BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF009J17

Length=555
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACL00957.1|  sucrose synthase                                        253   7e-76   Ipomoea batatas [batate]
gb|AAA63685.1|  sucrose synthase                                        224   4e-71   Solanum tuberosum [potatoes]
dbj|BAP82380.1|  sucrose synthase                                       221   1e-68   Phelipanche aegyptiaca
ref|XP_006353766.1|  PREDICTED: sucrose synthase 2 isoform X2           231   1e-67   
ref|XP_010323602.1|  PREDICTED: sucrose synthase isoform X1             231   1e-67   
ref|NP_001274911.1|  sucrose synthase 2                                 231   1e-67   Solanum tuberosum [potatoes]
sp|P49039.1|SUS2_SOLTU  RecName: Full=Sucrose synthase; AltName: ...    231   1e-67   Solanum tuberosum [potatoes]
ref|NP_001234804.1|  sucrose synthase                                   231   2e-67   
ref|XP_009625446.1|  PREDICTED: sucrose synthase                        229   1e-66   Nicotiana tomentosiformis
gb|AHL84158.1|  sucrose synthase                                        229   1e-66   Nicotiana tabacum [American tobacco]
ref|XP_009589756.1|  PREDICTED: sucrose synthase                        228   2e-66   Nicotiana tomentosiformis
ref|XP_009792656.1|  PREDICTED: sucrose synthase                        228   2e-66   Nicotiana sylvestris
gb|ABV02029.1|  sucrose sythase                                         228   2e-66   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_011093886.1|  PREDICTED: sucrose synthase                        228   2e-66   Sesamum indicum [beniseed]
gb|AEN79500.1|  sucrose synthase 1                                      228   3e-66   Phelipanche ramosa
ref|XP_009760458.1|  PREDICTED: sucrose synthase                        227   6e-66   Nicotiana sylvestris
emb|CAI56307.1|  sucrose synthase                                       225   2e-65   Coffea canephora [robusta coffee]
gb|ABI17891.1|  sucrose synthase                                        225   2e-65   Coffea canephora [robusta coffee]
emb|CAJ32596.1|  sucrose synthase                                       225   2e-65   Coffea arabica [arabica coffee]
ref|NP_001275286.1|  sucrose synthase                                   224   7e-65   Solanum tuberosum [potatoes]
sp|P10691.1|SUS1_SOLTU  RecName: Full=Sucrose synthase; AltName: ...    224   8e-65   Solanum tuberosum [potatoes]
ref|XP_006345244.1|  PREDICTED: uncharacterized LOC102577594            224   8e-65   Solanum tuberosum [potatoes]
gb|AAA97571.1|  sucrose synthase                                        223   8e-65   Solanum tuberosum [potatoes]
emb|CAA09681.1|  sucrose synthase                                       222   2e-64   Solanum lycopersicum
ref|NP_001234655.1|  sucrose synthase                                   222   3e-64   
ref|XP_011078145.1|  PREDICTED: sucrose synthase                        221   1e-63   
gb|EYU25805.1|  hypothetical protein MIMGU_mgv1a001207mg                210   6e-60   Erythranthe guttata [common monkey flower]
gb|ABD61653.1|  sucrose synthase                                        209   1e-59   Cichorium intybus [radicchio]
gb|AFO84090.1|  sucrose synthase                                        206   1e-58   Actinidia chinensis
sp|P49035.1|SUS1_DAUCA  RecName: Full=Sucrose synthase isoform 1;...    205   4e-58   Daucus carota [carrots]
ref|XP_010107074.1|  Sucrose synthase                                   197   1e-55   Morus notabilis
gb|AHL29281.1|  sucrose synthase 1                                      197   3e-55   Camellia sinensis [black tea]
gb|AAD09568.1|  sucrose synthase                                        191   1e-54   Gossypium hirsutum [American cotton]
ref|XP_008337809.1|  PREDICTED: sucrose synthase                        194   3e-54   Malus domestica [apple tree]
gb|AEK81522.1|  sucrose synthase isoform D                              193   8e-54   Gossypium hirsutum [American cotton]
gb|AEV40460.1|  sucrose synthase 1                                      193   8e-54   Gossypium arboreum [tree cotton]
gb|KJB82966.1|  hypothetical protein B456_013G222400                    192   8e-54   Gossypium raimondii
gb|KJB82967.1|  hypothetical protein B456_013G222400                    192   9e-54   Gossypium raimondii
ref|XP_007012546.1|  Sucrose synthase 4 isoform 1                       193   1e-53   Theobroma cacao [chocolate]
gb|KHG00606.1|  Sucrose synthase                                        192   1e-53   Gossypium arboreum [tree cotton]
gb|KDO73787.1|  hypothetical protein CISIN_1g003661mg                   190   1e-53   Citrus sinensis [apfelsine]
ref|XP_008382924.1|  PREDICTED: sucrose synthase-like                   191   2e-53   
ref|XP_008349074.1|  PREDICTED: sucrose synthase-like                   191   2e-53   
dbj|BAM68526.1|  sucrose synthase                                       191   3e-53   Mangifera indica
dbj|BAM68521.1|  sucrose synthase                                       191   3e-53   Mangifera indica
dbj|BAM68527.1|  sucrose synthase                                       191   3e-53   Mangifera indica
dbj|BAM68520.1|  sucrose synthase                                       191   3e-53   Mangifera indica
dbj|BAM37539.1|  sucrose synthase                                       191   3e-53   Mangifera indica
gb|KDO73786.1|  hypothetical protein CISIN_1g003661mg                   190   4e-53   Citrus sinensis [apfelsine]
emb|CAN82840.1|  hypothetical protein VITISV_024563                     190   6e-53   Vitis vinifera
ref|XP_002275155.1|  PREDICTED: sucrose synthase                        190   6e-53   Vitis vinifera
ref|XP_006474580.1|  PREDICTED: sucrose synthase-like isoform X1        190   6e-53   Citrus sinensis [apfelsine]
ref|XP_006452883.1|  hypothetical protein CICLE_v10007483mg             190   6e-53   Citrus clementina [clementine]
dbj|BAA89049.1|  sucrose synthase                                       190   6e-53   Citrus unshiu [satsuma mandarin]
ref|XP_007012547.1|  Sucrose synthase 4 isoform 2                       190   8e-53   
gb|AIJ28960.1|  sucrose synthase                                        190   9e-53   Manihot esculenta subsp. flabellifolia
gb|AIJ28962.1|  sucrose synthase                                        189   1e-52   Manihot esculenta [manioc]
ref|XP_009359754.1|  PREDICTED: sucrose synthase                        189   1e-52   
dbj|BAM05649.1|  sucrose synthase 3                                     189   2e-52   Eucalyptus globulus subsp. globulus
dbj|BAM05652.1|  sucrose synthase 3                                     189   2e-52   Eucalyptus globulus subsp. globulus
dbj|BAM05650.1|  sucrose synthase 3                                     189   2e-52   Eucalyptus pilularis
ref|XP_009343357.1|  PREDICTED: sucrose synthase                        189   3e-52   Pyrus x bretschneideri [bai li]
ref|XP_009348896.1|  PREDICTED: sucrose synthase-like                   189   3e-52   Pyrus x bretschneideri [bai li]
gb|AEV40462.1|  sucrose synthase 3                                      188   3e-52   Gossypium arboreum [tree cotton]
gb|ADY68844.1|  sucrose synthase                                        188   3e-52   Gossypium barbadense [Egyptian cotton]
gb|KJB54540.1|  hypothetical protein B456_009G038000                    186   3e-52   Gossypium raimondii
gb|ADY68848.1|  sucrose synthase                                        188   4e-52   Gossypium hirsutum [American cotton]
gb|AEN71063.1|  sucrose synthase Sus1                                   188   4e-52   Gossypium mustelinum
gb|AAD28641.1|  sucrose synthase                                        188   4e-52   Gossypium hirsutum [American cotton]
gb|ADY68846.1|  sucrose synthase                                        188   4e-52   Gossypium herbaceum subsp. africanum
gb|AGQ57012.1|  sucrose synthase 1                                      188   4e-52   Hevea brasiliensis [jebe]
gb|AGM14949.1|  sucrose synthase 4                                      188   4e-52   Hevea brasiliensis [jebe]
gb|AFY03624.1|  sucrose synthase                                        179   4e-52   Eucalyptus globulus [blue gum]
gb|AEV40463.1|  sucrose synthase 4                                      187   7e-52   Gossypium arboreum [tree cotton]
ref|XP_008450968.1|  PREDICTED: sucrose synthase                        187   7e-52   Cucumis melo [Oriental melon]
ref|XP_008391788.1|  PREDICTED: sucrose synthase-like isoform X2        187   7e-52   
ref|XP_008338289.1|  PREDICTED: sucrose synthase-like                   187   8e-52   
gb|AEK81520.1|  sucrose synthase isoform B                              187   9e-52   Gossypium hirsutum [American cotton]
ref|XP_010047438.1|  PREDICTED: sucrose synthase                        187   9e-52   Eucalyptus grandis [rose gum]
dbj|BAA88905.1|  sucrose synthase                                       187   9e-52   Citrus unshiu [satsuma mandarin]
gb|AEV40464.1|  sucrose synthase 5                                      187   9e-52   Gossypium arboreum [tree cotton]
ref|XP_008391777.1|  PREDICTED: sucrose synthase-like isoform X1        187   1e-51   
ref|XP_009348897.1|  PREDICTED: sucrose synthase-like                   186   1e-51   Pyrus x bretschneideri [bai li]
gb|KJB54542.1|  hypothetical protein B456_009G038000                    186   1e-51   Gossypium raimondii
ref|XP_009343356.1|  PREDICTED: sucrose synthase-like                   186   1e-51   Pyrus x bretschneideri [bai li]
gb|AEN71079.1|  sucrose synthase Sus1                                   186   2e-51   Gossypium aridum
gb|AFY03626.1|  sucrose synthase                                        186   2e-51   Eucalyptus globulus [blue gum]
gb|AEN71075.1|  sucrose synthase Sus1                                   186   2e-51   Gossypium armourianum
gb|AEN71060.1|  sucrose synthase Sus1                                   186   2e-51   Gossypium laxum
gb|AEN71059.1|  sucrose synthase Sus1                                   186   2e-51   Gossypium thurberi
gb|AEN71080.1|  sucrose synthase Sus1                                   186   2e-51   Gossypium gossypioides
dbj|BAM05651.1|  sucrose synthase 3                                     186   2e-51   Eucalyptus pyrocarpa
gb|AEN71068.1|  sucrose synthase Sus1                                   186   2e-51   Gossypium tomentosum
gb|AEN71061.1|  sucrose synthase Sus1                                   186   2e-51   Gossypium schwendimanii
gb|ADY68845.1|  sucrose synthase                                        186   2e-51   Gossypium barbadense [Egyptian cotton]
gb|ACV72640.1|  sucrose synthase 1                                      186   2e-51   Gossypium hirsutum [American cotton]
gb|AEN71078.1|  sucrose synthase Sus1                                   186   2e-51   Gossypium klotzschianum
gb|KJB54541.1|  hypothetical protein B456_009G038000                    186   2e-51   Gossypium raimondii
gb|KJB54539.1|  hypothetical protein B456_009G038000                    186   2e-51   Gossypium raimondii
ref|NP_001289655.1|  sucrose synthase                                   185   4e-51   Eucalyptus grandis [rose gum]
gb|KJB65375.1|  hypothetical protein B456_010G092300                    185   4e-51   Gossypium raimondii
gb|AEN83999.1|  sucrose synthase                                        185   6e-51   Cucumis sativus [cucumbers]
gb|KJB65372.1|  hypothetical protein B456_010G092300                    185   6e-51   Gossypium raimondii
ref|XP_004144053.1|  PREDICTED: sucrose synthase-like                   185   6e-51   Cucumis sativus [cucumbers]
gb|KJB65376.1|  hypothetical protein B456_010G092300                    185   6e-51   Gossypium raimondii
gb|KGN66333.1|  hypothetical protein Csa_1G597800                       184   6e-51   Cucumis sativus [cucumbers]
dbj|BAA89232.1|  wsus                                                   184   2e-50   Citrullus lanatus [wild melon]
gb|AEF56625.1|  sucrose synthase                                        184   2e-50   Arachis hypogaea var. vulgaris [Spanish peanut]
gb|AEN71066.1|  sucrose synthase Sus1                                   184   2e-50   Gossypium darwinii
gb|AIL23782.1|  sucrose synthase                                        182   3e-50   Prunus serrulata
ref|XP_010520519.1|  PREDICTED: sucrose synthase 4-like                 182   4e-50   Tarenaya hassleriana [spider flower]
sp|P49034.1|SUSY_ALNGL  RecName: Full=Sucrose synthase; AltName: ...    182   4e-50   Alnus glutinosa
gb|KDP33978.1|  hypothetical protein JCGZ_07549                         182   5e-50   Jatropha curcas
ref|NP_001237525.1|  sucrose synthase                                   182   5e-50   Glycine max [soybeans]
ref|XP_003609946.1|  Sucrose synthase                                   183   6e-50   
ref|XP_008242292.1|  PREDICTED: sucrose synthase                        182   6e-50   Prunus mume [ume]
ref|XP_007204649.1|  hypothetical protein PRUPE_ppa001535mg             182   6e-50   Prunus persica
ref|XP_010049327.1|  PREDICTED: sucrose synthase-like                   182   6e-50   Eucalyptus grandis [rose gum]
gb|AFI57908.1|  sucrose synthase 1                                      182   6e-50   Prunus persica
ref|NP_001289661.1|  sucrose synthase-like                              182   6e-50   Eucalyptus grandis [rose gum]
gb|KCW81848.1|  hypothetical protein EUGRSUZ_C03199                     182   6e-50   Eucalyptus grandis [rose gum]
ref|XP_010271909.1|  PREDICTED: sucrose synthase                        181   1e-49   Nelumbo nucifera [Indian lotus]
gb|AII19313.1|  sucrose synthase 1                                      181   1e-49   Ricinus communis
ref|XP_002516210.1|  sucrose synthase, putative                         181   1e-49   
gb|AIJ28959.1|  sucrose synthase                                        181   1e-49   Manihot esculenta subsp. flabellifolia
gb|KHN17754.1|  Sucrose synthase                                        181   1e-49   Glycine soja [wild soybean]
gb|AIJ28961.1|  sucrose synthase                                        181   1e-49   Manihot esculenta [manioc]
ref|XP_003551045.1|  PREDICTED: sucrose synthase-like isoform X1        181   1e-49   
gb|ABD96570.1|  sucrose synthase                                        181   1e-49   Manihot esculenta [manioc]
sp|P31926.1|SUSY_VICFA  RecName: Full=Sucrose synthase; AltName: ...    180   2e-49   Vicia faba [broad bean]
gb|AEN71067.1|  sucrose synthase Sus1                                   180   2e-49   Gossypium tomentosum
gb|AGH29112.1|  sucrose synthase                                        180   3e-49   Jatropha curcas
gb|AAC28107.1|  nodule-enhanced sucrose synthase                        180   3e-49   Pisum sativum [garden pea]
emb|CAA09910.1|  sucrose synthase                                       180   3e-49   Pisum sativum [garden pea]
sp|Q41607.1|SUS2_TULGE  RecName: Full=Sucrose synthase 2; AltName...    180   3e-49   Tulipa gesneriana
ref|XP_004287669.1|  PREDICTED: sucrose synthase                        180   3e-49   Fragaria vesca subsp. vesca
ref|XP_004508033.1|  PREDICTED: sucrose synthase-like isoform X1        180   4e-49   
ref|XP_004508035.1|  PREDICTED: sucrose synthase-like isoform X3        179   4e-49   Cicer arietinum [garbanzo]
gb|AEE60913.1|  nodule-enhanced sucrose synthase                        179   5e-49   Cicer arietinum [garbanzo]
ref|XP_010247458.1|  PREDICTED: sucrose synthase                        179   1e-48   Nelumbo nucifera [Indian lotus]
gb|AGM14948.1|  sucrose synthase 3                                      178   1e-48   Hevea brasiliensis [jebe]
sp|Q01390.1|SUSY_VIGRR  RecName: Full=Sucrose synthase; AltName: ...    178   2e-48   Vigna radiata var. radiata [golden gram]
dbj|BAH56282.1|  sucrose synthase                                       178   2e-48   Vigna angularis [azuki bean]
gb|AGW23638.1|  sucrose synthase                                        178   2e-48   Lilium davidii
ref|XP_010535796.1|  PREDICTED: sucrose synthase 4                      177   4e-48   Tarenaya hassleriana [spider flower]
sp|O65026.1|SUSY_MEDSA  RecName: Full=Sucrose synthase; AltName: ...    177   5e-48   Medicago sativa [alfalfa]
gb|ADW80550.1|  sucrose synthase 1                                      176   5e-48   Populus tomentosa [Chinese white poplar]
gb|ADV71181.1|  sucrose synthase 1                                      176   5e-48   Populus tomentosa [Chinese white poplar]
gb|ADW80541.1|  sucrose synthase 1                                      176   6e-48   Populus tomentosa [Chinese white poplar]
dbj|BAE99649.1|  sucrose synthase like protein                          172   6e-48   Arabidopsis thaliana [mouse-ear cress]
gb|ADW80543.1|  sucrose synthase 1                                      176   6e-48   Populus tomentosa [Chinese white poplar]
gb|ADW80570.1|  sucrose synthase 1                                      176   6e-48   Populus tomentosa [Chinese white poplar]
gb|ADW80539.1|  sucrose synthase 1                                      176   6e-48   Populus tomentosa [Chinese white poplar]
gb|ADW80540.1|  sucrose synthase 1                                      176   6e-48   Populus tomentosa [Chinese white poplar]
gb|ADW80536.1|  sucrose synthase 1                                      176   6e-48   Populus tomentosa [Chinese white poplar]
ref|XP_010937277.1|  PREDICTED: sucrose synthase 2-like                 176   6e-48   Elaeis guineensis
gb|ADW80558.1|  sucrose synthase 1                                      176   6e-48   Populus tomentosa [Chinese white poplar]
gb|ADW80545.1|  sucrose synthase 1                                      176   6e-48   Populus tomentosa [Chinese white poplar]
ref|XP_010939862.1|  PREDICTED: sucrose synthase 1                      176   7e-48   Elaeis guineensis
gb|AGV22112.1|  sucrose synthase 2                                      176   8e-48   Betula luminifera [liang ye hua]
gb|AES92143.2|  sucrose synthase                                        176   8e-48   Medicago truncatula
ref|XP_008783098.1|  PREDICTED: sucrose synthase 1                      176   1e-47   Phoenix dactylifera
ref|XP_003609949.1|  Sucrose synthase                                   176   1e-47   Medicago truncatula
emb|CAB40795.1|  sucrose synthase                                       176   1e-47   Medicago truncatula
gb|ADW80555.1|  sucrose synthase 1                                      176   1e-47   Populus tomentosa [Chinese white poplar]
gb|ADW80549.1|  sucrose synthase 1                                      176   1e-47   Populus tomentosa [Chinese white poplar]
gb|ADW80546.1|  sucrose synthase 1                                      176   1e-47   Populus tomentosa [Chinese white poplar]
gb|ADW80559.1|  sucrose synthase 1                                      176   1e-47   Populus tomentosa [Chinese white poplar]
gb|ADW80563.1|  sucrose synthase 1                                      176   1e-47   Populus tomentosa [Chinese white poplar]
gb|ADW80535.1|  sucrose synthase 1                                      176   1e-47   Populus tomentosa [Chinese white poplar]
gb|ADW80534.1|  sucrose synthase 1                                      176   1e-47   Populus tomentosa [Chinese white poplar]
gb|ADW80562.1|  sucrose synthase 1                                      175   1e-47   Populus tomentosa [Chinese white poplar]
gb|ADW80560.1|  sucrose synthase 1                                      175   1e-47   Populus tomentosa [Chinese white poplar]
gb|ADW80548.1|  sucrose synthase 1                                      175   1e-47   Populus tomentosa [Chinese white poplar]
ref|XP_006838088.1|  hypothetical protein AMTR_s00106p00019920          175   1e-47   Amborella trichopoda
gb|ADW80552.1|  sucrose synthase 1                                      175   2e-47   Populus tomentosa [Chinese white poplar]
gb|ADR81996.1|  sucrose synthase 1                                      175   2e-47   Populus trichocarpa [western balsam poplar]
ref|XP_011010968.1|  PREDICTED: sucrose synthase-like isoform X1        175   2e-47   Populus euphratica
ref|XP_008800466.1|  PREDICTED: sucrose synthase 2                      175   2e-47   Phoenix dactylifera
gb|ADW80551.1|  sucrose synthase 1                                      174   3e-47   Populus tomentosa [Chinese white poplar]
gb|AAN76498.1|AF315375_1  sucrose synthase                              174   3e-47   Phaseolus vulgaris [French bean]
ref|XP_007154543.1|  hypothetical protein PHAVU_003G127500g             174   3e-47   Phaseolus vulgaris [French bean]
gb|AHA41509.1|  sucrose synthase                                        174   6e-47   Populus deltoides
gb|ADW80571.1|  sucrose synthase 1                                      174   7e-47   Populus tomentosa [Chinese white poplar]
gb|ABP88869.1|  sucrose synthase                                        173   7e-47   Medicago falcata [sickle alfalfa]
ref|XP_002324136.2|  sucrose synthase family protein                    173   7e-47   
gb|ADW80566.1|  sucrose synthase 1                                      173   7e-47   Populus tomentosa [Chinese white poplar]
ref|XP_011010969.1|  PREDICTED: sucrose synthase-like isoform X2        173   7e-47   Populus euphratica
ref|XP_002877269.1|  hypothetical protein ARALYDRAFT_484788             173   9e-47   
gb|ABF50715.1|  sucrose synthase                                        173   9e-47   Viscum album subsp. album
gb|AAR03498.1|  sucrose synthase                                        172   1e-46   Populus tremuloides
gb|ACR08725.1|  sucrose synthase                                        163   2e-46   Vigna luteola
gb|AAZ32907.1|  sucrose synthase                                        160   3e-46   Medicago sativa [alfalfa]
ref|XP_009390882.1|  PREDICTED: sucrose synthase 2-like                 172   3e-46   
ref|NP_566865.2|  sucrose synthase 4                                    172   3e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290612.1|  hypothetical protein CARUB_v10016702mg             172   3e-46   Capsella rubella
gb|ADY02961.1|  sucrose synthase                                        171   4e-46   Dendrobium officinale
gb|ADW80556.1|  sucrose synthase 1                                      170   1e-45   Populus tomentosa [Chinese white poplar]
gb|ADW80565.1|  sucrose synthase 1                                      170   1e-45   Populus tomentosa [Chinese white poplar]
gb|ADR81997.1|  sucrose synthase 2                                      170   1e-45   Populus trichocarpa [western balsam poplar]
ref|XP_006381564.1|  sucrose synthase family protein                    170   1e-45   Populus trichocarpa [western balsam poplar]
ref|XP_009390318.1|  PREDICTED: sucrose synthase 2-like                 170   2e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011039917.1|  PREDICTED: sucrose synthase                        169   2e-45   Populus euphratica
gb|ADW80597.1|  sucrose synthase 2                                      169   2e-45   Populus tomentosa [Chinese white poplar]
gb|ADW80579.1|  sucrose synthase 2                                      169   3e-45   Populus tomentosa [Chinese white poplar]
ref|XP_009404100.1|  PREDICTED: sucrose synthase 2                      169   3e-45   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY16569.1|  BnaC09g37040D                                          169   4e-45   Brassica napus [oilseed rape]
gb|ADW80587.1|  sucrose synthase 2                                      169   4e-45   Populus tomentosa [Chinese white poplar]
gb|ADW80586.1|  sucrose synthase 2                                      169   4e-45   Populus tomentosa [Chinese white poplar]
gb|ADW80611.1|  sucrose synthase 2                                      168   5e-45   Populus tomentosa [Chinese white poplar]
gb|AAR19769.1|  sucrose synthase                                        168   5e-45   Beta vulgaris [beet]
gb|ADW80606.1|  sucrose synthase 2                                      168   5e-45   Populus tomentosa [Chinese white poplar]
gb|ADW80589.1|  sucrose synthase 2                                      168   5e-45   Populus tomentosa [Chinese white poplar]
gb|ADW80591.1|  sucrose synthase 2                                      168   5e-45   Populus tomentosa [Chinese white poplar]
gb|ADV71182.1|  sucrose synthase 2                                      168   5e-45   Populus tomentosa [Chinese white poplar]
gb|ADW80593.1|  sucrose synthase 2                                      168   5e-45   Populus tomentosa [Chinese white poplar]
gb|ADW80581.1|  sucrose synthase 2                                      168   5e-45   Populus tomentosa [Chinese white poplar]
gb|ADW80607.1|  sucrose synthase 2                                      168   5e-45   Populus tomentosa [Chinese white poplar]
gb|ADW80574.1|  sucrose synthase 2                                      168   5e-45   Populus tomentosa [Chinese white poplar]
gb|ADW80610.1|  sucrose synthase 2                                      168   5e-45   Populus tomentosa [Chinese white poplar]
gb|ADW80609.1|  sucrose synthase 2                                      168   5e-45   Populus tomentosa [Chinese white poplar]
gb|ADW80595.1|  sucrose synthase 2                                      168   5e-45   Populus tomentosa [Chinese white poplar]
gb|ADW80592.1|  sucrose synthase 2                                      168   5e-45   Populus tomentosa [Chinese white poplar]
gb|ADW80601.1|  sucrose synthase 2                                      168   5e-45   Populus tomentosa [Chinese white poplar]
gb|ADW80599.1|  sucrose synthase 2                                      168   5e-45   Populus tomentosa [Chinese white poplar]
gb|ADW80585.1|  sucrose synthase 2                                      168   5e-45   Populus tomentosa [Chinese white poplar]
emb|CDX92432.1|  BnaA10g14710D                                          168   6e-45   
gb|ADW80577.1|  sucrose synthase 2                                      168   6e-45   Populus tomentosa [Chinese white poplar]
gb|ADW80603.1|  sucrose synthase 2                                      168   6e-45   Populus tomentosa [Chinese white poplar]
gb|ADW80576.1|  sucrose synthase 2                                      168   6e-45   Populus tomentosa [Chinese white poplar]
gb|AEA76429.1|  sucrose synthase 1                                      168   6e-45   Oncidium hybrid cultivar
gb|ADW80584.1|  sucrose synthase 2                                      168   6e-45   Populus tomentosa [Chinese white poplar]
gb|ADW80582.1|  sucrose synthase 2                                      168   6e-45   Populus tomentosa [Chinese white poplar]
gb|ADW80578.1|  sucrose synthase 2                                      168   6e-45   Populus tomentosa [Chinese white poplar]
gb|ADW80588.1|  sucrose synthase 2                                      168   6e-45   Populus tomentosa [Chinese white poplar]
gb|ADW80608.1|  sucrose synthase 2                                      168   6e-45   Populus tomentosa [Chinese white poplar]
ref|XP_006287059.1|  hypothetical protein CARUB_v10000208mg             169   6e-45   
gb|ADW80604.1|  sucrose synthase 2                                      168   6e-45   Populus tomentosa [Chinese white poplar]
gb|ADW80583.1|  sucrose synthase 2                                      168   8e-45   Populus tomentosa [Chinese white poplar]
gb|ADW80602.1|  sucrose synthase 2                                      167   9e-45   Populus tomentosa [Chinese white poplar]
gb|ADW80575.1|  sucrose synthase 2                                      167   1e-44   Populus tomentosa [Chinese white poplar]
ref|XP_009380139.1|  PREDICTED: sucrose synthase 2-like                 167   1e-44   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEO09338.2|  sucrose synthase                                        167   1e-44   Musa acuminata AAA Group [Cavendish banana]
ref|XP_002874016.1|  hypothetical protein ARALYDRAFT_910122             167   1e-44   Arabidopsis lyrata subsp. lyrata
emb|CDX70945.1|  BnaC03g10290D                                          167   2e-44   
ref|XP_009131818.1|  PREDICTED: sucrose synthase 1                      167   2e-44   Brassica rapa
dbj|BAM05645.1|  sucrose synthase 1                                     167   2e-44   Eucalyptus pilularis
gb|AFR41747.1|  sucrose synthase                                        154   2e-44   Populus trichocarpa [western balsam poplar]
gb|ADW80580.1|  sucrose synthase 2                                      166   2e-44   Populus tomentosa [Chinese white poplar]
emb|CAA57881.1|  sucrose synthase                                       166   3e-44   Oxybasis rubra [pigweed]
gb|AFS17277.1|  sucrose synthase 1                                      166   3e-44   Amaranthus cruentus/Amaranthus hypocondriacus mixed library
emb|CAA50317.1|  sucrose synthase                                       166   3e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010687574.1|  PREDICTED: sucrose synthase                        166   4e-44   
gb|ADW80600.1|  sucrose synthase 2                                      166   4e-44   Populus tomentosa [Chinese white poplar]
gb|AAM95943.1|  sucrose synthase                                        166   5e-44   Oncidium hybrid cultivar
gb|AFR41760.1|  sucrose synthase                                        153   5e-44   Populus nigra [black poplar]
gb|ADW80590.1|  sucrose synthase 2                                      166   5e-44   Populus tomentosa [Chinese white poplar]
gb|ABW76422.1|  sucrose synthase                                        166   5e-44   Populus tremuloides
ref|XP_009120766.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...    166   5e-44   Brassica rapa
gb|ADW80605.1|  sucrose synthase 2                                      166   5e-44   Populus tomentosa [Chinese white poplar]
ref|XP_004488146.1|  PREDICTED: sucrose synthase-like isoform X6        165   6e-44   
gb|ADW80598.1|  sucrose synthase 2                                      165   6e-44   Populus tomentosa [Chinese white poplar]
gb|AFR41742.1|  sucrose synthase                                        153   7e-44   Populus trichocarpa [western balsam poplar]
ref|XP_004488141.1|  PREDICTED: sucrose synthase-like isoform X1        165   7e-44   
dbj|BAE06059.1|  sucrose synthase                                       166   8e-44   Potamogeton distinctus
ref|NP_197583.1|  sucrose synthase 1                                    165   9e-44   Arabidopsis thaliana [mouse-ear cress]
gb|KHN47619.1|  Sucrose synthase                                        165   1e-43   Glycine soja [wild soybean]
ref|XP_003533802.1|  PREDICTED: sucrose synthase-like isoform X1        165   1e-43   Glycine max [soybeans]
pdb|3S28|A  Chain A, The Crystal Structure Of Sucrose Synthase-1 ...    165   1e-43   Arabidopsis thaliana [mouse-ear cress]
dbj|BAM05648.1|  sucrose synthase 1                                     164   1e-43   Eucalyptus globulus subsp. globulus
ref|XP_008797380.1|  PREDICTED: sucrose synthase 1-like isoform X2      164   1e-43   Phoenix dactylifera
gb|AFR41759.1|  sucrose synthase                                        152   1e-43   Populus fremontii
gb|AFR41743.1|  sucrose synthase                                        152   2e-43   Populus trichocarpa [western balsam poplar]
ref|XP_009601288.1|  PREDICTED: sucrose synthase 2-like                 162   2e-43   Nicotiana tomentosiformis
pdb|3S27|A  Chain A, The Crystal Structure Of Sucrose Synthase-1 ...    164   2e-43   Arabidopsis thaliana [mouse-ear cress]
gb|AAM95944.1|  sucrose synthase                                        164   2e-43   x Mokara cv. 'Yellow'
gb|AFR41753.1|  sucrose synthase                                        151   3e-43   Populus alba [abele]
gb|AFR41745.1|  sucrose synthase                                        151   3e-43   Populus trichocarpa [western balsam poplar]
gb|EAZ04713.1|  hypothetical protein OsI_26874                          163   4e-43   Oryza sativa Indica Group [Indian rice]
ref|NP_001060278.1|  Os07g0616800                                       163   4e-43   
ref|XP_010420928.1|  PREDICTED: sucrose synthase 1-like                 163   4e-43   
ref|XP_006657957.1|  PREDICTED: sucrose synthase 3-like                 163   5e-43   
gb|AFR41749.1|  sucrose synthase                                        150   5e-43   
gb|AAV64256.2|  sucrose synthase                                        163   6e-43   
ref|XP_003546526.1|  PREDICTED: sucrose synthase-like isoform X1        162   1e-42   
gb|AFW88072.1|  sucrose synthase1                                       160   1e-42   
ref|XP_010917399.1|  PREDICTED: sucrose synthase 1-like                 162   1e-42   
gb|AFR41744.1|  sucrose synthase                                        149   1e-42   
ref|XP_010558842.1|  PREDICTED: sucrose synthase 3-like                 152   1e-42   
gb|AFW88071.1|  sucrose synthase1                                       160   1e-42   
ref|XP_004984086.1|  PREDICTED: sucrose synthase 2-like                 162   1e-42   
ref|XP_002465161.1|  hypothetical protein SORBIDRAFT_01g033060          162   2e-42   
gb|AGI56230.1|  sucrose synthase 1                                      162   2e-42   
gb|AAC41682.1|  sucrose synthase 3                                      161   2e-42   
gb|KHN49081.1|  Sucrose synthase                                        161   2e-42   
ref|XP_009800149.1|  PREDICTED: sucrose synthase 2-like                 161   2e-42   
ref|XP_010051346.1|  PREDICTED: sucrose synthase-like                   161   2e-42   
ref|XP_010493195.1|  PREDICTED: sucrose synthase 1                      161   2e-42   
ref|XP_006400648.1|  hypothetical protein EUTSA_v10012719mg             161   2e-42   
prf||2008300A  sucrose synthase:ISOTYPE=2                               160   3e-42
gb|ACP17902.1|  sucrose synthase                                        160   3e-42   
ref|XP_007138617.1|  hypothetical protein PHAVU_009G223800g             160   3e-42   
gb|AAL50570.1|AF412037_1  sucrose synthase                              160   4e-42   
sp|O49845.1|SUS2_DAUCA  RecName: Full=Sucrose synthase isoform 2;...    160   5e-42   
gb|AAA68209.1|  sus1                                                    160   5e-42   
ref|NP_001105323.1|  sucrose synthase 2                                 160   5e-42   
ref|XP_008797379.1|  PREDICTED: sucrose synthase 1-like isoform X1      160   5e-42   
ref|XP_008659017.1|  PREDICTED: sucrose synthase 2 isoform X1           160   5e-42   
gb|AIS75087.1|  sus1                                                    160   6e-42   
gb|AAQ18911.1|  sucrose synthase                                        150   6e-42   
ref|XP_006650177.1|  PREDICTED: sucrose synthase 1-like isoform X2      159   1e-41   
ref|XP_010454391.1|  PREDICTED: sucrose synthase 1-like isoform X2      159   2e-41   
ref|XP_010454392.1|  PREDICTED: sucrose synthase 1-like isoform X3      159   2e-41   
ref|XP_010454390.1|  PREDICTED: sucrose synthase 1-like isoform X1      159   2e-41   
ref|XP_006650176.1|  PREDICTED: sucrose synthase 1-like isoform X1      159   2e-41   
gb|KEH37657.1|  sucrose synthase                                        159   2e-41   
gb|ABF96469.1|  Sucrose synthase 2, putative, expressed                 156   3e-41   
ref|XP_008783137.1|  PREDICTED: sucrose synthase 1-like isoform X2      158   3e-41   
ref|XP_008783129.1|  PREDICTED: sucrose synthase 1-like isoform X1      158   3e-41   
gb|EMS65561.1|  Sucrose synthase 2                                      158   3e-41   
gb|AIL88516.1|  sucrose synthase type 2-1                               158   4e-41   
ref|NP_001275237.1|  sucrose synthase                                   157   4e-41   
gb|EMT20174.1|  Sucrose synthase 2                                      156   4e-41   
ref|XP_010069893.1|  PREDICTED: sucrose synthase 2                      157   5e-41   
dbj|BAK02964.1|  predicted protein                                      157   5e-41   
gb|AIL88517.1|  sucrose synthase type 2-2                               157   6e-41   
emb|CAC32462.1|  sucrose synthase isoform 3                             157   7e-41   
ref|XP_003562658.1|  PREDICTED: sucrose synthase 2                      157   8e-41   
ref|NP_001050319.1|  Os03g0401300                                       156   1e-40   
ref|XP_004964611.1|  PREDICTED: sucrose synthase 1-like                 156   1e-40   
gb|EMS66266.1|  Sucrose synthase 1                                      156   2e-40   
ref|XP_010088308.1|  Sucrose synthase 2                                 144   2e-40   
gb|AAL50572.2|AF412039_1  sucrose synthase                              155   2e-40   
gb|AAL50571.1|AF412038_1  sucrose synthase                              155   2e-40   
ref|XP_003557752.1|  PREDICTED: sucrose synthase 1                      155   2e-40   
ref|XP_008659019.1|  PREDICTED: sucrose synthase 1 isoform X1           155   3e-40   
gb|AAF85966.1|AF263384_1  sucrose synthase-2                            155   3e-40   
ref|NP_001266691.1|  sucrose synthase 1                                 155   3e-40   
ref|NP_001105411.1|  sucrose synthase 1                                 155   3e-40   
gb|EAY90371.1|  hypothetical protein OsI_11950                          155   4e-40   
gb|ACM69042.1|  sucrose synthase                                        155   4e-40   
gb|AEX98033.1|  sucrose synthase                                        155   4e-40   
ref|XP_004247973.1|  PREDICTED: sucrose synthase 2-like                 155   4e-40   
gb|AGM14950.1|  sucrose synthase 5                                      155   4e-40   
gb|AIO11845.1|  sucrose synthase                                        155   4e-40   
gb|AFW85475.1|  shrunken1 isoform 1                                     155   5e-40   
gb|AAM68126.1|  sucrose synthase                                        154   6e-40   
ref|XP_006655877.1|  PREDICTED: sucrose synthase 2-like                 154   8e-40   
emb|CAA78747.1|  sucrose synthase                                       154   9e-40   
ref|XP_008235123.1|  PREDICTED: sucrose synthase 3                      154   9e-40   
ref|XP_007050987.1|  Sucrose synthase 3 isoform 4                       152   9e-40   
gb|AEX32875.1|  sucrose synthase 2                                      154   9e-40   
dbj|BAJ99820.1|  predicted protein                                      154   1e-39   
gb|ABL74568.1|  sucrose synthase 2                                      154   1e-39   
gb|AGV22111.1|  sucrose synthase 1                                      154   1e-39   
ref|NP_001057047.1|  Os06g0194900                                       154   1e-39   
emb|CAA04543.1|  sucrose synthase type I                                154   1e-39   
ref|XP_010456053.1|  PREDICTED: sucrose synthase 3-like                 153   1e-39   
ref|XP_003564156.1|  PREDICTED: sucrose synthase 1                      153   2e-39   
ref|XP_007050986.1|  Sucrose synthase 3 isoform 3                       152   2e-39   
gb|AHM02468.1|  sucrose synthase                                        152   3e-39   
ref|XP_007050984.1|  Sucrose synthase 3 isoform 1                       152   3e-39   
ref|XP_007050985.1|  Sucrose synthase 3 isoform 2                       152   3e-39   
emb|CAA03935.1|  sucrose synthase type 2                                152   3e-39   
ref|NP_192137.1|  sucrose synthase 3                                    152   4e-39   
ref|XP_002271896.1|  PREDICTED: sucrose synthase 2                      152   5e-39   
tpg|DAA45275.1|  TPA: hypothetical protein ZEAMMB73_631953              142   5e-39   
gb|ACR78192.1|  sucrose synthase                                        142   5e-39   
gb|AAC28175.1|  T2H3.8                                                  152   6e-39   
gb|AEH27530.1|  putative sucrose synthase                               150   6e-39   
gb|EMT33394.1|  Sucrose synthase 1                                      151   8e-39   
sp|P31923.1|SUS2_HORVU  RecName: Full=Sucrose synthase 2; AltName...    151   8e-39   
sp|Q41608.1|SUS1_TULGE  RecName: Full=Sucrose synthase 1; AltName...    151   9e-39   
gb|EMS59092.1|  Sucrose synthase 1                                      151   1e-38   
emb|CAA75793.1|  sucrose synthase 2                                     151   1e-38   
gb|ADW80596.1|  sucrose synthase 2                                      151   1e-38   
ref|XP_010429475.1|  PREDICTED: sucrose synthase 3                      150   1e-38   
ref|XP_010422613.1|  PREDICTED: sucrose synthase 3-like                 150   2e-38   
ref|XP_010556726.1|  PREDICTED: sucrose synthase 3                      150   2e-38   
emb|CAZ64535.1|  sucrose synthase                                       150   2e-38   
sp|P31922.1|SUS1_HORVU  RecName: Full=Sucrose synthase 1; AltName...    150   2e-38   
ref|XP_010932353.1|  PREDICTED: sucrose synthase 1-like isoform X1      150   2e-38   
gb|KCW81856.1|  hypothetical protein EUGRSUZ_C03207                     150   2e-38   
ref|XP_002874924.1|  hypothetical protein ARALYDRAFT_490342             150   2e-38   
gb|AEN71088.1|  sucrose synthase SusA1                                  150   2e-38   
emb|CAB38022.1|  sucrose synthase                                       150   2e-38   
gb|AEN71090.1|  sucrose synthase SusA1                                  150   3e-38   
gb|AEN71096.1|  sucrose synthase SusA1                                  150   3e-38   
gb|AEN71086.1|  sucrose synthase SusA1                                  150   3e-38   
gb|AEN71106.1|  sucrose synthase SusA1                                  150   3e-38   
gb|AEN71104.1|  sucrose synthase SusA1                                  150   3e-38   
gb|AEN71092.1|  sucrose synthase SusA1                                  150   3e-38   
gb|AEV40893.1|  sucrose synthase                                        150   3e-38   
gb|AEN71099.1|  sucrose synthase SusA1                                  150   3e-38   
gb|AEN71083.1|  sucrose synthase SusA1                                  150   3e-38   
gb|AEN71101.1|  sucrose synthase SusA1                                  150   3e-38   
gb|AEN71093.1|  sucrose synthase SusA1                                  150   3e-38   
gb|AEN71085.1|  sucrose synthase SusA1                                  150   3e-38   
gb|AEN71105.1|  sucrose synthase SusA1                                  150   3e-38   
gb|AEN71103.1|  sucrose synthase SusA1                                  150   3e-38   
gb|AEV40895.1|  sucrose synthase                                        150   3e-38   
gb|AEN71087.1|  sucrose synthase SusA1                                  150   3e-38   
gb|AEN71084.1|  sucrose synthase SusA1                                  150   3e-38   
ref|XP_010049329.1|  PREDICTED: sucrose synthase-like                   150   3e-38   
ref|XP_008784779.1|  PREDICTED: sucrose synthase 4-like                 147   3e-38   
gb|AGM14947.1|  sucrose synthase 2                                      149   3e-38   
gb|KJB24379.1|  hypothetical protein B456_004G142700                    149   3e-38   
emb|CDY52781.1|  BnaCnng23260D                                          149   3e-38   
gb|AGQ57013.1|  sucrose synthase 2                                      149   4e-38   
gb|KJB24381.1|  hypothetical protein B456_004G142700                    149   4e-38   
dbj|BAJ88274.1|  predicted protein                                      144   4e-38   
gb|AFO84091.1|  sucrose synthase                                        149   4e-38   
gb|AEV40894.1|  sucrose synthase                                        149   4e-38   
gb|AEN71094.1|  sucrose synthase SusA1                                  149   4e-38   
gb|AEN71091.1|  sucrose synthase SusA1                                  149   4e-38   
gb|AFM52237.1|  putative sucrose synthase 6                             149   5e-38   
gb|EAZ00002.1|  hypothetical protein OsI_22003                          149   5e-38   
gb|AEZ00745.1|  SusA1                                                   149   5e-38   
gb|AEN79501.1|  sucrose synthase 2                                      149   5e-38   
gb|AEN71089.1|  sucrose synthase SusA1                                  149   5e-38   
gb|ADP88918.1|  sucrose synthase                                        149   6e-38   
ref|XP_006287087.1|  hypothetical protein CARUB_v10000249mg             149   6e-38   
gb|AEZ00746.1|  SusA1                                                   149   7e-38   
dbj|BAJ10424.1|  sucrose synthase                                       148   8e-38   
gb|ACR78193.1|  sucrose synthase                                        139   1e-37   
ref|XP_009414138.1|  PREDICTED: sucrose synthase 4-like                 148   1e-37   
gb|KDP28192.1|  hypothetical protein JCGZ_13963                         148   1e-37   
ref|XP_004290813.1|  PREDICTED: sucrose synthase 2                      148   1e-37   
gb|KDO87157.1|  hypothetical protein CISIN_1g003492mg                   147   1e-37   
ref|XP_006396435.1|  hypothetical protein EUTSA_v10028435mg             147   2e-37   
ref|XP_009410254.1|  PREDICTED: sucrose synthase 1-like                 147   2e-37   
gb|KFK30802.1|  hypothetical protein AALP_AA6G027800                    147   2e-37   
gb|ABI81471.1|  sucrose synthase                                        136   2e-37   
ref|XP_009111303.1|  PREDICTED: sucrose synthase 3                      147   2e-37   
ref|XP_006396436.1|  hypothetical protein EUTSA_v10028435mg             147   3e-37   
gb|EMT16287.1|  Sucrose synthase 2                                      143   3e-37   
ref|XP_002523115.1|  sucrose synthase, putative                         147   3e-37   
dbj|BAP47501.1|  sucrose synthase                                       147   3e-37   
gb|KDO87155.1|  hypothetical protein CISIN_1g003492mg                   147   3e-37   
gb|EYU46748.1|  hypothetical protein MIMGU_mgv1a001481mg                147   3e-37   
gb|AEV40896.1|  sucrose synthase                                        146   4e-37   
gb|EPS70967.1|  sucrose synthase                                        142   4e-37   
emb|CDY22042.1|  BnaA09g00710D                                          146   5e-37   
gb|KDO87150.1|  hypothetical protein CISIN_1g003492mg                   146   5e-37   
gb|KDO87154.1|  hypothetical protein CISIN_1g003492mg                   146   6e-37   
gb|KDO87151.1|  hypothetical protein CISIN_1g003492mg                   146   6e-37   
ref|XP_006444402.1|  hypothetical protein CICLE_v10018889mg             146   6e-37   
dbj|BAE79815.1|  sucrose synthase                                       146   6e-37   
dbj|BAA88981.1|  sucrose synthase                                       146   6e-37   
ref|XP_006480003.1|  PREDICTED: sucrose synthase 3-like                 146   6e-37   
dbj|BAA88904.1|  sucrose synthase                                       146   6e-37   
tpg|DAA45276.1|  TPA: hypothetical protein ZEAMMB73_631953              141   8e-37   
gb|AHL29282.1|  sucrose synthase 2                                      145   1e-36   
dbj|BAB20799.1|  sucrose synthase 1                                     145   1e-36   
gb|AAK65960.1|AF273253_1  sucrose synthase                              145   1e-36   
ref|XP_010921619.1|  PREDICTED: sucrose synthase 4                      145   1e-36   
ref|XP_010684343.1|  PREDICTED: sucrose synthase                        145   1e-36   
gb|ABR87939.1|  sucrose synthase 1                                      145   2e-36   
ref|XP_010938368.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...    145   2e-36   
gb|AFP23359.1|  sucrose synthase                                        145   2e-36   
gb|ABF95855.1|  Sucrose synthase 2, putative, expressed                 144   2e-36   
gb|KGN52828.1|  hypothetical protein Csa_4G001950                       145   2e-36   
ref|XP_004494391.1|  PREDICTED: sucrose synthase 2-like isoform X2      144   2e-36   
ref|XP_008789904.1|  PREDICTED: sucrose synthase 4                      144   2e-36   
ref|XP_004494390.1|  PREDICTED: sucrose synthase 2-like isoform X1      144   3e-36   
ref|XP_002271530.1|  PREDICTED: sucrose synthase 2                      144   4e-36   
ref|NP_001280838.1|  sucrose synthase 3                                 144   4e-36   
ref|NP_001268888.1|  sucrose synthase 2-like                            144   4e-36   
ref|XP_008386674.1|  PREDICTED: sucrose synthase 3                      144   4e-36   
gb|KFK36302.1|  hypothetical protein AALP_AA4G104600                    144   4e-36   
ref|XP_010259474.1|  PREDICTED: sucrose synthase 4-like                 144   4e-36   
sp|O24301.1|SUS2_PEA  RecName: Full=Sucrose synthase 2; AltName: ...    144   4e-36   
emb|CAZ65725.1|  sucrose synthase                                       144   4e-36   
ref|XP_004495938.1|  PREDICTED: sucrose synthase 2-like                 144   4e-36   
ref|NP_001050064.1|  Os03g0340500                                       143   6e-36   
gb|AIL88515.1|  sucrose synthase type 3                                 143   7e-36   
ref|XP_008454320.1|  PREDICTED: sucrose synthase 2                      143   9e-36   
ref|XP_003554531.1|  PREDICTED: sucrose synthase 2-like                 142   1e-35   
gb|AIO11846.1|  sucrose synthase                                        142   2e-35   
ref|XP_003521575.1|  PREDICTED: sucrose synthase 2-like                 142   2e-35   
ref|XP_009378749.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...    142   2e-35   
gb|KCW81853.1|  hypothetical protein EUGRSUZ_C03204                     141   2e-35   
gb|KEH24408.1|  sucrose synthase                                        142   2e-35   
ref|XP_003557951.1|  PREDICTED: sucrose synthase 4                      142   2e-35   
gb|AES61743.2|  sucrose synthase                                        141   3e-35   
ref|XP_003591492.1|  Sucrose synthase                                   141   3e-35   
ref|XP_011462741.1|  PREDICTED: sucrose synthase 2                      141   3e-35   
ref|XP_007163137.1|  hypothetical protein PHAVU_001G209600g             141   3e-35   
gb|AFS17278.1|  sucrose synthase 2                                      141   3e-35   
tpg|DAA45281.1|  TPA: putative sucrose synthase family protein          141   4e-35   
ref|XP_008655408.1|  PREDICTED: sucrose synthase 4-like                 141   4e-35   
ref|NP_001105194.1|  sucrose synthase2                                  141   4e-35   
ref|XP_007163138.1|  hypothetical protein PHAVU_001G209600g             140   5e-35   
gb|AJA37527.1|  sucrose synthase                                        140   6e-35   
ref|XP_008245451.1|  PREDICTED: sucrose synthase 2-like                 131   1e-34   
gb|KDO73788.1|  hypothetical protein CISIN_1g003661mg                   140   1e-34   
ref|XP_002465303.1|  hypothetical protein SORBIDRAFT_01g035890          139   1e-34   
ref|XP_008245453.1|  PREDICTED: sucrose synthase 2-like                 131   2e-34   
emb|CAJ32597.1|  sucrose synthase                                       139   2e-34   
emb|CDP17108.1|  unnamed protein product                                139   2e-34   



>gb|ACL00957.1| sucrose synthase [Ipomoea batatas]
Length=727

 Score =   253 bits (645),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 123/125 (98%), Positives = 124/125 (99%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPH+LLAEFEAICKEDQE
Sbjct  1    MAERALTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHELLAEFEAICKEDQE  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE
Sbjct  61   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AAA63685.1| sucrose synthase, partial [Solanum tuberosum]
Length=158

 Score =   224 bits (571),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRVHSLRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D+ 
Sbjct  1    MAERVLTRVHSLRERVDATLAAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKN  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KLN+HAF+++LKSTQEAIVLPPWVALAIRLRPGVWEY+RVNV+AL VEEL+VPEYLQFKE
Sbjct  61   KLNEHAFEELLKSTQEAIVLPPWVALAIRLRPGVWEYIRVNVNALVVEELSVPEYLQFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>dbj|BAP82380.1| sucrose synthase, partial [Orobanche aegyptiaca]
Length=243

 Score =   221 bits (562),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRVHSLRERLDATL AHRNEILLF+S++E+HGKGILKPHQL+AEF+ IC+ D+ 
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRVEAHGKGILKPHQLVAEFKVICQADKA  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL DHAFQ+VLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+AL VEELTV +YL FKE
Sbjct  61   KLQDHAFQEVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALVVEELTVSQYLHFKE  120

Query  539  ELVDG  553
            ELV+G
Sbjct  121  ELVNG  125



>ref|XP_006353766.1| PREDICTED: sucrose synthase 2 isoform X2 [Solanum tuberosum]
Length=805

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED++
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFESIHKEDKD  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KLNDHAF++VLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+AL VEELTVPE+LQFKE
Sbjct  61   KLNDHAFEEVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALIVEELTVPEFLQFKE  120

Query  539  ELVDG  553
            ELV+G
Sbjct  121  ELVNG  125



>ref|XP_010323602.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323603.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323604.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323605.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 gb|ADM47608.1| sucrose synthase isoform 3 [Solanum lycopersicum]
Length=805

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA+RVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED++
Sbjct  1    MAQRVLTRVHSLRERLDATLDAHRNEILLFLSRIESHGKGILKPHQLLAEFESIQKEDKD  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KLNDHAF++VLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+AL+VEELTVPE+LQFKE
Sbjct  61   KLNDHAFEEVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALSVEELTVPEFLQFKE  120

Query  539  ELVDG  553
            ELV+G
Sbjct  121  ELVNG  125



>ref|NP_001274911.1| sucrose synthase 2 [Solanum tuberosum]
 gb|AAO34668.1| sucrose synthase 2 [Solanum tuberosum]
Length=805

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED++
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFESIHKEDKD  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KLNDHAF++VLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+AL VEELTVPE+LQFKE
Sbjct  61   KLNDHAFEEVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALIVEELTVPEFLQFKE  120

Query  539  ELVDG  553
            ELV+G
Sbjct  121  ELVNG  125



>sp|P49039.1|SUS2_SOLTU RecName: Full=Sucrose synthase; AltName: Full=SS65; AltName: 
Full=Sucrose-UDP glucosyltransferase [Solanum tuberosum]
 gb|AAA97572.1| sucrose synthase [Solanum tuberosum]
Length=805

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED++
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFESIHKEDKD  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KLNDHAF++VLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+AL VEELTVPE+LQFKE
Sbjct  61   KLNDHAFEEVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALIVEELTVPEFLQFKE  120

Query  539  ELVDG  553
            ELV+G
Sbjct  121  ELVNG  125



>ref|NP_001234804.1| sucrose synthase [Solanum lycopersicum]
 emb|CAA09593.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA+RVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED++
Sbjct  1    MAQRVLTRVHSLRERLDATLDAHRNEILLFLSRIESHGKGILKPHQLLAEFESIQKEDKD  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KLNDHAF++VLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+AL+VEELTVPE+LQFKE
Sbjct  61   KLNDHAFEEVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALSVEELTVPEFLQFKE  120

Query  539  ELVDG  553
            ELV+G
Sbjct  121  ELVNG  125



>ref|XP_009625446.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
Length=805

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED+ 
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFESIHKEDKN  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KLNDHAF++VLKSTQEAIVL PWVALAIRLRPGVWEYVRVNV+AL VEELTVPEYLQFKE
Sbjct  61   KLNDHAFEEVLKSTQEAIVLSPWVALAIRLRPGVWEYVRVNVNALIVEELTVPEYLQFKE  120

Query  539  ELVDG  553
            ELV+G
Sbjct  121  ELVNG  125



>gb|AHL84158.1| sucrose synthase [Nicotiana tabacum]
Length=805

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED+ 
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFESIHKEDKN  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KLNDHAF++VLKSTQEAIVL PWVALAIRLRPGVWEYVRVNV+AL VEELTVPEYLQFKE
Sbjct  61   KLNDHAFEEVLKSTQEAIVLSPWVALAIRLRPGVWEYVRVNVNALIVEELTVPEYLQFKE  120

Query  539  ELVDG  553
            ELV+G
Sbjct  121  ELVNG  125



>ref|XP_009589756.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
 ref|XP_009589757.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
Length=805

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEF+AI ++D++
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFDAIRQDDKK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KLNDHAF+++LKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+AL VEELTVPEYL FKE
Sbjct  61   KLNDHAFEELLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALVVEELTVPEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_009792656.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
Length=805

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEF++I KED+ 
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFDSIHKEDKN  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KLNDHAF++VLKSTQEAIVL PWVALAIRLRPGVWEYVRVNV+AL VEELTVPEYLQFKE
Sbjct  61   KLNDHAFEEVLKSTQEAIVLSPWVALAIRLRPGVWEYVRVNVNALVVEELTVPEYLQFKE  120

Query  539  ELVDG  553
            ELV+G
Sbjct  121  ELVNG  125



>gb|ABV02029.1| sucrose sythase [Nicotiana langsdorffii x Nicotiana sanderae]
Length=805

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEF+AI ++D++
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFDAIRQDDKK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KLNDHAF+++LKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+ALAVEEL VPEYL FKE
Sbjct  61   KLNDHAFEELLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALAVEELAVPEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_011093886.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093887.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093888.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093889.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093890.1| PREDICTED: sucrose synthase [Sesamum indicum]
Length=805

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IE+HGKGILKPHQL+AEFEAIC  D+E
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIEAHGKGILKPHQLMAEFEAICAADKE  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL DHAF++VLKSTQEAIV PPWVALAIRLRPGVWEYVRVNV+AL VEELTVPEYLQFKE
Sbjct  61   KLQDHAFKEVLKSTQEAIVFPPWVALAIRLRPGVWEYVRVNVNALVVEELTVPEYLQFKE  120

Query  539  ELVDG  553
             LV+G
Sbjct  121  VLVNG  125



>gb|AEN79500.1| sucrose synthase 1 [Orobanche ramosa]
Length=805

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRVHSLRERLDATL AHRNEILLF+S++E+HGKGILKPHQL+AEFEAIC+ D+ 
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRVEAHGKGILKPHQLVAEFEAICQADKA  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL DHAFQ+VLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+AL VEELTVP+YL FKE
Sbjct  61   KLQDHAFQEVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALVVEELTVPQYLHFKE  120

Query  539  ELVDG  553
            ELV+G
Sbjct  121  ELVNG  125



>ref|XP_009760458.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
 ref|XP_009760459.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
Length=805

 Score =   227 bits (578),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEF+AI ++D++
Sbjct  1    MAERALTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFDAIRQDDKK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KLNDHAF+++LKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+AL VEELTVPEYL FKE
Sbjct  61   KLNDHAFEELLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALVVEELTVPEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>emb|CAI56307.1| sucrose synthase [Coffea canephora]
 emb|CDP03035.1| unnamed protein product [Coffea canephora]
Length=806

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRVHSLRERLDATL AHRN++LLFMS++E+HGKGILKPHQLLAEFE I K+ ++
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNDVLLFMSRLETHGKGILKPHQLLAEFEEINKDGKQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            K++DHAF++VLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHAL VEELTVPEYL FKE
Sbjct  61   KIHDHAFEEVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALVVEELTVPEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ABI17891.1| sucrose synthase [Coffea canephora]
Length=806

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRVHSLRERLDATL AHRN++LLFMS++E+HGKGILKPHQLLAEFE I K+ ++
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNDVLLFMSRLETHGKGILKPHQLLAEFEEINKDGKQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            K++DHAF++VLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHAL VEELTVPEYL FKE
Sbjct  61   KIHDHAFEEVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALVVEELTVPEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>emb|CAJ32596.1| sucrose synthase [Coffea arabica]
Length=806

 Score =   225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRVHSLRERLDATL AHRN++LLFMS++E+HGKGILKPHQLLAEFE I K+ ++
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNDVLLFMSRLETHGKGILKPHQLLAEFEEINKDGKQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            K++DHAF++VLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHAL VEELTVPEYL FKE
Sbjct  61   KIHDHAFEEVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALVVEELTVPEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|NP_001275286.1| sucrose synthase [Solanum tuberosum]
 emb|CAD61188.1| sucrose synthase 4 [Solanum tuberosum]
Length=805

 Score =   224 bits (570),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRVHSLRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D+ 
Sbjct  1    MAERVLTRVHSLRERVDATLAAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKN  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KLN+HAF+++LKSTQEAIVLPPWVALAIRLRPGVWEY+RVNV+AL VEEL+VPEYLQFKE
Sbjct  61   KLNEHAFEELLKSTQEAIVLPPWVALAIRLRPGVWEYIRVNVNALVVEELSVPEYLQFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>sp|P10691.1|SUS1_SOLTU RecName: Full=Sucrose synthase; AltName: Full=SS16; AltName: 
Full=Sucrose-UDP glucosyltransferase [Solanum tuberosum]
 gb|AAA33841.1| sucrase synthase (EC 2.4.1.13) [Solanum tuberosum]
Length=805

 Score =   224 bits (570),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRVHSLRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D+ 
Sbjct  1    MAERVLTRVHSLRERVDATLAAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKN  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KLN+HAF+++LKSTQEAIVLPPWVALAIRLRPGVWEY+RVNV+AL VEEL+VPEYLQFKE
Sbjct  61   KLNEHAFEELLKSTQEAIVLPPWVALAIRLRPGVWEYIRVNVNALVVEELSVPEYLQFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_006345244.1| PREDICTED: uncharacterized LOC102577594 [Solanum tuberosum]
Length=805

 Score =   224 bits (570),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRVHSLRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D+ 
Sbjct  1    MAERVLTRVHSLRERVDATLAAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKN  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KLN+HAF+++LKSTQEAIVLPPWVALAIRLRPGVWEY+RVNV+AL VEEL+VPEYLQFKE
Sbjct  61   KLNEHAFEELLKSTQEAIVLPPWVALAIRLRPGVWEYIRVNVNALVVEELSVPEYLQFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AAA97571.1| sucrose synthase [Solanum tuberosum]
Length=805

 Score =   223 bits (569),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRVHSLRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D+ 
Sbjct  1    MAERVLTRVHSLRERVDATLAAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKN  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KLN+HAF+++LKSTQEAIVLPPWVALAIRLRPGVWEY+RVNV+AL VEEL+VPEYLQFKE
Sbjct  61   KLNEHAFEELLKSTQEAIVLPPWVALAIRLRPGVWEYIRVNVNALVVEELSVPEYLQFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>emb|CAA09681.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   222 bits (566),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRVH LRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D++
Sbjct  1    MAERVLTRVHRLRERVDATLAAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKD  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KLN+HAF+++LKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+AL VEEL+VPEYLQFKE
Sbjct  61   KLNEHAFEELLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALVVEELSVPEYLQFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|NP_001234655.1| sucrose synthase [Solanum lycopersicum]
 sp|P49037.1|SUSY_SOLLC RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Solanum lycopersicum]
 gb|AAA34196.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRVH LRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D++
Sbjct  1    MAERVLTRVHRLRERVDATLCAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKD  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KLN+HAF+++LKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+AL VEEL+VPEYLQFKE
Sbjct  61   KLNEHAFEELLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALVVEELSVPEYLQFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_011078145.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078146.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078147.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078148.1| PREDICTED: sucrose synthase [Sesamum indicum]
Length=805

 Score =   221 bits (562),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA+ VLTRVHSLRERLDATL AHRNEILLF+S+IE HGKGILKPHQLL+EFEAIC+ D+E
Sbjct  1    MADPVLTRVHSLRERLDATLAAHRNEILLFLSRIEGHGKGILKPHQLLSEFEAICEADKE  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL DHAF++VLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+AL VEE++V +YLQFKE
Sbjct  61   KLQDHAFKEVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALVVEEVSVSQYLQFKE  120

Query  539  ELVDG  553
            ELV+G
Sbjct  121  ELVNG  125



>gb|EYU25805.1| hypothetical protein MIMGU_mgv1a001207mg [Erythranthe guttata]
Length=866

 Score =   210 bits (535),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 116/128 (91%), Gaps = 1/128 (1%)
 Frame = +2

Query  173  TAMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKED  352
            + M ERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQL+ EFEAI + D
Sbjct  59   STMPERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLVPEFEAIFESD  118

Query  353  QE-KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQ  529
            ++ KL DHAF+Q+LK+TQEAIVLPPWVALAIRLRPGVWEYVRVNV+ L  E+LTV +YLQ
Sbjct  119  KKPKLQDHAFKQLLKTTQEAIVLPPWVALAIRLRPGVWEYVRVNVNTLVFEDLTVQQYLQ  178

Query  530  FKEELVDG  553
            FKEELV+G
Sbjct  179  FKEELVNG  186



>gb|ABD61653.1| sucrose synthase [Cichorium intybus]
Length=806

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 113/125 (90%), Gaps = 1/125 (1%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAE+V TRVHSLRERLD+TL  HRNEIL+ +S+IESHGKGILKPHQL+AEF+AI KED  
Sbjct  1    MAEKVFTRVHSLRERLDSTLATHRNEILMVLSRIESHGKGILKPHQLMAEFDAISKEDN-  59

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL+D AF +VLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+AL VEEL+VPEYL FKE
Sbjct  60   KLHDGAFHEVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALVVEELSVPEYLHFKE  119

Query  539  ELVDG  553
            ELV G
Sbjct  120  ELVSG  124



>gb|AFO84090.1| sucrose synthase [Actinidia chinensis]
Length=806

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA +VLTRVHSLRERLD TL+AHRNEILLF+SKIESHGKGILKPHQ+ AE EA+ KE Q+
Sbjct  1    MAGQVLTRVHSLRERLDGTLSAHRNEILLFLSKIESHGKGILKPHQIEAEIEALSKEVQQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF ++LKS QEAIVLPPW+A A+RLRPGVWEY+RVN++AL VEEL+VPEYLQFKE
Sbjct  61   KLYDGAFGELLKSAQEAIVLPPWIAFAVRLRPGVWEYMRVNLNALVVEELSVPEYLQFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>sp|P49035.1|SUS1_DAUCA RecName: Full=Sucrose synthase isoform 1; AltName: Full=Sucrose 
synthase isoform I; AltName: Full=Sucrose-UDP glucosyltransferase 
1; AltName: Full=Susy*Dc1 [Daucus carota]
 emb|CAA53081.1| sucrose synthase [Daucus carota]
 emb|CAA76056.1| sucrose synthase isoform I [Daucus carota]
Length=808

 Score =   205 bits (521),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            M E VLTRVHSLRER+D+TL  HRNEIL+F+S+IESHGKGILKPHQLLAE+EAI KED+ 
Sbjct  1    MGEPVLTRVHSLRERMDSTLANHRNEILMFLSRIESHGKGILKPHQLLAEYEAISKEDKL  60

Query  359  KLNDH--AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQF  532
            KL+D   AF +V+KSTQEAIV PPWVALAIRLRPGVWEYVRVNVH L VEEL+VP+YLQF
Sbjct  61   KLDDGHGAFAEVIKSTQEAIVSPPWVALAIRLRPGVWEYVRVNVHHLVVEELSVPQYLQF  120

Query  533  KEELVDG  553
            KEELV G
Sbjct  121  KEELVIG  127



>ref|XP_010107074.1| Sucrose synthase [Morus notabilis]
 gb|EXC13595.1| Sucrose synthase [Morus notabilis]
Length=806

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRVHSLRERLD TL+AHRNEIL F+S+IE+ GKG L+PHQL AEFEAI + +++
Sbjct  1    MAERVLTRVHSLRERLDETLSAHRNEILAFLSRIEAKGKGFLQPHQLTAEFEAIPEANRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL +EEL V EYL FKE
Sbjct  61   KLLDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVIEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AHL29281.1| sucrose synthase 1 [Camellia sinensis]
Length=805

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA  VLTRVHSLR+RLD TL+ HRNE+LL +S IE HGKGILKPHQ+ AEFEA+ K  Q+
Sbjct  1    MASHVLTRVHSLRDRLDGTLSTHRNELLLLLSNIEKHGKGILKPHQIEAEFEALPKHAQQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL+D  F +VLKS QEAIVLPPWVALAIRLRPGVWEY+RVN++AL VEEL+VPEYL FKE
Sbjct  61   KLHDGPFGEVLKSAQEAIVLPPWVALAIRLRPGVWEYIRVNINALVVEELSVPEYLHFKE  120

Query  539  ELVDG  553
            ELV+G
Sbjct  121  ELVEG  125



>gb|AAD09568.1| sucrose synthase [Gossypium hirsutum]
Length=454

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHSLRERLD+TLTAHRNEIL  +S+IE  GKGIL  HQ++ EFEAI +E++ 
Sbjct  1    MAERALTRVHSLRERLDSTLTAHRNEILALLSRIEGKGKGILLHHQIILEFEAIPEENER  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF ++LK++QE IVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL+FKE
Sbjct  61   KLADGAFFEILKASQEXIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLRFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_008337809.1| PREDICTED: sucrose synthase [Malus domestica]
 ref|XP_008337810.1| PREDICTED: sucrose synthase [Malus domestica]
 ref|XP_008337811.1| PREDICTED: sucrose synthase [Malus domestica]
Length=807

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRV SLRERLD TL+AHRNEIL  +S+IES GKG L+PHQLLAEFE I + +++
Sbjct  1    MAERVLTRVQSLRERLDETLSAHRNEILALLSRIESKGKGFLQPHQLLAEFEEIPEANRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLK+TQE IVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYLQFKE
Sbjct  61   KLLDGAFGEVLKNTQEVIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVAEYLQFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AEK81522.1| sucrose synthase isoform D [Gossypium hirsutum]
Length=806

 Score =   193 bits (490),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHSLRERLD+TLTAHRNEIL  +S+IE  GKGIL  HQ++ EFEAI +E+++
Sbjct  1    MAERALTRVHSLRERLDSTLTAHRNEILALLSRIEGKGKGILLHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF ++LK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL+FKE
Sbjct  61   KLADGAFFEILKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLRFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AEV40460.1| sucrose synthase 1 [Gossypium arboreum]
 gb|AFM52232.1| putative sucrose synthase 1 [Gossypium arboreum]
Length=806

 Score =   193 bits (490),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHSLRERLD+TLTAHRNEIL  +S+IE  GKGIL  HQ++ EFEAI +E+++
Sbjct  1    MAERALTRVHSLRERLDSTLTAHRNEILALLSRIEGKGKGILLHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF ++LK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL+FKE
Sbjct  61   KLADGAFFEILKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLRFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|KJB82966.1| hypothetical protein B456_013G222400 [Gossypium raimondii]
Length=806

 Score =   192 bits (489),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHSLRERLD+TLTAHRNEIL  +S+IE  GKGIL  HQ++ EFEAI +E+++
Sbjct  1    MAERALTRVHSLRERLDSTLTAHRNEILALLSRIEGKGKGILLHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF ++LK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL+FKE
Sbjct  61   KLADGAFFEILKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLRFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|KJB82967.1| hypothetical protein B456_013G222400 [Gossypium raimondii]
Length=815

 Score =   192 bits (489),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHSLRERLD+TLTAHRNEIL  +S+IE  GKGIL  HQ++ EFEAI +E+++
Sbjct  1    MAERALTRVHSLRERLDSTLTAHRNEILALLSRIEGKGKGILLHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF ++LK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL+FKE
Sbjct  61   KLADGAFFEILKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLRFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_007012546.1| Sucrose synthase 4 isoform 1 [Theobroma cacao]
 gb|EOY30165.1| Sucrose synthase 4 isoform 1 [Theobroma cacao]
Length=852

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 119/155 (77%), Gaps = 6/155 (4%)
 Frame = +2

Query  89   IASFFPFVFSSAIAPFFL*ALS*GS*SLTAMAERVLTRVHSLRERLDATLTAHRNEILLF  268
            +AS  PF F S    F    L      +  MAERV+TRVHSLRERLD TLTAHRNEIL  
Sbjct  23   LASPIPFSFISLNPSFRYFRL------VQRMAERVITRVHSLRERLDETLTAHRNEILAL  76

Query  269  MSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDHAFQQVLKSTQEAIVLPPWVALAIRL  448
            +++IE  GKGIL+ HQ++ EFEAI +E+++KL D AF ++L+++QEAIV PPWVALA+R 
Sbjct  77   LARIEGKGKGILQHHQIILEFEAIPEENRKKLADGAFFEILRASQEAIVFPPWVALAVRP  136

Query  449  RPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            RPGVWEY+RVNVHAL VEELTV EYL FKEELVDG
Sbjct  137  RPGVWEYIRVNVHALVVEELTVAEYLHFKEELVDG  171



>gb|KHG00606.1| Sucrose synthase [Gossypium arboreum]
Length=814

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHSLRERLD+TLTAHRNEIL  +S+IE  GKGIL  HQ++ EFEAI +E+++
Sbjct  9    MAERALTRVHSLRERLDSTLTAHRNEILALLSRIEGKGKGILLHHQIILEFEAIPEENRK  68

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF ++LK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL+FKE
Sbjct  69   KLADGAFFEILKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLRFKE  128

Query  539  ELVDG  553
            ELVDG
Sbjct  129  ELVDG  133



>gb|KDO73787.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
Length=562

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHSLRERLD TL+AHRNEIL  +S+IE  GKGIL+ HQL+AEFE+I +E+++
Sbjct  1    MAERALTRVHSLRERLDETLSAHRNEILALLSRIEGKGKGILQNHQLIAEFESISEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L + AF +VL++TQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61   HLTEGAFGEVLRATQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELLVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_008382924.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRV SLRERLD TL+  RN+ L  +S+IES GKG L+PHQLLAEFEAI + +++
Sbjct  1    MAERVLTRVQSLRERLDETLSTQRNDFLALLSRIESKGKGFLQPHQLLAEFEAIPENNRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLK TQEAIVLPPWVALA+R RPGVWEY+RVNVHALA+EEL V EYLQFKE
Sbjct  61   KLLDGAFGEVLKHTQEAIVLPPWVALAVRPRPGVWEYIRVNVHALALEELCVAEYLQFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_008349074.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRV SLRERLD TL+  RN+ L  +S+IES GKG L+PHQLLAEFEAI + +++
Sbjct  1    MAERVLTRVQSLRERLDETLSTQRNDFLALLSRIESKGKGFLQPHQLLAEFEAIPENNRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLK TQEAIVLPPWVALA+R RPGVWEY+RVNVHALA+EEL V EYLQFKE
Sbjct  61   KLLDGAFGEVLKHTQEAIVLPPWVALAVRPRPGVWEYIRVNVHALALEELCVAEYLQFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>dbj|BAM68526.1| sucrose synthase [Mangifera indica]
 dbj|BAM68529.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHSLRERLD TL AHRNEIL  +S++E+ GKGIL+ HQL+ EFEAI  ++++
Sbjct  1    MAERALTRVHSLRERLDETLYAHRNEILALLSRLEAKGKGILQHHQLILEFEAIPADNRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL+D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61   KLSDGAFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELLVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>dbj|BAM68521.1| sucrose synthase [Mangifera indica]
 dbj|BAM68528.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHSLRERLD TL AHRNEIL  +S++E+ GKGIL+ HQL+ EFEAI  ++++
Sbjct  1    MAERALTRVHSLRERLDETLYAHRNEILALLSRLEAKGKGILQHHQLILEFEAIPADNRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL+D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61   KLSDGAFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELLVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>dbj|BAM68527.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHSLRERLD TL AHRNEIL  +S++E+ GKGIL+ HQL+ EFEAI  ++++
Sbjct  1    MAERALTRVHSLRERLDETLYAHRNEILALLSRLEAKGKGILQHHQLILEFEAIPADNRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL+D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61   KLSDGAFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELLVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>dbj|BAM68520.1| sucrose synthase [Mangifera indica]
 dbj|BAM68522.1| sucrose synthase [Mangifera indica]
 dbj|BAM68523.1| sucrose synthase [Mangifera indica]
 dbj|BAM68524.1| sucrose synthase [Mangifera indica]
 dbj|BAM68525.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHSLRERLD TL AHRNEIL  +S++E+ GKGIL+ HQL+ EFEAI  ++++
Sbjct  1    MAERALTRVHSLRERLDETLYAHRNEILALLSRLEAKGKGILQHHQLILEFEAIPADNRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL+D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61   KLSDGAFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELLVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>dbj|BAM37539.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHSLRERLD TL AHRNEIL  +S++E+ GKGIL+ HQL+ EFEAI  ++++
Sbjct  1    MAERALTRVHSLRERLDETLYAHRNEILALLSRLEAKGKGILQHHQLILEFEAIPADNRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL+D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61   KLSDGAFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELLVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|KDO73786.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
Length=700

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHSLRERLD TL+AHRNEIL  +S+IE  GKGIL+ HQL+AEFE+I +E+++
Sbjct  1    MAERALTRVHSLRERLDETLSAHRNEILALLSRIEGKGKGILQNHQLIAEFESISEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L + AF +VL++TQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61   HLTEGAFGEVLRATQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELLVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>emb|CAN82840.1| hypothetical protein VITISV_024563 [Vitis vinifera]
Length=806

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA+ VLT VHSLR R+D TLTAHRNEIL F+S+IE HGKGIL+PHQLLAEFEA+ + +++
Sbjct  1    MADGVLTGVHSLRARVDETLTAHRNEILSFLSRIEGHGKGILQPHQLLAEFEALPEVNRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL+D  F  +LKS QEAIVLPPW+A A+R RPGVWEY+RVNV AL VEEL VPEYL FKE
Sbjct  61   KLSDGPFGDILKSIQEAIVLPPWIAFAVRPRPGVWEYIRVNVSALVVEELLVPEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_002275155.1| PREDICTED: sucrose synthase [Vitis vinifera]
 ref|XP_010656083.1| PREDICTED: sucrose synthase [Vitis vinifera]
 ref|XP_010656084.1| PREDICTED: sucrose synthase [Vitis vinifera]
 emb|CBI27755.3| unnamed protein product [Vitis vinifera]
Length=806

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA+ VLT VHSLR R+D TLTAHRNEIL F+S+IE HGKGIL+PHQLLAEFEA+ + +++
Sbjct  1    MADGVLTGVHSLRARVDETLTAHRNEILSFLSRIEGHGKGILQPHQLLAEFEALPEVNRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL+D  F  +LKS QEAIVLPPW+A A+R RPGVWEY+RVNV AL VEEL VPEYL FKE
Sbjct  61   KLSDGPFGDILKSIQEAIVLPPWIAFAVRPRPGVWEYIRVNVSALVVEELLVPEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_006474580.1| PREDICTED: sucrose synthase-like isoform X1 [Citrus sinensis]
 ref|XP_006474581.1| PREDICTED: sucrose synthase-like isoform X2 [Citrus sinensis]
 ref|XP_006474582.1| PREDICTED: sucrose synthase-like isoform X3 [Citrus sinensis]
 ref|XP_006474583.1| PREDICTED: sucrose synthase-like isoform X4 [Citrus sinensis]
 ref|XP_006474584.1| PREDICTED: sucrose synthase-like isoform X5 [Citrus sinensis]
 ref|XP_006474585.1| PREDICTED: sucrose synthase-like isoform X6 [Citrus sinensis]
 ref|XP_006474586.1| PREDICTED: sucrose synthase-like isoform X7 [Citrus sinensis]
 ref|XP_006474587.1| PREDICTED: sucrose synthase-like isoform X8 [Citrus sinensis]
 gb|KDO73779.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73780.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73781.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73782.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73783.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73784.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73785.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|AIN45138.1| sucrose synthase [Citrus suavissima]
Length=805

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHSLRERLD TL+AHRNEIL  +S+IE  GKGIL+ HQL+AEFE+I +E+++
Sbjct  1    MAERALTRVHSLRERLDETLSAHRNEILALLSRIEGKGKGILQNHQLIAEFESISEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L + AF +VL++TQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61   HLTEGAFGEVLRATQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELLVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_006452883.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452884.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452885.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452886.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452887.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452888.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452889.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452890.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452891.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66123.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66124.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66125.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66126.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66127.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66128.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66129.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66130.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66131.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
Length=806

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHSLRERLD TL+AHRNEIL  +S+IE  GKGIL+ HQL+AEFE+I +E+++
Sbjct  1    MAERALTRVHSLRERLDETLSAHRNEILALLSRIEGKGKGILQNHQLIAEFESISEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L + AF +VL++TQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61   HLTEGAFGEVLRATQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELLVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>dbj|BAA89049.1| sucrose synthase [Citrus unshiu]
Length=805

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHSLRERLD TL+AHRNEIL  +S+IE  GKGIL+ HQL+AEFE+I +E+++
Sbjct  1    MAERALTRVHSLRERLDETLSAHRNEILALLSRIEGKGKGILQNHQLIAEFESISEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L + AF +VL++TQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61   HLTEGAFGEVLRATQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELLVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_007012547.1| Sucrose synthase 4 isoform 2 [Theobroma cacao]
 gb|EOY30166.1| Sucrose synthase 4 isoform 2 [Theobroma cacao]
Length=806

 Score =   190 bits (482),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERV+TRVHSLRERLD TLTAHRNEIL  +++IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MAERVITRVHSLRERLDETLTAHRNEILALLARIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF ++L+++QEAIV PPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61   KLADGAFFEILRASQEAIVFPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AIJ28960.1| sucrose synthase [Manihot esculenta subsp. flabellifolia]
Length=806

 Score =   190 bits (482),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERV+TRVHS+RERLD TL+AHRNEI+  +S+IE  GKGIL+ HQ++AEFEAI +E+++
Sbjct  1    MAERVITRVHSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHQIIAEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL+S QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61   KLLDGAFGEVLRSAQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AIJ28962.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERV+TRVHS+RERLD TL+AHRNEI+  +S+IE  GKGIL+ HQ++AEFEAI +E+++
Sbjct  1    MAERVITRVHSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHQIIAEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL+S QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61   KLLDGAFGEVLRSAQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_009359754.1| PREDICTED: sucrose synthase [Pyrus x bretschneideri]
Length=837

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRV SLRERLD TL+AHRNEIL  +S+IE  GKG L+PHQLLAEFE I + ++ 
Sbjct  1    MAERVLTRVQSLRERLDETLSAHRNEILALLSRIEKKGKGFLQPHQLLAEFEEIPETNRR  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLK+TQE IVLPPWVALA+R RPGVWEY+RVNVHAL  EEL V EYLQFKE
Sbjct  61   KLLDGAFGEVLKNTQEVIVLPPWVALAVRPRPGVWEYIRVNVHALVFEELRVAEYLQFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>dbj|BAM05649.1| sucrose synthase 3 [Eucalyptus globulus subsp. globulus]
Length=806

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER+LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1    MAERLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL++ AF ++L+S+QEAIVLPPW+ALA+R RPGVWEY+RVN+HAL VEEL V E+L FKE
Sbjct  61   KLSEGAFGEILRSSQEAIVLPPWIALAVRPRPGVWEYIRVNIHALVVEELQVTEFLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>dbj|BAM05652.1| sucrose synthase 3, partial [Eucalyptus globulus subsp. globulus]
Length=795

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER+LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1    MAERLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL++ AF ++L+S+QEAIVLPPW+ALA+R RPGVWEY+RVN+HAL VEEL V E+L FKE
Sbjct  61   KLSEGAFGEILRSSQEAIVLPPWIALAVRPRPGVWEYIRVNIHALVVEELQVTEFLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>dbj|BAM05650.1| sucrose synthase 3, partial [Eucalyptus pilularis]
Length=795

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER+LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1    MAERLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL++ AF ++L+S+QEAIVLPPW+ALA+R RPGVWEY+RVN+HAL +EEL V E+L FKE
Sbjct  61   KLSEGAFGEILRSSQEAIVLPPWIALAVRPRPGVWEYIRVNIHALVIEELQVTEFLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_009343357.1| PREDICTED: sucrose synthase [Pyrus x bretschneideri]
Length=807

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRV SLRERLD TL+  RNEIL  +S+IES GKG L+PHQL AEFEAI + +++
Sbjct  1    MAERVLTRVQSLRERLDQTLSTQRNEILALLSRIESKGKGFLQPHQLHAEFEAIPENNRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLK TQEA+VLPPWVALA+R RPGVWEY+RVNVHAL +EEL V EYLQFKE
Sbjct  61   KLLDGAFGEVLKHTQEAVVLPPWVALAVRPRPGVWEYIRVNVHALTLEELRVAEYLQFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_009348896.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRV SLRERLD TL+  RNEIL  +S+IES GKG L+PHQL AEFEAI + +++
Sbjct  1    MAERVLTRVQSLRERLDETLSTQRNEILALLSRIESKGKGFLQPHQLHAEFEAIPENNRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLK TQEA+VLPPWVALA+R RPGVWEY+RVNVHAL +EEL V EYLQFKE
Sbjct  61   KLLDGAFGEVLKHTQEAVVLPPWVALAVRPRPGVWEYIRVNVHALTLEELRVAEYLQFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AEV40462.1| sucrose synthase 3 [Gossypium arboreum]
 gb|AFM52234.1| putative sucrose synthase 3 [Gossypium arboreum]
 gb|KHG30366.1| Sucrose synthase [Gossypium arboreum]
Length=805

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA+RV+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MADRVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL + AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61   KLANGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADY68844.1| sucrose synthase [Gossypium barbadense]
Length=805

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA+RV+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MADRVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL + AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61   KLANGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|KJB54540.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=562

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADY68848.1| sucrose synthase [Gossypium hirsutum]
Length=805

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA+RV+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MADRVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL + AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61   KLANGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AEN71063.1| sucrose synthase Sus1 [Gossypium mustelinum]
 gb|AEN71065.1| sucrose synthase Sus1 [Gossypium darwinii]
 gb|AEN71069.1| sucrose synthase Sus1 [Gossypium barbadense var. brasiliense]
 gb|AEN71071.1| sucrose synthase Sus1 [Gossypium barbadense var. peruvianum]
 gb|AEN71073.1| sucrose synthase Sus1 [Gossypium hirsutum subsp. latifolium]
Length=805

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA+RV+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MADRVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL + AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61   KLANGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AAD28641.1| sucrose synthase [Gossypium hirsutum]
Length=806

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MAERALTRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL + AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61   KLANGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADY68846.1| sucrose synthase [Gossypium herbaceum subsp. africanum]
Length=805

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA+RV+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MADRVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL + AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61   KLANGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AGQ57012.1| sucrose synthase 1 [Hevea brasiliensis]
Length=806

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERV+TRVHS+RERLD TL+AHRNEI+  +S+IE  GKGIL+ H ++AEFEAI +E+++
Sbjct  1    MAERVITRVHSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHHIIAEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D  F +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61   KLLDSVFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AGM14949.1| sucrose synthase 4 [Hevea brasiliensis]
Length=806

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERV+TRVHS+RERLD TL+AHRNEI+  +S+IE  GKGIL+ H ++AEFEAI +E+++
Sbjct  1    MAERVITRVHSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHHIIAEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D  F +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61   KLLDSVFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AFY03624.1| sucrose synthase, partial [Eucalyptus globulus]
Length=274

 Score =   179 bits (454),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA+R+LTR HSLRERLD TL+A+RN+I+ F+S++E+ GKGIL+ HQ+ AEFEAI +E + 
Sbjct  1    MADRMLTRSHSLRERLDETLSANRNDIVAFLSRVEAKGKGILQRHQIFAEFEAISEESRA  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLKSTQEAIV PPWVALA+R RPGVWE++RVNVHAL +E+L V EYL FKE
Sbjct  61   KLLDGAFGEVLKSTQEAIVSPPWVALAVRPRPGVWEHIRVNVHALVLEQLEVAEYLHFKE  120

Query  539  ELVDG  553
            EL DG
Sbjct  121  ELADG  125



>gb|AEV40463.1| sucrose synthase 4 [Gossypium arboreum]
 gb|AFM52235.1| putative sucrose synthase 4 [Gossypium arboreum]
 gb|KHG06249.1| Sucrose synthase [Gossypium arboreum]
Length=806

 Score =   187 bits (476),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERV+TRVHSLRERLD TL AHRNE+L  +++IE  GKGIL+ HQ++ EFEAI +E ++
Sbjct  1    MAERVITRVHSLRERLDDTLIAHRNEVLALLTRIEGKGKGILQHHQIILEFEAIPEETRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF ++L+++QEAIVLPPWVALA+R RPGVWEY++VNVHAL VEELTV EYL FKE
Sbjct  61   KLADGAFSEILRASQEAIVLPPWVALAVRPRPGVWEYIKVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_008450968.1| PREDICTED: sucrose synthase [Cucumis melo]
 ref|XP_008450969.1| PREDICTED: sucrose synthase [Cucumis melo]
 ref|XP_008450970.1| PREDICTED: sucrose synthase [Cucumis melo]
Length=806

 Score =   187 bits (475),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVL RVHSLRERLD TL A RNEIL  +SKIE+ GKGIL+ H+L+AEFE I +E+++
Sbjct  1    MAERVLNRVHSLRERLDETLIAQRNEILGLLSKIEAKGKGILQHHELIAEFETIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL+STQE+IVLPPWVALA+R RPGVWEY++VNVHAL VEEL V EYL+FKE
Sbjct  61   KLADGAFGEVLRSTQESIVLPPWVALAVRPRPGVWEYIKVNVHALVVEELQVSEYLRFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_008391788.1| PREDICTED: sucrose synthase-like isoform X2 [Malus domestica]
Length=806

 Score =   187 bits (475),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRV SLRERLD TL  HRNEIL  +S+IES GKG L+PHQL AEFEAI + +++
Sbjct  1    MAERALTRVQSLRERLDETLXTHRNEILALLSRIESKGKGFLQPHQLHAEFEAIPENNRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLK TQEA+VLPPWVA A+R RPGVWEY+RVNVHAL +EEL V EYLQFKE
Sbjct  61   KLLDGAFGEVLKHTQEAVVLPPWVAFAVRPRPGVWEYIRVNVHALVLEELRVAEYLQFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_008338289.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   187 bits (475),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRV SLRERLD TL  HRNEIL  +S+IES GKG L+PHQL AEFEAI + +++
Sbjct  1    MAERALTRVQSLRERLDETLXTHRNEILALLSRIESKGKGFLQPHQLHAEFEAIPENNRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLK TQEA+VLPPWVA A+R RPGVWEY+RVNVHAL +EEL V EYLQFKE
Sbjct  61   KLLDGAFGEVLKHTQEAVVLPPWVAFAVRPRPGVWEYIRVNVHALVLEELRVAEYLQFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AEK81520.1| sucrose synthase isoform B [Gossypium hirsutum]
Length=805

 Score =   187 bits (475),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERV+TRVHSLRERLD TL AHRNE+L  +++IE  GKGIL+ HQ++ EFEAI +E ++
Sbjct  1    MAERVITRVHSLRERLDDTLIAHRNEVLALLTRIEGKGKGILQHHQIILEFEAIPEETRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF ++L+++QEAIVLPPWVALA+R RPGVWEY++VNVHAL VEELTV EYL FKE
Sbjct  61   KLADGAFSEILRASQEAIVLPPWVALAVRPRPGVWEYIKVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_010047438.1| PREDICTED: sucrose synthase [Eucalyptus grandis]
 gb|KCW79350.1| hypothetical protein EUGRSUZ_C00769 [Eucalyptus grandis]
Length=805

 Score =   187 bits (475),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER+LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1    MAERLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL++ AF ++L+S+QEAI+LPPW+ALA+R RPGVWEY+RVN+HAL VEEL V E+L FKE
Sbjct  61   KLSEGAFGEILRSSQEAIILPPWIALAVRPRPGVWEYIRVNIHALVVEELQVTEFLHFKE  120

Query  539  ELVDG  553
            ELV+G
Sbjct  121  ELVNG  125



>dbj|BAA88905.1| sucrose synthase [Citrus unshiu]
Length=805

 Score =   187 bits (475),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHSLRERLD TL+AHRNEIL  +S+IE  GKGIL+ HQL+AEFE+I +E+++
Sbjct  1    MAERALTRVHSLRERLDETLSAHRNEILALLSRIEGKGKGILQNHQLIAEFESISEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L + AF +VL++TQEAIVL PWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61   HLTEGAFGEVLRATQEAIVLAPWVALAVRPRPGVWEYIRVNVHALVVEELLVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AEV40464.1| sucrose synthase 5 [Gossypium arboreum]
Length=833

 Score =   187 bits (475),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERV+TRVHSLRERLD TL AHRNE+L  +++IE  GKGIL+ HQ++ EFEAI +E ++
Sbjct  1    MAERVITRVHSLRERLDDTLIAHRNEVLALLTRIEGKGKGILQHHQIILEFEAIPEETRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF ++L+++QEAIVLPPWVALA+R RPGVWEY++VNVHAL VEELTV EYL FKE
Sbjct  61   KLADGAFSEILRASQEAIVLPPWVALAVRPRPGVWEYIKVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_008391777.1| PREDICTED: sucrose synthase-like isoform X1 [Malus domestica]
 ref|XP_008391781.1| PREDICTED: sucrose synthase-like isoform X1 [Malus domestica]
Length=806

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRV SLRERLD TL  HRNEIL  +S+IES GKG L+PHQL AEFEAI + +++
Sbjct  1    MAERALTRVQSLRERLDETLFTHRNEILALLSRIESKGKGFLQPHQLHAEFEAIPENNRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLK TQEA+VLPPWVA A+R RPGVWEY+RVNVHAL +EEL V EYLQFKE
Sbjct  61   KLLDGAFGEVLKHTQEAVVLPPWVAFAVRPRPGVWEYIRVNVHALVLEELRVAEYLQFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_009348897.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRV SLRERLD TL+  RN+ L  +S+IES GKG L+PHQLLAEFEAI + +++
Sbjct  1    MAERVLTRVQSLRERLDETLSTQRNDFLALLSRIESKGKGFLQPHQLLAEFEAIPENNRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLK TQEAIVLPPWVALA+R RPGVWEY+RVNVHALA+EEL V EYLQ KE
Sbjct  61   KLLDGAFGEVLKHTQEAIVLPPWVALAVRPRPGVWEYIRVNVHALALEELCVAEYLQLKE  120

Query  539  ELVD  550
            ELVD
Sbjct  121  ELVD  124



>gb|KJB54542.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=750

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_009343356.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRV SLRERLD TL+  RN+ L  +S+IES GKG L+PHQLLAEFEAI + +++
Sbjct  1    MAERVLTRVQSLRERLDETLSTQRNDFLALLSRIESKGKGFLQPHQLLAEFEAIPENNRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLK TQEAIVLPPWVALA+R RPGVWEY+RVNVHALA+EEL V EYLQ KE
Sbjct  61   KLLDGAFGEVLKHTQEAIVLPPWVALAVRPRPGVWEYIRVNVHALALEELCVAEYLQLKE  120

Query  539  ELVD  550
            ELVD
Sbjct  121  ELVD  124



>gb|AEN71079.1| sucrose synthase Sus1 [Gossypium aridum]
Length=805

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AFY03626.1| sucrose synthase, partial [Eucalyptus globulus]
Length=796

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA R+LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1    MAXRLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL++ AF ++L+S+QEAIVLPPW+ALA+R RPGVWEY+RVN+HAL VEEL V E+L FKE
Sbjct  61   KLSEGAFGEILRSSQEAIVLPPWIALAVRPRPGVWEYIRVNIHALVVEELQVTEFLHFKE  120

Query  539  ELVDG  553
            ELV+G
Sbjct  121  ELVBG  125



>gb|AEN71075.1| sucrose synthase Sus1 [Gossypium armourianum]
 gb|AEN71076.1| sucrose synthase Sus1 [Gossypium harknessii]
Length=805

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AEN71060.1| sucrose synthase Sus1 [Gossypium laxum]
 gb|AEN71081.1| sucrose synthase Sus1 [Gossypium lobatum]
Length=805

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AEN71059.1| sucrose synthase Sus1 [Gossypium thurberi]
 gb|AEN71082.1| sucrose synthase Sus1 [Gossypium trilobum]
Length=805

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AEN71080.1| sucrose synthase Sus1 [Gossypium gossypioides]
Length=805

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>dbj|BAM05651.1| sucrose synthase 3, partial [Eucalyptus pyrocarpa]
Length=795

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAE +LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1    MAESLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL++ AF ++L+S+QEAIVLPPW+ALA+R RPGVWEY+RVN+HAL +EEL V E+L FKE
Sbjct  61   KLSEGAFGEILRSSQEAIVLPPWIALAVRPRPGVWEYIRVNIHALVIEELQVTEFLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AEN71068.1| sucrose synthase Sus1 [Gossypium tomentosum]
Length=805

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AEN71061.1| sucrose synthase Sus1 [Gossypium schwendimanii]
Length=805

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADY68845.1| sucrose synthase [Gossypium barbadense]
 gb|ADY68847.1| sucrose synthase [Gossypium raimondii]
 gb|AEN71062.1| sucrose synthase Sus1 [Gossypium turneri]
 gb|AEN71064.1| sucrose synthase Sus1 [Gossypium mustelinum]
 gb|AEN71070.1| sucrose synthase Sus1 [Gossypium barbadense var. brasiliense]
 gb|AEN71072.1| sucrose synthase Sus1 [Gossypium barbadense var. peruvianum]
 gb|AEN71077.1| sucrose synthase Sus1 [Gossypium davidsonii]
 gb|KJB54536.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
 gb|KJB54537.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
 gb|KJB54538.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=805

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ACV72640.1| sucrose synthase 1 [Gossypium hirsutum]
 gb|ADY68849.1| sucrose synthase [Gossypium hirsutum]
 gb|AEN71074.1| sucrose synthase Sus1 [Gossypium hirsutum subsp. latifolium]
Length=805

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AEN71078.1| sucrose synthase Sus1 [Gossypium klotzschianum]
Length=805

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|KJB54541.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=819

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|KJB54539.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=833

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|NP_001289655.1| sucrose synthase [Eucalyptus grandis]
 gb|ABB53602.1| sucrose synthase [Eucalyptus grandis]
Length=805

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            M ER+LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1    MPERLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL++ AF ++L+S+QEAIVLPPW+ALA+R RPGVWEY+RVN+HAL VEEL V E+L FKE
Sbjct  61   KLSEGAFGEILRSSQEAIVLPPWIALAVRPRPGVWEYIRVNIHALVVEELQVTEFLHFKE  120

Query  539  ELVDG  553
            ELV+G
Sbjct  121  ELVNG  125



>gb|KJB65375.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
Length=750

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERV+TRVHSLR+RLD T  AHRNE+L  +++IE  GKGIL+ HQ + EFEAI +E ++
Sbjct  1    MAERVITRVHSLRDRLDDTFIAHRNEVLALLTRIEGKGKGILQHHQFILEFEAIPEETRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF ++L+++QEAIVLPPWVALA+R RPGVWEY++VNVHAL VEELTV EYL FKE
Sbjct  61   KLADGAFSEILRASQEAIVLPPWVALAVRPRPGVWEYIKVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AEN83999.1| sucrose synthase [Cucumis sativus]
Length=806

 Score =   185 bits (469),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVL R+HSLRERLD TL A RNEIL  +SKIE+ GKGIL+ H+L+AEFE I +E++ 
Sbjct  1    MAERVLNRIHSLRERLDETLIAQRNEILGLLSKIEAKGKGILQHHELIAEFETIPEENRR  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL+STQE+IVLPPWVALA+R RPGVWEY++VNVHAL VEEL   EYL+FKE
Sbjct  61   KLADGAFGEVLRSTQESIVLPPWVALAVRPRPGVWEYIKVNVHALVVEELQASEYLRFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|KJB65372.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
 gb|KJB65373.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
 gb|KJB65374.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
Length=806

 Score =   185 bits (469),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERV+TRVHSLR+RLD T  AHRNE+L  +++IE  GKGIL+ HQ + EFEAI +E ++
Sbjct  1    MAERVITRVHSLRDRLDDTFIAHRNEVLALLTRIEGKGKGILQHHQFILEFEAIPEETRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF ++L+++QEAIVLPPWVALA+R RPGVWEY++VNVHAL VEELTV EYL FKE
Sbjct  61   KLADGAFSEILRASQEAIVLPPWVALAVRPRPGVWEYIKVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_004144053.1| PREDICTED: sucrose synthase-like [Cucumis sativus]
 ref|XP_004159357.1| PREDICTED: sucrose synthase-like [Cucumis sativus]
Length=806

 Score =   185 bits (469),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVL R+HSLRERLD TL A RNEIL  +SKIE+ GKGIL+ H+L+AEFE I +E++ 
Sbjct  1    MAERVLNRIHSLRERLDETLIAQRNEILGLLSKIEAKGKGILQHHELIAEFETIPEENRR  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL+STQE+IVLPPWVALA+R RPGVWEY++VNVHAL VEEL   EYL+FKE
Sbjct  61   KLADGAFGEVLRSTQESIVLPPWVALAVRPRPGVWEYIKVNVHALVVEELQASEYLRFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|KJB65376.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
Length=818

 Score =   185 bits (469),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERV+TRVHSLR+RLD T  AHRNE+L  +++IE  GKGIL+ HQ + EFEAI +E ++
Sbjct  1    MAERVITRVHSLRDRLDDTFIAHRNEVLALLTRIEGKGKGILQHHQFILEFEAIPEETRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF ++L+++QEAIVLPPWVALA+R RPGVWEY++VNVHAL VEELTV EYL FKE
Sbjct  61   KLADGAFSEILRASQEAIVLPPWVALAVRPRPGVWEYIKVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|KGN66333.1| hypothetical protein Csa_1G597800 [Cucumis sativus]
Length=783

 Score =   184 bits (468),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVL R+HSLRERLD TL A RNEIL  +SKIE+ GKGIL+ H+L+AEFE I +E++ 
Sbjct  1    MAERVLNRIHSLRERLDETLIAQRNEILGLLSKIEAKGKGILQHHELIAEFETIPEENRR  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL+STQE+IVLPPWVALA+R RPGVWEY++VNVHAL VEEL   EYL+FKE
Sbjct  61   KLADGAFGEVLRSTQESIVLPPWVALAVRPRPGVWEYIKVNVHALVVEELQASEYLRFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>dbj|BAA89232.1| wsus [Citrullus lanatus]
Length=806

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVL RVHSLRERLD TL A RNEIL  +SKIE+ GKGIL+ HQL+AEFEAI +E+++
Sbjct  1    MAERVLNRVHSLRERLDETLIAQRNEILGLLSKIEAKGKGILQHHQLIAEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D  F +VL++TQE+IVLPPWVALA+R RPGVWEY++VNVHAL VEEL V EYL  KE
Sbjct  61   KLADGDFGEVLRATQESIVLPPWVALAVRPRPGVWEYIKVNVHALVVEELQVAEYLHLKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AEF56625.1| sucrose synthase [Arachis hypogaea var. vulgaris]
Length=806

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MAADRLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL   EYL+FKE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVEELQAAEYLRFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AEN71066.1| sucrose synthase Sus1 [Gossypium darwinii]
Length=805

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA  V+TRVHSLRERLD TL AH NEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHGNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AIL23782.1| sucrose synthase [Prunus serrulata]
Length=806

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA+R LTRVHSLRERLD TL+AHRNEI   +S+I + GKG ++PH+L+AEFEAI + +++
Sbjct  1    MADRALTRVHSLRERLDVTLSAHRNEIAALLSRIINKGKGFMQPHELVAEFEAIPESNRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL  TQE IVLPPWVALA+R RPGVWEY+RVNV AL VEEL VPEYL FKE
Sbjct  61   KLLDGAFGEVLTHTQEVIVLPPWVALAVRPRPGVWEYIRVNVDALVVEELQVPEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_010520519.1| PREDICTED: sucrose synthase 4-like [Tarenaya hassleriana]
Length=807

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERV+TRVHS RERLD TL A RNE+L  +S++E+ GKGIL+ HQ++AEFE++ +E Q+
Sbjct  1    MAERVITRVHSQRERLDETLAAQRNEVLALLSRVEAKGKGILQHHQIIAEFESLPEETQK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL   AF +VL+STQEAIVLPPWVALAIR RPGVWEY+RVN+HAL VEEL V EYL FKE
Sbjct  61   KLEGGAFFEVLRSTQEAIVLPPWVALAIRPRPGVWEYIRVNLHALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>sp|P49034.1|SUSY_ALNGL RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Alnus glutinosa]
 emb|CAA63122.1| sucrose synthase [Alnus glutinosa]
Length=803

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRVHSLRERLD TL A+RNEI+  +S+I   GKGI + HQL+AE EAI +  ++
Sbjct  1    MAERVLTRVHSLRERLDETLVANRNEIVALLSRIIGKGKGICRNHQLIAEVEAIPEATRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL+S QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL VPEYL FKE
Sbjct  61   KLLDGAFGEVLRSAQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVPEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|KDP33978.1| hypothetical protein JCGZ_07549 [Jatropha curcas]
Length=805

 Score =   182 bits (462),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERV+TRVHS+RERLD TL AHRNEI+  +S+IE+ GKGIL+ H ++AEFEAI +E+++
Sbjct  1    MAERVITRVHSIRERLDETLKAHRNEIVALLSRIEAKGKGILQHHHIIAEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L D  F +VL+S QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61   ILLDGVFGEVLRSAQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|NP_001237525.1| sucrose synthase [Glycine max]
 sp|P13708.2|SUSY_SOYBN RecName: Full=Sucrose synthase; AltName: Full=Nodulin-100; Short=N-100; 
AltName: Full=Sucrose-UDP glucosyltransferase [Glycine 
max]
 gb|AAC39323.1| sucrose synthase [Glycine max]
 gb|KHN45052.1| Sucrose synthase [Glycine soja]
Length=805

 Score =   182 bits (462),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MATDRLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL   EYL FKE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVEELQPAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_003609946.1| Sucrose synthase [Medicago truncatula]
Length=893

 Score =   183 bits (464),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 117/152 (77%), Gaps = 0/152 (0%)
 Frame = +2

Query  98   FFPFVFSSAIAPFFL*ALS*GS*SLTAMAERVLTRVHSLRERLDATLTAHRNEILLFMSK  277
            +FPF+   ++ P    A +  S    +MA   LTRVHSL+ERLD TLTA+RNEIL  +S+
Sbjct  62   YFPFIHPFSLHPPLFFAFTLFSFHRFSMATERLTRVHSLKERLDETLTANRNEILALLSR  121

Query  278  IESHGKGILKPHQLLAEFEAICKEDQEKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPG  457
            +E+ GKGIL+ HQ++AEFE I ++ ++KL D AF +VL+STQEAIVLPPWVALA+R RPG
Sbjct  122  LEAKGKGILQHHQVIAEFEEIPEDSRQKLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPG  181

Query  458  VWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            +WEY+RVNVHAL VE L   E+L+FKEELVDG
Sbjct  182  IWEYLRVNVHALVVENLQPAEFLKFKEELVDG  213



>ref|XP_008242292.1| PREDICTED: sucrose synthase [Prunus mume]
 ref|XP_008242293.1| PREDICTED: sucrose synthase [Prunus mume]
Length=806

 Score =   182 bits (462),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRV SLRERLD TL+AHRNEI+  +S+I + GKG ++PH+L+AEFEAI + +++
Sbjct  1    MAERALTRVQSLRERLDVTLSAHRNEIVALLSRIVNKGKGFMQPHELVAEFEAIPESNRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL  TQE IVLPPWVALA+R RPGVWEY+RVNV AL VEEL VPEYL FKE
Sbjct  61   KLLDGAFGEVLTHTQEVIVLPPWVALAVRPRPGVWEYIRVNVDALVVEELQVPEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_007204649.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 ref|XP_007204650.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 gb|EMJ05848.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 gb|EMJ05849.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
Length=806

 Score =   182 bits (462),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRV SLRERLD TL+AHRNEI+  +S+I + GKG ++PH+L+AEFEAI + +++
Sbjct  1    MAERALTRVQSLRERLDVTLSAHRNEIVALLSRIVNKGKGFMQPHELVAEFEAIPESNRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL  TQE IVLPPWVALA+R RPGVWEY+RVNV AL VEEL VPEYL FKE
Sbjct  61   KLLDGAFGEVLTHTQEVIVLPPWVALAVRPRPGVWEYIRVNVDALVVEELQVPEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_010049327.1| PREDICTED: sucrose synthase-like [Eucalyptus grandis]
 ref|XP_010049328.1| PREDICTED: sucrose synthase-like [Eucalyptus grandis]
Length=805

 Score =   182 bits (461),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA+R+LTR HSLRERLD TL+AHRN+I+ F+S++E+ GKGIL+ HQ+ AEFEAI +E + 
Sbjct  1    MADRMLTRSHSLRERLDETLSAHRNDIVAFLSRVEAKGKGILQRHQIFAEFEAISEESRA  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLKSTQEAIV PPWVALA+R RPGVWE++RVNVHAL +E+L V EYL FKE
Sbjct  61   KLLDGAFGEVLKSTQEAIVSPPWVALAVRPRPGVWEHIRVNVHALVLEQLEVAEYLHFKE  120

Query  539  ELVDG  553
            EL DG
Sbjct  121  ELADG  125



>gb|AFI57908.1| sucrose synthase 1 [Prunus persica]
Length=806

 Score =   182 bits (461),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRV SLRERLD TL+AHRNEI+  +S+I + GKG ++PH+L+AEFEAI + +++
Sbjct  1    MAERALTRVQSLRERLDVTLSAHRNEIVALLSRIVNKGKGFMQPHELVAEFEAIPESNRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL  TQE IVLPPWVALA+R RPGVWEY+RVNV AL VEEL VPEYL FKE
Sbjct  61   KLLDGAFGEVLTHTQEVIVLPPWVALAVRPRPGVWEYIRVNVDALVVEELQVPEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|NP_001289661.1| sucrose synthase-like [Eucalyptus grandis]
 gb|ABB53601.1| sucrose synthase [Eucalyptus grandis]
Length=805

 Score =   182 bits (461),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA+R+LTR HSLRERLD TL+AHRN+I+ F+S++E+ GKGIL+ HQ+ AEFEAI +E + 
Sbjct  1    MADRMLTRSHSLRERLDETLSAHRNDIVAFLSRVEAKGKGILQRHQIFAEFEAISEESRA  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLKSTQEAIV PPWVALA+R RPGVWE++RVNVHAL +E+L V EYL FKE
Sbjct  61   KLLDGAFGEVLKSTQEAIVSPPWVALAVRPRPGVWEHIRVNVHALVLEQLEVAEYLHFKE  120

Query  539  ELVDG  553
            EL DG
Sbjct  121  ELADG  125



>gb|KCW81848.1| hypothetical protein EUGRSUZ_C03199 [Eucalyptus grandis]
Length=820

 Score =   182 bits (462),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA+R+LTR HSLRERLD TL+AHRN+I+ F+S++E+ GKGIL+ HQ+ AEFEAI +E + 
Sbjct  1    MADRMLTRSHSLRERLDETLSAHRNDIVAFLSRVEAKGKGILQRHQIFAEFEAISEESRA  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VLKSTQEAIV PPWVALA+R RPGVWE++RVNVHAL +E+L V EYL FKE
Sbjct  61   KLLDGAFGEVLKSTQEAIVSPPWVALAVRPRPGVWEHIRVNVHALVLEQLEVAEYLHFKE  120

Query  539  ELVDG  553
            EL DG
Sbjct  121  ELADG  125



>ref|XP_010271909.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
Length=806

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER L RVHSLRERL  TL+AHRNE+L  +S+IE HGKGIL+PH LL E  AI + D++
Sbjct  1    MAERALARVHSLRERLGETLSAHRNELLHLLSRIEYHGKGILQPHHLLEELGAISEGDRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D  F  V++STQE IVLPPWVALA+R RPGVW+Y+RVNV+ALAVEELTV EYLQFKE
Sbjct  61   KLLDGVFGDVIRSTQEIIVLPPWVALAVRPRPGVWDYIRVNVNALAVEELTVAEYLQFKE  120

Query  539  ELVDG  553
            +LV+G
Sbjct  121  DLVNG  125



>gb|AII19313.1| sucrose synthase 1, partial [Ricinus communis]
Length=805

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERV+TRVHS+RERLD TL A+RNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERVITRVHSIRERLDETLAANRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEDIRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L D  F +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61   NLLDSVFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_002516210.1| sucrose synthase, putative [Ricinus communis]
 gb|EEF46212.1| sucrose synthase, putative [Ricinus communis]
Length=773

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERV+TRVHS+RERLD TL A+RNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERVITRVHSIRERLDETLAANRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEDIRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L D  F +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61   NLLDSVFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AIJ28959.1| sucrose synthase [Manihot esculenta subsp. flabellifolia]
Length=806

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERV+TRV S+RERLD TL+AHRNEI+  +S+IE  GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MAERVITRVQSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHQIIAEFEEIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL +  F +VL+S QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61   KLLESVFGEVLRSAQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|KHN17754.1| Sucrose synthase [Glycine soja]
Length=805

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MATDRLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY++VNVHAL VEEL   EYL FKE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLKVNVHALVVEELQPAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AIJ28961.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERV+TRV S+RERLD TL+AHRNEI+  +S+IE  GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MAERVITRVQSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHQIIAEFEEIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL +  F +VL+S QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61   KLLESVFGEVLRSAQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_003551045.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006600427.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=805

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MATDRLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY++VNVHAL VEEL   EYL FKE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLKVNVHALVVEELQPAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ABD96570.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERV+TRV S+RERLD TL+AHRNEI+  +S+IE  GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MAERVITRVQSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHQIIAEFEEIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL +  F +VL+S QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61   KLLESVFGEVLRSAQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>sp|P31926.1|SUSY_VICFA RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Vicia faba]
 emb|CAA49428.1| sucrose synthase [Vicia faba]
 gb|AAC37346.1| UDP-glucose:D-fructose-2-glucosyltransferase [Vicia faba]
Length=806

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MATERLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VE L   E+L+FKE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVENLQPAEFLKFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AEN71067.1| sucrose synthase Sus1 [Gossypium tomentosum]
Length=805

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA+RV+TRVHSLRERLD TL A RNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MADRVITRVHSLRERLDETLLADRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL + AF +VLK++QEAIVLPP VALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61   KLANGAFFEVLKASQEAIVLPPCVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AGH29112.1| sucrose synthase [Jatropha curcas]
Length=805

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERV+TRVHS+RERLD TL A+RNEI+  +S+IE+ GKGIL+ H ++AEFEAI +E+++
Sbjct  1    MAERVITRVHSIRERLDETLKAYRNEIVALLSRIEAKGKGILQHHHIIAEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L D  F +VL+S QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61   ILLDGVFGEVLRSAQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AAC28107.1| nodule-enhanced sucrose synthase [Pisum sativum]
Length=806

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MATDRLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VE L   E+L+FKE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVENLQPAEFLKFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>emb|CAA09910.1| sucrose synthase [Pisum sativum]
Length=806

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MATDRLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VE L   E+L+FKE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVENLQPAEFLKFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>sp|Q41607.1|SUS2_TULGE RecName: Full=Sucrose synthase 2; AltName: Full=Sucrose-UDP glucosyltransferase 
2 [Tulipa gesneriana]
 emb|CAA65640.1| sucrose-synthase 21 [Tulipa gesneriana]
Length=820

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 103/126 (82%), Gaps = 1/126 (1%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEA-ICKEDQ  355
            MA+R +TRVHS+RERL  TL+AH+NE+L   S+    G+G+L+PHQLL E+EA I   D+
Sbjct  1    MADRAMTRVHSVRERLTDTLSAHKNELLALFSRFVKQGQGMLQPHQLLTEYEAVIPAADR  60

Query  356  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  535
            EKL D  F+ VLK+ QEAIV+PPWVALAIR RPGVWEYVRVNV  LAVEELTVPEYLQFK
Sbjct  61   EKLKDGVFEDVLKAAQEAIVIPPWVALAIRPRPGVWEYVRVNVSELAVEELTVPEYLQFK  120

Query  536  EELVDG  553
            EELVDG
Sbjct  121  EELVDG  126



>ref|XP_004287669.1| PREDICTED: sucrose synthase [Fragaria vesca subsp. vesca]
 ref|XP_011461050.1| PREDICTED: sucrose synthase [Fragaria vesca subsp. vesca]
Length=806

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +2

Query  188  RVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLN  367
            R L R HSLRERLD TL+AHRNEIL F+S+IE+ GKG L+PHQL+ EFEAI +  ++ L 
Sbjct  5    RALNRAHSLRERLDDTLSAHRNEILAFLSRIEAKGKGFLQPHQLIDEFEAIPEASRKNLL  64

Query  368  DHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELV  547
            +  F +VLK+TQEAIVLPPWVALA+R RPGVWEY+RVNVH+L  EEL VPEYL FKEELV
Sbjct  65   ESEFGEVLKNTQEAIVLPPWVALAVRPRPGVWEYIRVNVHSLVAEELLVPEYLHFKEELV  124

Query  548  DG  553
            DG
Sbjct  125  DG  126



>ref|XP_004508033.1| PREDICTED: sucrose synthase-like isoform X1 [Cicer arietinum]
 ref|XP_004508034.1| PREDICTED: sucrose synthase-like isoform X2 [Cicer arietinum]
Length=811

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA   LTRVHSLRER+D TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1    MATDRLTRVHSLRERIDETLTANRNEILALLSRIEAKGKGILQHHQIIAEFEEIPEEPRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL   E+L+FKE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVEELQPAEFLKFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_004508035.1| PREDICTED: sucrose synthase-like isoform X3 [Cicer arietinum]
Length=806

 Score =   179 bits (455),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA   LTRVHSLRER+D TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1    MATDRLTRVHSLRERIDETLTANRNEILALLSRIEAKGKGILQHHQIIAEFEEIPEEPRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL   E+L+FKE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVEELQPAEFLKFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AEE60913.1| nodule-enhanced sucrose synthase [Cicer arietinum]
Length=806

 Score =   179 bits (455),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA   LTRVHSLRER+D TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1    MATDRLTRVHSLRERIDETLTANRNEILALLSRIEAKGKGILQHHQIIAEFEEIPEEPRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL   E+L+FKE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVEELQPAEFLKFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_010247458.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
 ref|XP_010247459.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
 ref|XP_010247460.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
Length=806

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVL RVHSLRERL  TL A RNE+L+ +S+IE HGKGI++PH LL E E I + D++
Sbjct  1    MAERVLARVHSLRERLGETLAAQRNELLILLSRIEGHGKGIMQPHHLLEELEKIPEGDRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D  F  V++STQEAIVLPPWVALA+R RPGVW+Y+RVN++AL VEELT  +YLQFKE
Sbjct  61   KLVDGVFGDVIRSTQEAIVLPPWVALAVRPRPGVWDYIRVNINALVVEELTESQYLQFKE  120

Query  539  ELVDG  553
            ELV+G
Sbjct  121  ELVNG  125



>gb|AGM14948.1| sucrose synthase 3 [Hevea brasiliensis]
Length=810

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERV+TRVHS RERLD TL+AHRNEI+  +S+IE  GKGIL+ H ++AEFEAI +E+++
Sbjct  1    MAERVITRVHSFRERLDETLSAHRNEIVALLSRIEGKGKGILQHHHIIAEFEAIPEENRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D  F +VL+S QEAIVLPP VA A+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61   KLLDSVFGEVLRSAQEAIVLPPCVAFAVRPRPGVWEYIRVNVHALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELV+G
Sbjct  121  ELVNG  125



>sp|Q01390.1|SUSY_VIGRR RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Vigna radiata var. radiata]
 dbj|BAA01108.1| sucrose synthase [Vigna radiata var. radiata]
Length=805

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA   LTRVHSLRERLD TL+A+RNEIL  +S+IE  GKGIL+ HQ++AEFE I +E ++
Sbjct  1    MATDRLTRVHSLRERLDETLSANRNEILALLSRIEGKGKGILQHHQVIAEFEEIPEESRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VE L   EYL+FKE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVEVLQPAEYLRFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>dbj|BAH56282.1| sucrose synthase [Vigna angularis]
Length=805

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA   LTRVHSLRERLD TL+A+RNEIL  +S+IE  GKGIL+ HQ++AEFE I +E ++
Sbjct  1    MATDRLTRVHSLRERLDETLSANRNEILALLSRIEGKGKGILQHHQVIAEFEEIPEESRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VE L   EYL+FKE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVEVLQPAEYLRFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AGW23638.1| sucrose synthase [Lilium davidii]
Length=846

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 104/126 (83%), Gaps = 1/126 (1%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  355
            MA+R LTR H+ R+RL  TL+AH+NE+L   S+    G+G+L+PHQLLAE+EA+  E ++
Sbjct  4    MADRGLTRNHTFRDRLSDTLSAHKNELLALFSRFVKQGQGMLQPHQLLAEYEAVIPEAER  63

Query  356  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  535
            EKL D  F+ VLK+ QEAIV+PPWVALAIR RPGVWEYVRVNV+ LAVEELTVPEYLQFK
Sbjct  64   EKLKDGVFEDVLKAAQEAIVIPPWVALAIRPRPGVWEYVRVNVNELAVEELTVPEYLQFK  123

Query  536  EELVDG  553
            EELVDG
Sbjct  124  EELVDG  129



>ref|XP_010535796.1| PREDICTED: sucrose synthase 4 [Tarenaya hassleriana]
Length=806

 Score =   177 bits (449),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERV+TRVHS RERLD TL+A RNE+L  +S++E+ GKGIL+ HQ++AEFEA+ +E ++
Sbjct  1    MAERVITRVHSQRERLDGTLSAQRNEVLSLLSRVEAKGKGILQHHQIIAEFEALPEETRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL   AF ++L+S+QEAIVLPPWVALAIR RPGVWEY+RVN+HAL VEEL V EYL  KE
Sbjct  61   KLEGSAFFEILRSSQEAIVLPPWVALAIRPRPGVWEYIRVNLHALVVEELLVSEYLHLKE  120

Query  539  ELVDG  553
            ELV+G
Sbjct  121  ELVNG  125



>sp|O65026.1|SUSY_MEDSA RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Medicago sativa]
 gb|AAC17867.1| sucrose synthase [Medicago sativa]
Length=805

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA   LTRVHSL+ERLD TLTA+RNEIL  +S++E+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1    MATERLTRVHSLKERLDETLTANRNEILALLSRLEAKGKGILQHHQVIAEFEEIPEESRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL+STQEAIVLPPWVALA+R RPG+WEY+RVNVHAL VE L   E+L+FKE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGIWEYLRVNVHALVVENLQPAEFLKFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADW80550.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADV71181.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80538.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80557.1| sucrose synthase 1 [Populus tomentosa]
 gb|AFZ78658.1| sucrose synthase [Populus tomentosa]
Length=805

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADW80541.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80542.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80547.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80553.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80554.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80564.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>dbj|BAE99649.1| sucrose synthase like protein [Arabidopsis thaliana]
Length=395

 Score =   172 bits (435),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +2

Query  176  AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  355
            A AERV+TRVHS RERLDATL A +NE+   +S++E+ GKGIL+ HQ++AEFEA+  E Q
Sbjct  2    ANAERVITRVHSQRERLDATLVAQKNEVFALLSRVEAKGKGILQHHQIIAEFEAMPLETQ  61

Query  356  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  535
            +KL   AF + L+S QEAIVLPP+VALA+R RPGVWEYVRVN+H L VEEL   EYLQFK
Sbjct  62   KKLKGGAFFEFLRSAQEAIVLPPFVALAVRPRPGVWEYVRVNLHDLVVEELQASEYLQFK  121

Query  536  EELVDG  553
            EELVDG
Sbjct  122  EELVDG  127



>gb|ADW80543.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADW80570.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADW80539.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80569.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADW80540.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADW80536.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80544.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80561.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80567.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80568.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_010937277.1| PREDICTED: sucrose synthase 2-like [Elaeis guineensis]
Length=816

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 102/126 (81%), Gaps = 1/126 (1%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  355
            MA   L+R+HS+RERL  TL+AH NE++   S+  + GKG+L PHQLLAE+EA+  E D+
Sbjct  1    MATPALSRIHSVRERLGDTLSAHPNELVALFSRFVNQGKGMLLPHQLLAEYEAVIPEVDR  60

Query  356  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  535
            EKL D  F+ VLK+ QEAIVLPPWVALAIR RPGVWEYVRVNV  LAVEELTVPEYLQFK
Sbjct  61   EKLKDGVFEDVLKAAQEAIVLPPWVALAIRPRPGVWEYVRVNVSELAVEELTVPEYLQFK  120

Query  536  EELVDG  553
            EELVDG
Sbjct  121  EELVDG  126



>gb|ADW80558.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADW80545.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_010939862.1| PREDICTED: sucrose synthase 1 [Elaeis guineensis]
Length=815

 Score =   176 bits (447),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 102/126 (81%), Gaps = 1/126 (1%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  355
            MA   L+RVHS+RERL  TL+AH NE++   S+  + GKG+L PHQLLAE+EA+  E D+
Sbjct  1    MASPALSRVHSVRERLGDTLSAHPNELVALFSRFVNQGKGMLLPHQLLAEYEAVIPEADR  60

Query  356  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  535
            EKL D  F+ VLK+ QEAIVLPPWVALAIR RPGVW+YVRVNV  LAVEELTVPEYLQFK
Sbjct  61   EKLKDGVFEDVLKAAQEAIVLPPWVALAIRPRPGVWQYVRVNVSELAVEELTVPEYLQFK  120

Query  536  EELVDG  553
            EELVDG
Sbjct  121  EELVDG  126



>gb|AGV22112.1| sucrose synthase 2 [Betula luminifera]
Length=807

 Score =   176 bits (446),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAERVLTRVHSLRERLD TL A+RNEI+  +S+I   GKGIL+ H L+AE EAI +   +
Sbjct  1    MAERVLTRVHSLRERLDDTLAANRNEIVALLSRIVGKGKGILQHHHLIAEVEAIPEATSK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL + AF +VL+S QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61   KLLEGAFGEVLRSAQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AES92143.2| sucrose synthase [Medicago truncatula]
Length=750

 Score =   176 bits (445),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA   LTRVHSL+ERLD TLTA+RNEIL  +S++E+ GKGIL+ HQ++AEFE I ++ ++
Sbjct  1    MATERLTRVHSLKERLDETLTANRNEILALLSRLEAKGKGILQHHQVIAEFEEIPEDSRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL+STQEAIVLPPWVALA+R RPG+WEY+RVNVHAL VE L   E+L+FKE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGIWEYLRVNVHALVVENLQPAEFLKFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_008783098.1| PREDICTED: sucrose synthase 1 [Phoenix dactylifera]
Length=816

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 102/126 (81%), Gaps = 1/126 (1%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  355
            MA   L+R+HS+RERL  TL+AH NE++   S+  + GKG+L PHQLLAE+EA+  E D+
Sbjct  1    MATPPLSRIHSVRERLGDTLSAHPNELVALFSRFVNQGKGMLLPHQLLAEYEAVIPEGDR  60

Query  356  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  535
            EKL D  F+ VLK+ QEAIVLPPWVALAIR RPGVWEYVRVNV  LAVEELTVPEYLQFK
Sbjct  61   EKLKDGVFEDVLKAAQEAIVLPPWVALAIRPRPGVWEYVRVNVSELAVEELTVPEYLQFK  120

Query  536  EELVDG  553
            EELVDG
Sbjct  121  EELVDG  126



>ref|XP_003609949.1| Sucrose synthase [Medicago truncatula]
 emb|CAB40794.1| sucrose synthase [Medicago truncatula]
 gb|AES92146.1| sucrose synthase [Medicago truncatula]
Length=805

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA   LTRVHSL+ERLD TLTA+RNEIL  +S++E+ GKGIL+ HQ++AEFE I ++ ++
Sbjct  1    MATERLTRVHSLKERLDETLTANRNEILALLSRLEAKGKGILQHHQVIAEFEEIPEDSRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL+STQEAIVLPPWVALA+R RPG+WEY+RVNVHAL VE L   E+L+FKE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGIWEYLRVNVHALVVENLQPAEFLKFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>emb|CAB40795.1| sucrose synthase [Medicago truncatula]
Length=805

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA   LTRVHSL+ERLD TLTA+RNEIL  +S++E+ GKGIL+ HQ++AEFE I ++ ++
Sbjct  1    MATERLTRVHSLKERLDETLTANRNEILALLSRLEAKGKGILQHHQVIAEFEEIPEDSRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL+STQEAIVLPPWVALA+R RPG+WEY+RVNVHAL VE L   E+L+FKE
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGIWEYLRVNVHALVVENLQPAEFLKFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADW80555.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQMVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADW80549.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADW80546.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADW80559.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADW80563.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADW80535.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80537.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADW80534.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADW80562.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADW80560.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADW80548.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_006838088.1| hypothetical protein AMTR_s00106p00019920 [Amborella trichopoda]
 gb|ERN00657.1| hypothetical protein AMTR_s00106p00019920 [Amborella trichopoda]
Length=810

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 104/126 (83%), Gaps = 1/126 (1%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFE-AICKEDQ  355
            MA R LTRV S+RER++ TL+AHRNE++  +S+    GKGIL+PHQLL EFE  I +ED+
Sbjct  1    MATRRLTRVLSMRERVEDTLSAHRNELVCLLSRYVEQGKGILQPHQLLDEFEKVIAEEDR  60

Query  356  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  535
            +KL+   F  VL+STQEAIVLPPWVALA+R RPGVWEYVRVNVH L VE+LTVPEYL+FK
Sbjct  61   QKLSQGLFGDVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVHELVVEQLTVPEYLRFK  120

Query  536  EELVDG  553
            EELVDG
Sbjct  121  EELVDG  126



>gb|ADW80552.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTR+HS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRIHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADR81996.1| sucrose synthase 1 [Populus trichocarpa]
 gb|ADV71183.1| sucrose synthase 1 [Populus trichocarpa]
Length=805

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIEGKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_011010968.1| PREDICTED: sucrose synthase-like isoform X1 [Populus euphratica]
Length=812

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  176  AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  355
            AMAER LTRVHS+RER+D TL AHRNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ +
Sbjct  7    AMAERALTRVHSIRERVDETLKAHRNEIVALLTRIEGKGKGILQHHQIVAEFEAIPEDTR  66

Query  356  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  535
            + L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL  EEL V EYL FK
Sbjct  67   KTLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVAEELRVAEYLHFK  126

Query  536  EELVDG  553
            EELVDG
Sbjct  127  EELVDG  132



>ref|XP_008800466.1| PREDICTED: sucrose synthase 2 [Phoenix dactylifera]
 ref|XP_008800467.1| PREDICTED: sucrose synthase 2 [Phoenix dactylifera]
Length=815

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 102/126 (81%), Gaps = 1/126 (1%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  355
            MA   L+R+HS+RERL  TL+AH NE++   S+  + GKG+L PHQLLAE+EA+  E D+
Sbjct  1    MASPTLSRIHSVRERLGDTLSAHPNELVALFSRFVNQGKGMLLPHQLLAEYEAVIPEADR  60

Query  356  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  535
            EKL D  F+ VLK+ QEAIVLPPWVALAIR RPGVW+YVRVNV  LAVEELTVP+YLQFK
Sbjct  61   EKLKDGVFEDVLKAAQEAIVLPPWVALAIRPRPGVWQYVRVNVSELAVEELTVPQYLQFK  120

Query  536  EELVDG  553
            EELVDG
Sbjct  121  EELVDG  126



>gb|ADW80551.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+S QEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61   TLAGGAFAEVLRSAQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AAN76498.1|AF315375_1 sucrose synthase [Phaseolus vulgaris]
Length=805

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA   LTRVHSLRERLD TL+A+RNEIL  +S+IE+ G GIL+ HQ++AEFE I +E ++
Sbjct  1    MAADRLTRVHSLRERLDETLSANRNEILALLSRIEAKGTGILQHHQVIAEFEEIPEESRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VE L   EYL+FKE
Sbjct  61   KLIDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVEVLQPAEYLRFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_007154543.1| hypothetical protein PHAVU_003G127500g [Phaseolus vulgaris]
 gb|ESW26537.1| hypothetical protein PHAVU_003G127500g [Phaseolus vulgaris]
Length=805

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA   LTRVHSLRERLD TL+A+RNEIL  +S+IE+ G GIL+ HQ++AEFE I +E ++
Sbjct  1    MAADRLTRVHSLRERLDETLSANRNEILALLSRIEAKGTGILQHHQVIAEFEEIPEESRQ  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VE L   EYL+FKE
Sbjct  61   KLIDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVEVLQPAEYLRFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|AHA41509.1| sucrose synthase [Populus deltoides]
Length=805

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            M ER LTRVHS+RER+D TL AHRNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MTERALTRVHSIRERVDETLKAHRNEIVALLTRIEGKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADW80571.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   174 bits (440),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+S QEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61   TLAGGAFAEVLRSAQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ABP88869.1| sucrose synthase [Medicago falcata]
Length=804

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +2

Query  188  RVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLN  367
            R LTRVHSL+ERLD TLTA+RNEIL  +S++E+ GKGIL+ H+++AEFE I +E ++KL 
Sbjct  3    RRLTRVHSLKERLDETLTANRNEILALLSRLEAKGKGILQHHRVIAEFEEIPEESRQKLT  62

Query  368  DHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELV  547
            D AF +VL+STQEAIVLPPWVALA+R RPG+WEY+RVNVHAL VE L   E+L+FKEELV
Sbjct  63   DGAFGEVLRSTQEAIVLPPWVALAVRPRPGIWEYLRVNVHALVVENLQPAEFLKFKEELV  122

Query  548  DG  553
            DG
Sbjct  123  DG  124



>ref|XP_002324136.2| sucrose synthase family protein [Populus trichocarpa]
 gb|EEF02701.2| sucrose synthase family protein [Populus trichocarpa]
Length=805

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            M ER LTRVHS+RER+D TL AHRNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MTERALTRVHSIRERVDETLKAHRNEIVALLTRIEGKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADW80566.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+S QEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61   TLAGGAFAEVLRSAQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_011010969.1| PREDICTED: sucrose synthase-like isoform X2 [Populus euphratica]
Length=805

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIEGKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL  EEL V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVAEELRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_002877269.1| hypothetical protein ARALYDRAFT_484788 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53528.1| hypothetical protein ARALYDRAFT_484788 [Arabidopsis lyrata subsp. 
lyrata]
Length=808

 Score =   173 bits (439),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  176  AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  355
            A AERV+TRVHS RERLDATL A +NE+L  +S++E+ GKGIL+ HQ++AEFEA+  E Q
Sbjct  2    ANAERVITRVHSQRERLDATLIAQKNEVLALLSRVEAKGKGILQYHQIIAEFEAMPLETQ  61

Query  356  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  535
            +KL   AF ++L+S QEAIVLPP+VALA+R RPGVWEYVRVN+H L V+EL   EYLQFK
Sbjct  62   KKLQGGAFFEILRSAQEAIVLPPFVALAVRPRPGVWEYVRVNLHDLVVDELQASEYLQFK  121

Query  536  EELVDG  553
            EELVDG
Sbjct  122  EELVDG  127



>gb|ABF50715.1| sucrose synthase [Viscum album subsp. album]
Length=810

 Score =   173 bits (439),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +2

Query  176  AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  355
             MA+R LTRV+SLRERLD TL  HRNEIL  +S+IE++GKGIL+ H +++E EA+ K D 
Sbjct  22   GMADRALTRVYSLRERLDETLADHRNEILALLSRIENNGKGILQHHHIVSELEALPKADM  81

Query  356  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  535
             KL D AF  V++S QEAIV  PWVALA+R RPGVW+Y+RVNV+ALAVEEL V EYL FK
Sbjct  82   LKLTDGAFGDVIRSAQEAIVFSPWVALAVRPRPGVWDYIRVNVNALAVEELKVAEYLHFK  141

Query  536  EELVDG  553
            EELVDG
Sbjct  142  EELVDG  147



>gb|AAR03498.1| sucrose synthase [Populus tremuloides]
Length=805

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            M ER LTRVHS+RE +D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI +++++
Sbjct  1    MTERALTRVHSIREHVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDNRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ACR08725.1| sucrose synthase, partial [Vigna luteola]
Length=221

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  212  LRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDHAFQQVL  391
            LRERLD TL+A RNEIL  +S+IE  GKGIL+ HQ++AEFE I +E ++KL D AF +VL
Sbjct  1    LRERLDETLSASRNEILALLSRIEGKGKGILQHHQVIAEFEEIPEESRQKLTDGAFGEVL  60

Query  392  KSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            +STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VE L   EYL FKEELVDG
Sbjct  61   RSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVEVLQPAEYLHFKEELVDG  114



>gb|AAZ32907.1| sucrose synthase [Medicago sativa]
Length=153

 Score =   160 bits (406),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTR  SLRER D +LTAHR EIL  +S+IE+ GKGIL+ HQ++AEFE I +E ++KL + 
Sbjct  4    LTRSTSLRERFDGSLTAHRIEILALLSRIEAKGKGILQHHQVIAEFEEIPEEKRQKLVNG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEA+VLPP+VALA+R RPGVWEY+RV+VH+L V+EL   EYL+FKEELV+G
Sbjct  64   AFGEVLRSTQEAVVLPPFVALAVRPRPGVWEYLRVDVHSLVVDELRAAEYLKFKEELVEG  123



>ref|XP_009390882.1| PREDICTED: sucrose synthase 2-like [Musa acuminata subsp. malaccensis]
Length=816

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 102/126 (81%), Gaps = 1/126 (1%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  355
            M++R LTR HS+RER+  +L++H NE++   S+    GKG+L+PHQLLAE+ A+  E D+
Sbjct  1    MSQRTLTRAHSVRERIGDSLSSHPNELVALFSRFVHQGKGMLQPHQLLAEYGAVFSEADR  60

Query  356  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  535
            EKL D AF+ V+++ QEAIV+PPWVALAIR RPGVWEYVRVN+  LAVEELTVPEYLQFK
Sbjct  61   EKLKDGAFEDVIQAAQEAIVIPPWVALAIRPRPGVWEYVRVNISELAVEELTVPEYLQFK  120

Query  536  EELVDG  553
            EEL DG
Sbjct  121  EELADG  126



>ref|NP_566865.2| sucrose synthase 4 [Arabidopsis thaliana]
 sp|Q9LXL5.1|SUS4_ARATH RecName: Full=Sucrose synthase 4; Short=AtSUS4; AltName: Full=Sucrose-UDP 
glucosyltransferase 4 [Arabidopsis thaliana]
 emb|CAB89040.1| sucrose synthase-like protein [Arabidopsis thaliana]
 gb|AEE77773.1| sucrose synthase 4 [Arabidopsis thaliana]
Length=808

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +2

Query  176  AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  355
            A AERV+TRVHS RERLDATL A +NE+   +S++E+ GKGIL+ HQ++AEFEA+  E Q
Sbjct  2    ANAERVITRVHSQRERLDATLVAQKNEVFALLSRVEAKGKGILQHHQIIAEFEAMPLETQ  61

Query  356  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  535
            +KL   AF + L+S QEAIVLPP+VALA+R RPGVWEYVRVN+H L VEEL   EYLQFK
Sbjct  62   KKLKGGAFFEFLRSAQEAIVLPPFVALAVRPRPGVWEYVRVNLHDLVVEELQASEYLQFK  121

Query  536  EELVDG  553
            EELVDG
Sbjct  122  EELVDG  127



>ref|XP_006290612.1| hypothetical protein CARUB_v10016702mg [Capsella rubella]
 gb|EOA23510.1| hypothetical protein CARUB_v10016702mg [Capsella rubella]
Length=807

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +2

Query  176  AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  355
            A AERVLTRVHS RERLD TL AH+NE+L  +S++E+ GKGIL+ HQ++AEFEA+  E Q
Sbjct  2    ANAERVLTRVHSQRERLDETLVAHKNEVLALLSRVEAKGKGILQHHQIIAEFEAMPVEAQ  61

Query  356  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  535
            +KL   AF ++L+STQEAIVLPP VALA+R RPGVWEY+RVNVH L +EEL   EYL FK
Sbjct  62   KKLQGGAFFEILRSTQEAIVLPPLVALAVRPRPGVWEYIRVNVHDLVIEELQASEYLHFK  121

Query  536  EELVDG  553
            E+LV+G
Sbjct  122  EDLVNG  127



>gb|ADY02961.1| sucrose synthase [Dendrobium catenatum]
Length=807

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 99/123 (80%), Gaps = 1/123 (1%)
 Frame = +2

Query  188  RVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQEKL  364
            R LTR+HS+RERL  TL+AH NE+L   S+    GKG+L PHQ+LAE+E++  E D+EKL
Sbjct  5    RTLTRIHSIRERLGDTLSAHTNELLSLFSRFVKQGKGMLLPHQILAEYESVIPEADREKL  64

Query  365  NDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEEL  544
             +  F+ VLK+ QEAIV PPWVALAIR RPGVWEYVRVNV  LAVEELTVPEYLQFKEEL
Sbjct  65   KNGGFEDVLKAAQEAIVTPPWVALAIRPRPGVWEYVRVNVSELAVEELTVPEYLQFKEEL  124

Query  545  VDG  553
            V+G
Sbjct  125  VEG  127



>gb|ADW80556.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PP +ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPRIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADW80565.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
             L   AF +VL+STQEAIV+PP +ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPRIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADR81997.1| sucrose synthase 2 [Populus trichocarpa]
 gb|ADV71184.1| sucrose synthase 2 [Populus trichocarpa]
Length=803

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +2

Query  191  VLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLND  370
            VLTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L  
Sbjct  3    VLTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAG  62

Query  371  HAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVD  550
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVD
Sbjct  63   GAFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVD  122

Query  551  G  553
            G
Sbjct  123  G  123



>ref|XP_006381564.1| sucrose synthase family protein [Populus trichocarpa]
 gb|ERP59361.1| sucrose synthase family protein [Populus trichocarpa]
Length=803

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +2

Query  191  VLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLND  370
            VLTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L  
Sbjct  3    VLTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAG  62

Query  371  HAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVD  550
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVD
Sbjct  63   GAFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVD  122

Query  551  G  553
            G
Sbjct  123  G  123



>ref|XP_009390318.1| PREDICTED: sucrose synthase 2-like [Musa acuminata subsp. malaccensis]
Length=815

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 100/126 (79%), Gaps = 1/126 (1%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  355
            M +R LTR HS+RER+  +L++H NE++   S+    GKG+L+PHQLLAE+ A   E D+
Sbjct  1    MPQRSLTRAHSVRERIGDSLSSHPNELVALFSRFIHQGKGMLQPHQLLAEYAAAFSEADK  60

Query  356  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  535
            EKL D AF+ V+K+ QEAIV+PPWVALAIR RPGVWEYVRVN+  LAVEELTVPEYL FK
Sbjct  61   EKLKDGAFEDVIKAAQEAIVIPPWVALAIRPRPGVWEYVRVNISELAVEELTVPEYLHFK  120

Query  536  EELVDG  553
            EELVDG
Sbjct  121  EELVDG  126



>ref|XP_011039917.1| PREDICTED: sucrose synthase [Populus euphratica]
Length=803

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +2

Query  191  VLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLND  370
            VLTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L  
Sbjct  3    VLTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAG  62

Query  371  HAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVD  550
             AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNV AL VEEL V EYL FKEELVD
Sbjct  63   GAFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYIRVNVQALVVEELRVAEYLHFKEELVD  122

Query  551  G  553
            G
Sbjct  123  G  123



>gb|ADW80597.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ+LAEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQILAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|ADW80579.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKTLAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>ref|XP_009404100.1| PREDICTED: sucrose synthase 2 [Musa acuminata subsp. malaccensis]
 ref|XP_009404101.1| PREDICTED: sucrose synthase 2 [Musa acuminata subsp. malaccensis]
Length=815

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 101/126 (80%), Gaps = 1/126 (1%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  355
            M +R LTR HS+RER+  +L++H NE++   S+  + GKG+L+PHQLLAE+ A   E D+
Sbjct  1    MPQRTLTRAHSVRERIGDSLSSHPNELVALFSRFINQGKGMLQPHQLLAEYAAAFSEADR  60

Query  356  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  535
            EKL D AF+ V+K+ QEAIV+PPWVALAIR RPGVWE+VRVN+  LAVEELTVPEYL FK
Sbjct  61   EKLKDGAFEDVIKAAQEAIVIPPWVALAIRPRPGVWEHVRVNISELAVEELTVPEYLHFK  120

Query  536  EELVDG  553
            EELVDG
Sbjct  121  EELVDG  126



>emb|CDY16569.1| BnaC09g37040D [Brassica napus]
Length=805

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            M   VLTRVHS RERL+ TL A RNE+L  +S++E  GKGIL+ +Q++AEFEA+ +E Q+
Sbjct  1    MVNGVLTRVHSQRERLNETLVAQRNEVLALLSRVEGKGKGILQQNQIIAEFEALPEETQK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            K+   AF  +LK+TQEAIVLPPW+ALA+R RPGVWEY+RVN+HAL VEELT  E+L FKE
Sbjct  61   KIEGGAFFDLLKTTQEAIVLPPWIALAVRPRPGVWEYIRVNLHALVVEELTPAEFLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADW80587.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQRHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|ADW80586.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQRHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|ADW80611.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|AAR19769.1| sucrose synthase [Beta vulgaris]
Length=805

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 101/125 (81%), Gaps = 3/125 (2%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA R LTRV SL+ERLD TLTA RNEI+ F+SKI SHGKGIL+PH++L+EFEA+   D+ 
Sbjct  1    MASR-LTRVPSLKERLDETLTAQRNEIISFLSKIASHGKGILQPHEVLSEFEAVA--DKH  57

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D  F +VL+ TQE IVLPPW+ LA+R RPG+WEY+RVNV ALAVEELT  ++L  KE
Sbjct  58   KLADGPFGEVLRHTQETIVLPPWITLAVRPRPGIWEYIRVNVDALAVEELTPSQFLHVKE  117

Query  539  ELVDG  553
            ELVDG
Sbjct  118  ELVDG  122



>gb|ADW80606.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|ADW80589.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|ADW80591.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|ADV71182.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80572.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80573.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80594.1| sucrose synthase 2 [Populus tomentosa]
 gb|AFZ78659.1| sucrose synthase [Populus tomentosa]
Length=803

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|ADW80593.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|ADW80581.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|ADW80607.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|ADW80574.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|ADW80610.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|ADW80609.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|ADW80595.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|ADW80592.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|ADW80601.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|ADW80599.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|ADW80585.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>emb|CDX92432.1| BnaA10g14710D [Brassica napus]
Length=805

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            M   VLTRVHS RERL  TL A RNE+L  +S++E+ GKGIL+ +Q++AEFEA+ +E Q+
Sbjct  1    MVNGVLTRVHSQRERLSETLVAQRNEVLALLSRVEAKGKGILQQNQIVAEFEALPEETQK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            K+   AF  +LK+TQEAIVLPPWVALA+R RPGVWEY+RVN+HAL VEELT  E+L FKE
Sbjct  61   KIEGGAFFDLLKTTQEAIVLPPWVALAVRPRPGVWEYIRVNLHALVVEELTPAEFLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>gb|ADW80577.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|ADW80603.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|ADW80576.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|AEA76429.1| sucrose synthase 1 [Oncidium hybrid cultivar]
Length=816

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 102/127 (80%), Gaps = 2/127 (2%)
 Frame = +2

Query  179  MAE-RVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-D  352
            MA+ R L+RVHS RERL  TL+AH+NE+L   S+    GK +L PHQ+LAE+E++  E D
Sbjct  1    MADNRFLSRVHSARERLGDTLSAHKNELLALFSRFVKQGKVMLLPHQILAEYESVIPEAD  60

Query  353  QEKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQF  532
            ++KL D  F+ VLK+ QEAIV+PPWVALAIR RPGVWEYVRVNV  LAVEEL+VPEYLQF
Sbjct  61   RQKLKDGVFEDVLKAAQEAIVVPPWVALAIRPRPGVWEYVRVNVSELAVEELSVPEYLQF  120

Query  533  KEELVDG  553
            KEELVDG
Sbjct  121  KEELVDG  127



>gb|ADW80584.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|ADW80582.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVRALVVEELRVAEYLHFKEELVDG  123



>gb|ADW80578.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|ADW80588.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|ADW80608.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>ref|XP_006287059.1| hypothetical protein CARUB_v10000208mg, partial [Capsella rubella]
 gb|EOA19957.1| hypothetical protein CARUB_v10000208mg, partial [Capsella rubella]
Length=850

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  176  AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  355
            A AER++TRVHS RERL+ TL + RNE+L  +S++E+ GKGIL+ +Q++AEFEA+ ++ Q
Sbjct  44   ANAERMITRVHSQRERLNETLVSERNEVLALLSRVEAKGKGILQQNQIIAEFEALPEQTQ  103

Query  356  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  535
            +KL   AF  +LKSTQEAIVLPPWVALA+R RPGVWEY+RVN+HAL VEEL   E+L FK
Sbjct  104  KKLEGGAFFDLLKSTQEAIVLPPWVALAVRPRPGVWEYLRVNLHALVVEELQPSEFLHFK  163

Query  536  EELVDG  553
            EELVDG
Sbjct  164  EELVDG  169



>gb|ADW80604.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|ADW80583.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   168 bits (425),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  ++++E  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRVEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|ADW80602.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   167 bits (424),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E  + L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIGKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>gb|ADW80575.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  G+GIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGRGILQRHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123



>ref|XP_009380139.1| PREDICTED: sucrose synthase 2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009380141.1| PREDICTED: sucrose synthase 2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009380142.1| PREDICTED: sucrose synthase 2-like [Musa acuminata subsp. malaccensis]
Length=816

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 100/125 (80%), Gaps = 1/125 (1%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  355
            M++R LTR HS RER+  +L++H NE++   S+    GKG+L+PHQLLAE+ A+  E D+
Sbjct  1    MSQRTLTRAHSFRERIGDSLSSHPNELVALFSRFIQQGKGMLQPHQLLAEYAAVFSEADK  60

Query  356  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  535
            EKL D AF+ V+K+ QEAIV+PP VALAIR RPGVWEYVRVN+  LAVEELTVPEYLQFK
Sbjct  61   EKLKDGAFEDVIKAAQEAIVIPPRVALAIRPRPGVWEYVRVNISELAVEELTVPEYLQFK  120

Query  536  EELVD  550
            EELVD
Sbjct  121  EELVD  125



>gb|AEO09338.2| sucrose synthase [Musa acuminata AAA Group]
Length=816

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 100/125 (80%), Gaps = 1/125 (1%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  355
            M++R LTR HS RER+  +L++H NE++   S+    GKG+L+PHQLLAE+ A+  E D+
Sbjct  1    MSQRTLTRAHSFRERIGDSLSSHPNELVALFSRFIQQGKGMLQPHQLLAEYAAVFSEADK  60

Query  356  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  535
            EKL D AF+ V+K+ QEAIV+PP VALAIR RPGVWEYVRVN+  LAVEELTVPEYLQFK
Sbjct  61   EKLKDGAFEDVIKAAQEAIVIPPRVALAIRPRPGVWEYVRVNISELAVEELTVPEYLQFK  120

Query  536  EELVD  550
            EELVD
Sbjct  121  EELVD  125



>ref|XP_002874016.1| hypothetical protein ARALYDRAFT_910122 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50275.1| hypothetical protein ARALYDRAFT_910122 [Arabidopsis lyrata subsp. 
lyrata]
Length=808

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +2

Query  176  AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  355
            A AER++TRVHS RERL+ TL + RNE+L  +S++E+ GKGIL+ +Q++AEFEA+ +E Q
Sbjct  2    ANAERMITRVHSQRERLNETLVSERNEVLALLSRVEAKGKGILQQNQIIAEFEALPEETQ  61

Query  356  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  535
            +KL    F  +LKSTQEAIVLPPWVALA+R RPGVWEY+RVN+HAL V+EL   E+L FK
Sbjct  62   KKLEGGPFFDLLKSTQEAIVLPPWVALAVRPRPGVWEYIRVNLHALVVDELQPAEFLHFK  121

Query  536  EELVDG  553
            EELVDG
Sbjct  122  EELVDG  127



>emb|CDX70945.1| BnaC03g10290D [Brassica napus]
Length=806

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            M   VLTRVHS RERL+ TL A RNE+L  +S++E+ GKGIL+ +Q++AEFEA+ +E Q+
Sbjct  1    MVNGVLTRVHSQRERLNETLVAQRNEVLALLSRVEAKGKGILQQNQIIAEFEALPEETQK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            K+   AF  +LK+TQEAIVLPPWVALA+R RPGVWEY+RVN+HAL VEEL   E+L FKE
Sbjct  61   KIEGGAFFDLLKTTQEAIVLPPWVALAVRPRPGVWEYIRVNLHALVVEELQPAEFLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>ref|XP_009131818.1| PREDICTED: sucrose synthase 1 [Brassica rapa]
Length=806

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            M   VLTRVHS RERL+ TL A RNE+L  +S++E+ GKGIL+ +Q++AEFEA+ +E Q+
Sbjct  1    MVNGVLTRVHSQRERLNETLVAQRNEVLALLSRVEAKGKGILQQNQIIAEFEALPEETQK  60

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            K+   AF  +LK+TQEAIVLPPWVALA+R RPGVWEY+RVN+HAL VEEL   E+L FKE
Sbjct  61   KIEGGAFFDLLKTTQEAIVLPPWVALAVRPRPGVWEYIRVNLHALVVEELQPAEFLHFKE  120

Query  539  ELVDG  553
            ELVDG
Sbjct  121  ELVDG  125



>dbj|BAM05645.1| sucrose synthase 1, partial [Eucalyptus pilularis]
 dbj|BAM05646.1| sucrose synthase 1, partial [Eucalyptus pilularis]
 dbj|BAM05647.1| sucrose synthase 1, partial [Eucalyptus pyrocarpa]
Length=786

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +2

Query  209  SLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDHAFQQV  388
            SLRERLD TL+AHRN+I+ F+S++E+ GKGIL+ HQ+ AEFEAI +E + KL D AF +V
Sbjct  1    SLRERLDETLSAHRNDIVAFLSRVEAKGKGILQRHQIFAEFEAISEESRAKLLDGAFGEV  60

Query  389  LKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            LKSTQEAIV PPWVALA+R RPGVWE++RVNVHAL +E+L V EYL FKEEL DG
Sbjct  61   LKSTQEAIVSPPWVALAVRPRPGVWEHIRVNVHALVLEQLEVAEYLHFKEELADG  115



>gb|AFR41747.1| sucrose synthase, partial [Populus trichocarpa]
 gb|AFR41748.1| sucrose synthase, partial [Populus trichocarpa]
Length=113

 Score =   154 bits (390),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  182  AERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEK  361
            AER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++ 
Sbjct  1    AERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRKT  60

Query  362  LNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPE  520
            L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V E
Sbjct  61   LAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAE  113



>gb|ADW80580.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  194  LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  373
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  374  AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  553
            AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELV+G
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVNG  123



>emb|CAA57881.1| sucrose synthase [Oxybasis rubra]
Length=803

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 100/125 (80%), Gaps = 3/125 (2%)
 Frame = +2

Query  179  MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  358
            MA R LTRV SL+ERLD TLTA RNEIL F+S+I SHGKGIL+PH+LL+EFEA+   D+ 
Sbjct  1    MAGR-LTRVPSLKERLDETLTAQRNEILSFLSRIVSHGKGILQPHELLSEFEAVS--DKH  57

Query  359  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  538
            KL D  F +V + TQEAIVLPPW+ LA+R RPGVWEY+RVNV  LAVEELT  ++L  KE
Sbjct  58   KLADGPFGEVFRHTQEAIVLPPWITLAVRPRPGVWEYIRVNVDELAVEELTPSQFLHVKE  117

Query  539  ELVDG  553
            ELVDG
Sbjct  118  ELVDG  122



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 617525281800