210  GLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNG  389
            G+A MAA+MA+TYKAYLG GLGPLS++ ++++PHPGRV G+  +   MP +L+WVLGGN 
Sbjct  59   GMAGMAAMMASTYKAYLGEGLGPLSWIQRWKLPHPGRVTGQVALLATMPAVLAWVLGGNI  118

Query  390  EKLEG--RPKQCRLSDK----ANDQLRKWFDDDDALERAMNGEWFL  509
              L G  RP  CR++D     +  +   +  D+DAL RA +  W L
Sbjct  119  GALVGAERPGACRITDGLKFFSEKEFELFMRDNDALLRATHARWML  164



>dbj|BAD07276.1| zeaxanthin epoxidase [Citrus unshiu]
 dbj|BAD07284.1| zeaxanthin epoxidase [Citrus sinensis]
 dbj|BAD07292.1| zeaxanthin epoxidase [Citrus limon]
Length=313

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIEDGYQLA+EL+KA ++S ES  PIDI S+LKSYE+ 
Sbjct  234  RVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERA  293

Query  183  RRLRVGIIHGLARMAALMAA  242
            RRLRV +IHGLAR AA+MA+
Sbjct  294  RRLRVAVIHGLARSAAVMAS  313



>gb|ABW97847.1| ABA2 [Nicotiana tabacum]
Length=436

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGDS+HAMQPNLGQGGCMAIED YQLALELDKA  +S ESG+ +DI SSL+SYE  
Sbjct  359  RVTLLGDSVHAMQPNLGQGGCMAIEDSYQLALELDKALSRSAESGSAVDIISSLRSYESS  418

Query  183  RRLRVGIIHGLARMAALM  236
            R+LRVG+IHGL+RMAA+M
Sbjct  419  RKLRVGVIHGLSRMAAIM  436



>ref|XP_008350906.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Malus domestica]
Length=484

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 91/144 (63%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGD+ H MQPNLGQGGCMAIED YQL  ELD+A +   +     +I  +L+ Y K+
Sbjct  341  RVTLLGDAAHPMQPNLGQGGCMAIEDCYQLIHELDQASKTESDFQMSDEIVLALRRYVKK  400

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R  RVGI+H  +RMA+ M  +Y+ Y+    GP++ L   +I HP     R F+   MP  
Sbjct  401  RMWRVGIVHAASRMASRMLESYQPYIKFRTGPVAHLLTRQITHPAIPLFRAFLQFFMPKF  460

Query  363  LSWVLGGNGEKLEGRPKQCRLSDK  434
            ++W++ G+G  L+G   +C++ DK
Sbjct  461  MAWMIAGDGLFLKGERTECKVQDK  484



>ref|XP_002268367.2| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X2 
[Vitis vinifera]
Length=474

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 86/133 (65%), Gaps = 8/133 (6%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPI----DITSSLKS  170
            RVTL+GD+ H MQPNLGQGGCMAIED YQL LELDK       SG+ I     I S+L+ 
Sbjct  344  RVTLVGDAAHPMQPNLGQGGCMAIEDCYQLILELDKI----ANSGSSILLSDQIVSALRR  399

Query  171  YEKERRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLA  350
            YEK+R  RVG +H  +RMA+ + A Y+ Y+  G GPL  L+  RI HPG    R F+ + 
Sbjct  400  YEKKRMFRVGTVHTASRMASEVLAAYQPYMEFGFGPLPGLSTLRITHPGIQVARMFLQVF  459

Query  351  MPLMLSWVLGGNG  389
            +   ++W++ G+G
Sbjct  460  LQQFMTWMISGHG  472



>ref|XP_010659557.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Vitis vinifera]
 emb|CBI32174.3| unnamed protein product [Vitis vinifera]
Length=475

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 86/133 (65%), Gaps = 8/133 (6%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPI----DITSSLKS  170
            RVTL+GD+ H MQPNLGQGGCMAIED YQL LELDK       SG+ I     I S+L+ 
Sbjct  344  RVTLVGDAAHPMQPNLGQGGCMAIEDCYQLILELDKI----ANSGSSILLSDQIVSALRR  399

Query  171  YEKERRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLA  350
            YEK+R  RVG +H  +RMA+ + A Y+ Y+  G GPL  L+  RI HPG    R F+ + 
Sbjct  400  YEKKRMFRVGTVHTASRMASEVLAAYQPYMEFGFGPLPGLSTLRITHPGIQVARMFLQVF  459

Query  351  MPLMLSWVLGGNG  389
            +   ++W++ G+G
Sbjct  460  LQQFMTWMISGHG  472



>ref|XP_002512157.1| zeaxanthin epoxidase, putative [Ricinus communis]
 gb|EEF50191.1| zeaxanthin epoxidase, putative [Ricinus communis]
Length=459

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 85/141 (60%), Gaps = 0/141 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGD+ H MQPNLGQGGCMAIED YQL LELDK  +  ++     +I S L+ YEK+
Sbjct  316  RVTLLGDAAHPMQPNLGQGGCMAIEDCYQLILELDKFNKSGLDVQQSEEIFSVLRRYEKK  375

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R  RV ++H  +RMA+ +  TY+ Y+    GP+S L+  RI  P     R  + + +P  
Sbjct  376  RIFRVSMVHAASRMASKVLTTYQPYIHFQSGPMSHLSSRRITKPSVHVARLLLQIFLPQF  435

Query  363  LSWVLGGNGEKLEGRPKQCRL  425
            ++W++  +G      P  C L
Sbjct  436  MTWMIAAHGTSELRSPVYCML  456



>gb|AFK39661.1| unknown [Lotus japonicus]
Length=192

 Score =   119 bits (299),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 79/129 (61%), Gaps = 3/129 (2%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTL+GD+ H MQPNLGQGGCMAIED YQL LELDK    +       D+ S+L+ YEK+
Sbjct  65   RVTLIGDAAHPMQPNLGQGGCMAIEDCYQLILELDKV---AQNGSGDFDVISALRRYEKK  121

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R  RV ++H  +R+A+ +   Y+ Y+     PLS L   +I HPG    R  +    P  
Sbjct  122  RIPRVRVLHTASRLASKLLVNYRPYIEFKFWPLSNLANMKIKHPGIYVARALLKFTFPHF  181

Query  363  LSWVLGGNG  389
            ++W++ G+G
Sbjct  182  VTWMIAGHG  190



>ref|XP_008231370.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Prunus mume]
Length=487

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 86/144 (60%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGD+ H MQPNLGQGGCMAIED YQL  EL +A     +     +I  +L+ Y  +
Sbjct  341  RVTLLGDAAHPMQPNLGQGGCMAIEDCYQLIHELVQASESDSDVQISEEIVLALRRYANK  400

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R  RVG++   +R A+ M A+YK Y+    GPL+ L   +I HP     R F+ + +P  
Sbjct  401  RLWRVGLVFAASRFASKMLASYKPYIEFKTGPLAHLLTQQITHPAIPVFRAFLQICLPKF  460

Query  363  LSWVLGGNGEKLEGRPKQCRLSDK  434
            L+W+  G+G  L+    QC++ D+
Sbjct  461  LAWITAGHGLCLKRERNQCKVQDR  484



>ref|XP_011002325.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X2 
[Populus euphratica]
Length=515

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 82/129 (64%), Gaps = 0/129 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGD+ H MQPNLGQGGCMAIED YQL LELDK  +  ++     +I++ L+ YEK+
Sbjct  385  RVTLLGDAAHPMQPNLGQGGCMAIEDCYQLILELDKFVKNGLDFQQSNEISTMLRRYEKK  444

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R  RV  +H  +RMA+     Y+ Y+  G G LS+ +  +I  P  +  R F+ + MP  
Sbjct  445  RMFRVNTVHAASRMASKALTAYRPYMEFGSGSLSYKSSPKITKPSVLVVRAFLQIFMPQF  504

Query  363  LSWVLGGNG  389
            + W++ G+G
Sbjct  505  MIWMMAGHG  513



>ref|XP_006369457.1| hypothetical protein POPTR_0001s23620g, partial [Populus trichocarpa]
 gb|ERP66026.1| hypothetical protein POPTR_0001s23620g, partial [Populus trichocarpa]
Length=469

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 82/128 (64%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGD+ H MQPNLGQGGCMAIED YQL LELDK  +  ++     +I++ L+ YEK+
Sbjct  342  RVTLLGDAAHPMQPNLGQGGCMAIEDCYQLILELDKVVKSGLDFQQSNEISTMLRRYEKK  401

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R  R+  +H  +RMA+     Y+ Y+  G G LS+++  +I  P  +  R F+ + MP  
Sbjct  402  RMFRISTVHAASRMASKALTAYRPYMEFGSGSLSYISSPKITKPSVLVVRAFLQIFMPQF  461

Query  363  LSWVLGGN  386
            + W++ G+
Sbjct  462  MIWMMAGH  469



>ref|XP_011002324.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Populus euphratica]
Length=520

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 85/134 (63%), Gaps = 5/134 (4%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGD+ H MQPNLGQGGCMAIED YQL LELDK  +  ++     +I++ L+ YEK+
Sbjct  385  RVTLLGDAAHPMQPNLGQGGCMAIEDCYQLILELDKFVKNGLDFQQSNEISTMLRRYEKK  444

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSF-LTQF----RIPHPGRVGGRFFIDL  347
            R  RV  +H  +RMA+     Y+ Y+  G G LSF L+Q+    +I  P  +  R F+ +
Sbjct  445  RMFRVNTVHAASRMASKALTAYRPYMEFGSGSLSFMLSQYKSSPKITKPSVLVVRAFLQI  504

Query  348  AMPLMLSWVLGGNG  389
             MP  + W++ G+G
Sbjct  505  FMPQFMIWMMAGHG  518



>gb|KEH29085.1| antheraxanthin epoxidase/zeaxanthin epoxidase [Medicago truncatula]
Length=352

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 81/129 (63%), Gaps = 4/129 (3%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGD+ H MQPNLG GGCMAIED YQL LELDK      ES     +TS+L+ YEK+
Sbjct  228  RVTLLGDAAHPMQPNLGLGGCMAIEDCYQLILELDKVGSGFEES----QVTSALRRYEKK  283

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R  RV ++H  +RMA+ M   Y+ Y+   L P S LT  +I HPG    R  +   +P  
Sbjct  284  RIPRVRVLHTASRMASKMLVNYRPYIQFQLWPHSKLTDMQIKHPGVHVARALLKFTLPQF  343

Query  363  LSWVLGGNG  389
            ++W++ G+G
Sbjct  344  VNWMISGHG  352



>gb|KDP20392.1| hypothetical protein JCGZ_05275 [Jatropha curcas]
Length=467

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 83/129 (64%), Gaps = 1/129 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTL+GD+ H MQPNLGQGGCMAIED YQL LELDK  +  ++     +I+S+L+ YEK+
Sbjct  340  RVTLIGDAAHPMQPNLGQGGCMAIEDCYQLVLELDKFSKSGLDVQQS-EISSALRRYEKK  398

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R  RV  +H  +RMA+ +  +Y+ Y+    GPLS L+  RI  P     R  + + +P  
Sbjct  399  RIFRVSTVHAASRMASKVLTSYQPYIYFRSGPLSGLSTTRITKPSLQVARILLQIFLPQF  458

Query  363  LSWVLGGNG  389
            ++W++ G G
Sbjct  459  MTWMIAGYG  467



>ref|XP_008375252.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Malus domestica]
Length=490

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 85/150 (57%), Gaps = 0/150 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RV LLGD+ H +QPNLG GGCMA+ED YQL  ELD+      ++     I  +L+ Y  +
Sbjct  341  RVALLGDAAHPLQPNLGIGGCMAVEDSYQLVDELDQVSSTGSDAQRTDAIVLALRRYATK  400

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R  RVGI+H   RMA  M A Y+  +   +GPL+ L+  +I HP     R F+   MP  
Sbjct  401  RMRRVGIVHAATRMAPEMLAMYRPCIEFKIGPLAHLSTLKIMHPAFPMARAFLQFCMPEF  460

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQLR  452
            ++W++ G+G  L+GR K      +   Q++
Sbjct  461  MTWIITGHGLSLKGREKDPSYKQQNESQIQ  490



>ref|XP_009354804.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Pyrus x 
bretschneideri]
Length=445

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 80/137 (58%), Gaps = 0/137 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RV LLGD+ H +QPNLG GGCMAIED YQL  ELD+ +     +     I  +L+ Y  +
Sbjct  293  RVALLGDAAHPLQPNLGIGGCMAIEDSYQLIDELDQVFSTGSNAQRTDAIVLALRRYATK  352

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R  RVGI+H   RMA  M A Y+  +    GPL+ L+  +I HP     R F+   MP  
Sbjct  353  RIRRVGIVHAATRMAPEMLAMYRPCIEFKFGPLAHLSTLKIMHPAFPMARAFLQFCMPEF  412

Query  363  LSWVLGGNGEKLEGRPK  413
            ++W++ G+G  L+GR K
Sbjct  413  MTWIITGHGLSLKGREK  429



>ref|XP_009356317.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Pyrus x 
bretschneideri]
Length=445

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 83/148 (56%), Gaps = 0/148 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RV LLGD+ H +QPNLG GGCMAIED YQL  ELD+       + +   I  +L+ Y  +
Sbjct  293  RVALLGDAAHPLQPNLGIGGCMAIEDSYQLTDELDQVSSTGSNAQSTDAIVLALRRYATK  352

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R  RVG++H   RMA  M A Y+  +    GPL+ L+  +I HP     R F+   MP  
Sbjct  353  RMRRVGMVHAATRMAPEMLAMYRPCIEFKFGPLAHLSTLKIMHPAFPMARAFLQFCMPEF  412

Query  363  LSWVLGGNGEKLEGRPKQCRLSDKANDQ  446
            ++W++ G+G  L+GR K+     +   Q
Sbjct  413  MTWIITGHGLSLKGREKEPSYKQQNESQ  440



>ref|XP_003605012.1| Zeaxanthin epoxidase [Medicago truncatula]
 gb|AES87209.1| antheraxanthin epoxidase/zeaxanthin epoxidase [Medicago truncatula]
Length=467

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 81/129 (63%), Gaps = 4/129 (3%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGD+ H MQPNLG GGCMAIED YQL LELDK      ES     +TS+L+ YEK+
Sbjct  341  RVTLLGDAAHPMQPNLGLGGCMAIEDCYQLILELDKVGSGFEES----QVTSALRRYEKK  396

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R  RV ++H  +RMA+ M   Y+ Y+   L P S LT  +I HPG    R  +   +P  
Sbjct  397  RIPRVRVLHTASRMASKMLVNYRPYIQFQLWPHSKLTDMQIKHPGVHVARALLKFTLPQF  456

Query  363  LSWVLGGNG  389
            ++W++ G+G
Sbjct  457  VNWMISGHG  465



>emb|CAN75880.1| hypothetical protein VITISV_024453 [Vitis vinifera]
Length=1348

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 84/143 (59%), Gaps = 17/143 (12%)
 Frame = +3

Query  3     RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPI----DITSSLKS  170
             RVTL+GD+ H MQPNLGQGGCMAIED YQL LELDK       SG+ I     I S+L+ 
Sbjct  1170  RVTLVGDAAHPMQPNLGQGGCMAIEDCYQLILELDKI----ANSGSSILLSDQIVSALRR  1225

Query  171   YEKERRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDL-  347
             YEK+R  RVG +H  +RMA+ + A Y+ Y+  G GPL  L+  RI HPG    R F+ + 
Sbjct  1226  YEKKRMFRVGTVHTASRMASEVLAAYQPYMEFGFGPLPGLSTLRITHPGIQVARMFLQVN  1285

Query  348   --------AMPLMLSWVLGGNGE  392
                      + L   WV  GN E
Sbjct  1286  CLSNKPITGILLSCFWVNEGNAE  1308



>ref|XP_003534337.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Glycine max]
Length=478

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 80/129 (62%), Gaps = 3/129 (2%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGD+ H MQPNLGQGGCMAIED YQL LELDK  +   +     ++ S+L+ YEK+
Sbjct  351  RVTLLGDAAHPMQPNLGQGGCMAIEDCYQLILELDKVAKHGSDGS---EVISALRRYEKK  407

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R  RV ++H  +RMA+ M   Y+ Y+     PLS +T  +I HPG    +       P  
Sbjct  408  RIPRVRVLHTASRMASQMLVNYRPYIEFKFWPLSNVTTMQIKHPGIHVAQALFKFTFPQF  467

Query  363  LSWVLGGNG  389
            ++W++ G+G
Sbjct  468  VTWMIAGHG  476



>ref|XP_006586729.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X2 
[Glycine max]
Length=477

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 80/129 (62%), Gaps = 3/129 (2%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGD+ H MQPNLGQGGCMAIED YQL LELDK  +   +     ++ S+L+ YEK+
Sbjct  350  RVTLLGDAAHPMQPNLGQGGCMAIEDCYQLILELDKVAKHGSDGS---EVISALRRYEKK  406

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R  RV ++H  +RMA+ M   Y+ Y+     PLS +T  +I HPG    +       P  
Sbjct  407  RIPRVRVLHTASRMASQMLVNYRPYIEFKFWPLSNVTTMQIKHPGIHVAQALFKFTFPQF  466

Query  363  LSWVLGGNG  389
            ++W++ G+G
Sbjct  467  VTWMIAGHG  475



>gb|KHN05293.1| Zeaxanthin epoxidase, chloroplastic [Glycine soja]
Length=505

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 80/129 (62%), Gaps = 3/129 (2%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGD+ H MQPNLGQGGCMAIED YQL LELDK  +   +     ++ S+L+ YEK+
Sbjct  350  RVTLLGDAAHPMQPNLGQGGCMAIEDCYQLILELDKVAKHGSDGS---EVISALRRYEKK  406

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R  RV ++H  +RMA+ M   Y+ Y+     PLS +T  +I HPG    +       P  
Sbjct  407  RIPRVRVLHTASRMASQMLVNYRPYIEFKFWPLSNVTTMQIKHPGIHVAQALFKFTFPQF  466

Query  363  LSWVLGGNG  389
            ++W++ G+G
Sbjct  467  VTWMIAGHG  475



>gb|KEH29084.1| antheraxanthin epoxidase/zeaxanthin epoxidase [Medicago truncatula]
Length=464

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 81/129 (63%), Gaps = 5/129 (4%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGD+ H MQPNLG GGCMAIED YQL LELDK      ES     +TS+L+ YEK+
Sbjct  341  RVTLLGDAAHPMQPNLGLGGCMAIEDCYQLILELDKVGSGFEES----QVTSALRRYEKK  396

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R  RV ++H  +RMA+ M   Y+ Y+   L P S LT  +I HPG    R  +   +P  
Sbjct  397  RIPRVRVLHTASRMASKMLVNYRPYIQFQLWPHS-LTDMQIKHPGVHVARALLKFTLPQF  455

Query  363  LSWVLGGNG  389
            ++W++ G+G
Sbjct  456  VNWMISGHG  464



>ref|XP_008231369.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Prunus mume]
Length=487

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 82/135 (61%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RV LLGD+ H +QPNLGQGGCMAIED YQL  ELD+      ++     I  +L+ Y K+
Sbjct  341  RVALLGDAAHPLQPNLGQGGCMAIEDCYQLIHELDQVPNTGSDAEISDAICLALRQYAKK  400

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R  RVGI+H   RMA+ M A Y+  +    GPL+ L+  +I +P    GR F+   +P  
Sbjct  401  RIRRVGIVHAATRMASKMLAMYQPSIQFKTGPLAHLSSLQITYPAFRMGRAFLQYLLPKF  460

Query  363  LSWVLGGNGEKLEGR  407
            ++W++ G+G  L+ +
Sbjct  461  MTWMIAGHGLSLKSQ  475



>gb|KEH29086.1| antheraxanthin epoxidase/zeaxanthin epoxidase [Medicago truncatula]
Length=466

 Score =   115 bits (288),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 81/129 (63%), Gaps = 5/129 (4%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGD+ H MQPNLG GGCMAIED YQL LELDK      ES     +TS+L+ YEK+
Sbjct  341  RVTLLGDAAHPMQPNLGLGGCMAIEDCYQLILELDKVGSGFEES----QVTSALRRYEKK  396

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R  RV ++H  +RMA+ M   Y+ Y+   L P S LT  +I HPG    R  +   +P  
Sbjct  397  RIPRVRVLHTASRMASKMLVNYRPYIQFQLWPHS-LTDMQIKHPGVHVARALLKFTLPQF  455

Query  363  LSWVLGGNG  389
            ++W++ G+G
Sbjct  456  VNWMISGHG  464



>ref|XP_007133854.1| hypothetical protein PHAVU_011G214600g [Phaseolus vulgaris]
 gb|ESW05848.1| hypothetical protein PHAVU_011G214600g [Phaseolus vulgaris]
Length=475

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 80/130 (62%), Gaps = 4/130 (3%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGD+ H MQPNLGQGGCMAIED YQL LELDK  R   +     ++ S+L+ YEK+
Sbjct  347  RVTLLGDAAHPMQPNLGQGGCMAIEDCYQLILELDKIARHDPDES---EVISALRRYEKK  403

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLS-FLTQFRIPHPGRVGGRFFIDLAMPL  359
            R  RV ++H  +RMA+ M   Y+ Y+     PLS  +T  +I HPG    +       P 
Sbjct  404  RIPRVRVLHTASRMASKMLVNYQPYIEFKFWPLSKNVTNMQIKHPGIHAAQALFKFTSPQ  463

Query  360  MLSWVLGGNG  389
             ++W++ G+G
Sbjct  464  FVTWMMEGHG  473



>ref|XP_006850014.1| hypothetical protein AMTR_s00022p00182600 [Amborella trichopoda]
 gb|ERN11595.1| hypothetical protein AMTR_s00022p00182600 [Amborella trichopoda]
Length=612

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 77/128 (60%), Gaps = 6/128 (5%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
             VTLLGD+ HAMQPNLGQGGCMAIED YQL +EL+KA +    +    +I  +LK YE +
Sbjct  415  HVTLLGDAAHAMQPNLGQGGCMAIEDCYQLIIELEKAAKLGFRNRLCKEIPYALKRYESK  474

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R LRVGI+H ++R+AA   + Y  Y  VGLG +S               R F+   + +M
Sbjct  475  RMLRVGILHSISRLAADSLSFYHPYFDVGLGTISVKNHLLFE------ARHFVQFGLSVM  528

Query  363  LSWVLGGN  386
            + W+  GN
Sbjct  529  MDWITAGN  536



>ref|XP_007221074.1| hypothetical protein PRUPE_ppa016605mg [Prunus persica]
 gb|EMJ22273.1| hypothetical protein PRUPE_ppa016605mg [Prunus persica]
Length=456

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 78/129 (60%), Gaps = 0/129 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGD+ H MQPNLGQGGCMAIED YQL  EL +A           +I  +L+ Y  +
Sbjct  328  RVTLLGDAAHPMQPNLGQGGCMAIEDCYQLIHELVQASESDSNVQISEEIVLALRRYANK  387

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R  RVG++   +R A+ M A+YK Y+   +GPL+ L   +I HP     R F+ + +P  
Sbjct  388  RLWRVGLVFAASRFASKMLASYKPYIEFKIGPLAHLLTQQITHPAIPVFRAFLQICLPKF  447

Query  363  LSWVLGGNG  389
            ++W+  G+G
Sbjct  448  MAWITAGHG  456



>ref|XP_006586730.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X3 
[Glycine max]
Length=472

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 77/129 (60%), Gaps = 9/129 (7%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGD+ H MQPNLGQGGCMAIED YQL LELDK  +   +     ++ S+L+ YEK+
Sbjct  351  RVTLLGDAAHPMQPNLGQGGCMAIEDCYQLILELDKVAKHGSDGS---EVISALRRYEKK  407

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R  RV ++H  +RMA+ M   Y+ Y+     PLS      I HPG    +       P  
Sbjct  408  RIPRVRVLHTASRMASQMLVNYRPYIEFKFWPLS------IKHPGIHVAQALFKFTFPQF  461

Query  363  LSWVLGGNG  389
            ++W++ G+G
Sbjct  462  VTWMIAGHG  470



>ref|XP_010257460.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X3 
[Nelumbo nucifera]
Length=444

 Score =   109 bits (273),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGD+ H MQPNLGQGGCMAIED YQL LEL+K +    ++    +I S+LK YEK+
Sbjct  339  RVTLLGDAAHPMQPNLGQGGCMAIEDCYQLILELEKVFEHINDAQVFEEIASALKRYEKK  398

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPL  281
            R  RV +IH L+RMA+ M   Y+ YL    GPL
Sbjct  399  RMFRVSVIHTLSRMASRMVTKYQPYLNFSPGPL  431



>ref|XP_007219109.1| hypothetical protein PRUPE_ppa015657mg [Prunus persica]
 gb|EMJ20308.1| hypothetical protein PRUPE_ppa015657mg [Prunus persica]
Length=468

 Score =   109 bits (273),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 78/129 (60%), Gaps = 0/129 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RV LLGD+ H +QPNLGQGGCMAIED YQL  ELD+      ++     I  +L+ Y K+
Sbjct  340  RVALLGDAAHPLQPNLGQGGCMAIEDCYQLIDELDQVPNTGTDAQISDAICLALRQYAKK  399

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            R  RVGI+H   RMA+ M A Y+    +  G L+ L+  +I +P    G+ F+   +P  
Sbjct  400  RIRRVGIVHAATRMASKMLAMYQPCTQLKTGTLAHLSSLQITYPAFRMGQAFLQFLLPKF  459

Query  363  LSWVLGGNG  389
            ++W++ G+G
Sbjct  460  MTWMIAGHG  468



>gb|EYU27117.1| hypothetical protein MIMGU_mgv1a020551mg, partial [Erythranthe 
guttata]
Length=410

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 78/130 (60%), Gaps = 3/130 (2%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPID-ITSSLKSYEK  179
            RV LLGD+ HAM PNLGQGG MAIED Y L LEL    ++   S  P+D IT++   +EK
Sbjct  281  RVILLGDAAHAMLPNLGQGGSMAIEDCYWLMLELQNLAQRHTISEIPLDQITTAFTRFEK  340

Query  180  ERRLRVGIIHGLARMAALMAATYKAYLGVGLGPL-SFLTQFRIPHPGRVGGRFFIDLAMP  356
            +R  RV I+H + R+A+ + A Y+ YL + +GP+ +     R+ HP        + LAMP
Sbjct  341  KRMFRVRIVHSICRLASTLTAFYQTYL-IDIGPIFNVAGVLRVKHPAFHVSNKLLQLAMP  399

Query  357  LMLSWVLGGN  386
              + WV+ G 
Sbjct  400  KFMEWVIVGQ  409



>ref|XP_011087105.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Sesamum 
indicum]
Length=474

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 77/129 (60%), Gaps = 1/129 (1%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDK-AWRQSVESGAPIDITSSLKSYEK  179
            RV LLGD+ HAM PNLGQGG +AIED Y L +EL   A  + +      D+ S+ + +EK
Sbjct  345  RVILLGDAAHAMLPNLGQGGSIAIEDCYWLMVELQNLAQTRPMSDITSDDLASAFRRFEK  404

Query  180  ERRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPL  359
            +R  RV  +H + RMA++M + Y++YL +G  PL      R+ HPG +     + +A+P 
Sbjct  405  KRMFRVRTVHTICRMASVMTSVYQSYLDIGPLPLFKEWSMRVKHPGLLITNQLLQIALPK  464

Query  360  MLSWVLGGN  386
             + WV+ G 
Sbjct  465  FMDWVIAGQ  473



>ref|XP_011087095.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Sesamum 
indicum]
Length=440

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 79/136 (58%), Gaps = 10/136 (7%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQ----SVESGAPIDITSSLKS  170
            RV L+GD+ HAM PNLGQGG MAIED Y L +EL    +     S  S   +D+  + + 
Sbjct  306  RVILVGDAAHAMLPNLGQGGSMAIEDCYWLMVELQNLAQTHLMLSEISSDELDL--AFRR  363

Query  171  YEKERRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQ----FRIPHPGRVGGRFF  338
            +EK+R LRV  +H + RMA++M + Y+++L + L PL   T      ++ HPG V     
Sbjct  364  FEKKRMLRVRTLHSICRMASVMTSGYQSHLHISLPPLPLFTNEYWSLKVKHPGMVIANQA  423

Query  339  IDLAMPLMLSWVLGGN  386
            + LA+P  + WV+ G 
Sbjct  424  LLLALPKFMDWVVIGQ  439



>ref|XP_002502759.1| zeaxanthin epoxidase [Micromonas sp. RCC299]
 gb|ACO64017.1| zeaxanthin epoxidase [Micromonas sp. RCC299]
Length=549

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 73/136 (54%), Gaps = 16/136 (12%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RV LLGDS HA+QPNLGQGG  AIE  Y LA EL K   +         +  +L  Y   
Sbjct  369  RVALLGDSAHAVQPNLGQGGGQAIESAYALADELAKCEGKK-------GVQKALVMYTMR  421

Query  183  RRLRVGIIHGLARMAALMAATYKAYLG---VGLGPLSF------LTQFRIPHPGRVGGRF  335
            R LR G IHGL+R ++LM   Y+ YLG    G  P         + + +IPHPG V G+ 
Sbjct  422  RFLRTGSIHGLSRFSSLMNTVYRKYLGDEPYGFYPEPVKQFWNNVAKLKIPHPGSVAGQI  481

Query  336  FIDLAMPLMLSWVLGG  383
             I   MP +L +V GG
Sbjct  482  AIMGTMPGLLEYVGGG  497



>ref|XP_003060868.1| zeaxanthin epoxidase [Micromonas pusilla CCMP1545]
 gb|EEH54518.1| zeaxanthin epoxidase [Micromonas pusilla CCMP1545]
Length=497

 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 73/138 (53%), Gaps = 20/138 (14%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RV LLGDS HA+QPNLGQGG  AIE  Y LA EL K   +         +  +L  Y   
Sbjct  317  RVALLGDSAHAVQPNLGQGGGQAIESAYALADELVKCENKK-------GVQMALMKYTSR  369

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSF-----------LTQFRIPHPGRVGG  329
            R LR G IHGL+R +++M   Y+ YLG    P  F           + + +IPHPG V G
Sbjct  370  RFLRTGSIHGLSRFSSIMNTVYRRYLGD--EPYDFYPEPVRKFWNEVAKLKIPHPGSVVG  427

Query  330  RFFIDLAMPLMLSWVLGG  383
            +  I   MP +L +V GG
Sbjct  428  QMAIMGTMPGLLEYVGGG  445



>ref|XP_003083516.1| zeaxanthin epoxidase precursor (ISS), partial [Ostreococcus tauri]
Length=448

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 76/138 (55%), Gaps = 16/138 (12%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            R+ LLGDS HA+QPNLGQGG  AIE  Y LA EL K      E G    +  +L  Y   
Sbjct  271  RMALLGDSAHAVQPNLGQGGGQAIEGAYVLADELSKC-----EGGK--GVQKALMMYAAR  323

Query  183  RRLRVGIIHGLARMAALMAATYKAYLG---VGLGPLSF------LTQFRIPHPGRVGGRF  335
            R LR G IHGL+R ++LM   Y+ YLG    G  P         +++ +IPHPG V G+ 
Sbjct  324  RFLRTGAIHGLSRFSSLMNTFYRRYLGDEPYGWYPEPAKEMWHEVSKAKIPHPGSVVGQI  383

Query  336  FIDLAMPLMLSWVLGGNG  389
             +   MP++L +V  G G
Sbjct  384  ALMATMPIILEYVGAGYG  401



>emb|CEG00292.1| Monooxygenase, FAD-binding [Ostreococcus tauri]
Length=522

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 76/138 (55%), Gaps = 16/138 (12%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            R+ LLGDS HA+QPNLGQGG  AIE  Y LA EL K      E G    +  +L  Y   
Sbjct  345  RMALLGDSAHAVQPNLGQGGGQAIEGAYVLADELSKC-----EGGK--GVQKALMMYAAR  397

Query  183  RRLRVGIIHGLARMAALMAATYKAYLG---VGLGPLSF------LTQFRIPHPGRVGGRF  335
            R LR G IHGL+R ++LM   Y+ YLG    G  P         +++ +IPHPG V G+ 
Sbjct  398  RFLRTGAIHGLSRFSSLMNTFYRRYLGDEPYGWYPEPAKEMWHEVSKAKIPHPGSVVGQI  457

Query  336  FIDLAMPLMLSWVLGGNG  389
             +   MP++L +V  G G
Sbjct  458  ALMATMPIILEYVGAGYG  475



>gb|EYU27115.1| hypothetical protein MIMGU_mgv1a007399mg [Erythranthe guttata]
Length=409

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 68/132 (52%), Gaps = 6/132 (5%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPI-DITSSLKSYEK  179
            RV LLGD+ HAMQP LGQG  MAIED Y L +EL    ++   SG P+  +T + + YE 
Sbjct  276  RVVLLGDAAHAMQPYLGQGSTMAIEDCYWLMVELQNVAKRHTVSGIPLHQLTLAFRRYED  335

Query  180  ERRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLT----QFRIPHPGRVGGRFFIDL  347
             R+ RV  IH + R+   + + YK YL    GPL           +  P  V       L
Sbjct  336  RRKFRVTTIHTICRLIGDVGSHYKTYL-FDTGPLQLFNVVSAAVSVKDPVSVITMKLFQL  394

Query  348  AMPLMLSWVLGG  383
            A+P ++ WV+  
Sbjct  395  ALPTIVDWVIAN  406



>ref|XP_006586731.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X4 
[Glycine max]
Length=425

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 3/76 (4%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTLLGD+ H MQPNLGQGGCMAIED YQL LELDK  +   +     ++ S+L+ YEK+
Sbjct  351  RVTLLGDAAHPMQPNLGQGGCMAIEDCYQLILELDKVAKHGSDGS---EVISALRRYEKK  407

Query  183  RRLRVGIIHGLARMAA  230
            R  RV ++H  +RMA+
Sbjct  408  RIPRVRVLHTASRMAS  423



>ref|XP_011468712.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=439

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITS  158
             VTLLGDS+HAMQPNLGQGGCMAIEDGYQLALEL+KA ++S E G P DI++
Sbjct  367  NVTLLGDSVHAMQPNLGQGGCMAIEDGYQLALELEKALKKSHELGTPPDISA  418



>ref|XP_007512298.1| zeaxanthin epoxidase [Bathycoccus prasinos]
 emb|CCO66386.1| zeaxanthin epoxidase [Bathycoccus prasinos]
Length=521

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 75/139 (54%), Gaps = 22/139 (16%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKA-WRQSVESGAPIDITSSLKSYEK  179
            RV LLGDS HA+QPNLGQGG  AIE  Y LA EL K   ++ VE         +L  Y  
Sbjct  342  RVALLGDSAHAVQPNLGQGGGQAIESAYVLADELSKCEGKKGVE--------LALVRYAT  393

Query  180  ERRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSF-----------LTQFRIPHPGRVG  326
             R LR   IHGL+R ++LM   Y+ YLG    P  +           + + +IPHPG V 
Sbjct  394  RRFLRTSSIHGLSRFSSLMNTFYRRYLGD--EPYDWYPEPVRKFWESVAKLKIPHPGSVM  451

Query  327  GRFFIDLAMPLMLSWVLGG  383
            G+  +  +MP++L +V  G
Sbjct  452  GQIILMGSMPVILEYVGAG  470



>ref|XP_001421564.1| zeaxanthin epoxidase (ABA1) (NPQ2), partial [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO99857.1| zeaxanthin epoxidase (ABA1) (NPQ2), partial [Ostreococcus lucimarinus 
CCE9901]
Length=429

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 75/138 (54%), Gaps = 20/138 (14%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            R+ LLGDS HA+QPNLGQGG  AIE  Y LA EL K      E G    + ++L +Y   
Sbjct  301  RMALLGDSAHAVQPNLGQGGGQAIESAYVLADELSKC-----EGGK--GVQNALMAYASR  353

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSF-----------LTQFRIPHPGRVGG  329
            R LR   IHGL+R ++LM   Y+ +LG    P  +           + + +IPHPG V G
Sbjct  354  RFLRTASIHGLSRFSSLMNTFYRRHLGD--EPYDWYPEPVKNMWNTVAKAKIPHPGSVIG  411

Query  330  RFFIDLAMPLMLSWVLGG  383
            +  +   MP++L +V  G
Sbjct  412  QIALIGTMPIILEYVGAG  429



>gb|KHN36228.1| Zeaxanthin epoxidase, chloroplastic [Glycine soja]
Length=426

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 71/142 (50%), Gaps = 53/142 (37%)
 Frame = +3

Query  138  APIDITSSLKSYEKERRLRVGIIHGLARMAALMAATYKAYLGVGLGPLSFLTQFRIPHPG  317
             P DI S    YE+ERRLRV I+HG+ARMAA+MA+TYKAYLGVGLGPL            
Sbjct  250  VPADIESV--GYERERRLRVAIVHGMARMAAMMASTYKAYLGVGLGPL------------  295

Query  318  RVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNG  497
                                                  +AN QL +WF+ ++ALERA+NG
Sbjct  296  --------------------------------------EANGQLHRWFEANNALERAING  317

Query  498  EWFLSPLKNATSTASEPILLRR  563
            EW L P  +   T ++PI L +
Sbjct  318  EWILLPCGDEAGT-TKPICLSQ  338



>gb|EWM27076.1| zeaxanthin epoxidase [Nannochloropsis gaditana]
Length=503

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 49/75 (65%), Gaps = 7/75 (9%)
 Frame = +3

Query  6    VTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKER  185
            V +LGD+ H M PNLGQGGC A+EDGY+LA EL K   +        D+  +L+ YE +R
Sbjct  352  VAVLGDAAHPMMPNLGQGGCQAVEDGYRLAQELSKITDRG-------DVAWALRMYENQR  404

Query  186  RLRVGIIHGLARMAA  230
             +R   +HGLAR+A+
Sbjct  405  LVRSSAVHGLARIAS  419



>ref|XP_002178367.1| zeaxanthin epoxidase [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC50032.1| zeaxanthin epoxidase [Phaeodactylum tricornutum CCAP 1055/1]
Length=557

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 45/75 (60%), Gaps = 7/75 (9%)
 Frame = +3

Query  6    VTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKER  185
            V LLGD +HAM PNLGQGGC AIED + +  EL  A ++S        I   L+ Y++ R
Sbjct  364  VALLGDGVHAMMPNLGQGGCQAIEDAFVIGQELGSATKRS-------QIVDKLREYQQRR  416

Query  186  RLRVGIIHGLARMAA  230
             +R   + GL+R A+
Sbjct  417  LIRSAAVQGLSRFAS  431



>ref|XP_009040452.1| hypothetical protein AURANDRAFT_31758 [Aureococcus anophagefferens]
 gb|EGB04896.1| hypothetical protein AURANDRAFT_31758 [Aureococcus anophagefferens]
Length=406

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 58/105 (55%), Gaps = 11/105 (10%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RV + GD+ H M PNLGQGGC + EDGY+LA EL              D +++L SY ++
Sbjct  299  RVAICGDAAHPMMPNLGQGGCQSTEDGYRLAEELATVTHTK-------DTSAALGSYSRK  351

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGL-GPLSFL--TQFRIP  308
            R +R  I+ G A++ + +   +   + + L GP  FL  TQ  +P
Sbjct  352  RVVRTSIVQGFAQLGSDLLVDFDLMMTIPLVGPF-FLKATQLSMP  395



>ref|XP_002506632.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67890.1| predicted protein [Micromonas sp. RCC299]
Length=332

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 60/108 (56%), Gaps = 18/108 (17%)
 Frame = +3

Query  6    VTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKER  185
            VTLLGDS HA  PN+GQG  +A EDGY+LA  L+K   +S       ++ S+L S+ K+R
Sbjct  171  VTLLGDSCHATMPNIGQGAGLAFEDGYELAKILEKVKNRS-------EVPSALDSFYKKR  223

Query  186  RLRVGIIHGLARM--AALMAAT--------YKAYLGVGLGPLSFLTQF  299
             LR   + GL RM   A+   T         + ++G  L PL F TQF
Sbjct  224  ILRTAAVQGLGRMNSEAIKILTPLLPIRPLVEYFIGPFL-PLVFRTQF  270



>ref|XP_002291549.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED91656.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=615

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 54/104 (52%), Gaps = 9/104 (9%)
 Frame = +3

Query  6    VTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKER  185
            V L GD+ H M PNLGQGGC A EDGY+L  EL K            D+  +L  Y + R
Sbjct  509  VALCGDAAHPMMPNLGQGGCQATEDGYRLVEELAKVQHSR-------DVPGALGRYSRVR  561

Query  186  RLRVGIIHGLARMAALMAATYKAYLGVG-LGPLSFLTQFRIPHP  314
             +R  II G A++ + +   +   + +  LGP  FLT  ++  P
Sbjct  562  VIRTAIIQGFAQLGSDLLVDFDLMMTIPLLGPF-FLTMTQLSMP  604



>ref|XP_002180238.1| zeaxanthin epoxidase [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC48429.1| zeaxanthin epoxidase [Phaeodactylum tricornutum CCAP 1055/1]
Length=565

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 56/104 (54%), Gaps = 9/104 (9%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            +V + GD+ H M PNLGQGGC A EDGY+LA EL              DI  +L+ Y ++
Sbjct  458  QVAICGDAAHPMMPNLGQGGCQATEDGYRLAEELATVRTTK-------DIEGALQEYYRK  510

Query  183  RRLRVGIIHGLARMAALMAATYKAYLGVGL-GPLS-FLTQFRIP  308
            R  R  II  LA++ + +   +   + + L GP   F+TQ  +P
Sbjct  511  RIPRTTIIQALAQLGSDLLVDFDKMMTIPLVGPFFLFMTQVSMP  554



>emb|CAH25347.1| zeaxanthin epoxidase [Guillardia theta]
Length=236

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 7/76 (9%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
             VT++GD++H M PNLGQGGC AIED Y L+  L    ++        DI  +L+S+  +
Sbjct  59   HVTMIGDAVHPMMPNLGQGGCQAIEDAYVLSEILGTVEKRE-------DIPGALRSFYFK  111

Query  183  RRLRVGIIHGLARMAA  230
            R  R  +I GL+R+A+
Sbjct  112  RLPRTSVIQGLSRIAS  127



>emb|CBJ27312.1| zeaxanthin epoxidase, chloroplast precursor [Ectocarpus siliculosus]
Length=566

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 61/119 (51%), Gaps = 15/119 (13%)
 Frame = +3

Query  9    TLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKERR  188
             L+GD+ H M PNLGQGGC A+EDGY L   L     +S        I  +L+S+ + R 
Sbjct  398  VLIGDACHPMMPNLGQGGCQAMEDGYILTNMLKDVTHRS-------QIPETLESFYRSRI  450

Query  189  LRVGIIHGLARMAA-LMAATYKAYLGVGLGPLSFLTQFRIPHPGRVGGRFFIDLAMPLM  362
            +R  ++ GL+R+A+ L+   +   + V L P      F +  PG +   F   +  P++
Sbjct  451  IRTSVVQGLSRIASDLIVKNFDTPMKVTLSP------FNMDAPGGINS-FMTSVMKPVL  502



>ref|XP_005836989.1| zeaxanthin epoxidase, plastid-targeted [Guillardia theta CCMP2712]
 gb|ACI45952.1| putative plastid zeaxanthin epoxidase precursor [Guillardia theta]
 gb|EKX50009.1| zeaxanthin epoxidase, plastid-targeted [Guillardia theta CCMP2712]
Length=556

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 7/76 (9%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
             VT++GD++H M PNLGQGGC AIED Y L+  L    ++        DI  +L+S+  +
Sbjct  379  HVTMIGDAVHPMMPNLGQGGCQAIEDAYVLSEILGTVEKRE-------DIPGALRSFYFK  431

Query  183  RRLRVGIIHGLARMAA  230
            R  R  +I GL+R+A+
Sbjct  432  RLPRTSVIQGLSRIAS  447



>ref|XP_002952254.1| hypothetical protein VOLCADRAFT_92803 [Volvox carteri f. nagariensis]
 gb|EFJ46725.1| hypothetical protein VOLCADRAFT_92803 [Volvox carteri f. nagariensis]
Length=462

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 43/68 (63%), Gaps = 4/68 (6%)
 Frame = +3

Query  6    VTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESG----APIDITSSLKSY  173
            VTL+GD+ H M PNLGQGGC A+ED  QLA  L    + +  +G    +P D+ S+L+SY
Sbjct  342  VTLVGDAAHPMTPNLGQGGCTALEDAVQLARRLGALAKGAGATGSSPLSPADVASALRSY  401

Query  174  EKERRLRV  197
            E ER  R 
Sbjct  402  EYERSSRC  409



>ref|WP_040935469.1| Zeaxanthin epoxidase, partial [Prochloron didemni]
Length=310

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 5/73 (7%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTL+GD+ H +QPN+GQGGCMAIED Y+L   L  +     +     +IT SL+ +E+ 
Sbjct  200  RVTLIGDAAHPVQPNIGQGGCMAIEDAYELVKHLINSPNHPNQ-----EITVSLRQFEQN  254

Query  183  RRLRVGIIHGLAR  221
            R  RV  +   +R
Sbjct  255  RFPRVEKVFNTSR  267



>ref|WP_027336971.1| monooxygenase [Halomonas sp. HL-48]
Length=406

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 51/84 (61%), Gaps = 2/84 (2%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RV LLGD+ H M P+LGQGGC A+ED + L+  L++A  ++ ++ A   I S+L  Y++ 
Sbjct  293  RVALLGDAAHGMAPDLGQGGCQAMEDAWVLSQALERALEENTDTSAA--IKSALAQYDRA  350

Query  183  RRLRVGIIHGLARMAALMAATYKA  254
            R  RVG I   AR  A M   + A
Sbjct  351  RVDRVGEIVQRARKRAAMIHGHDA  374



>ref|WP_040945347.1| Zeaxanthin epoxidase [Prochloron didemni]
Length=399

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 5/73 (7%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RVTL+GD+ H +QPN+GQGGCMAIED Y+L   L  +     +     +IT SL+ +E+ 
Sbjct  289  RVTLIGDAAHPVQPNIGQGGCMAIEDAYELVKHLINSPNHPNQ-----EITVSLRQFEQN  343

Query  183  RRLRVGIIHGLAR  221
            R  RV  +   +R
Sbjct  344  RFPRVEKVFNTSR  356



>gb|KIE13607.1| Zeaxanthin epoxidase [Tolypothrix bouteillei VB521301]
Length=415

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 47/83 (57%), Gaps = 11/83 (13%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLA--LELDKAWRQSVESGAPIDITSSLKSYE  176
            RVTLLGD+ H +QPNLGQGGCMA+ED +++A  L L   ++          I S L+ YE
Sbjct  298  RVTLLGDAAHPVQPNLGQGGCMAVEDAFEIAKLLNLSANYKA---------IPSLLRQYE  348

Query  177  KERRLRVGIIHGLARMAALMAAT  245
              R  RV  +  ++R    +  T
Sbjct  349  SSRSQRVTRVFNVSRQVGALGQT  371



>ref|WP_030054615.1| monooxygenase [Streptomyces peruviensis]
Length=387

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 47/78 (60%), Gaps = 11/78 (14%)
 Frame = +3

Query  3    RVTLLGDSIHAMQPNLGQGGCMAIEDGYQLALELDKAWRQSVESGAPIDITSSLKSYEKE  182
            RV LLGD+ HAM PNLGQG C A+ED   LA  LD         GAP D+T++L SY++ 
Sbjct  277  RVALLGDAAHAMTPNLGQGACQALEDAVTLAHCLD---------GAP-DVTAALHSYDRL  326

Query  183  RRLRV-GIIHGLARMAAL  233
            RR R   +    AR+ AL
Sbjct  327  RRPRTQAVARRSARLGAL  344



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920