BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF009I17

Length=511
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009624654.1|  PREDICTED: AP-3 complex subunit delta              176   1e-47   Nicotiana tomentosiformis
ref|XP_004235755.1|  PREDICTED: AP-3 complex subunit delta              175   4e-47   Solanum lycopersicum
ref|XP_006341581.1|  PREDICTED: AP-3 complex subunit delta-like         171   1e-45   Solanum tuberosum [potatoes]
ref|XP_009763005.1|  PREDICTED: AP-3 complex subunit delta              170   2e-45   Nicotiana sylvestris
ref|XP_011096986.1|  PREDICTED: AP-3 complex subunit delta isofor...    152   4e-39   
gb|EPS62380.1|  hypothetical protein M569_12412                         149   2e-38   Genlisea aurea
gb|EYU19013.1|  hypothetical protein MIMGU_mgv1a018800mg                147   2e-37   Erythranthe guttata [common monkey flower]
emb|CDO98419.1|  unnamed protein product                                144   3e-36   Coffea canephora [robusta coffee]
ref|XP_008459026.1|  PREDICTED: AP-3 complex subunit delta              143   6e-36   Cucumis melo [Oriental melon]
ref|XP_010246461.1|  PREDICTED: AP-3 complex subunit delta              142   1e-35   Nelumbo nucifera [Indian lotus]
ref|XP_004137481.1|  PREDICTED: AP-3 complex subunit delta-like         142   2e-35   Cucumis sativus [cucumbers]
ref|XP_010036902.1|  PREDICTED: AP-3 complex subunit delta              139   2e-34   Eucalyptus grandis [rose gum]
ref|XP_011045833.1|  PREDICTED: AP-3 complex subunit delta-like         138   3e-34   Populus euphratica
ref|XP_002318543.2|  delta-adaptin family protein                       138   4e-34   
ref|XP_003630870.1|  AP-3 complex subunit delta-1                       136   2e-33   Medicago truncatula
ref|XP_011008310.1|  PREDICTED: AP-3 complex subunit delta              135   3e-33   Populus euphratica
ref|XP_002321481.2|  hypothetical protein POPTR_0015s03830g             134   7e-33   
ref|XP_010694398.1|  PREDICTED: AP-3 complex subunit delta              133   2e-32   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP20144.1|  hypothetical protein JCGZ_05913                         132   5e-32   Jatropha curcas
ref|XP_010549108.1|  PREDICTED: AP-3 complex subunit delta              131   8e-32   Tarenaya hassleriana [spider flower]
ref|XP_007160391.1|  hypothetical protein PHAVU_002G317900g             131   9e-32   Phaseolus vulgaris [French bean]
ref|XP_006485818.1|  PREDICTED: AP-3 complex subunit delta-like         130   2e-31   Citrus sinensis [apfelsine]
ref|XP_008240244.1|  PREDICTED: AP-3 complex subunit delta              130   2e-31   Prunus mume [ume]
ref|XP_009347324.1|  PREDICTED: AP-3 complex subunit delta-like         130   3e-31   Pyrus x bretschneideri [bai li]
ref|XP_007210401.1|  hypothetical protein PRUPE_ppa000873mg             129   4e-31   Prunus persica
ref|XP_006584869.1|  PREDICTED: AP-3 complex subunit delta-like i...    129   5e-31   
ref|XP_006442618.1|  hypothetical protein CICLE_v10018705mg             129   7e-31   Citrus clementina [clementine]
gb|KDO45340.1|  hypothetical protein CISIN_1g040316mg                   129   8e-31   Citrus sinensis [apfelsine]
ref|XP_010663612.1|  PREDICTED: AP-3 complex subunit delta isofor...    129   8e-31   Vitis vinifera
ref|XP_004512869.1|  PREDICTED: AP-3 complex subunit delta-like         129   9e-31   Cicer arietinum [garbanzo]
gb|KFK39167.1|  hypothetical protein AALP_AA3G208900                    128   1e-30   Arabis alpina [alpine rockcress]
ref|XP_002524910.1|  conserved hypothetical protein                     128   1e-30   
ref|XP_010465916.1|  PREDICTED: AP-3 complex subunit delta-like         128   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_008393324.1|  PREDICTED: AP-3 complex subunit delta-like         128   1e-30   
ref|XP_008374775.1|  PREDICTED: AP-3 complex subunit delta-like         127   2e-30   Malus domestica [apple tree]
ref|XP_009360139.1|  PREDICTED: AP-3 complex subunit delta-like         127   2e-30   Pyrus x bretschneideri [bai li]
ref|XP_006406623.1|  hypothetical protein EUTSA_v10020046mg             127   2e-30   Eutrema salsugineum [saltwater cress]
ref|XP_010907010.1|  PREDICTED: AP-3 complex subunit delta-like         127   2e-30   Elaeis guineensis
ref|NP_175308.1|  AP-3 complex subunit delta                            125   7e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006580434.1|  PREDICTED: AP-3 complex subunit delta-like         126   7e-30   Glycine max [soybeans]
ref|XP_004300510.1|  PREDICTED: AP-3 complex subunit delta              125   8e-30   Fragaria vesca subsp. vesca
ref|XP_002894132.1|  delta-adaptin                                      125   8e-30   
gb|KHN21597.1|  AP-3 complex subunit delta                              125   8e-30   Glycine soja [wild soybean]
ref|XP_002885247.1|  hypothetical protein ARALYDRAFT_341963             125   9e-30   
emb|CBI15478.3|  unnamed protein product                                125   1e-29   Vitis vinifera
emb|CDY04318.1|  BnaC05g25800D                                          125   1e-29   
ref|XP_006296990.1|  hypothetical protein CARUB_v10012984mg             124   3e-29   Capsella rubella
ref|XP_010094731.1|  AP-3 complex subunit delta                         124   4e-29   Morus notabilis
ref|XP_010500417.1|  PREDICTED: AP-3 complex subunit delta-like         123   4e-29   Camelina sativa [gold-of-pleasure]
emb|CDY24454.1|  BnaC05g35000D                                          123   5e-29   Brassica napus [oilseed rape]
ref|XP_010461702.1|  PREDICTED: AP-3 complex subunit delta-like i...    123   5e-29   Camelina sativa [gold-of-pleasure]
ref|XP_002960406.1|  hypothetical protein SELMODRAFT_867                122   6e-29   
ref|XP_010479304.1|  PREDICTED: AP-3 complex subunit delta              123   7e-29   Camelina sativa [gold-of-pleasure]
ref|XP_006305898.1|  hypothetical protein CARUB_v10011071mg             123   7e-29   Capsella rubella
ref|XP_002967314.1|  hypothetical protein SELMODRAFT_87265              123   7e-29   Selaginella moellendorffii
emb|CDY68338.1|  BnaAnng26940D                                          122   9e-29   Brassica napus [oilseed rape]
ref|XP_009145908.1|  PREDICTED: AP-3 complex subunit delta-like         122   9e-29   
emb|CDX92225.1|  BnaA05g21820D                                          122   1e-28   
ref|XP_009144999.1|  PREDICTED: LOW QUALITY PROTEIN: AP-3 complex...    122   2e-28   
ref|XP_010506684.1|  PREDICTED: AP-3 complex subunit delta-like         122   2e-28   
ref|XP_010922047.1|  PREDICTED: LOW QUALITY PROTEIN: AP-3 complex...    121   3e-28   
gb|KJB52992.1|  hypothetical protein B456_008G287400                    120   4e-28   Gossypium raimondii
gb|KJB52993.1|  hypothetical protein B456_008G287400                    120   6e-28   Gossypium raimondii
ref|XP_006842352.1|  hypothetical protein AMTR_s00079p00176010          116   1e-26   Amborella trichopoda
ref|XP_001777950.1|  predicted protein                                  113   8e-26   
ref|XP_008797681.1|  PREDICTED: LOW QUALITY PROTEIN: AP-3 complex...    114   9e-26   
ref|XP_009396369.1|  PREDICTED: AP-3 complex subunit delta-like         112   5e-25   
gb|KFK26686.1|  hypothetical protein AALP_AA8G280000                    107   1e-23   Arabis alpina [alpine rockcress]
ref|XP_004968829.1|  PREDICTED: AP-3 complex subunit delta-like         107   2e-23   Setaria italica
ref|XP_007036565.1|  Delta-adaptin                                      105   1e-22   
ref|XP_009395567.1|  PREDICTED: AP-3 complex subunit delta-like         103   5e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|ESA02637.1|  hypothetical protein GLOINDRAFT_337273                99.8    1e-20   
ref|XP_008879710.1|  hypothetical protein H310_13840                  99.4    1e-20   Aphanomyces invadans
gb|EXX63225.1|  Apl5p                                                 99.4    2e-20   Rhizophagus irregularis DAOM 197198w
ref|NP_001146284.1|  uncharacterized protein LOC100279859             97.1    9e-20   
ref|XP_008672722.1|  PREDICTED: uncharacterized protein LOC100279...  97.1    9e-20   
gb|KIY72913.1|  Adaptor protein complex AP-3 delta subunit            97.1    9e-20   Cylindrobasidium torrendii FP15055 ss-10
ref|XP_009840021.1|  hypothetical protein H257_14009                  96.7    1e-19   Aphanomyces astaci
ref|XP_002676406.1|  predicted protein                                94.7    2e-19   Naegleria gruberi strain NEG-M
ref|XP_008032162.1|  Ap3d1 protein                                    95.9    2e-19   Trametes versicolor FP-101664 SS1
ref|XP_009530641.1|  hypothetical protein PHYSODRAFT_346958           94.7    6e-19   Phytophthora sojae
ref|XP_003084451.1|  AP3D1 protein (ISS)                              94.7    6e-19   
emb|CDO73429.1|  hypothetical protein BN946_scf185013.g63             94.4    6e-19   Trametes cinnabarina
gb|KDQ31388.1|  hypothetical protein PLEOSDRAFT_1075478               94.0    8e-19   Pleurotus ostreatus PC15
emb|CEG00870.1|  Clathrin/coatomer adaptor,adaptin-like,N-terminal    94.4    8e-19   Ostreococcus tauri
ref|XP_007325694.1|  hypothetical protein AGABI1DRAFT_117402          94.0    9e-19   Agaricus bisporus var. burnettii JB137-S8
ref|XP_006454290.1|  hypothetical protein AGABI2DRAFT_197206          94.0    1e-18   Agaricus bisporus var. bisporus H97
gb|EPB87573.1|  hypothetical protein HMPREF1544_05664                 93.6    1e-18   Mucor circinelloides f. circinelloides 1006PhL
emb|CEP17621.1|  hypothetical protein                                 94.0    1e-18   Parasitella parasitica
ref|XP_008662607.1|  PREDICTED: AP-3 complex subunit delta-like       93.2    2e-18   Zea mays [maize]
ref|XP_008908689.1|  hypothetical protein PPTG_13960                  93.2    2e-18   Phytophthora parasitica INRA-310
gb|EEE54678.1|  hypothetical protein OsJ_01979                        93.2    2e-18   Oryza sativa Japonica Group [Japonica rice]
gb|ETO71144.1|  hypothetical protein F444_12465                       93.2    2e-18   Phytophthora parasitica P1976
gb|ETI42551.1|  hypothetical protein F443_12365                       93.2    2e-18   Phytophthora parasitica P1569
gb|ETM42450.1|  hypothetical protein L914_11924                       93.2    2e-18   Phytophthora parasitica
gb|ETL89193.1|  hypothetical protein L917_11853                       93.2    2e-18   Phytophthora parasitica
ref|XP_001240296.1|  hypothetical protein CIMG_07459                  93.2    2e-18   
gb|ETL35961.1|  hypothetical protein L916_12010                       93.2    2e-18   Phytophthora parasitica
gb|ETK82574.1|  hypothetical protein L915_12086                       93.2    2e-18   Phytophthora parasitica
ref|XP_009540749.1|  hypothetical protein HETIRDRAFT_166278           92.8    3e-18   Heterobasidion irregulare TC 32-1
ref|XP_002898476.1|  AP-3 complex subunit delta, putative             92.8    3e-18   Phytophthora infestans T30-4
emb|CDW59385.1|  Adaptin N domain containing protein                  89.0    3e-18   Trichuris trichiura
gb|EFW14498.1|  AP-3 complex subunit delta                            92.0    4e-18   Coccidioides posadasii str. Silveira
gb|EAS28713.2|  AP-3 complex subunit delta                            92.0    4e-18   Coccidioides immitis RS
dbj|BAE33449.1|  unnamed protein product                              87.0    4e-18   Mus musculus [mouse]
gb|KDQ63013.1|  hypothetical protein JAAARDRAFT_75593                 91.7    5e-18   Jaapia argillacea MUCL 33604
ref|XP_003038390.1|  hypothetical protein SCHCODRAFT_47178            91.7    5e-18   Schizophyllum commune H4-8
emb|CDH52951.1|  ap3d1 protein                                        88.2    6e-18   Lichtheimia corymbifera JMRC:FSU:9682
gb|KDO18891.1|  hypothetical protein SPRG_15843                       91.7    6e-18   Saprolegnia parasitica CBS 223.65
ref|XP_001422394.1|  predicted protein                                90.5    8e-18   Ostreococcus lucimarinus CCE9901
ref|XP_008620785.1|  hypothetical protein SDRG_16358                  90.9    1e-17   Saprolegnia diclina VS20
ref|XP_007360699.1|  Adaptor protein complex AP-3 delta subunit       90.9    1e-17   Dichomitus squalens LYAD-421 SS1
gb|KFH70940.1|  hypothetical protein MVEG_03786                       90.9    1e-17   Mortierella verticillata NRRL 6337
gb|AAH97241.1|  Si:ch211-129c21.6 protein                             86.7    1e-17   Danio rerio [leopard danio]
ref|XP_003063782.1|  predicted protein                                90.1    2e-17   Micromonas pusilla CCMP1545
gb|KIM47679.1|  hypothetical protein M413DRAFT_416871                 90.1    2e-17   Hebeloma cylindrosporum h7
ref|XP_002504298.1|  predicted protein                                90.1    2e-17   Micromonas commoda
gb|KIM88794.1|  hypothetical protein PILCRDRAFT_239285                89.4    2e-17   Piloderma croceum F 1598
emb|CEG62868.1|  hypothetical protein RMATCC62417_00125               89.7    3e-17   Rhizopus microsporus
ref|XP_001914564.1|  AP-3 complex subunit delta-1                     83.6    3e-17   Entamoeba histolytica HM-1:IMSS
gb|KDR85547.1|  hypothetical protein GALMADRAFT_53684                 89.4    4e-17   Galerina marginata CBS 339.88
ref|XP_011410230.1|  PREDICTED: AP-3 complex subunit delta-1-like     89.4    4e-17   
emb|CCL98144.1|  predicted protein                                    89.0    5e-17   Fibroporia radiculosa
gb|KIK02036.1|  hypothetical protein K443DRAFT_677925                 89.0    5e-17   Laccaria amethystina LaAM-08-1
ref|XP_002392365.1|  hypothetical protein MPER_08072                  85.1    7e-17   
gb|KII93311.1|  hypothetical protein PLICRDRAFT_672814                88.2    8e-17   Plicaturopsis crispa FD-325 SS-3
ref|XP_007784505.1|  hypothetical protein W97_08546                   88.2    9e-17   Coniosporium apollinis CBS 100218
gb|EMD42246.1|  hypothetical protein CERSUDRAFT_102602                87.8    1e-16   Gelatoporia subvermispora B
ref|XP_004091134.1|  PREDICTED: LOW QUALITY PROTEIN: AP-3 complex...  88.2    1e-16   
ref|XP_004993320.1|  hypothetical protein PTSG_05451                  88.2    1e-16   Salpingoeca rosetta
ref|XP_002770560.1|  DEHA2G01518p                                     87.8    1e-16   Debaryomyces hansenii CBS767
ref|XP_007860291.1|  Adaptor protein complex AP-3 delta subunit       87.4    1e-16   Gloeophyllum trabeum ATCC 11539
gb|KJA28571.1|  hypothetical protein HYPSUDRAFT_211879                87.4    1e-16   Hypholoma sublateritium FD-334 SS-4
gb|KIL71660.1|  hypothetical protein M378DRAFT_115001                 87.0    2e-16   Amanita muscaria Koide BX008
gb|KIM26948.1|  hypothetical protein M408DRAFT_330313                 87.0    2e-16   Serendipita vermifera MAFF 305830
ref|XP_007297917.1|  Adaptor protein complex AP-3 delta subunit       86.7    2e-16   Stereum hirsutum FP-91666 SS1
gb|KIO06956.1|  hypothetical protein M404DRAFT_137182                 87.0    2e-16   Pisolithus tinctorius Marx 270
ref|XP_007270957.1|  Adaptor protein complex AP-3 delta subunit       87.0    2e-16   Fomitiporia mediterranea MF3/22
gb|KIM70059.1|  hypothetical protein SCLCIDRAFT_101653                87.0    2e-16   Scleroderma citrinum Foug A
gb|KIJ07920.1|  hypothetical protein PAXINDRAFT_139610                87.0    2e-16   Paxillus involutus ATCC 200175
emb|CDS08434.1|  hypothetical protein LRAMOSA09796                    87.0    2e-16   Lichtheimia ramosa
gb|KIK35695.1|  hypothetical protein CY34DRAFT_811953                 86.7    3e-16   Suillus luteus UH-Slu-Lm8-n1
gb|AAH05142.1|  AP3D1 protein                                         86.7    3e-16   Homo sapiens [man]
ref|XP_008476895.1|  PREDICTED: AP-3 complex subunit delta            86.7    3e-16   
ref|XP_009250845.1|  PREDICTED: AP-3 complex subunit delta-1-like     86.7    3e-16   
ref|XP_002548142.1|  predicted protein                                85.9    3e-16   Candida tropicalis MYA-3404
emb|CDH52950.1|  ap3d1 protein                                        86.7    3e-16   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDH52949.1|  ap3d1 protein                                        86.7    3e-16   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_006677182.1|  hypothetical protein BATDEDRAFT_16060            85.9    4e-16   Batrachochytrium dendrobatidis JAM81
ref|XP_005587509.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  86.7    4e-16   
ref|XP_008970832.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  86.7    4e-16   Pan paniscus [bonobo]
dbj|BAD92041.1|  Adapter-related protein complex 3 delta 1 subuni...  86.7    4e-16   Homo sapiens [man]
ref|XP_008970833.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  86.3    4e-16   Pan paniscus [bonobo]
ref|XP_005587508.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  86.3    4e-16   
gb|AAH10065.1|  AP3D1 protein                                         85.9    4e-16   Homo sapiens [man]
ref|XP_002603862.1|  hypothetical protein BRAFLDRAFT_276908           86.3    4e-16   Branchiostoma floridae
ref|XP_001750781.1|  hypothetical protein                             86.3    4e-16   Monosiga brevicollis MX1
ref|XP_002563394.1|  Pc20g08980                                       86.3    5e-16   Penicillium rubens Wisconsin 54-1255
ref|XP_007712477.1|  hypothetical protein COCCADRAFT_5236             86.3    5e-16   Bipolaris zeicola 26-R-13
gb|EUN26163.1|  hypothetical protein COCVIDRAFT_27471                 86.3    5e-16   Bipolaris victoriae FI3
ref|XP_003788905.1|  PREDICTED: AP-3 complex subunit delta-1          86.3    5e-16   Otolemur garnettii
ref|NP_003929.4|  AP-3 complex subunit delta-1 isoform 2              86.3    5e-16   Homo sapiens [man]
ref|XP_004059739.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  86.3    5e-16   
ref|XP_002801055.1|  PREDICTED: AP-3 complex subunit delta-1-like...  86.3    5e-16   
ref|XP_001149847.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  86.3    5e-16   
ref|XP_007337124.1|  Adaptor protein complex AP-3 delta subunit       85.9    5e-16   
ref|XP_004059738.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  86.3    5e-16   
ref|XP_009191363.1|  PREDICTED: LOW QUALITY PROTEIN: AP-3 complex...  85.9    5e-16   
ref|NP_001248755.1|  AP-3 complex subunit delta-1 isoform 3           85.9    5e-16   Homo sapiens [man]
gb|EHH29436.1|  hypothetical protein EGK_09867                        85.9    5e-16   Macaca mulatta [rhesus macaque]
ref|XP_003928649.1|  PREDICTED: AP-3 complex subunit delta-1          85.9    5e-16   Saimiri boliviensis boliviensis
ref|XP_010599778.1|  PREDICTED: LOW QUALITY PROTEIN: AP-3 complex...  85.9    6e-16   
emb|CDR46823.1|  CYFA0S26e00474g1_1                                   85.9    6e-16   Cyberlindnera fabianii
ref|XP_006722995.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  85.9    6e-16   
ref|XP_009432590.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  85.9    6e-16   
gb|EFX01470.1|  ap-3 complex subunit                                  85.9    6e-16   Grosmannia clavigera kw1407
gb|KFD46939.1|  hypothetical protein M513_12185                       85.9    6e-16   Trichuris suis
ref|XP_007992896.1|  PREDICTED: AP-3 complex subunit delta-1          85.9    7e-16   Chlorocebus sabaeus
ref|XP_007390989.1|  hypothetical protein PHACADRAFT_83114            85.5    7e-16   Phanerochaete carnosa HHB-10118-sp
gb|AAD03777.1|  AP-3 complex delta subunit                            85.5    7e-16   Homo sapiens [man]
ref|XP_002801056.1|  PREDICTED: AP-3 complex subunit delta-1-like...  85.5    7e-16   
gb|EAW69416.1|  hCG2004350, isoform CRA_d                             85.5    7e-16   Homo sapiens [man]
gb|EAW69414.1|  hCG2004350, isoform CRA_c                             85.5    7e-16   Homo sapiens [man]
ref|XP_003648865.1|  hypothetical protein THITE_2106790               85.5    8e-16   Thielavia terrestris NRRL 8126
ref|XP_008187663.1|  PREDICTED: AP-3 complex subunit delta-1          85.5    8e-16   
ref|XP_006259093.1|  PREDICTED: AP-3 complex subunit delta-1          85.5    9e-16   
emb|CEJ94524.1|  hypothetical protein VHEMI10048                      85.5    9e-16   Torrubiella hemipterigena
gb|KIK71432.1|  hypothetical protein GYMLUDRAFT_148356                85.1    9e-16   Gymnopus luxurians FD-317 M1
gb|EMD90835.1|  hypothetical protein COCHEDRAFT_1136907               85.5    9e-16   Bipolaris maydis C5
ref|XP_011276163.1|  AP-3 complex subunit delta                       85.1    9e-16   Wickerhamomyces ciferrii
ref|XP_006037222.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  85.5    9e-16   
ref|XP_007434059.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  85.5    9e-16   Python bivittatus
ref|XP_007434058.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  85.5    9e-16   Python bivittatus
ref|XP_749144.1|  AP-3 complex subunit delta                          85.1    9e-16   Aspergillus fumigatus Af293
ref|XP_011286865.1|  PREDICTED: AP-3 complex subunit delta-1          85.5    9e-16   
ref|XP_008587465.1|  PREDICTED: AP-3 complex subunit delta-1          85.5    9e-16   Galeopterus variegatus [Malayan flying lemur]
ref|XP_006037223.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  85.5    9e-16   
ref|XP_006037221.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  85.5    9e-16   
gb|EHB06581.1|  AP-3 complex subunit delta-1                          85.5    1e-15   Heterocephalus glaber [naked mole rat]
gb|KHJ44674.1|  adaptin region                                        85.5    1e-15   Trichuris suis
ref|XP_005505615.1|  PREDICTED: AP-3 complex subunit delta-1          85.5    1e-15   
ref|XP_007949190.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  85.5    1e-15   Orycteropus afer afer
ref|XP_005531388.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  85.1    1e-15   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005496329.1|  PREDICTED: AP-3 complex subunit delta-1          85.1    1e-15   
ref|XP_005427354.1|  PREDICTED: AP-3 complex subunit delta-1          85.1    1e-15   
ref|XP_007762502.1|  Adaptor protein complex AP-3 delta subunit       84.7    1e-15   Coniophora puteana RWD-64-598 SS2
gb|KIJ53612.1|  hypothetical protein M422DRAFT_222276                 85.1    1e-15   Sphaerobolus stellatus SS14
ref|XP_007844550.1|  ap3d1 protein                                    85.1    1e-15   
ref|XP_008031374.1|  hypothetical protein SETTUDRAFT_143720           85.1    1e-15   Exserohilum turcica Et28A
gb|KFD62221.1|  hypothetical protein M514_12185                       85.1    1e-15   Trichuris suis
gb|EMG47168.1|  putative clathrin-associated protein AP-3 complex...  85.1    1e-15   Candida maltosa Xu316
ref|XP_008637238.1|  PREDICTED: AP-3 complex subunit delta-1          85.1    1e-15   
ref|XP_005531389.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  85.1    1e-15   
ref|XP_002194075.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  85.1    1e-15   
ref|XP_003642902.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  85.1    1e-15   
dbj|BAF62313.1|  adaptor-related protein complex 3, delta-1 subunit   85.1    1e-15   Sus scrofa [pigs]
ref|XP_009095100.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  85.1    1e-15   
ref|XP_008928906.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  85.1    1e-15   
ref|XP_008169551.1|  PREDICTED: AP-3 complex subunit delta-1          85.1    1e-15   Chrysemys picta bellii
ref|XP_007949191.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  85.1    1e-15   Orycteropus afer afer
ref|XP_006743758.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  85.1    1e-15   
ref|XP_004948822.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  85.1    1e-15   Gallus gallus [bantam]
gb|KIK97687.1|  hypothetical protein PAXRUDRAFT_200770                84.7    1e-15   Paxillus rubicundulus Ve08.2h10
ref|XP_010564917.1|  PREDICTED: AP-3 complex subunit delta-1          85.1    1e-15   Haliaeetus leucocephalus
ref|XP_009095099.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  85.1    1e-15   Serinus canaria [canary]
ref|XP_009561068.1|  PREDICTED: AP-3 complex subunit delta-1          85.1    1e-15   Cuculus canorus
gb|EJU02826.1|  Adaptor protein complex AP-3 delta subunit            84.7    1e-15   Dacryopinax primogenitus
ref|XP_005060053.1|  PREDICTED: AP-3 complex subunit delta-1          85.1    1e-15   
gb|KGU11907.1|  hypothetical protein MEY_02688                        84.7    1e-15   Candida albicans 19F
ref|XP_009883352.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  85.1    1e-15   Charadrius vociferus
gb|KFO53542.1|  AP-3 complex subunit delta-1                          85.1    1e-15   Corvus brachyrhynchos
gb|ETE69298.1|  AP-3 complex subunit delta-1                          85.1    1e-15   Ophiophagus hannah
gb|EDL89242.1|  adaptor-related protein complex 3, delta 1 subuni...  84.7    1e-15   Rattus norvegicus [brown rat]
ref|XP_008928907.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  85.1    1e-15   
gb|KGQ99568.1|  hypothetical protein MG1_02731                        84.7    1e-15   Candida albicans GC75
gb|KHC78440.1|  hypothetical protein MGS_02713                        84.7    1e-15   Candida albicans P78042
gb|KGU31824.1|  hypothetical protein MGK_02712                        84.7    1e-15   Candida albicans P57055
gb|KGU27120.1|  hypothetical protein MG7_02726                        84.7    1e-15   Candida albicans P34048
gb|KGQ87886.1|  hypothetical protein MEO_02685                        84.7    1e-15   Candida albicans P94015
gb|EEQ44317.1|  conserved hypothetical protein                        84.7    1e-15   Candida albicans WO-1
gb|KGR17376.1|  hypothetical protein MG9_02724                        84.7    1e-15   Candida albicans P37037
gb|KGR12647.1|  hypothetical protein MG3_02731                        84.7    1e-15   Candida albicans P78048
ref|XP_720078.1|  potential clathrin-associated protein AP-3 comp...  84.7    1e-15   
gb|KHC78813.1|  hypothetical protein W5Q_02773                        84.7    1e-15   Candida albicans SC5314
gb|KHC70002.1|  hypothetical protein MGI_02692                        84.7    1e-15   Candida albicans P75016
gb|KHC56647.1|  hypothetical protein MGC_02714                        84.7    1e-15   Candida albicans P37039
gb|KHC43674.1|  hypothetical protein W5O_02725                        84.7    1e-15   Candida albicans Ca6
gb|KHC37604.1|  hypothetical protein MGQ_02700                        84.7    1e-15   Candida albicans P76067
gb|KGU31091.1|  hypothetical protein MGM_02712                        84.7    1e-15   Candida albicans P75063
gb|KGU12737.1|  hypothetical protein MEM_02719                        84.7    1e-15   Candida albicans L26
gb|KGU10118.1|  hypothetical protein MEQ_02686                        84.7    1e-15   Candida albicans P87
gb|KGT70007.1|  hypothetical protein MEK_02727                        84.7    1e-15   Candida albicans 12C
gb|KGQ92188.1|  hypothetical protein MEU_02709                        84.7    1e-15   Candida albicans P37005
gb|KHC52099.1|  hypothetical protein MEW_02657                        84.7    1e-15   Candida albicans P60002
ref|XP_010184277.1|  PREDICTED: AP-3 complex subunit delta-1          84.3    1e-15   Mesitornis unicolor
ref|XP_010409717.1|  PREDICTED: AP-3 complex subunit delta-1          84.7    1e-15   Corvus cornix cornix
ref|XP_004890376.1|  PREDICTED: LOW QUALITY PROTEIN: AP-3 complex...  84.7    1e-15   
ref|XP_009883351.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.7    1e-15   Charadrius vociferus
ref|XP_002473971.1|  predicted protein                                84.0    1e-15   
ref|XP_002171406.2|  AP-3 adaptor complex subunit Apl5                84.3    1e-15   Schizosaccharomyces japonicus yFS275
gb|KHC64654.1|  hypothetical protein MGE_02712                        84.7    1e-15   Candida albicans P75010
gb|KHC36595.1|  hypothetical protein MGO_02687                        84.7    1e-15   Candida albicans P76055
gb|KGR10756.1|  hypothetical protein MG5_02707                        84.7    1e-15   Candida albicans P57072
ref|XP_008123094.1|  PREDICTED: AP-3 complex subunit delta-1          84.7    1e-15   
ref|XP_010279834.1|  PREDICTED: AP-3 complex subunit delta-1          84.7    2e-15   Phaethon lepturus
ref|XP_006743757.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.7    2e-15   
ref|XP_004008681.1|  PREDICTED: LOW QUALITY PROTEIN: AP-3 complex...  84.7    2e-15   
gb|EDP48204.1|  AP-3 complex subunit delta, putative                  84.7    2e-15   Aspergillus fumigatus A1163
ref|XP_009459933.1|  PREDICTED: AP-3 complex subunit delta-1          84.7    2e-15   Nipponia nippon
ref|XP_006897989.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.7    2e-15   Elephantulus edwardii [Cape long-eared elephant shrew]
dbj|BAA36591.1|  adaptor related protein complex (AP)-3 delta sub...  84.7    2e-15   Bos taurus [bovine]
gb|ELR61772.1|  AP-3 complex subunit delta-1                          84.7    2e-15   Bos mutus
ref|XP_003696565.1|  PREDICTED: LOW QUALITY PROTEIN: AP-3 complex...  84.7    2e-15   Apis florea [dwarf honeybee]
ref|XP_005633160.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.7    2e-15   Canis lupus familiaris [dogs]
ref|XP_004865947.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.7    2e-15   Heterocephalus glaber [naked mole rat]
ref|XP_004689439.1|  PREDICTED: AP-3 complex subunit delta-1          84.7    2e-15   
ref|XP_533956.2|  PREDICTED: AP-3 complex subunit delta-1 isoformX1   84.7    2e-15   
gb|EWM28142.1|  ap-3 complex subunit delta-1                          84.3    2e-15   Nannochloropsis gaditana
ref|XP_004395449.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.7    2e-15   Odobenus rosmarus divergens
ref|XP_004632753.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.7    2e-15   
ref|NP_776423.3|  AP-3 complex subunit delta-1                        84.7    2e-15   
ref|XP_007324248.1|  hypothetical protein SERLADRAFT_358727           84.3    2e-15   
ref|XP_005682665.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.7    2e-15   
ref|XP_006897988.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.7    2e-15   
ref|XP_005633161.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.7    2e-15   
ref|XP_005107704.1|  PREDICTED: AP-3 complex subunit delta-1-like...  84.7    2e-15   
ref|XP_006618193.1|  PREDICTED: AP-3 complex subunit delta-1-like     84.7    2e-15   
ref|XP_395563.4|  PREDICTED: AP-3 complex subunit delta-1             84.7    2e-15   
ref|XP_006047872.1|  PREDICTED: AP-3 complex subunit delta-1-like...  84.7    2e-15   
ref|XP_005682664.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.7    2e-15   
ref|XP_006869041.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.7    2e-15   
ref|XP_004865948.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.7    2e-15   
ref|XP_004395450.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.7    2e-15   
ref|XP_011231496.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.7    2e-15   
ref|XP_004441401.1|  PREDICTED: AP-3 complex subunit delta-1          84.7    2e-15   
ref|XP_004286402.1|  PREDICTED: LOW QUALITY PROTEIN: AP-3 complex...  84.7    2e-15   
ref|XP_005405978.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.7    2e-15   
ref|XP_006047871.1|  PREDICTED: AP-3 complex subunit delta-1-like...  84.7    2e-15   
ref|XP_005405976.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.7    2e-15   
ref|XP_004615005.1|  PREDICTED: AP-3 complex subunit delta-1          84.7    2e-15   
ref|XP_005107703.1|  PREDICTED: AP-3 complex subunit delta-1-like...  84.7    2e-15   
ref|XP_010870059.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.7    2e-15   
gb|KIP11664.1|  hypothetical protein PHLGIDRAFT_82909                 84.0    2e-15   
ref|XP_010870058.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.7    2e-15   
ref|XP_007379266.1|  Adaptor protein complex AP-3 delta subunit       84.3    2e-15   
ref|XP_006869042.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.7    2e-15   
ref|XP_003833785.1|  hypothetical protein LEMA_P065460.1              84.3    2e-15   
ref|XP_005107705.1|  PREDICTED: AP-3 complex subunit delta-1-like...  84.7    2e-15   
ref|XP_008558668.1|  PREDICTED: AP-3 complex subunit delta-1          84.3    2e-15   
ref|XP_004632752.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.3    2e-15   
ref|XP_005993846.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.3    2e-15   
ref|XP_010870060.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.3    2e-15   
gb|EFB22865.1|  hypothetical protein PANDA_015532                     84.3    2e-15   
ref|XP_007489375.1|  PREDICTED: AP-3 complex subunit delta-1          84.3    2e-15   
dbj|BAE33305.1|  unnamed protein product                              84.0    2e-15   
ref|XP_003302370.1|  hypothetical protein PTT_14147                   84.3    2e-15   
ref|XP_001933337.1|  AP-3 complex subunit delta                       84.3    2e-15   
ref|XP_007460429.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.3    2e-15   
ref|XP_007460430.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.3    2e-15   
ref|XP_003502629.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.3    2e-15   
emb|CCD42727.1|  similar to AP-3 complex subunit delta                84.3    2e-15   
ref|XP_007579137.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.3    2e-15   
ref|XP_007579135.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.3    2e-15   
ref|XP_007579134.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.3    2e-15   
ref|XP_007579133.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.3    2e-15   
emb|CCE40261.1|  hypothetical protein CPAR2_102990                    84.3    2e-15   
ref|XP_001527217.1|  conserved hypothetical protein                   84.3    2e-15   
dbj|BAE24834.1|  unnamed protein product                              84.0    2e-15   
ref|XP_003867570.1|  Apl5 protein                                     84.0    2e-15   
gb|AAH37477.1|  Ap3d1 protein                                         84.0    2e-15   
ref|XP_005806447.1|  PREDICTED: AP-3 complex subunit delta-1-like...  84.3    2e-15   
emb|CDQ81929.1|  unnamed protein product                              84.3    2e-15   
gb|AAH22171.1|  Ap3d1 protein                                         84.0    2e-15   
ref|XP_003439885.1|  PREDICTED: AP-3 complex subunit delta-1-like...  84.3    2e-15   
gb|AAH80909.1|  ap3d1 protein                                         84.0    2e-15   
gb|EHK97912.1|  putative AP-3 complex subunit delta                   83.6    2e-15   
ref|XP_005806446.1|  PREDICTED: AP-3 complex subunit delta-1-like...  84.3    2e-15   
ref|XP_001822245.2|  AP-3 complex subunit delta                       84.0    2e-15   
ref|XP_008405159.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.3    2e-15   
ref|XP_008405160.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.3    2e-15   
ref|XP_005734134.1|  PREDICTED: AP-3 complex subunit delta-1-like     84.0    2e-15   
ref|XP_005920868.1|  PREDICTED: AP-3 complex subunit delta-1-like...  84.0    2e-15   
ref|XP_008405157.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.3    2e-15   
ref|XP_008405156.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.3    2e-15   
ref|XP_005479093.1|  PREDICTED: AP-3 complex subunit delta-1-like...  84.3    2e-15   
gb|KIL91202.1|  hypothetical protein FAVG1_05901                      84.0    2e-15   
ref|XP_005993845.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    2e-15   
gb|EDL31507.1|  adaptor-related protein complex 3, delta 1 subuni...  84.0    2e-15   
ref|XP_005083348.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    2e-15   
ref|XP_008405158.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
ref|XP_005479094.1|  PREDICTED: AP-3 complex subunit delta-1-like...  84.0    3e-15   
ref|XP_004555024.1|  PREDICTED: AP-3 complex subunit delta-1-like...  84.0    3e-15   
ref|XP_005920865.1|  PREDICTED: AP-3 complex subunit delta-1-like...  84.0    3e-15   
gb|AAI54681.1|  ap3d1 protein                                         84.0    3e-15   
ref|XP_005479092.1|  PREDICTED: AP-3 complex subunit delta-1-like...  84.0    3e-15   
ref|XP_008405155.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
ref|XP_005479091.1|  PREDICTED: AP-3 complex subunit delta-1-like...  84.0    3e-15   
ref|XP_002419192.1|  clathrin assembly complex AP-3 adaptin compo...  84.0    3e-15   
ref|XP_004555025.1|  PREDICTED: AP-3 complex subunit delta-1-like...  84.0    3e-15   
ref|XP_005920866.1|  PREDICTED: AP-3 complex subunit delta-1-like...  84.0    3e-15   
ref|XP_004555023.1|  PREDICTED: AP-3 complex subunit delta-1-like...  84.0    3e-15   
ref|XP_005920864.1|  PREDICTED: AP-3 complex subunit delta-1-like...  84.0    3e-15   
ref|XP_005359091.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
ref|XP_005083349.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
ref|XP_003486469.1|  PREDICTED: AP-3 complex subunit delta-1-like     84.0    3e-15   
ref|XP_006206484.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
ref|NP_001094189.1|  AP-3 complex subunit delta-1                     84.0    3e-15   
gb|KIY50457.1|  Adaptor protein complex AP-3 delta subunit            84.0    3e-15   
ref|XP_005332049.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
ref|XP_006800493.1|  PREDICTED: AP-3 complex subunit delta-1-like...  84.0    3e-15   
ref|XP_006800492.1|  PREDICTED: AP-3 complex subunit delta-1-like...  84.0    3e-15   
ref|XP_008835340.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
ref|XP_005359090.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
ref|XP_005332050.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
gb|EPS31299.1|  hypothetical protein PDE_06254                        84.0    3e-15   
ref|XP_008835341.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
gb|AGO13081.1|  AaceriAFL076Wp                                        84.0    3e-15   
ref|XP_004595715.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
ref|XP_008835339.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
ref|XP_008835338.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
ref|XP_004595714.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
ref|XP_006206482.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
ref|XP_006800494.1|  PREDICTED: AP-3 complex subunit delta-1-like...  84.0    3e-15   
ref|XP_009294541.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
ref|XP_003394522.1|  PREDICTED: AP-3 complex subunit delta-1-like     84.0    3e-15   
ref|XP_007376282.1|  hypothetical protein SPAPADRAFT_67558            84.0    3e-15   
ref|XP_011141506.1|  PREDICTED: AP-3 complex subunit delta-1          84.0    3e-15   
ref|XP_006206483.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
ref|XP_010998552.1|  PREDICTED: AP-3 complex subunit delta-1          84.0    3e-15   
ref|NP_031486.1|  AP-3 complex subunit delta-1                        84.0    3e-15   
ref|XP_009294543.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
ref|XP_009294539.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
ref|XP_008295683.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
ref|XP_009294538.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
ref|XP_008295679.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
ref|XP_008295678.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
ref|XP_009294544.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
ref|XP_008295682.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
ref|XP_010735108.1|  PREDICTED: AP-3 complex subunit delta-1          84.0    3e-15   
ref|XP_004654967.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  83.6    3e-15   
ref|XP_002937985.2|  PREDICTED: AP-3 complex subunit delta-1          84.0    3e-15   
ref|XP_011472830.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
ref|XP_008295677.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
ref|XP_008295680.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  84.0    3e-15   
ref|XP_006513204.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  83.6    3e-15   
ref|XP_004654966.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  83.6    3e-15   
ref|XP_008333598.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  83.6    3e-15   
ref|XP_008333593.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  83.6    3e-15   
ref|XP_011260384.1|  PREDICTED: LOW QUALITY PROTEIN: AP-3 complex...  83.6    3e-15   
ref|XP_008333608.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  83.6    3e-15   
ref|XP_008333604.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  83.6    3e-15   
ref|XP_011472829.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  83.6    3e-15   
gb|KIH86630.1|  AP-3 complex subunit delta-1                          83.6    3e-15   
ref|NP_001038480.1|  AP-3 complex subunit delta-1                     83.6    3e-15   
ref|XP_009294542.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  83.6    3e-15   
ref|XP_007233355.1|  PREDICTED: AP-3 complex subunit delta-1-like...  83.6    3e-15   
ref|XP_011348286.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  83.6    4e-15   
ref|XP_007233354.1|  PREDICTED: AP-3 complex subunit delta-1-like...  83.6    4e-15   
ref|XP_010965215.1|  PREDICTED: AP-3 complex subunit delta-1          83.6    4e-15   
emb|CDP25279.1|  Putative AP-3 complex subunit delta                  83.6    4e-15   
emb|CAG07955.1|  unnamed protein product                              83.6    4e-15   
ref|XP_011472828.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  83.6    4e-15   
gb|EFN74144.1|  AP-3 complex subunit delta-1                          83.6    4e-15   
ref|XP_008148890.1|  PREDICTED: AP-3 complex subunit delta-1          83.6    4e-15   
gb|EQB57887.1|  hypothetical protein CGLO_01930                       83.6    4e-15   
ref|XP_002106880.1|  GD15877                                          80.1    4e-15   
ref|XP_009294540.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  83.6    4e-15   
gb|KIV78189.1|  hypothetical protein PV11_09929                       83.2    4e-15   
ref|XP_003700338.1|  PREDICTED: AP-3 complex subunit delta-1-like     83.6    4e-15   
ref|XP_011348285.1|  PREDICTED: AP-3 complex subunit delta-1 isof...  83.6    4e-15   
ref|XP_009044017.1|  hypothetical protein LOTGIDRAFT_177167           83.2    4e-15   
ref|XP_011437817.1|  PREDICTED: AP-3 complex subunit delta-1-like     83.2    4e-15   
ref|XP_009648594.1|  AP-3 complex subunit delta                       83.2    5e-15   
gb|KIW17788.1|  hypothetical protein PV08_04983                       83.2    5e-15   
gb|EYE93316.1|  Adaptor protein complex AP-3 delta subunit            83.2    5e-15   
gb|EKC26369.1|  AP-3 complex subunit delta-1                          83.2    5e-15   
ref|XP_008856437.1|  Adapter-related protein complex 3 (AP-3) sub...  82.0    5e-15   
gb|KHJ30145.1|  putative ap-3 complex subunit delta                   82.8    6e-15   
ref|XP_008080040.1|  ARM repeat-containing protein                    83.2    6e-15   
ref|XP_009848498.1|  hypothetical protein NEUTE1DRAFT_144627          82.8    6e-15   
gb|EGU82223.1|  hypothetical protein FOXB_07283                       82.8    6e-15   
gb|EWZ97592.1|  hypothetical protein FOWG_02021                       82.8    6e-15   
gb|EWZ45590.1|  hypothetical protein FOZG_05862                       82.8    6e-15   
gb|EWY99560.1|  hypothetical protein FOYG_03571                       82.8    6e-15   
gb|KHN95399.1|  AP-3 complex subunit delta                            82.8    6e-15   
ref|XP_001911054.1|  hypothetical protein                             82.8    6e-15   
gb|EMT64988.1|  AP-3 complex subunit delta                            82.8    7e-15   
gb|EQL38865.1|  hypothetical protein BDFG_00386                       82.8    7e-15   
ref|NP_985472.1|  AFL076Wp                                            82.8    7e-15   
gb|EWY99559.1|  hypothetical protein FOYG_03571                       82.8    7e-15   
gb|EWZ45589.1|  hypothetical protein FOZG_05862                       82.8    7e-15   
gb|EWZ97591.1|  hypothetical protein FOWG_02021                       82.8    7e-15   
gb|EXM35755.1|  hypothetical protein FOTG_00163                       82.4    7e-15   
gb|EXL62940.1|  hypothetical protein FOCG_01367                       82.4    7e-15   
gb|EKG14807.1|  Clathrin/coatomer adaptor adaptin-like protein        82.4    8e-15   
gb|EXM07755.1|  hypothetical protein FOIG_02701                       82.4    8e-15   
gb|EXK99753.1|  hypothetical protein FOQG_00174                       82.4    8e-15   
gb|EXK42995.1|  hypothetical protein FOMG_05707                       82.4    8e-15   
gb|EXA50859.1|  hypothetical protein FOVG_03397                       82.4    8e-15   
emb|CCA68714.1|  related to Adapter-related protein complex 3 del...  82.4    8e-15   
gb|KIW37157.1|  hypothetical protein PV06_10776                       82.4    8e-15   
gb|EXL79724.1|  hypothetical protein FOPG_06493                       82.4    9e-15   
gb|EXM35754.1|  hypothetical protein FOTG_00163                       82.4    9e-15   
emb|CCX34088.1|  Similar to AP-3 complex subunit delta-1; acc. no...  82.4    9e-15   
ref|XP_003006235.1|  AP-3 complex subunit delta                       82.4    9e-15   
gb|EXL62939.1|  hypothetical protein FOCG_01367                       82.4    9e-15   
gb|EXA50858.1|  hypothetical protein FOVG_03397                       82.4    9e-15   
gb|ELT88988.1|  hypothetical protein CAPTEDRAFT_18044                 82.4    9e-15   
gb|EXM07754.1|  hypothetical protein FOIG_02701                       82.4    9e-15   
gb|EXK99752.1|  hypothetical protein FOQG_00174                       82.4    9e-15   
ref|XP_011054656.1|  PREDICTED: AP-3 complex subunit delta-1          82.4    9e-15   
gb|EWG47801.1|  hypothetical protein FVEG_07824                       82.4    1e-14   
gb|EXL79723.1|  hypothetical protein FOPG_06493                       82.4    1e-14   
gb|EXK42994.1|  hypothetical protein FOMG_05707                       82.4    1e-14   
ref|XP_002161814.2|  PREDICTED: AP-3 complex subunit delta-1-like     82.0    1e-14   
ref|XP_007524947.1|  PREDICTED: AP-3 complex subunit delta-1          82.4    1e-14   
ref|XP_001630332.1|  predicted protein                                82.0    1e-14   
gb|KFY58287.1|  hypothetical protein V496_06194                       82.0    1e-14   
ref|XP_011168699.1|  PREDICTED: AP-3 complex subunit delta-1          82.0    1e-14   
ref|XP_007834671.1|  hypothetical protein PFICI_07899                 82.0    1e-14   
ref|XP_002442304.1|  hypothetical protein SORBIDRAFT_08g017720        82.0    1e-14   
gb|EFZ12443.1|  hypothetical protein SINV_04691                       82.0    1e-14   
gb|EEQ88738.1|  AP-3 complex subunit delta                            82.0    1e-14   
ref|XP_454829.1|  hypothetical protein                                82.0    1e-14   
emb|CBJ32812.1|  Coatomer protein complex,delta sub-unit              82.0    1e-14   
ref|XP_011502931.1|  PREDICTED: AP-3 complex subunit delta-1          82.0    1e-14   
ref|XP_641687.1|  delta adaptin                                       82.0    1e-14   
ref|XP_003644783.1|  hypothetical protein Ecym_2217                   82.0    1e-14   
ref|XP_011127982.1|  hypothetical protein AOL_s00215g478              82.0    1e-14   
gb|EPT03380.1|  hypothetical protein FOMPIDRAFT_1022378               82.0    1e-14   
ref|XP_007896896.1|  PREDICTED: AP-3 complex subunit delta-1          82.0    1e-14   
emb|CCT66695.1|  related to APL5-AP-3 complex subunit, gamma-adap...  81.6    1e-14   
ref|XP_003974178.1|  PREDICTED: AP-3 complex subunit delta-1-like...  81.6    1e-14   
gb|KEQ97960.1|  hypothetical protein AUEXF2481DRAFT_86846             81.6    1e-14   
gb|KFX90355.1|  hypothetical protein V490_06498                       81.6    2e-14   
ref|XP_006696965.1|  AP-3 complex subunit delta-like protein          81.6    2e-14   
gb|KIW61674.1|  hypothetical protein PV05_01770                       81.6    2e-14   
gb|KIN03823.1|  hypothetical protein OIDMADRAFT_51759                 81.6    2e-14   
gb|EMH73665.1|  Adapter-related protein complex 3 subunit, putative   81.6    2e-14   
ref|XP_655217.2|  Adapter-related protein complex 3 (AP-3) subunit    81.6    2e-14   



>ref|XP_009624654.1| PREDICTED: AP-3 complex subunit delta [Nicotiana tomentosiformis]
Length=971

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 95/102 (93%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MAGPSL+ESLFQRSL+DLIKG+RL+ G   ES FISKAVDEIRREIKSTD QTKATALQK
Sbjct  1    MAGPSLLESLFQRSLEDLIKGLRLYVGD--ESTFISKAVDEIRREIKSTDQQTKATALQK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            LTYLHSIHGVDMSWAAFHAIELSS+QSF +KRIAYLAA+LSF
Sbjct  59   LTYLHSIHGVDMSWAAFHAIELSSSQSFNFKRIAYLAASLSF  100



>ref|XP_004235755.1| PREDICTED: AP-3 complex subunit delta [Solanum lycopersicum]
Length=970

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 94/102 (92%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MAGPSL++SLFQRSL+DLIKG+RLF G   ES FISKAVDEIRREIKSTD QTKATALQK
Sbjct  1    MAGPSLLDSLFQRSLEDLIKGLRLFVGD--ESSFISKAVDEIRREIKSTDQQTKATALQK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             TYLHSIHGVDMSWAAFHAIELSS+QSF +KRIAYLAA+LSF
Sbjct  59   FTYLHSIHGVDMSWAAFHAIELSSSQSFNFKRIAYLAASLSF  100



>ref|XP_006341581.1| PREDICTED: AP-3 complex subunit delta-like [Solanum tuberosum]
Length=970

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 93/102 (91%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MAG SL++SLFQRSL+DLIKG+RLF G   ES FISKAVDEIRREIKSTD QTKA ALQK
Sbjct  1    MAGSSLLDSLFQRSLEDLIKGLRLFVGD--ESSFISKAVDEIRREIKSTDQQTKANALQK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            LTYLHSIHGVDMSWAAFHAIELSS+QSF +KRIAYLAA+LSF
Sbjct  59   LTYLHSIHGVDMSWAAFHAIELSSSQSFNFKRIAYLAASLSF  100



>ref|XP_009763005.1| PREDICTED: AP-3 complex subunit delta [Nicotiana sylvestris]
Length=971

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 93/100 (93%), Gaps = 2/100 (2%)
 Frame = +1

Query  211  GPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLT  390
            GPSL++SLFQRSL+DLIKG+RL+ G   ES FISKAVDEIRREIKSTD QTKATALQKLT
Sbjct  4    GPSLLDSLFQRSLEDLIKGLRLYVGD--ESTFISKAVDEIRREIKSTDQQTKATALQKLT  61

Query  391  YLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            YLHSIHGVDMSWAAFHAIELSS+QSF +KRIAYLAA+LSF
Sbjct  62   YLHSIHGVDMSWAAFHAIELSSSQSFNFKRIAYLAASLSF  101



>ref|XP_011096986.1| PREDICTED: AP-3 complex subunit delta isoform X1 [Sesamum indicum]
Length=937

 Score =   152 bits (384),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 75/102 (74%), Positives = 88/102 (86%), Gaps = 1/102 (1%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MAGPSLM+SLFQRSLDD+IKG+RL   G  E  FI+K++DEIRRE+KSTD QTKA ALQK
Sbjct  1    MAGPSLMDSLFQRSLDDIIKGVRLCPPGT-EPTFIAKSLDEIRREVKSTDRQTKAIALQK  59

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            LTYLHS+HGVDMSWAAF  +ELSS+ +  +KRIAYLAA+LSF
Sbjct  60   LTYLHSLHGVDMSWAAFQCVELSSSSAHSHKRIAYLAASLSF  101



>gb|EPS62380.1| hypothetical protein M569_12412 [Genlisea aurea]
Length=783

 Score =   149 bits (377),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 73/102 (72%), Positives = 89/102 (87%), Gaps = 1/102 (1%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MAGPSLM+SLFQ SL+D+IK +RL   G+ ES FISK+V++IRREIKSTDPQTKATA++K
Sbjct  1    MAGPSLMDSLFQSSLEDVIKSLRLCPPGS-ESAFISKSVEDIRREIKSTDPQTKATAVEK  59

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            L YLHS+HGVD+SWAAFH +ELSS+ +  +KRIAYLAA LSF
Sbjct  60   LAYLHSLHGVDVSWAAFHYVELSSSAAHSHKRIAYLAAALSF  101



>gb|EYU19013.1| hypothetical protein MIMGU_mgv1a018800mg, partial [Erythranthe 
guttata]
Length=863

 Score =   147 bits (371),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 71/99 (72%), Positives = 87/99 (88%), Gaps = 1/99 (1%)
 Frame = +1

Query  214  PSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTY  393
            PSLM+SLFQRS+DD+IKG+RL   G  ES FISK++DEIRREIKSTDPQTKATAL KLTY
Sbjct  5    PSLMDSLFQRSIDDVIKGLRLCPPGT-ESIFISKSLDEIRREIKSTDPQTKATALHKLTY  63

Query  394  LHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            LHS+H  +MSWAAFH++ELSS+ +  YKR+A+L+A+LSF
Sbjct  64   LHSLHSAEMSWAAFHSVELSSSAAHSYKRVAFLSASLSF  102



>emb|CDO98419.1| unnamed protein product [Coffea canephora]
Length=976

 Score =   144 bits (363),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 71/108 (66%), Positives = 86/108 (80%), Gaps = 7/108 (6%)
 Frame = +1

Query  208  AGPSLMESLFQRSLDDLIKGIRLFSGGAG-------ESGFISKAVDEIRREIKSTDPQTK  366
             GPSLM+SLFQRSL+DLIKG+R+ +  AG        S F+SK++DE+RREIKSTD QTK
Sbjct  3    GGPSLMDSLFQRSLEDLIKGLRIHNLAAGTAAGTPESSTFLSKSIDEVRREIKSTDQQTK  62

Query  367  ATALQKLTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             TALQKLTYLHS++ +DMSWAAFHAIELSS+  F  KR  YLAA++SF
Sbjct  63   TTALQKLTYLHSLYAIDMSWAAFHAIELSSSTIFNSKRTGYLAASISF  110



>ref|XP_008459026.1| PREDICTED: AP-3 complex subunit delta [Cucumis melo]
Length=977

 Score =   143 bits (361),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 71/102 (70%), Positives = 86/102 (84%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MAG SLM+SLFQR+LDDLIKG+RL     GES FISKA+DEIRREIKSTDPQTK+TALQK
Sbjct  1    MAGSSLMDSLFQRTLDDLIKGLRL--QLIGESAFISKAMDEIRREIKSTDPQTKSTALQK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            L+YL+S+HG+DM+WAAFH +E+ S+  F  K+I Y AA+ SF
Sbjct  59   LSYLNSLHGIDMNWAAFHVVEVMSSSRFAQKKIGYHAASQSF  100



>ref|XP_010246461.1| PREDICTED: AP-3 complex subunit delta [Nelumbo nucifera]
Length=977

 Score =   142 bits (358),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 70/102 (69%), Positives = 85/102 (83%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            M+  S+MESLFQRSLDDLIKGIRL     GES FI+KA++EIRREIK+TD QTKA AL+K
Sbjct  1    MSASSIMESLFQRSLDDLIKGIRL--QLIGESKFITKAMEEIRREIKTTDSQTKAVALEK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            LTYL+SIHG+DMSWAAFH +E+ S+  F +K+I YLAA+ SF
Sbjct  59   LTYLNSIHGIDMSWAAFHVVEVMSSSRFAHKKIGYLAASQSF  100



>ref|XP_004137481.1| PREDICTED: AP-3 complex subunit delta-like [Cucumis sativus]
 ref|XP_004161844.1| PREDICTED: AP-3 complex subunit delta-like [Cucumis sativus]
 gb|KGN64130.1| hypothetical protein Csa_1G042420 [Cucumis sativus]
Length=977

 Score =   142 bits (358),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 70/102 (69%), Positives = 85/102 (83%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MAG SLM++LFQR+LDDLIKG+RL     GES FISKA+DEIRREIKSTDPQTK+TALQK
Sbjct  1    MAGSSLMDTLFQRTLDDLIKGLRL--QLIGESAFISKAMDEIRREIKSTDPQTKSTALQK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            L+YL S+HG+DM+WAAFH +E+ S+  F  K+I Y AA+ SF
Sbjct  59   LSYLSSLHGIDMNWAAFHVVEVMSSSRFAQKKIGYHAASQSF  100



>ref|XP_010036902.1| PREDICTED: AP-3 complex subunit delta [Eucalyptus grandis]
 gb|KCW48560.1| hypothetical protein EUGRSUZ_K02232 [Eucalyptus grandis]
Length=962

 Score =   139 bits (350),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 70/102 (69%), Positives = 84/102 (82%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MAGPS+ME+LFQR+L+DLIKG+RL     GES FISKAV+EIRREIKSTD  TK+ ALQK
Sbjct  1    MAGPSMMETLFQRTLEDLIKGMRL--QLIGESAFISKAVEEIRREIKSTDLHTKSIALQK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            LTYL+S+H +DMSWAAFHA+E  S+  F  KRI Y+AA+ SF
Sbjct  59   LTYLNSLHAMDMSWAAFHAVECMSSSRFADKRIGYVAASQSF  100



>ref|XP_011045833.1| PREDICTED: AP-3 complex subunit delta-like [Populus euphratica]
Length=969

 Score =   138 bits (348),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 67/102 (66%), Positives = 84/102 (82%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MA PSLM++LFQRSLDD+IKG+R     + ES FISK ++EIRREIK+TD QTK+TALQK
Sbjct  1    MASPSLMDTLFQRSLDDIIKGLR--HQQSTESTFISKVIEEIRREIKTTDLQTKSTALQK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            LTYL+SIH +DMSWA+FHAIE  S+ +F +K+I YLA + SF
Sbjct  59   LTYLNSIHSIDMSWASFHAIECISSPTFAHKKIGYLAISQSF  100



>ref|XP_002318543.2| delta-adaptin family protein [Populus trichocarpa]
 gb|EEE96763.2| delta-adaptin family protein [Populus trichocarpa]
Length=941

 Score =   138 bits (347),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 67/102 (66%), Positives = 84/102 (82%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MA PSLM++LFQRSLDD+IKG+R     + ES FISK ++EIRREIK+TD QTK+TALQK
Sbjct  1    MASPSLMDTLFQRSLDDIIKGLR--HQQSTESTFISKVIEEIRREIKTTDLQTKSTALQK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            LTYL+SIH +DMSWA+FHAIE  S+ +F +K+I YLA + SF
Sbjct  59   LTYLNSIHSIDMSWASFHAIECISSPTFAHKKIGYLAISQSF  100



>ref|XP_003630870.1| AP-3 complex subunit delta-1 [Medicago truncatula]
 gb|AET05346.1| adaptin amino-terminal region protein [Medicago truncatula]
Length=968

 Score =   136 bits (342),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 69/105 (66%), Positives = 86/105 (82%), Gaps = 5/105 (5%)
 Frame = +1

Query  205  MAGPS---LMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATA  375
            MAG S   +M++LFQR+LDDLIK +RL      ES FISK+++EIRREIKSTDPQTK+TA
Sbjct  1    MAGSSSSSIMDNLFQRTLDDLIKSMRL--QLLTESSFISKSIEEIRREIKSTDPQTKSTA  58

Query  376  LQKLTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            LQKLTYL SIHG+DMSWA+FH +E+ S+  FL+KRI Y AA++SF
Sbjct  59   LQKLTYLSSIHGIDMSWASFHVVEVMSSSLFLHKRIGYHAASVSF  103



>ref|XP_011008310.1| PREDICTED: AP-3 complex subunit delta [Populus euphratica]
Length=966

 Score =   135 bits (341),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 68/102 (67%), Positives = 84/102 (82%), Gaps = 1/102 (1%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MA PSLM++LFQRSLDD+IKG+R     + ES FISK ++EIRREIKSTD QTK+TALQK
Sbjct  1    MASPSLMDTLFQRSLDDIIKGVRQ-QQSSTESIFISKVIEEIRREIKSTDLQTKSTALQK  59

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            LTYL+SIH +DMSWA+FHAIE  S+ +F +K+I YLA + SF
Sbjct  60   LTYLNSIHFIDMSWASFHAIECISSPTFSHKKIGYLAISQSF  101



>ref|XP_002321481.2| hypothetical protein POPTR_0015s03830g [Populus trichocarpa]
 gb|EEF05608.2| hypothetical protein POPTR_0015s03830g [Populus trichocarpa]
Length=914

 Score =   134 bits (338),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 67/102 (66%), Positives = 84/102 (82%), Gaps = 1/102 (1%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MA PSLM++LFQRSLDD+IKG+R     + ES FISK ++EIRREIKSTD +TK+TALQK
Sbjct  1    MASPSLMDTLFQRSLDDIIKGVRQ-QQSSTESIFISKVIEEIRREIKSTDLRTKSTALQK  59

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            LTYL+SIH +DMSWA+FHAIE  S+ +F +K+I YLA + SF
Sbjct  60   LTYLNSIHFIDMSWASFHAIECISSPTFSHKKIGYLAISQSF  101



>ref|XP_010694398.1| PREDICTED: AP-3 complex subunit delta [Beta vulgaris subsp. vulgaris]
Length=976

 Score =   133 bits (335),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 68/104 (65%), Positives = 80/104 (77%), Gaps = 2/104 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGE--SGFISKAVDEIRREIKSTDPQTKATAL  378
            MA  S+MESLFQRSL+DLIKGIRL S  +    S F+SKA++EIRREIKSTDP TK+ AL
Sbjct  1    MANSSIMESLFQRSLEDLIKGIRLHSPESSTPISTFLSKAMEEIRREIKSTDPHTKSAAL  60

Query  379  QKLTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             KLTYLHS++G DMSWAAFH +E+ S   F  K+I YLAA  SF
Sbjct  61   LKLTYLHSLYGFDMSWAAFHVVEVISYPQFSLKKIGYLAAVASF  104



>gb|KDP20144.1| hypothetical protein JCGZ_05913 [Jatropha curcas]
Length=954

 Score =   132 bits (332),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 65/102 (64%), Positives = 81/102 (79%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MA PSLM++LFQR+LDD+IKG+R      GES FISK ++EIRREIKSTD  TK+ AL K
Sbjct  1    MASPSLMDTLFQRTLDDIIKGLR--HQQTGESAFISKVMEEIRREIKSTDLHTKSIALHK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            LTYL+SIH +D+SWAAFHAIE  S+ +F +K+I YLA + SF
Sbjct  59   LTYLNSIHFIDISWAAFHAIECISSPNFSHKKIGYLAISQSF  100



>ref|XP_010549108.1| PREDICTED: AP-3 complex subunit delta [Tarenaya hassleriana]
Length=855

 Score =   131 bits (330),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 65/98 (66%), Positives = 81/98 (83%), Gaps = 2/98 (2%)
 Frame = +1

Query  217  SLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYL  396
            SLM+SLFQRSL+DLIKG+RL     GES FISK++DEIRREIK+TD  TK+TALQKL+YL
Sbjct  8    SLMDSLFQRSLEDLIKGLRL--QLIGESAFISKSLDEIRREIKATDLSTKSTALQKLSYL  65

Query  397  HSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            +++HG+DMSWAAFHA+E+ S+  F +KRI Y A   SF
Sbjct  66   NALHGIDMSWAAFHAVEVVSSSRFAHKRIGYHAIAQSF  103



>ref|XP_007160391.1| hypothetical protein PHAVU_002G317900g [Phaseolus vulgaris]
 gb|ESW32385.1| hypothetical protein PHAVU_002G317900g [Phaseolus vulgaris]
Length=975

 Score =   131 bits (330),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 66/102 (65%), Positives = 82/102 (80%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MAG S+ME+LFQ SL+DLIK +RL     GE+ FISKAV+EIRREIKSTD QTK+TALQK
Sbjct  1    MAGSSIMENLFQHSLEDLIKAMRL--QLIGETTFISKAVEEIRREIKSTDQQTKSTALQK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            L+YL ++HGVDMSWA+F  +E+ S+  F +KRI Y AA+ SF
Sbjct  59   LSYLSAVHGVDMSWASFQVVEVMSSSKFAHKRIGYHAASQSF  100



>ref|XP_006485818.1| PREDICTED: AP-3 complex subunit delta-like [Citrus sinensis]
Length=978

 Score =   130 bits (327),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 67/102 (66%), Positives = 79/102 (77%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MAG S+ME+LFQR LDDLIKGIR       ES FISKA++EIRREIKSTD  TK+ ALQK
Sbjct  1    MAGTSIMETLFQRDLDDLIKGIR--QQQIKESLFISKAIEEIRREIKSTDLPTKSAALQK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            L+YL S+HG DMS+AAFHA+E+ S+  F YK+I Y A T SF
Sbjct  59   LSYLSSLHGADMSFAAFHAVEVMSSPQFFYKKIGYHAVTQSF  100



>ref|XP_008240244.1| PREDICTED: AP-3 complex subunit delta [Prunus mume]
Length=975

 Score =   130 bits (327),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 67/102 (66%), Positives = 81/102 (79%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MAG SLME+LFQR+L+DLIKG+RL     GES F+SKA+DEIRRE+KSTD  TKA AL K
Sbjct  1    MAGSSLMENLFQRTLEDLIKGLRL--QLIGESAFLSKAIDEIRREVKSTDSDTKANALHK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            LTYL S+H  DMS+AAFH +EL S+  F +K+IAY AA+ SF
Sbjct  59   LTYLSSLHFYDMSFAAFHVVELLSSTRFSHKKIAYHAASHSF  100



>ref|XP_009347324.1| PREDICTED: AP-3 complex subunit delta-like [Pyrus x bretschneideri]
Length=960

 Score =   130 bits (326),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 68/102 (67%), Positives = 80/102 (78%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MAG SLME+LFQR+L+DLIKG+RL     GES F+SKA+DEIRREIKSTD  TKA AL K
Sbjct  1    MAGSSLMENLFQRTLEDLIKGLRL--QLIGESAFLSKALDEIRREIKSTDADTKANALHK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            LTYL S+H  DMS+AAFH +EL S+  F +K+IAY AA  SF
Sbjct  59   LTYLSSLHFFDMSFAAFHVVELLSSTRFSHKKIAYHAAAHSF  100



>ref|XP_007210401.1| hypothetical protein PRUPE_ppa000873mg [Prunus persica]
 gb|EMJ11600.1| hypothetical protein PRUPE_ppa000873mg [Prunus persica]
Length=974

 Score =   129 bits (325),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 66/102 (65%), Positives = 81/102 (79%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MAG SLME+LFQR+L+DLIKG+RL     GES F+SKA+DEIRRE+KSTD  TKA A+ K
Sbjct  1    MAGSSLMENLFQRTLEDLIKGLRL--QLIGESAFLSKAIDEIRREVKSTDSDTKANAIHK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            LTYL S+H  DMS+AAFH +EL S+  F +K+IAY AA+ SF
Sbjct  59   LTYLSSLHFYDMSFAAFHVVELLSSTRFSHKKIAYHAASHSF  100



>ref|XP_006584869.1| PREDICTED: AP-3 complex subunit delta-like isoform X1 [Glycine 
max]
 ref|XP_006584870.1| PREDICTED: AP-3 complex subunit delta-like isoform X2 [Glycine 
max]
 ref|XP_006584871.1| PREDICTED: AP-3 complex subunit delta-like isoform X3 [Glycine 
max]
 ref|XP_006584872.1| PREDICTED: AP-3 complex subunit delta-like isoform X4 [Glycine 
max]
 ref|XP_006584873.1| PREDICTED: AP-3 complex subunit delta-like isoform X5 [Glycine 
max]
Length=916

 Score =   129 bits (324),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 63/102 (62%), Positives = 79/102 (77%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MAG S+ME+LFQR+L+DLIKG+RL     GES FIS A +EIRRE+KSTD  TK+ ALQK
Sbjct  1    MAGSSIMENLFQRTLEDLIKGLRL--QLIGESTFISNATEEIRREVKSTDQHTKSIALQK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            L+YL ++H VDMSWA FH +E+ S+  F +KRI Y AA+ SF
Sbjct  59   LSYLSAVHAVDMSWACFHVVEVMSSSKFAHKRIGYHAASQSF  100



>ref|XP_006442618.1| hypothetical protein CICLE_v10018705mg [Citrus clementina]
 gb|ESR55858.1| hypothetical protein CICLE_v10018705mg [Citrus clementina]
Length=978

 Score =   129 bits (323),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 66/102 (65%), Positives = 79/102 (77%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MAG S+ME+LFQR LDDLIKGIR       ES FISKA++EIRREIKSTD  TK+ AL+K
Sbjct  1    MAGTSIMETLFQRDLDDLIKGIR--QQQIKESLFISKAIEEIRREIKSTDLPTKSAALRK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            L+YL S+HG DMS+AAFHA+E+ S+  F YK+I Y A T SF
Sbjct  59   LSYLSSLHGADMSFAAFHAVEVMSSPQFFYKKIGYHAVTQSF  100



>gb|KDO45340.1| hypothetical protein CISIN_1g040316mg [Citrus sinensis]
Length=957

 Score =   129 bits (323),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 66/102 (65%), Positives = 79/102 (77%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MAG S+ME+LFQR LDDLIKGIR       ES FISKA++EIRREIKSTD  TK+ AL+K
Sbjct  1    MAGTSIMETLFQRDLDDLIKGIR--QQQIKESLFISKAIEEIRREIKSTDLPTKSAALRK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            L+YL S+HG DMS+AAFHA+E+ S+  F YK+I Y A T SF
Sbjct  59   LSYLSSLHGADMSFAAFHAVEVMSSPQFFYKKIGYHAVTQSF  100



>ref|XP_010663612.1| PREDICTED: AP-3 complex subunit delta isoform X1 [Vitis vinifera]
Length=964

 Score =   129 bits (323),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 65/100 (65%), Positives = 80/100 (80%), Gaps = 2/100 (2%)
 Frame = +1

Query  211  GPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLT  390
            G S+M+SLFQRSL+DLIKGIRL      E  FISK+ D+IRREIKSTD  TK+ ALQKLT
Sbjct  2    GSSIMDSLFQRSLEDLIKGIRL--NLLTEPTFISKSTDDIRREIKSTDLHTKSVALQKLT  59

Query  391  YLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            YL +++G+DMSWAAFH +EL S+ +F +K+IAYLAA  SF
Sbjct  60   YLSALYGLDMSWAAFHVVELMSSSAFAHKKIAYLAAAHSF  99



>ref|XP_004512869.1| PREDICTED: AP-3 complex subunit delta-like [Cicer arietinum]
Length=1014

 Score =   129 bits (323),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 62/98 (63%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = +1

Query  217  SLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYL  396
            S+M++LFQR+LDDLIK +RL      ES FISK++++IRREIKSTDPQTK+TAL+KLTYL
Sbjct  54   SIMDNLFQRTLDDLIKSMRL--QLLNESTFISKSIEDIRREIKSTDPQTKSTALEKLTYL  111

Query  397  HSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             +IHGVDMSWA+FH +E+ S+  F +K+I Y AA++SF
Sbjct  112  SAIHGVDMSWASFHVVEVMSSSLFSHKKIGYHAASISF  149



>gb|KFK39167.1| hypothetical protein AALP_AA3G208900 [Arabis alpina]
Length=860

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 79/98 (81%), Gaps = 2/98 (2%)
 Frame = +1

Query  217  SLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYL  396
            SLM+SLFQRSL+DLIKG+RL     GES FISK+++EIRREIK TD  TK+ ALQKL+YL
Sbjct  6    SLMDSLFQRSLEDLIKGLRL--QLLGESTFISKSLEEIRREIKQTDLSTKSVALQKLSYL  63

Query  397  HSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             ++HGVDMSWAAFHA+E+ S+  F +KRI Y A T SF
Sbjct  64   AALHGVDMSWAAFHAVEVVSSSRFAHKRIGYHAITQSF  101



>ref|XP_002524910.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37534.1| conserved hypothetical protein [Ricinus communis]
Length=848

 Score =   128 bits (321),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 63/102 (62%), Positives = 81/102 (79%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MA  SL+++LFQR+LDD+IKG+R      GES FISK V+EIRREIKSTD  TK+ ALQK
Sbjct  1    MASTSLIDTLFQRTLDDIIKGLR--HQQTGESAFISKIVEEIRREIKSTDLHTKSVALQK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            LTYL+S+H +DMSWAAFHA+E  S+ +F +K++ YLA + SF
Sbjct  59   LTYLNSLHFIDMSWAAFHAVECISSPNFSHKKLGYLAISQSF  100



>ref|XP_010465916.1| PREDICTED: AP-3 complex subunit delta-like [Camelina sativa]
Length=861

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 78/98 (80%), Gaps = 2/98 (2%)
 Frame = +1

Query  217  SLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYL  396
            SLM+SLFQRSL+DLIKGIRL     GES FISK++DEIRREIKSTD  TK+ ALQKL+YL
Sbjct  6    SLMDSLFQRSLEDLIKGIRL--QLHGESSFISKSLDEIRREIKSTDLSTKSIALQKLSYL  63

Query  397  HSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             ++HGVDMSWAAFHA+E+ S+  F  KRI Y A   SF
Sbjct  64   AALHGVDMSWAAFHAVEVVSSSRFEDKRIGYHAIAQSF  101



>ref|XP_008393324.1| PREDICTED: AP-3 complex subunit delta-like [Malus domestica]
Length=971

 Score =   128 bits (321),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 67/102 (66%), Positives = 80/102 (78%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MAG SLME+LFQR+L+DLIKG+RL     GES F+SKA+DEIRRE+KSTD  TKA AL K
Sbjct  1    MAGSSLMENLFQRTLEDLIKGLRL--QLIGESAFLSKALDEIRREVKSTDADTKANALHK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            LTYL S+H  DMS+AAFH +EL S+  F +K+IAY AA  SF
Sbjct  59   LTYLSSLHFYDMSFAAFHVVELLSSTRFSHKKIAYHAAAHSF  100



>ref|XP_008374775.1| PREDICTED: AP-3 complex subunit delta-like [Malus domestica]
Length=960

 Score =   127 bits (320),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 67/102 (66%), Positives = 80/102 (78%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MAG SLME+LFQR+L+DLIKG+RL     GES F+SKA+DEIRREIKSTD  TKA AL K
Sbjct  1    MAGSSLMENLFQRTLEDLIKGLRL--QLIGESAFLSKALDEIRREIKSTDADTKANALHK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            LTYL S+H  +MS+AAFH +EL S+  F +K+IAY AA  SF
Sbjct  59   LTYLSSLHFYNMSFAAFHVVELLSSTRFSHKKIAYHAAAHSF  100



>ref|XP_009360139.1| PREDICTED: AP-3 complex subunit delta-like [Pyrus x bretschneideri]
 ref|XP_009345482.1| PREDICTED: AP-3 complex subunit delta-like [Pyrus x bretschneideri]
Length=971

 Score =   127 bits (320),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 67/102 (66%), Positives = 80/102 (78%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MAG SLME+LFQR+L+DLIKG+RL     GES F+SKA+DEIRRE+KSTD  TKA AL K
Sbjct  1    MAGSSLMENLFQRTLEDLIKGLRL--QLIGESAFLSKALDEIRREVKSTDADTKANALHK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            LTYL S+H  DMS+AAFH +EL S+  F +K+IAY AA  SF
Sbjct  59   LTYLSSLHFYDMSFAAFHVVELLSSTRFSHKKIAYHAAAHSF  100



>ref|XP_006406623.1| hypothetical protein EUTSA_v10020046mg [Eutrema salsugineum]
 gb|ESQ48076.1| hypothetical protein EUTSA_v10020046mg [Eutrema salsugineum]
Length=862

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 78/98 (80%), Gaps = 2/98 (2%)
 Frame = +1

Query  217  SLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYL  396
            SLM+SLFQRSL+DLIKG+RL     GES FISK++DEIRREIK TD  TK+ ALQKL+YL
Sbjct  7    SLMDSLFQRSLEDLIKGLRL--QILGESTFISKSLDEIRREIKQTDLSTKSIALQKLSYL  64

Query  397  HSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             ++HGVDMSWAAFHA+E+ S+  F +KRI Y A   SF
Sbjct  65   AALHGVDMSWAAFHAVEVVSSSRFAHKRIGYHAIAQSF  102



>ref|XP_010907010.1| PREDICTED: AP-3 complex subunit delta-like [Elaeis guineensis]
Length=1022

 Score =   127 bits (319),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 66/100 (66%), Positives = 79/100 (79%), Gaps = 1/100 (1%)
 Frame = +1

Query  211  GPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLT  390
             PSL++SLFQRSLDDLIK +R     A E   +S+A+ EIRREI+S DP TKA ALQKLT
Sbjct  65   APSLVDSLFQRSLDDLIKSLRSQPASA-EPVLLSRALAEIRREIRSPDPDTKAVALQKLT  123

Query  391  YLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            YL SIHG+D SWAAFHA+EL  + S L+KR+AYLAA+LSF
Sbjct  124  YLSSIHGLDASWAAFHALELLPSPSPLHKRLAYLAASLSF  163



>ref|NP_175308.1| AP-3 complex subunit delta [Arabidopsis thaliana]
 ref|NP_849785.1| AP-3 complex subunit delta [Arabidopsis thaliana]
 ref|NP_001031156.1| AP-3 complex subunit delta [Arabidopsis thaliana]
 sp|Q9C744.1|AP3D_ARATH RecName: Full=AP-3 complex subunit delta; AltName: Full=Adaptor-related 
protein complex 3 subunit delta; AltName: Full=Delta-adaptin; 
Short=At-d-Ad; Short=At-delta-Ad; AltName: Full=Protein-affected 
trafficking 4 [Arabidopsis thaliana]
 gb|AAG60121.1|AC073555_5 delta-adaptin, putative [Arabidopsis thaliana]
 gb|AAL07009.1| At1g48760/F11I4_7 [Arabidopsis thaliana]
 gb|AEE32345.1| AP-3 complex subunit delta [Arabidopsis thaliana]
 gb|AEE32346.1| AP-3 complex subunit delta [Arabidopsis thaliana]
 gb|AEE32347.1| AP-3 complex subunit delta [Arabidopsis thaliana]
Length=869

 Score =   125 bits (315),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 64/98 (65%), Positives = 79/98 (81%), Gaps = 2/98 (2%)
 Frame = +1

Query  217  SLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYL  396
            S+M++LFQRSL+DLIKG RL     GES FIS+AV+EIRREIK+TD  TK+TAL KL+YL
Sbjct  7    SIMDNLFQRSLEDLIKGFRL--QLLGESNFISRAVEEIRREIKATDLSTKSTALHKLSYL  64

Query  397  HSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             ++HGVDMSWAAFHA+E+ S+  F +KRI Y A T SF
Sbjct  65   AALHGVDMSWAAFHAVEVVSSSRFQHKRIGYQAITQSF  102



>ref|XP_006580434.1| PREDICTED: AP-3 complex subunit delta-like [Glycine max]
Length=977

 Score =   126 bits (316),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 64/102 (63%), Positives = 80/102 (78%), Gaps = 3/102 (3%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            M+G S+ME+LFQR+L+DLIKG+RL     GES FISKA +EIRREIKSTD  TK+TAL K
Sbjct  1    MSG-SIMENLFQRTLEDLIKGMRL--QLIGESTFISKATEEIRREIKSTDQHTKSTALHK  57

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            L+YL ++H VDMSWA FH +E+ S+  F +KRI Y AA+ SF
Sbjct  58   LSYLSAVHAVDMSWACFHVVEVMSSSKFAHKRIGYHAASQSF  99



>ref|XP_004300510.1| PREDICTED: AP-3 complex subunit delta [Fragaria vesca subsp. 
vesca]
Length=963

 Score =   125 bits (315),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 65/102 (64%), Positives = 82/102 (80%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MAG S+M++LFQR+L+DLIKG+RL S    ES F+SK++DEIRRE KSTDP TK+TAL K
Sbjct  1    MAGFSVMDTLFQRTLEDLIKGLRLHS--LNESSFLSKSLDEIRREAKSTDPDTKSTALLK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            LTYL S+H  DMS+AAFH +EL S+  F +K+IAY AA+ SF
Sbjct  59   LTYLSSLHFHDMSFAAFHVVELLSSTRFSHKKIAYHAASHSF  100



>ref|XP_002894132.1| delta-adaptin [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70391.1| delta-adaptin [Arabidopsis lyrata subsp. lyrata]
Length=863

 Score =   125 bits (315),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 64/98 (65%), Positives = 79/98 (81%), Gaps = 2/98 (2%)
 Frame = +1

Query  217  SLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYL  396
            S+M++LFQRSL+DLIKG RL     GES FIS+A++EIRREIKSTD  TK+TAL KL+YL
Sbjct  7    SIMDNLFQRSLEDLIKGFRL--QLLGESNFISRALEEIRREIKSTDLSTKSTALHKLSYL  64

Query  397  HSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             ++HGVDMSWAAFHA+E+ S+  F +KRI Y A T SF
Sbjct  65   AALHGVDMSWAAFHAVEVVSSSRFQHKRIGYQAITQSF  102



>gb|KHN21597.1| AP-3 complex subunit delta [Glycine soja]
Length=977

 Score =   125 bits (315),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 3/102 (3%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            M+G S+ME+LFQR+L+DLIKG+RL     GES FIS A +EIRRE+KSTD  TK+TALQK
Sbjct  1    MSG-SIMENLFQRTLEDLIKGMRL--QLIGESTFISNATEEIRREVKSTDQHTKSTALQK  57

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            L+YL ++H VDMSWA FH +E+ S+  F +KRI Y AA+ SF
Sbjct  58   LSYLSAVHAVDMSWACFHVVEVMSSSKFAHKRIGYHAASQSF  99



>ref|XP_002885247.1| hypothetical protein ARALYDRAFT_341963 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61506.1| hypothetical protein ARALYDRAFT_341963 [Arabidopsis lyrata subsp. 
lyrata]
Length=886

 Score =   125 bits (315),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 79/98 (81%), Gaps = 5/98 (5%)
 Frame = +1

Query  217  SLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYL  396
            SLM++LFQRSL+DLIKG+RL     GES F+SK++++IRREIKSTD  TK+ ALQKLTYL
Sbjct  6    SLMDNLFQRSLEDLIKGLRL-----GESFFLSKSLEDIRREIKSTDLSTKSIALQKLTYL  60

Query  397  HSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             ++HGVDMSWAAFHA+E+ S+  F  KRI Y A T SF
Sbjct  61   AALHGVDMSWAAFHAVEVVSSSRFSDKRIGYHAITQSF  98



>emb|CBI15478.3| unnamed protein product [Vitis vinifera]
Length=868

 Score =   125 bits (313),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 63/96 (66%), Positives = 77/96 (80%), Gaps = 2/96 (2%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            M+SLFQRSL+DLIKGIRL      E  FISK+ D+IRREIKSTD  TK+ ALQKLTYL +
Sbjct  1    MDSLFQRSLEDLIKGIRL--NLLTEPTFISKSTDDIRREIKSTDLHTKSVALQKLTYLSA  58

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            ++G+DMSWAAFH +EL S+ +F +K+IAYLAA  SF
Sbjct  59   LYGLDMSWAAFHVVELMSSSAFAHKKIAYLAAAHSF  94



>emb|CDY04318.1| BnaC05g25800D [Brassica napus]
Length=803

 Score =   125 bits (313),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 63/97 (65%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +1

Query  220  LMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLH  399
            LM+++FQRSL+DLIKG RL     GES FIS+A++EIRREIK+TD  TK+TAL KL+YL 
Sbjct  7    LMDNMFQRSLEDLIKGFRL--QLLGESSFISRALEEIRREIKATDLSTKSTALHKLSYLA  64

Query  400  SIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            +IHGVDMSWAAFHA+E+ S+  F +KRI Y A T SF
Sbjct  65   AIHGVDMSWAAFHAVEVVSSSRFHHKRIGYQAITQSF  101



>ref|XP_006296990.1| hypothetical protein CARUB_v10012984mg [Capsella rubella]
 gb|EOA29888.1| hypothetical protein CARUB_v10012984mg [Capsella rubella]
Length=825

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 76/98 (78%), Gaps = 2/98 (2%)
 Frame = +1

Query  217  SLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYL  396
            SLM+SLFQRSL+DLIKGIRL     GES FISK+VDEIR EIK TD  TK+ ALQKL+YL
Sbjct  6    SLMDSLFQRSLEDLIKGIRLHL--LGESSFISKSVDEIRSEIKLTDLSTKSIALQKLSYL  63

Query  397  HSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             ++HGVDMSWAAFHA+E+ S+  F  KRI Y A   SF
Sbjct  64   AALHGVDMSWAAFHAVEVVSSSRFGDKRIGYHAIAQSF  101



>ref|XP_010094731.1| AP-3 complex subunit delta [Morus notabilis]
 gb|EXB56896.1| AP-3 complex subunit delta [Morus notabilis]
Length=973

 Score =   124 bits (310),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 64/102 (63%), Positives = 79/102 (77%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MAG SL ++LFQR+L+DLIKG+R+     GE+ FISKA+DEIRREIKSTDP  KA ALQK
Sbjct  1    MAGSSLRDTLFQRTLEDLIKGLRM--SFIGETAFISKAMDEIRREIKSTDPYIKAVALQK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            L+YL S+H   MS+AAFH +EL S+  F +KRIAY  A+ SF
Sbjct  59   LSYLSSLHFYGMSFAAFHVVELLSSTRFSHKRIAYHCASHSF  100



>ref|XP_010500417.1| PREDICTED: AP-3 complex subunit delta-like [Camelina sativa]
Length=870

 Score =   123 bits (309),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 63/98 (64%), Positives = 78/98 (80%), Gaps = 2/98 (2%)
 Frame = +1

Query  217  SLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYL  396
            S+M++LFQRSL+DLIKG RL     GES FIS+A++EIRREIK TD  TK+TAL KL+YL
Sbjct  7    SIMDNLFQRSLEDLIKGFRL--QLLGESNFISRALEEIRREIKVTDLSTKSTALHKLSYL  64

Query  397  HSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             ++HGVDMSWAAFHA+E+ S+  F +KRI Y A T SF
Sbjct  65   AALHGVDMSWAAFHAVEVVSSPRFQHKRIGYQAITQSF  102



>emb|CDY24454.1| BnaC05g35000D [Brassica napus]
Length=854

 Score =   123 bits (309),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 63/98 (64%), Positives = 78/98 (80%), Gaps = 5/98 (5%)
 Frame = +1

Query  217  SLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYL  396
            SLM+SLFQRSL+DLIKG+RL     GES FISK+++EIRREIK TD  TK+ ALQKL+YL
Sbjct  6    SLMDSLFQRSLEDLIKGLRL-----GESTFISKSLEEIRREIKLTDLSTKSVALQKLSYL  60

Query  397  HSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             ++HGVDM+WAAFHA+E+ S+  F +KRI Y A   SF
Sbjct  61   AALHGVDMTWAAFHAVEVVSSSRFAHKRIGYHAIAQSF  98



>ref|XP_010461702.1| PREDICTED: AP-3 complex subunit delta-like isoform X1 [Camelina 
sativa]
 ref|XP_010461703.1| PREDICTED: AP-3 complex subunit delta-like isoform X2 [Camelina 
sativa]
Length=865

 Score =   123 bits (309),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 63/98 (64%), Positives = 78/98 (80%), Gaps = 2/98 (2%)
 Frame = +1

Query  217  SLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYL  396
            S+M++LFQRSL+DLIKG RL     GES FIS+A++EIRREIK TD  TK+TAL KL+YL
Sbjct  7    SIMDNLFQRSLEDLIKGFRL--QLLGESNFISRALEEIRREIKVTDLSTKSTALHKLSYL  64

Query  397  HSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             ++HGVDMSWAAFHA+E+ S+  F +KRI Y A T SF
Sbjct  65   AALHGVDMSWAAFHAVEVVSSPRFQHKRIGYQAITQSF  102



>ref|XP_002960406.1| hypothetical protein SELMODRAFT_867, partial [Selaginella moellendorffii]
 gb|EFJ37945.1| hypothetical protein SELMODRAFT_867, partial [Selaginella moellendorffii]
Length=612

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            M+ LFQRSLDDL+KG+R  +  +GES +++KA++EIR+EIK+TDP  KA A+ KL YL++
Sbjct  1    MDYLFQRSLDDLVKGLRSQAAASGESRYVAKALEEIRKEIKATDPHIKAAAVHKLAYLNA  60

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            +HGVDM+WAAF  +E+ S   F +K+I YLAA+ SF
Sbjct  61   LHGVDMAWAAFQVVEVMSMPKFSHKKIGYLAASQSF  96



>ref|XP_010479304.1| PREDICTED: AP-3 complex subunit delta [Camelina sativa]
Length=867

 Score =   123 bits (308),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 63/98 (64%), Positives = 78/98 (80%), Gaps = 2/98 (2%)
 Frame = +1

Query  217  SLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYL  396
            S+M++LFQRSL+DLIKG RL     GES FIS+A++EIRREIK TD  TK+TAL KL+YL
Sbjct  7    SIMDNLFQRSLEDLIKGFRL--QLLGESNFISRALEEIRREIKVTDLSTKSTALHKLSYL  64

Query  397  HSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             ++HGVDMSWAAFHA+E+ S+  F +KRI Y A T SF
Sbjct  65   AALHGVDMSWAAFHAVEVVSSPRFQHKRIGYEAITQSF  102



>ref|XP_006305898.1| hypothetical protein CARUB_v10011071mg [Capsella rubella]
 gb|EOA38796.1| hypothetical protein CARUB_v10011071mg [Capsella rubella]
Length=871

 Score =   123 bits (308),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 63/98 (64%), Positives = 78/98 (80%), Gaps = 2/98 (2%)
 Frame = +1

Query  217  SLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYL  396
            S+M++LFQRSL+DLIKG RL     GES FIS+A++EIRREIK TD  TK+TAL KL+YL
Sbjct  7    SIMDNLFQRSLEDLIKGFRL--QLLGESNFISRALEEIRREIKVTDLSTKSTALHKLSYL  64

Query  397  HSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             ++HGVDMSWAAFHA+E+ S+  F +KRI Y A T SF
Sbjct  65   AALHGVDMSWAAFHAVEVVSSSRFQHKRIGYQAITQSF  102



>ref|XP_002967314.1| hypothetical protein SELMODRAFT_87265 [Selaginella moellendorffii]
 gb|EFJ31913.1| hypothetical protein SELMODRAFT_87265 [Selaginella moellendorffii]
Length=880

 Score =   123 bits (308),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +1

Query  217  SLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYL  396
            ++M+ LFQRSLDDL+KG+R  +  +GES +++KA++EIR+EIK+TDP  KA A+ KL YL
Sbjct  3    AVMDYLFQRSLDDLVKGLRSQAAASGESRYVAKALEEIRKEIKATDPHIKAAAVHKLAYL  62

Query  397  HSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            +++HGVDM+WAAF  +E+ S   F +K+I YLAA+ SF
Sbjct  63   NALHGVDMAWAAFQVVEVMSMPKFSHKKIGYLAASQSF  100



>emb|CDY68338.1| BnaAnng26940D [Brassica napus]
Length=850

 Score =   122 bits (307),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 62/96 (65%), Positives = 77/96 (80%), Gaps = 2/96 (2%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            M++LFQRSL+DLIKG RL     G+S FIS+A++EIRREIK+TD  TK+TAL KL+YL +
Sbjct  1    MDNLFQRSLEDLIKGFRL--QLLGDSSFISRALEEIRREIKATDLSTKSTALHKLSYLAA  58

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            IHGVDMSWAAFHA+E+ S+  F +KRI Y A T SF
Sbjct  59   IHGVDMSWAAFHALEVVSSSRFHHKRIGYQAITQSF  94



>ref|XP_009145908.1| PREDICTED: AP-3 complex subunit delta-like [Brassica rapa]
Length=856

 Score =   122 bits (307),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 62/98 (63%), Positives = 78/98 (80%), Gaps = 5/98 (5%)
 Frame = +1

Query  217  SLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYL  396
            SLM+SLFQRSL+DLIKG+RL     GES FIS++++EIRREIK TD  TK+ ALQKL+YL
Sbjct  6    SLMDSLFQRSLEDLIKGLRL-----GESTFISRSLEEIRREIKLTDLSTKSVALQKLSYL  60

Query  397  HSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             ++HGVDM+WAAFHA+E+ S+  F +KRI Y A   SF
Sbjct  61   AALHGVDMAWAAFHAVEVVSSSRFAHKRIGYHAIAQSF  98



>emb|CDX92225.1| BnaA05g21820D [Brassica napus]
Length=856

 Score =   122 bits (306),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 62/98 (63%), Positives = 78/98 (80%), Gaps = 5/98 (5%)
 Frame = +1

Query  217  SLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYL  396
            SLM+SLFQRSL+DLIKG+RL     GES FIS++++EIRREIK TD  TK+ ALQKL+YL
Sbjct  6    SLMDSLFQRSLEDLIKGLRL-----GESTFISRSLEEIRREIKLTDLSTKSVALQKLSYL  60

Query  397  HSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             ++HGVDM+WAAFHA+E+ S+  F +KRI Y A   SF
Sbjct  61   AALHGVDMAWAAFHAVEVVSSSRFAHKRIGYHAIAQSF  98



>ref|XP_009144999.1| PREDICTED: LOW QUALITY PROTEIN: AP-3 complex subunit delta [Brassica 
rapa]
Length=836

 Score =   122 bits (305),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 61/96 (64%), Positives = 77/96 (80%), Gaps = 2/96 (2%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            M++LFQRSL+DLIKG RL     G+S FIS+A++E+RREIK+TD  TK+TAL KL+YL +
Sbjct  1    MDNLFQRSLEDLIKGFRL--QLLGDSSFISRALEELRREIKATDLSTKSTALHKLSYLAA  58

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            IHGVDMSWAAFHA+E+ S+  F +KRI Y A T SF
Sbjct  59   IHGVDMSWAAFHALEVVSSSRFHHKRIGYQAITQSF  94



>ref|XP_010506684.1| PREDICTED: AP-3 complex subunit delta-like [Camelina sativa]
Length=859

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 76/98 (78%), Gaps = 2/98 (2%)
 Frame = +1

Query  217  SLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYL  396
            SLM SLFQRSL+DLIKGIRL     G+S FISK++DEIRREIK TD  TK+ ALQKL+YL
Sbjct  6    SLMYSLFQRSLEDLIKGIRL--QLHGDSSFISKSLDEIRREIKLTDLSTKSIALQKLSYL  63

Query  397  HSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             ++HGVDMSWAAFHA+E+ S+  F  KRI Y A   SF
Sbjct  64   AALHGVDMSWAAFHAVEVVSSSRFGDKRIGYHAIAQSF  101



>ref|XP_010922047.1| PREDICTED: LOW QUALITY PROTEIN: AP-3 complex subunit delta-like 
[Elaeis guineensis]
Length=968

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 79/102 (77%), Gaps = 6/102 (6%)
 Frame = +1

Query  220  LMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLH  399
            L++SLFQRSLDDLIK +R    GA E   +S+A+ EIRREI+S+DP TKA ALQKLTYL 
Sbjct  15   LVDSLFQRSLDDLIKSLRSQPAGA-EPTLLSRALAEIRREIRSSDPDTKAIALQKLTYLS  73

Query  400  SIHGVDMSWAAFHAIELSSAQSFLYK-----RIAYLAATLSF  510
            S+HG+D SWAAFHA+EL  + S L+K     R+AYLAA+LSF
Sbjct  74   SLHGLDASWAAFHALELLPSPSPLHKRLAYLRLAYLAASLSF  115



>gb|KJB52992.1| hypothetical protein B456_008G287400 [Gossypium raimondii]
Length=925

 Score =   120 bits (302),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 63/102 (62%), Positives = 81/102 (79%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            M+GPSLM+SLFQR+L+DLIKG+R      GE  FISKA++EIR+EIKSTD  TK+TAL K
Sbjct  1    MSGPSLMDSLFQRTLEDLIKGLR--QQLIGEQAFISKALEEIRKEIKSTDLSTKSTALLK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            L YL ++H  DMS+AAFHA+E+ S+  F +K+IAY A +LSF
Sbjct  59   LCYLSNLHFHDMSFAAFHALEVLSSPRFSHKKIAYHAISLSF  100



>gb|KJB52993.1| hypothetical protein B456_008G287400 [Gossypium raimondii]
Length=779

 Score =   120 bits (300),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 63/102 (62%), Positives = 81/102 (79%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            M+GPSLM+SLFQR+L+DLIKG+R      GE  FISKA++EIR+EIKSTD  TK+TAL K
Sbjct  1    MSGPSLMDSLFQRTLEDLIKGLR--QQLIGEQAFISKALEEIRKEIKSTDLSTKSTALLK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            L YL ++H  DMS+AAFHA+E+ S+  F +K+IAY A +LSF
Sbjct  59   LCYLSNLHFHDMSFAAFHALEVLSSPRFSHKKIAYHAISLSF  100



>ref|XP_006842352.1| hypothetical protein AMTR_s00079p00176010 [Amborella trichopoda]
 gb|ERN04027.1| hypothetical protein AMTR_s00079p00176010 [Amborella trichopoda]
Length=948

 Score =   116 bits (291),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 55/99 (56%), Positives = 78/99 (79%), Gaps = 2/99 (2%)
 Frame = +1

Query  214  PSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTY  393
            P++++SL QRSL+DLIKG+R+     GE+ +++KA+++IR+EIKSTD Q KA ALQKLTY
Sbjct  3    PAIVDSLLQRSLEDLIKGLRI--QMIGETQYLNKAMEDIRKEIKSTDHQMKAIALQKLTY  60

Query  394  LHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            L+ +HG DM+WA+FH +E+ S   F +K+I YLAA  SF
Sbjct  61   LNMLHGFDMNWASFHVVEVMSMPRFFHKKIGYLAACQSF  99



>ref|XP_001777950.1| predicted protein [Physcomitrella patens]
 gb|EDQ57274.1| predicted protein, partial [Physcomitrella patens]
Length=565

 Score =   113 bits (282),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 55/96 (57%), Positives = 74/96 (77%), Gaps = 2/96 (2%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            MESLFQR+LDDL+KG+RL     GES +++KA++E+R+E+KSTDP  K TALQKLTYL  
Sbjct  1    MESLFQRTLDDLVKGLRL--QMVGESRYLAKALEEVRKEMKSTDPIIKVTALQKLTYLQM  58

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
              G DMSWA+F A+E+ +   F +K++ YLAA+ SF
Sbjct  59   ACGADMSWASFCAVEVMTMTRFSHKKVGYLAASQSF  94



>ref|XP_008797681.1| PREDICTED: LOW QUALITY PROTEIN: AP-3 complex subunit delta-like 
[Phoenix dactylifera]
Length=912

 Score =   114 bits (285),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = +1

Query  208  AGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKL  387
              PSL++SLFQRSLDDLIK +R    GA E   +S+AV EIRREI+S DP TKA ALQKL
Sbjct  21   PAPSLVDSLFQRSLDDLIKALRSQPAGA-EPSLLSRAVAEIRREIRSPDPDTKAVALQKL  79

Query  388  TYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAA  498
            TYL S+HG+D SWAAFHA+EL  + S L     +LA 
Sbjct  80   TYLSSLHGLDASWAAFHALELLPSPSPLPDLALHLAP  116



>ref|XP_009396369.1| PREDICTED: AP-3 complex subunit delta-like [Musa acuminata subsp. 
malaccensis]
Length=938

 Score =   112 bits (280),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 61/102 (60%), Positives = 80/102 (78%), Gaps = 1/102 (1%)
 Frame = +1

Query  208  AGPSLMESLFQRSLDDLIKGIRLFSGGAG-ESGFISKAVDEIRREIKSTDPQTKATALQK  384
            + PSL+++LFQRSLDDLI+ +R  S  +  E+  I++A+DEIRREI+S D  TKA ALQK
Sbjct  6    SAPSLVDTLFQRSLDDLIRSLRSSSSSSVLEAAAITRALDEIRREIRSPDLDTKAVALQK  65

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            LTYL S+H +DMSWAAFHA+EL  + S  + R+AYLAA+LSF
Sbjct  66   LTYLASLHHLDMSWAAFHALELLPSPSLPHPRVAYLAASLSF  107



>gb|KFK26686.1| hypothetical protein AALP_AA8G280000 [Arabis alpina]
Length=863

 Score =   107 bits (268),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 57/97 (59%), Positives = 74/97 (76%), Gaps = 2/97 (2%)
 Frame = +1

Query  220  LMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLH  399
            LM++LFQR+L+DLIK  R       ES +ISK+++EIR EIKSTD  TK+TALQKLTYL 
Sbjct  14   LMDNLFQRNLEDLIKSFR--HNLLRESTYISKSLEEIRNEIKSTDLTTKSTALQKLTYLA  71

Query  400  SIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            ++H VDMS+AAFHA+E+ S+  F +K+I Y A T SF
Sbjct  72   ALHNVDMSFAAFHAVEVISSSKFHHKKIGYQAITQSF  108



>ref|XP_004968829.1| PREDICTED: AP-3 complex subunit delta-like [Setaria italica]
Length=948

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 74/103 (72%), Gaps = 2/103 (2%)
 Frame = +1

Query  208  AGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKL  387
            AGPSL+++LFQRSLDDL+K +R     AGES  +++A+ EI REI++ D  TKA ALQKL
Sbjct  14   AGPSLVDTLFQRSLDDLVKSLRSDPSAAGESAAVARALSEIHREIRAPDAATKAVALQKL  73

Query  388  TYLHSIH--GVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            TYL S+H   V     AF AIEL ++ S  +KR+AYLAA+LS 
Sbjct  74   TYLSSLHFAPVASHPLAFPAIELLASPSLPHKRLAYLAASLSL  116



>ref|XP_007036565.1| Delta-adaptin [Theobroma cacao]
 gb|EOY21066.1| Delta-adaptin [Theobroma cacao]
Length=941

 Score =   105 bits (261),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 61/102 (60%), Positives = 82/102 (80%), Gaps = 2/102 (2%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            M+GPSL++SLFQR+L+DLIKG+R      GE  FISKA++EIR+EIKSTD  TK+TAL K
Sbjct  1    MSGPSLIDSLFQRTLEDLIKGLR--QQLIGEQAFISKALEEIRKEIKSTDLSTKSTALLK  58

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            L+YL S+H  DM++A+FHA+E+ S+  F +K+IAY A +LSF
Sbjct  59   LSYLSSLHFHDMAFASFHALEVLSSPRFSHKKIAYHAISLSF  100



>ref|XP_009395567.1| PREDICTED: AP-3 complex subunit delta-like [Musa acuminata subsp. 
malaccensis]
Length=961

 Score =   103 bits (257),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 59/97 (61%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = +1

Query  220  LMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLH  399
            L+++LFQRSLDDLI+ +R  S  A E+  I++A+DEIRREI+S D  TK  ALQKLTYL 
Sbjct  13   LIDTLFQRSLDDLIRVLRSSSSAALEAAAIARALDEIRREIRSPDLDTKVVALQKLTYLA  72

Query  400  SIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            S+H  DMSWAAFHA+EL  + S    R AYLAA+LSF
Sbjct  73   SLHHFDMSWAAFHALELLPSTSLPQPRAAYLAASLSF  109



>gb|ESA02637.1| hypothetical protein GLOINDRAFT_337273 [Rhizophagus irregularis 
DAOM 181602]
Length=1245

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 48/93 (52%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F+++L DLI+GIR  +    E  +I+  + EIR+E+KS DP  KA A+ KLTYL  + G
Sbjct  1    MFEKTLTDLIRGIR--TNKKNEQKYIAACLQEIRQEVKSNDPDVKAVAISKLTYLQML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH +E+ S+  FL KRI YLAAT SF
Sbjct  58   YDMSWASFHVVEVMSSAKFLQKRIGYLAATQSF  90



>ref|XP_008879710.1| hypothetical protein H310_13840 [Aphanomyces invadans]
 gb|ETV91784.1| hypothetical protein H310_13840 [Aphanomyces invadans]
Length=895

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 49/93 (53%), Positives = 68/93 (73%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F+++L DL+KGIR   G    S +IS+ + EI+ E+KSTDP  KA A++KLTYL ++ G
Sbjct  1    MFEKTLADLVKGIRACKGDV--SVYISQCMQEIKTELKSTDPFVKAQAIRKLTYL-NMQG  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWAAFH +E+ S + F +KRI YLAA+ SF
Sbjct  58   YDMSWAAFHTVEVMSYERFAHKRIGYLAASQSF  90



>gb|EXX63225.1| Apl5p [Rhizophagus irregularis DAOM 197198w]
 gb|EXX71451.1| Apl5p [Rhizophagus irregularis DAOM 197198w]
 gb|EXX71454.1| Apl5p [Rhizophagus irregularis DAOM 197198w]
 gb|EXX73063.1| Apl5p [Rhizophagus irregularis DAOM 197198w]
Length=1252

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 48/93 (52%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F+++L DLI+GIR  +    E  +I+  + EIR+E+KS DP  KA A+ KLTYL  + G
Sbjct  1    MFEKTLTDLIRGIR--TNKKNEQKYIAACLQEIRQEVKSNDPDVKAVAISKLTYLQML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH +E+ S+  FL KRI YLAAT SF
Sbjct  58   YDMSWASFHVVEVMSSAKFLQKRIGYLAATQSF  90



>ref|NP_001146284.1| uncharacterized protein LOC100279859 [Zea mays]
 gb|ACL53627.1| unknown [Zea mays]
Length=876

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 72/102 (71%), Gaps = 2/102 (2%)
 Frame = +1

Query  211  GPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLT  390
             PSL+++LFQRSL+DL+K +R     AGE+  +++A+ EI REI++ D  TK+ A+QKLT
Sbjct  11   APSLVDTLFQRSLNDLVKSLRADPSAAGEAPAVTRALSEIHREIRAPDAATKSVAVQKLT  70

Query  391  YLHSIHGVDMS--WAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            YL S+H   +S    AF AIEL ++    +KR+AYLAA+LS 
Sbjct  71   YLSSLHFAPVSSHPLAFPAIELLASPHLPHKRLAYLAASLSL  112



>ref|XP_008672722.1| PREDICTED: uncharacterized protein LOC100279859 isoform X1 [Zea 
mays]
 gb|ACR36472.1| unknown [Zea mays]
 tpg|DAA55276.1| TPA: hypothetical protein ZEAMMB73_773793 [Zea mays]
Length=941

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 72/102 (71%), Gaps = 2/102 (2%)
 Frame = +1

Query  211  GPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLT  390
             PSL+++LFQRSL+DL+K +R     AGE+  +++A+ EI REI++ D  TK+ A+QKLT
Sbjct  11   APSLVDTLFQRSLNDLVKSLRADPSAAGEAPAVTRALSEIHREIRAPDAATKSVAVQKLT  70

Query  391  YLHSIHGVDMS--WAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            YL S+H   +S    AF AIEL ++    +KR+AYLAA+LS 
Sbjct  71   YLSSLHFAPVSSHPLAFPAIELLASPHLPHKRLAYLAASLSL  112



>gb|KIY72913.1| Adaptor protein complex AP-3 delta subunit [Cylindrobasidium 
torrendii FP15055 ss-10]
Length=879

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 51/93 (55%), Positives = 68/93 (73%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  S  + ES FISKAVDEIRREI+S D + KA A+ KLTYL  + G
Sbjct  1    MWERTLQDLIRGLR--SNKSDESKFISKAVDEIRREIRSDDMELKAGAVLKLTYLDML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+F+ +E+ S+  F  K + YLAAT SF
Sbjct  58   YDMSWASFNVVEVMSSSKFHLKSVGYLAATQSF  90



>ref|XP_009840021.1| hypothetical protein H257_14009 [Aphanomyces astaci]
 gb|ETV70309.1| hypothetical protein H257_14009 [Aphanomyces astaci]
Length=881

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 48/93 (52%), Positives = 69/93 (74%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F+++L DL+KGIR   G    S +IS+++ EI+ E+KSTDP  K+ A++KLTYL ++ G
Sbjct  1    MFEKTLADLVKGIRSCKGDV--SVYISQSMQEIKTELKSTDPFIKSQAIRKLTYL-NMQG  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWAAFH +E+ S + F +KRI YLAA+ SF
Sbjct  58   YDMSWAAFHTVEVMSYERFAHKRIGYLAASQSF  90



>ref|XP_002676406.1| predicted protein [Naegleria gruberi]
 gb|EFC43662.1| predicted protein [Naegleria gruberi]
Length=512

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 47/93 (51%), Positives = 66/93 (71%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F++SL D++KGIR  +  A E  +I   V EI+ E+++ D + KA A+QKLTYLH + G
Sbjct  1    MFEKSLQDMVKGIR--ANKATEDAYIRSCVSEIKDELRANDIKKKAVAVQKLTYLHML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DM+WAAFH +E+ S+  F YKRI YLAA+L F
Sbjct  58   YDMNWAAFHILEVMSSPIFTYKRIGYLAASLGF  90



>ref|XP_008032162.1| Ap3d1 protein [Trametes versicolor FP-101664 SS1]
 gb|EIW64489.1| Ap3d1 protein [Trametes versicolor FP-101664 SS1]
Length=923

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 50/93 (54%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +    ES FI++AVDEIR EIKS D + KA A+ KLTYLH + G
Sbjct  1    MWERTLQDLIRGLR--ANKKDESKFIAQAVDEIRNEIKSKDMEIKAAAVLKLTYLHML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH +E+ S      K I YLAA LSF
Sbjct  58   YDMSWASFHVVEVMSVPRIHLKTIGYLAAVLSF  90



>ref|XP_009530641.1| hypothetical protein PHYSODRAFT_346958 [Phytophthora sojae]
 gb|EGZ13212.1| hypothetical protein PHYSODRAFT_346958 [Phytophthora sojae]
Length=1103

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 49/97 (51%), Positives = 68/97 (70%), Gaps = 3/97 (3%)
 Frame = +1

Query  220  LMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLH  399
            L  ++F+++L DL+KGIR   G    S +IS+A+ EI+ E++STDP  KA A++KLTYLH
Sbjct  74   LATAMFEKNLQDLVKGIRSAKGDV--SVYISQALQEIKAELRSTDPFVKAQAVRKLTYLH  131

Query  400  SIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             + G DM WAAFH +E+ S + F +KRI Y AA  SF
Sbjct  132  ML-GYDMCWAAFHVVEVMSYERFAHKRIGYNAACQSF  167



>ref|XP_003084451.1| AP3D1 protein (ISS) [Ostreococcus tauri]
Length=1139

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 48/93 (52%), Positives = 66/93 (71%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            LFQ+SL D+I GIR    G  E  FI+K + ++R E++S+D +TKA A++K TYLHS+ G
Sbjct  31   LFQKSLRDMITGIRAHKDGQRE--FINKCLVDVRTEVQSSDVRTKAVAIEKATYLHSL-G  87

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
              M WA+FH +EL S Q+  YKR+ YLAA+ SF
Sbjct  88   HSMHWASFHVVELMSTQNVKYKRVGYLAASQSF  120



>emb|CDO73429.1| hypothetical protein BN946_scf185013.g63 [Trametes cinnabarina]
Length=915

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +    ES FI++AVDEIR EIK  D + KA A+ KLTYLH + G
Sbjct  1    MWERTLQDLIRGLR--ANKKDESKFIAQAVDEIRNEIKHKDMEIKAAAVLKLTYLHML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH +E+ SA     K I YLAAT SF
Sbjct  58   YDMSWASFHVVEVMSAPRIHLKTIGYLAATQSF  90



>gb|KDQ31388.1| hypothetical protein PLEOSDRAFT_1075478 [Pleurotus ostreatus 
PC15]
Length=860

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 49/93 (53%), Positives = 66/93 (71%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +    ES FISKAVDEIR EIKS D + KA A+ KLTYL  + G
Sbjct  1    MWERTLQDLIRGLR--ANKKDESKFISKAVDEIRTEIKSEDMELKAGAVLKLTYLDML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH +E+ S+  +  K + YLAAT +F
Sbjct  58   YDMSWASFHVVEVMSSPRYHLKTVGYLAATQTF  90



>emb|CEG00870.1| Clathrin/coatomer adaptor,adaptin-like,N-terminal [Ostreococcus 
tauri]
Length=963

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 48/93 (52%), Positives = 66/93 (71%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            LFQ+SL D+I GIR    G  E  FI+K + ++R E++S+D +TKA A++K TYLHS+ G
Sbjct  31   LFQKSLRDMITGIRAHKDGQRE--FINKCLVDVRTEVQSSDVRTKAVAIEKATYLHSL-G  87

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
              M WA+FH +EL S Q+  YKR+ YLAA+ SF
Sbjct  88   HSMHWASFHVVELMSTQNVKYKRVGYLAASQSF  120



>ref|XP_007325694.1| hypothetical protein AGABI1DRAFT_117402 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM83933.1| hypothetical protein AGABI1DRAFT_117402 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=897

 Score = 94.0 bits (232),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 50/93 (54%), Positives = 64/93 (69%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +    ES FI KAVDEIR+EIKS D + KA A+ KLTYL  + G
Sbjct  1    MWERTLQDLIRGLR--ANKKDESKFIGKAVDEIRQEIKSDDMELKAGAVLKLTYL-DMMG  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH IE  S+  F  K + YLAA  SF
Sbjct  58   YDMSWASFHVIEAMSSPKFHLKSVGYLAAAQSF  90



>ref|XP_006454290.1| hypothetical protein AGABI2DRAFT_197206 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV51308.1| hypothetical protein AGABI2DRAFT_197206 [Agaricus bisporus var. 
bisporus H97]
Length=898

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 50/93 (54%), Positives = 64/93 (69%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +    ES FI KAVDEIR+EIKS D + KA A+ KLTYL  + G
Sbjct  1    MWERTLQDLIRGLR--ANKKDESKFIGKAVDEIRQEIKSDDMELKAGAVLKLTYL-DMMG  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH IE  S+  F  K + YLAA  SF
Sbjct  58   YDMSWASFHVIEAMSSPKFHLKSVGYLAAAQSF  90



>gb|EPB87573.1| hypothetical protein HMPREF1544_05664 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=834

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 47/93 (51%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F++SL DLI+GIR  +    E  +I+  + EIR E+KS D   K+TA+ KLTYL  + G
Sbjct  1    MFEKSLTDLIRGIR--ANKKNEQKYIAVCLQEIRNEVKSNDLDIKSTAVAKLTYLQML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+F+ +E+ S+  FL+KR  YLAATLSF
Sbjct  58   YDMSWASFYMVEVMSSTKFLHKRTGYLAATLSF  90



>emb|CEP17621.1| hypothetical protein [Parasitella parasitica]
Length=1168

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 48/93 (52%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F++SL DLI+GIR  +    E  +I+  + EIR E+KS D   KATA+ KLTYL  + G
Sbjct  1    MFEKSLTDLIRGIR--ANKKNEQKYIAVCLQEIRNEVKSNDLDIKATAVAKLTYLQML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+F+ +E+ S+  FL+KR  YLAATLSF
Sbjct  58   YDMSWASFYMVEVMSSPKFLHKRTGYLAATLSF  90



>ref|XP_008662607.1| PREDICTED: AP-3 complex subunit delta-like [Zea mays]
Length=941

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 71/102 (70%), Gaps = 2/102 (2%)
 Frame = +1

Query  211  GPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLT  390
             PSL+++LFQRSL+DL+K +R      GE+  +++A+ EI REI++ D  TK+ ALQKLT
Sbjct  11   APSLVDTLFQRSLNDLVKFLRADPSSTGEAAAVARALSEIHREIRAPDAATKSVALQKLT  70

Query  391  YLHSIHGVDMS--WAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            YL S+H   ++    AF AIEL ++    +KR+AYLAA+LS 
Sbjct  71   YLSSLHFAPIASHPLAFLAIELLASPHLPHKRLAYLAASLSL  112



>ref|XP_008908689.1| hypothetical protein PPTG_13960 [Phytophthora parasitica INRA-310]
 gb|ETN06187.1| hypothetical protein PPTG_13960 [Phytophthora parasitica INRA-310]
Length=1004

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 47/93 (51%), Positives = 66/93 (71%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F+++L DL+KGIR   G    + +IS+A+ EI+ E++STDP  KA A++KLTYLH + G
Sbjct  1    MFEKNLQDLVKGIRSAKGDV--TVYISQALQEIKAELRSTDPFVKAQAVRKLTYLHML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DM WAAFH +E+ S + F +KRI Y AA  SF
Sbjct  58   YDMCWAAFHVVEVMSYERFAHKRIGYNAACQSF  90



>gb|EEE54678.1| hypothetical protein OsJ_01979 [Oryza sativa Japonica Group]
Length=905

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 50/99 (51%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +1

Query  220  LMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLH  399
            L+++LFQRSLDDL+K +R     AGES  +++A+ EI REI++ D  TKA ALQKLTYL 
Sbjct  15   LVDTLFQRSLDDLVKSLRADPSAAGESAAVARALSEIHREIRAPDTATKAVALQKLTYLS  74

Query  400  SIHGVDMSW--AAFHAIELSSAQSFLYKRIAYLAATLSF  510
            S+H   ++    AF AIEL ++    ++R+AYLAA+LS 
Sbjct  75   SLHFAPVASHPLAFPAIELIASPQLPHRRLAYLAASLSL  113



>gb|ETO71144.1| hypothetical protein F444_12465 [Phytophthora parasitica P1976]
Length=1003

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 47/93 (51%), Positives = 66/93 (71%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F+++L DL+KGIR   G    + +IS+A+ EI+ E++STDP  KA A++KLTYLH + G
Sbjct  1    MFEKNLQDLVKGIRSAKGDV--TVYISQALQEIKAELRSTDPFVKAQAVRKLTYLHML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DM WAAFH +E+ S + F +KRI Y AA  SF
Sbjct  58   YDMCWAAFHVVEVMSYERFAHKRIGYNAACQSF  90



>gb|ETI42551.1| hypothetical protein F443_12365 [Phytophthora parasitica P1569]
Length=1003

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 47/93 (51%), Positives = 66/93 (71%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F+++L DL+KGIR   G    + +IS+A+ EI+ E++STDP  KA A++KLTYLH + G
Sbjct  1    MFEKNLQDLVKGIRSAKGDV--TVYISQALQEIKAELRSTDPFVKAQAVRKLTYLHML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DM WAAFH +E+ S + F +KRI Y AA  SF
Sbjct  58   YDMCWAAFHVVEVMSYERFAHKRIGYNAACQSF  90



>gb|ETM42450.1| hypothetical protein L914_11924 [Phytophthora parasitica]
Length=1004

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 47/93 (51%), Positives = 66/93 (71%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F+++L DL+KGIR   G    + +IS+A+ EI+ E++STDP  KA A++KLTYLH + G
Sbjct  1    MFEKNLQDLVKGIRSAKGDV--TVYISQALQEIKAELRSTDPFVKAQAVRKLTYLHML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DM WAAFH +E+ S + F +KRI Y AA  SF
Sbjct  58   YDMCWAAFHVVEVMSYERFAHKRIGYNAACQSF  90



>gb|ETL89193.1| hypothetical protein L917_11853 [Phytophthora parasitica]
Length=1004

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 47/93 (51%), Positives = 66/93 (71%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F+++L DL+KGIR   G    + +IS+A+ EI+ E++STDP  KA A++KLTYLH + G
Sbjct  1    MFEKNLQDLVKGIRSAKGDV--TVYISQALQEIKAELRSTDPFVKAQAVRKLTYLHML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DM WAAFH +E+ S + F +KRI Y AA  SF
Sbjct  58   YDMCWAAFHVVEVMSYERFAHKRIGYNAACQSF  90



>ref|XP_001240296.1| hypothetical protein CIMG_07459 [Coccidioides immitis RS]
Length=991

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 48/93 (52%), Positives = 63/93 (68%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F++SL DLI+G+R   G  GE  +I  ++ E R EIKS D   KATAL KL YL  + G
Sbjct  1    MFEKSLYDLIRGLRNHKGNEGE--YIQNSLRECRTEIKSQDMDKKATALLKLIYLE-MFG  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWAAFH +E+ S+Q++L KR+ YL A  SF
Sbjct  58   YDMSWAAFHVLEVMSSQNYLQKRVGYLGAVQSF  90



>gb|ETL35961.1| hypothetical protein L916_12010 [Phytophthora parasitica]
 gb|ETP40396.1| hypothetical protein F442_12282 [Phytophthora parasitica P10297]
Length=1004

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 47/93 (51%), Positives = 66/93 (71%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F+++L DL+KGIR   G    + +IS+A+ EI+ E++STDP  KA A++KLTYLH + G
Sbjct  1    MFEKNLQDLVKGIRSAKGDV--TVYISQALQEIKAELRSTDPFVKAQAVRKLTYLHML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DM WAAFH +E+ S + F +KRI Y AA  SF
Sbjct  58   YDMCWAAFHVVEVMSYERFAHKRIGYNAACQSF  90



>gb|ETK82574.1| hypothetical protein L915_12086 [Phytophthora parasitica]
 gb|ETP12267.1| hypothetical protein F441_12350 [Phytophthora parasitica CJ01A1]
Length=1004

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 47/93 (51%), Positives = 66/93 (71%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F+++L DL+KGIR   G    + +IS+A+ EI+ E++STDP  KA A++KLTYLH + G
Sbjct  1    MFEKNLQDLVKGIRSAKGDV--TVYISQALQEIKAELRSTDPFVKAQAVRKLTYLHML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DM WAAFH +E+ S + F +KRI Y AA  SF
Sbjct  58   YDMCWAAFHVVEVMSYERFAHKRIGYNAACQSF  90



>ref|XP_009540749.1| hypothetical protein HETIRDRAFT_166278 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW86760.1| hypothetical protein HETIRDRAFT_166278 [Heterobasidion irregulare 
TC 32-1]
Length=924

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 46/101 (46%), Positives = 71/101 (70%), Gaps = 4/101 (4%)
 Frame = +1

Query  214  PSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTY  393
            P ++E++++R+L DLI+G+R  +    E+ FI++A+DEIRRE+KS D + KA A+ KLTY
Sbjct  23   PLVVETMWERTLQDLIRGLR--ANKKDEAKFIAQALDEIRREVKSKDMELKAGAVLKLTY  80

Query  394  LHSIH--GVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            +  +   G DMSWA+FH +E+ S+  +  K + YL AT SF
Sbjct  81   VCCLQMMGYDMSWASFHVVEVMSSPKYHLKSVGYLGATQSF  121



>ref|XP_002898476.1| AP-3 complex subunit delta, putative [Phytophthora infestans 
T30-4]
 gb|EEY62953.1| AP-3 complex subunit delta, putative [Phytophthora infestans 
T30-4]
Length=979

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 47/93 (51%), Positives = 66/93 (71%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F+++L DL+KGIR   G    + +IS+A+ EI+ E++STDP  KA A++KLTYLH + G
Sbjct  1    MFEKNLQDLVKGIRSAKGDV--TVYISQALQEIKVELRSTDPFIKAQAVRKLTYLHML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DM WAAFH +E+ S + F +KRI Y AA  SF
Sbjct  58   YDMCWAAFHVVEVMSYERFAHKRIGYNAACKSF  90



>emb|CDW59385.1| Adaptin N domain containing protein, partial [Trichuris trichiura]
Length=266

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 65/96 (68%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            +E +F+++  D+I+GIR  +    ES +I + +DEI+ E+KS  P  KA A+ KLTYL  
Sbjct  22   IERMFEKTPTDMIRGIR--ASKENESKYIGQCIDEIKVELKSEYPAVKANAVAKLTYLQM  79

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ S   F+ KRI YLAA+ +F
Sbjct  80   L-GYDISWAAFNIIEVMSCPKFVSKRIGYLAASQAF  114



>gb|EFW14498.1| AP-3 complex subunit delta [Coccidioides posadasii str. Silveira]
Length=952

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 48/92 (52%), Positives = 62/92 (67%), Gaps = 3/92 (3%)
 Frame = +1

Query  235  FQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHGV  414
            F++SL DLI+G+R   G  GE  +I  ++ E R EIKS D   KATAL KL YL  + G 
Sbjct  8    FEKSLYDLIRGLRNHKGNEGE--YIQNSLRECRTEIKSQDMDKKATALLKLIYLE-MFGY  64

Query  415  DMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            DMSWAAFH +E+ S+Q++L KR+ YL A  SF
Sbjct  65   DMSWAAFHVLEVMSSQNYLQKRVGYLGAVQSF  96



>gb|EAS28713.2| AP-3 complex subunit delta [Coccidioides immitis RS]
Length=1039

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 48/92 (52%), Positives = 62/92 (67%), Gaps = 3/92 (3%)
 Frame = +1

Query  235  FQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHGV  414
            F++SL DLI+G+R   G  GE  +I  ++ E R EIKS D   KATAL KL YL  + G 
Sbjct  50   FEKSLYDLIRGLRNHKGNEGE--YIQNSLRECRTEIKSQDMDKKATALLKLIYLE-MFGY  106

Query  415  DMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            DMSWAAFH +E+ S+Q++L KR+ YL A  SF
Sbjct  107  DMSWAAFHVLEVMSSQNYLQKRVGYLGAVQSF  138



>dbj|BAE33449.1| unnamed protein product [Mus musculus]
Length=162

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KR+ YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRVGYLAASQCF  102



>gb|KDQ63013.1| hypothetical protein JAAARDRAFT_75593 [Jaapia argillacea MUCL 
33604]
Length=898

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 49/93 (53%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +    ES FI++AVDEIR+EIKS D + KA A+ KL YL  + G
Sbjct  1    MWERTLQDLIRGLR--ANKKDESKFIAQAVDEIRKEIKSKDMELKAGAVLKLVYLDML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWAAFH +E+ S+  F  K I YLAA  SF
Sbjct  58   HDMSWAAFHVVEVMSSPKFHLKSIGYLAAAQSF  90



>ref|XP_003038390.1| hypothetical protein SCHCODRAFT_47178 [Schizophyllum commune 
H4-8]
 gb|EFJ03488.1| hypothetical protein SCHCODRAFT_47178 [Schizophyllum commune 
H4-8]
Length=911

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 46/93 (49%), Positives = 66/93 (71%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +    ES FI+KAV+EI+RE++  D + KA A+ KLTYL  + G
Sbjct  1    MWERTLQDLIRGLR--ANKKDESKFINKAVEEIKREVREEDMELKAGAVLKLTYLDML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH +E+ S+  F  K + YLAAT SF
Sbjct  58   YDMSWASFHVVEVMSSPRFHLKSVGYLAATQSF  90



>emb|CDH52951.1| ap3d1 protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=235

 Score = 88.2 bits (217),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 60/93 (65%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F++SL DLI+GIR  +    E  +I   + EIR E+KS D   K  A+ KLTYL  + G
Sbjct  1    MFEKSLTDLIRGIR--ANKKNEQKYIQVCLQEIRNEVKSNDVDVKGVAIAKLTYLQML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH +E+ S+   ++KR  YLAA+ SF
Sbjct  58   YDMSWASFHVVEVMSSPKLVHKRAGYLAASQSF  90



>gb|KDO18891.1| hypothetical protein SPRG_15843 [Saprolegnia parasitica CBS 223.65]
Length=916

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 46/93 (49%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F+++L DL+KGIR   G    S +IS+ + EI+ E+K+ DP  KA A++KLTYL ++ G
Sbjct  1    MFEKTLADLVKGIRSCKGDV--SVYISQCMQEIKNELKANDPFIKAQAIRKLTYL-NMQG  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DM WAAFH +E+ S + F +KRI YLAA  SF
Sbjct  58   YDMGWAAFHVVEVMSYERFAHKRIGYLAAGQSF  90



>ref|XP_001422394.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABP00711.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=622

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 48/93 (52%), Positives = 63/93 (68%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            LFQ+SL D+I GIR  S    +  FI+K + +IR E+ S+D +TKA A++K TYLHS+ G
Sbjct  20   LFQKSLRDMITGIR--SHKDSQKEFINKCLSDIRAEVVSSDIRTKAVAIEKATYLHSL-G  76

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
              M WA+FH +EL S  +  YKRI YLAA  SF
Sbjct  77   YSMHWASFHVVELMSTTNVKYKRIGYLAACQSF  109



>ref|XP_008620785.1| hypothetical protein SDRG_16358 [Saprolegnia diclina VS20]
 gb|EQC25760.1| hypothetical protein SDRG_16358 [Saprolegnia diclina VS20]
Length=924

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 46/93 (49%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F+++L DL+KGIR   G    S +IS+ + EI+ E+K+ DP  KA A++KLTYL ++ G
Sbjct  1    MFEKTLADLVKGIRSCKGDV--SVYISQCMQEIKNELKANDPFIKAQAIRKLTYL-NMQG  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DM WAAFH +E+ S + F +KRI YLAA  SF
Sbjct  58   YDMGWAAFHVVEVMSYERFAHKRIGYLAAGQSF  90



>ref|XP_007360699.1| Adaptor protein complex AP-3 delta subunit [Dichomitus squalens 
LYAD-421 SS1]
 gb|EJF67295.1| Adaptor protein complex AP-3 delta subunit [Dichomitus squalens 
LYAD-421 SS1]
Length=960

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 64/93 (69%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +    ES FI++AVDEIR E +S D + KA A+ KLTYLH + G
Sbjct  1    MWERTLQDLIRGLR--ANKKDESKFIAQAVDEIRTETRSKDMEIKAAAILKLTYLHML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH +E+ SA     K I YLAA  SF
Sbjct  58   YDMSWASFHVVEVMSAPRIHLKTIGYLAAAQSF  90



>gb|KFH70940.1| hypothetical protein MVEG_03786 [Mortierella verticillata NRRL 
6337]
Length=1249

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 60/96 (63%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            M  LF  +L DLI+GIR       E  +I+K + +IR E++  DP  KA A+ KLTYL  
Sbjct  1    MNGLFSHTLTDLIRGIR--QNKKNEQAYIAKEIADIRLELRRNDPDLKAQAIAKLTYLQ-  57

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G DMSWA+FH +E+ S+  FLYK I YL A  SF
Sbjct  58   MMGYDMSWASFHVVEVMSSPKFLYKGIGYLGAIQSF  93



>gb|AAH97241.1| Si:ch211-129c21.6 protein [Danio rerio]
Length=218

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 65/96 (68%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS  +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISTCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ +E+ S+  F YKRI YLAA+  F
Sbjct  68   L-GYDVSWAAFNIVEVMSSSKFTYKRIGYLAASQCF  102



>ref|XP_003063782.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52155.1| predicted protein [Micromonas pusilla CCMP1545]
Length=914

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 46/94 (49%), Positives = 64/94 (68%), Gaps = 2/94 (2%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +FQ++L D+I  IR   G   +  FI+K + +IR EI S D +TKA AL+K TYLH++ G
Sbjct  27   MFQKNLKDMITAIRAQKGDGSQKNFINKCLQDIRTEIVSPDVRTKAVALEKATYLHTL-G  85

Query  412  VDMSWAAFHAIELSSAQ-SFLYKRIAYLAATLSF  510
             +M+WA+FH +EL S   +  YKR+ YLAAT SF
Sbjct  86   FNMNWASFHVVELMSVSVNVKYKRVGYLAATQSF  119



>gb|KIM47679.1| hypothetical protein M413DRAFT_416871 [Hebeloma cylindrosporum 
h7]
Length=889

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 47/93 (51%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DL++G+R  +    E+ FI+KAVDEIRREIK+ D + KA A+ KLTYL  + G
Sbjct  1    MWERTLQDLVRGLR--ANKNDEAKFIAKAVDEIRREIKTDDMELKAGAVLKLTYLDML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH +E+ S+     K I YLAA  SF
Sbjct  58   YDMSWASFHVVEVMSSPKVHLKSIGYLAAAQSF  90



>ref|XP_002504298.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65556.1| predicted protein [Micromonas sp. RCC299]
Length=976

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 66/93 (71%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            LFQ++L D+I GIR  +    +  +++K + +IR E+ S+D +TKA A++K TYLHS+ G
Sbjct  38   LFQKNLRDMITGIR--AAKDKQKDYMNKCLQDIRAEVVSSDIRTKAVAIEKATYLHSL-G  94

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             +M+WA+FH +EL S  +  YKR+ YLAAT SF
Sbjct  95   YNMNWASFHVVELMSTDNVKYKRVGYLAATQSF  127



>gb|KIM88794.1| hypothetical protein PILCRDRAFT_239285 [Piloderma croceum F 1598]
Length=668

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 66/93 (71%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +  + ES FI++AVDEIRREI+S D + KA A+ KLTYL  + G
Sbjct  1    MWERTLQDLIRGLR--ANKSDESKFIAQAVDEIRREIRSKDMELKAAAVLKLTYL-DMMG  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DM WA+F+ +E+ S+  F  K + YLAA  SF
Sbjct  58   YDMGWASFNVVEVMSSARFHLKSVGYLAAVQSF  90



>emb|CEG62868.1| hypothetical protein RMATCC62417_00125 [Rhizopus microsporus]
Length=1174

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 45/93 (48%), Positives = 63/93 (68%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F++SL DLI+GIR  +    E  +I+  + EIR E+KS D   K+TA+ KL YL  + G
Sbjct  1    MFEKSLTDLIRGIR--ANKKNEQKYIAVCLQEIRNEVKSNDLDIKSTAIAKLAYLQML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH +E+ S+  F +K+  YLAATLSF
Sbjct  58   YDMSWASFHIVEVMSSAKFAHKQTGYLAATLSF  90



>ref|XP_001914564.1| AP-3 complex subunit delta-1 [Entamoeba histolytica HM-1:IMSS]
 gb|EDS88660.1| AP-3 complex subunit delta-1, putative, partial [Entamoeba histolytica 
HM-1:IMSS]
Length=111

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 64/102 (63%), Gaps = 8/102 (8%)
 Frame = +1

Query  205  MAGPSLMESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQK  384
            MA P     L   SL D++KG+R  S    E  FI++ + +I+++I ++D + KA  +QK
Sbjct  12   MAKP-----LIGTSLQDMVKGLR--SNAGNEQAFINQTIADIKKDIVTSDMKRKAICIQK  64

Query  385  LTYLHSIHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            LTYL  + G + +W+ FH IELS+ QSF  KR+AYLAA +  
Sbjct  65   LTYLEML-GQETNWSGFHIIELSAKQSFWMKRVAYLAAQICL  105



>gb|KDR85547.1| hypothetical protein GALMADRAFT_53684 [Galerina marginata CBS 
339.88]
Length=900

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 46/93 (49%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DL++G+R  +    E+ FI+KAVDEIR+EIK+ D + KA A+ KLTYL  + G
Sbjct  1    MWERTLQDLVRGLR--ANKKDEAKFIAKAVDEIRQEIKTDDMELKAGAVLKLTYLDML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH +E+ S+     K I YLAA  SF
Sbjct  58   YDMSWASFHVVEVMSSSKVHLKSIGYLAAAQSF  90



>ref|XP_011410230.1| PREDICTED: AP-3 complex subunit delta-1-like [Amphimedon queenslandica]
Length=1160

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 46/93 (49%), Positives = 63/93 (68%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F+++L DL++GIR   G   ES FIS  + EI+RE+K  +   KA A+ KLTYL  + G
Sbjct  1    MFEKTLSDLVRGIRSHRGS--ESQFISSCMAEIKRELKQGNITVKANAISKLTYLQML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             D++WAAF+ IE+ S+  F YKRI YLAAT  F
Sbjct  58   YDITWAAFNIIEVMSSSKFTYKRIGYLAATQCF  90



>emb|CCL98144.1| predicted protein [Fibroporia radiculosa]
Length=911

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 47/93 (51%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +    ES FIS+A+ EIR+EIKS D + KA A+ KLTYL  + G
Sbjct  1    MWERTLQDLIRGLR--ANKKDESKFISQAISEIRKEIKSKDMELKAGAVLKLTYLDML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH +E+ SA     K + YLAA+ SF
Sbjct  58   YDMSWASFHVVEVMSAPRIHLKSVGYLAASQSF  90



>gb|KIK02036.1| hypothetical protein K443DRAFT_677925 [Laccaria amethystina LaAM-08-1]
Length=890

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 46/93 (49%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +  + E+ FI+KAVDEIR+EIK  D + KA A+ KLTYL  + G
Sbjct  1    MWERTLQDLIRGLR--ANKSDEATFIAKAVDEIRQEIKGDDMELKAAAVLKLTYLDML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH +E+ S+     K + YLAA  SF
Sbjct  58   YDMSWASFHVVEVMSSPRVHLKSVGYLAAVQSF  90



>ref|XP_002392365.1| hypothetical protein MPER_08072 [Moniliophthora perniciosa FA553]
 gb|EEB93295.1| hypothetical protein MPER_08072 [Moniliophthora perniciosa FA553]
Length=231

 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 64/93 (69%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +    E+ FI+KAV+EIR+EI+  D + KA A+ KLTYL  + G
Sbjct  1    MWERTLQDLIRGLR--ANRKDEAKFIAKAVEEIRQEIRGDDMELKAGAVMKLTYL-DMMG  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH +E+ S+     K + YLAA  SF
Sbjct  58   YDMSWASFHVVEVMSSPRIHLKSVGYLAAGQSF  90



>gb|KII93311.1| hypothetical protein PLICRDRAFT_672814 [Plicaturopsis crispa 
FD-325 SS-3]
Length=899

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 45/93 (48%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +    ES FI++ VDEIR+E+KS D + KA A+ KLTYL  + G
Sbjct  1    MWERTLQDLIRGLR--ANKQDESKFIAQVVDEIRQEVKSKDMELKAGAVLKLTYLDML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+F+ +E+ S+  F  K + YLAA  SF
Sbjct  58   YDMSWASFNVVEVMSSSRFHLKSVGYLAAVQSF  90



>ref|XP_007784505.1| hypothetical protein W97_08546 [Coniosporium apollinis CBS 100218]
 gb|EON69188.1| hypothetical protein W97_08546 [Coniosporium apollinis CBS 100218]
Length=1045

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 47/93 (51%), Positives = 64/93 (69%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F++SL DLI+G+R   G   E  +I +++ E RREIKS D   KATAL KLTYL  + G
Sbjct  1    MFEKSLYDLIRGLRNHKGN--ERAYIQESLRECRREIKSQDMDLKATALLKLTYLE-MFG  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+F+ +E+ S+Q +  KR+ YLAA  SF
Sbjct  58   HDMSWASFNVLEVMSSQKYPQKRVGYLAAVQSF  90



>gb|EMD42246.1| hypothetical protein CERSUDRAFT_102602 [Ceriporiopsis subvermispora 
B]
Length=885

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +    ES FI++A+DEIR+E+KS D + KA A+ KLTYL  + G
Sbjct  1    MWERTLQDLIRGLR--ANKKDESKFIAQAIDEIRQEVKSKDMELKAGAVLKLTYLDML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH IE+ S+     K + YLAA  SF
Sbjct  58   YDMSWASFHIIEVMSSPRIHLKSVGYLAAVQSF  90



>ref|XP_004091134.1| PREDICTED: LOW QUALITY PROTEIN: AP-3 complex subunit delta-1 
[Nomascus leucogenys]
Length=1515

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  207  IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  264

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+ SF
Sbjct  265  L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQSF  299



>ref|XP_004993320.1| hypothetical protein PTSG_05451 [Salpingoeca rosetta]
 gb|EGD73757.1| hypothetical protein PTSG_05451 [Salpingoeca rosetta]
Length=1325

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 45/93 (48%), Positives = 64/93 (69%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F+++L DLI+GIR  S    E+ +IS  +DEIR+E+   D   KA AL KLTYL  + G
Sbjct  1    MFEKTLGDLIRGIR--SHPDDEAKYISSCMDEIRKELAQPDLDIKANALAKLTYLQML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWAAFH +E+ +++ + +KRI +LAA  SF
Sbjct  58   YDMSWAAFHVVEVMTSKKYAHKRIGFLAAAQSF  90



>ref|XP_002770560.1| DEHA2G01518p [Debaryomyces hansenii CBS767]
 emb|CAR65895.1| DEHA2G01518p [Debaryomyces hansenii CBS767]
Length=1116

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 46/94 (49%), Positives = 63/94 (67%), Gaps = 3/94 (3%)
 Frame = +1

Query  235  FQRSLDDLIKGIRLFSGGAGES--GFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIH  408
            F++SL DLIKGIR +S  + ES  GF+  A+ E + E+ +TD +TKA A+ KLTYL  ++
Sbjct  22   FEKSLSDLIKGIRSYSKESAESLSGFLDSAIMECKNELSTTDLETKAMAILKLTYLE-MY  80

Query  409  GVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            G +MSW  F  +E+ S+  F  KRI YLAA  SF
Sbjct  81   GFEMSWCNFQILEVMSSSKFQQKRIGYLAAIQSF  114



>ref|XP_007860291.1| Adaptor protein complex AP-3 delta subunit [Gloeophyllum trabeum 
ATCC 11539]
 gb|EPQ60168.1| Adaptor protein complex AP-3 delta subunit [Gloeophyllum trabeum 
ATCC 11539]
Length=753

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 47/93 (51%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +    E+ FI++AVDEIR+EIKS D + KA A+ KLTYL  + G
Sbjct  1    MWERTLQDLIRGLR--ANKKDEAKFIAQAVDEIRQEIKSKDMELKAAAVLKLTYLEML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWAAFH +E+ S+     K + YLAA  SF
Sbjct  58   YDMSWAAFHIVEVMSSPKTHLKTVGYLAAAQSF  90



>gb|KJA28571.1| hypothetical protein HYPSUDRAFT_211879 [Hypholoma sublateritium 
FD-334 SS-4]
Length=889

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 46/93 (49%), Positives = 64/93 (69%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DL++G+R  +    E+ FI+KAVDEIR EIK+ D + KA A+ KLTYL  + G
Sbjct  1    MWERTLQDLVRGLR--ANKKDEAKFIAKAVDEIRHEIKTDDMELKAGAVLKLTYLDML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH +E+ S+     K I YLAA  SF
Sbjct  58   YDMSWASFHVVEVMSSPKVHLKSIGYLAAAQSF  90



>gb|KIL71660.1| hypothetical protein M378DRAFT_115001 [Amanita muscaria Koide 
BX008]
Length=873

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 45/93 (48%), Positives = 62/93 (67%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +    E  FI+KAVDEIR EI+S D   KA A+ KLTYL  + G
Sbjct  1    MWERTLKDLIRGLR--ANKKDEPKFIAKAVDEIRSEIRSDDMDLKAGAVMKLTYL-DMMG  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DM WA+FH +E+ S+  +  K + YLAA  SF
Sbjct  58   YDMGWASFHVVEVMSSSKYHLKTVGYLAAAQSF  90



>gb|KIM26948.1| hypothetical protein M408DRAFT_330313 [Serendipita vermifera 
MAFF 305830]
Length=863

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 41/93 (44%), Positives = 67/93 (72%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +    E  FIS+A+DEIR+E+++ D +TKA A+ K+T+L  + G
Sbjct  1    MWERTLQDLIRGLR--ANKNDERKFISQAIDEIRKEVRNKDMETKAGAILKMTFLDML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             D++WA FH IE+ S+Q +  K + YLA++ SF
Sbjct  58   YDLAWANFHIIEVMSSQKYHLKTVGYLASSQSF  90



>ref|XP_007297917.1| Adaptor protein complex AP-3 delta subunit, partial [Stereum 
hirsutum FP-91666 SS1]
 gb|EIM92407.1| Adaptor protein complex AP-3 delta subunit, partial [Stereum 
hirsutum FP-91666 SS1]
Length=604

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 66/93 (71%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DL++G+R  +    E+ FI++AVDEIR E++S D + KA A+ KLTYL  + G
Sbjct  1    MWERTLQDLVRGLR--ANKRDEAKFIAQAVDEIRMEVRSKDMELKAGAVLKLTYLQMM-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH +E+ S+  +  K + YLAAT SF
Sbjct  58   YDMSWASFHVVEVMSSPKYHLKSVGYLAATQSF  90



>gb|KIO06956.1| hypothetical protein M404DRAFT_137182 [Pisolithus tinctorius 
Marx 270]
Length=896

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 66/93 (71%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +    E+ FI++A+DEIR+EIK+ D + KA A+ KLTYL+ + G
Sbjct  1    MWERTLQDLIRGLR--ANKNDEAKFIAQAMDEIRKEIKNKDMELKAGAVMKLTYLNML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DM+WA+FH IE+ S+     K + YLAA  SF
Sbjct  58   YDMNWASFHIIEVMSSSKIHLKTVGYLAAGQSF  90



>ref|XP_007270957.1| Adaptor protein complex AP-3 delta subunit [Fomitiporia mediterranea 
MF3/22]
 gb|EJC98671.1| Adaptor protein complex AP-3 delta subunit [Fomitiporia mediterranea 
MF3/22]
Length=924

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 43/93 (46%), Positives = 66/93 (71%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +    E+ FI+ A++EIR+E++S D + KA A+ KLTYL  + G
Sbjct  1    MWERNLQDLIRGLR--AHKHDEANFIAGAIEEIRKEVRSDDMELKAAAVLKLTYLEML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH +E+ S+  F  K + YLAAT +F
Sbjct  58   YDMSWASFHVVEVMSSPRFHLKSMGYLAATQTF  90



>gb|KIM70059.1| hypothetical protein SCLCIDRAFT_101653 [Scleroderma citrinum 
Foug A]
Length=901

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +    E+ FI++A+DE+R+EIKS D + KA A+ KLTYL  + G
Sbjct  1    MWERTLQDLIRGLR--ANKNDEAKFIAQAMDEVRKEIKSKDMELKAGAVMKLTYLDML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DM+WA+FH IE+ S+     K + YLAA  SF
Sbjct  58   YDMNWASFHVIEVMSSSKIHLKSVGYLAAGQSF  90



>gb|KIJ07920.1| hypothetical protein PAXINDRAFT_139610 [Paxillus involutus ATCC 
200175]
Length=892

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 47/93 (51%), Positives = 63/93 (68%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +    E  FIS+A +EIRREIKS D + KA A+ KLTYL  + G
Sbjct  1    MWERTLQDLIRGLR--ANKNDEVKFISQANEEIRREIKSKDMELKAGAVMKLTYLDML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH IE+ S+     K + YLAA  SF
Sbjct  58   YDMSWASFHVIEVMSSPKIHLKTVGYLAAVQSF  90



>emb|CDS08434.1| hypothetical protein LRAMOSA09796 [Absidia idahoensis var. thermophila]
Length=1165

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 43/93 (46%), Positives = 60/93 (65%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F++SL DLI+GIR  +    E  +I   + EIR E+KS D   K  A+ KLTYL  + G
Sbjct  1    MFEKSLTDLIRGIR--ANKKNEQKYIQVCLQEIRNEVKSNDVDVKGVAIAKLTYLQML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH +E+ S+   ++KR  YLAA+ SF
Sbjct  58   YDMSWASFHVVEVMSSPKLIHKRAGYLAASQSF  90



>gb|KIK35695.1| hypothetical protein CY34DRAFT_811953 [Suillus luteus UH-Slu-Lm8-n1]
Length=901

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 46/93 (49%), Positives = 62/93 (67%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +    ES FI +A+DEIRREIKS D   KA A+ KLTYL  + G
Sbjct  1    MWERTLQDLIRGLR--ANKNDESKFIGQAMDEIRREIKSKDMALKAGAVMKLTYLDML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH +E+ S+     K + YL A  SF
Sbjct  58   YDMSWASFHIVEVMSSPKIHIKSVGYLGAVQSF  90



>gb|AAH05142.1| AP3D1 protein, partial [Homo sapiens]
Length=865

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+ SF
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQSF  102



>ref|XP_008476895.1| PREDICTED: AP-3 complex subunit delta [Diaphorina citri]
Length=820

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            +E +F ++L DL++GIR  +    E+ FI++ ++EI++E++  +   KATA+ KLTYL  
Sbjct  10   LERMFDKNLTDLVRGIR--NNKDNEAKFIAQCIEEIKQELRQDNISVKATAVAKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWA F+ IE+ S+  F YKRI YLA++  F
Sbjct  68   L-GYDVSWAGFNIIEVMSSSKFTYKRIGYLASSQCF  102



>ref|XP_009250845.1| PREDICTED: AP-3 complex subunit delta-1-like, partial [Pongo 
abelii]
Length=888

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+ SF
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQSF  102



>ref|XP_002548142.1| predicted protein [Candida tropicalis MYA-3404]
 gb|EER33621.1| predicted protein [Candida tropicalis MYA-3404]
Length=601

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 46/94 (49%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +1

Query  235  FQRSLDDLIKGIRLFSGGAGES--GFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIH  408
            F++SL+DLIKGIR  S  + ES   F+  A+ E R E+ +TD +TKA A+ KL YL  ++
Sbjct  22   FEKSLNDLIKGIRAHSKESPESLANFLDVAIQECRNELSTTDLETKAIAILKLAYLE-MY  80

Query  409  GVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            G DMSW  F  +E+ S+  F  KRI YLAA  SF
Sbjct  81   GFDMSWCNFQILEVMSSSKFQQKRIGYLAAIQSF  114



>emb|CDH52950.1| ap3d1 protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=1164

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 43/93 (46%), Positives = 60/93 (65%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F++SL DLI+GIR  +    E  +I   + EIR E+KS D   K  A+ KLTYL  + G
Sbjct  1    MFEKSLTDLIRGIR--ANKKNEQKYIQVCLQEIRNEVKSNDVDVKGVAIAKLTYLQML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH +E+ S+   ++KR  YLAA+ SF
Sbjct  58   YDMSWASFHVVEVMSSPKLVHKRAGYLAASQSF  90



>emb|CDH52949.1| ap3d1 protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=1165

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 43/93 (46%), Positives = 60/93 (65%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F++SL DLI+GIR  +    E  +I   + EIR E+KS D   K  A+ KLTYL  + G
Sbjct  1    MFEKSLTDLIRGIR--ANKKNEQKYIQVCLQEIRNEVKSNDVDVKGVAIAKLTYLQML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH +E+ S+   ++KR  YLAA+ SF
Sbjct  58   YDMSWASFHVVEVMSSPKLVHKRAGYLAASQSF  90



>ref|XP_006677182.1| hypothetical protein BATDEDRAFT_16060, partial [Batrachochytrium 
dendrobatidis JAM81]
 gb|EGF82151.1| hypothetical protein BATDEDRAFT_16060, partial [Batrachochytrium 
dendrobatidis JAM81]
Length=623

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 40/93 (43%), Positives = 62/93 (67%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F++SL DLI+G+R  +    E  F++ A+DE+R+E+++ D   K  A+ KL  LH + G
Sbjct  1    MFEKSLTDLIRGLR--ANKNSEERFVANAIDEVRQELRTNDLDIKTNAISKLCVLHMM-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH IE+ S+     KR+ Y AA++SF
Sbjct  58   YDMSWASFHIIEVMSSSKLSQKRVGYYAASISF  90



>ref|XP_005587509.1| PREDICTED: AP-3 complex subunit delta-1 isoform X2 [Macaca fascicularis]
Length=1267

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  122  IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  179

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+ SF
Sbjct  180  L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQSF  214



>ref|XP_008970832.1| PREDICTED: AP-3 complex subunit delta-1 isoform X1 [Pan paniscus]
Length=1217

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  + G
Sbjct  1    MFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             D+SWAAF+ IE+ SA  F +KRI YLAA+ SF
Sbjct  58   YDISWAAFNIIEVMSASKFTFKRIGYLAASQSF  90



>dbj|BAD92041.1| Adapter-related protein complex 3 delta 1 subunit variant [Homo 
sapiens]
Length=1284

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  79   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  136

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+ SF
Sbjct  137  L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQSF  171



>ref|XP_008970833.1| PREDICTED: AP-3 complex subunit delta-1 isoform X2 [Pan paniscus]
Length=1205

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  + G
Sbjct  1    MFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             D+SWAAF+ IE+ SA  F +KRI YLAA+ SF
Sbjct  58   YDISWAAFNIIEVMSASKFTFKRIGYLAASQSF  90



>ref|XP_005587508.1| PREDICTED: AP-3 complex subunit delta-1 isoform X1 [Macaca fascicularis]
Length=1327

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  122  IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  179

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+ SF
Sbjct  180  L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQSF  214



>gb|AAH10065.1| AP3D1 protein [Homo sapiens]
 gb|ADZ15549.1| adaptor-related protein complex 3, delta 1 subunit [synthetic 
construct]
 gb|AIC59451.1| AP3D1, partial [synthetic construct]
Length=742

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+ SF
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQSF  102



>ref|XP_002603862.1| hypothetical protein BRAFLDRAFT_276908 [Branchiostoma floridae]
 gb|EEN59873.1| hypothetical protein BRAFLDRAFT_276908 [Branchiostoma floridae]
Length=1179

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            +E +F ++L DL++GIR  +    E+ FI++ +DEI++E++  +   KA A+ KLTYL  
Sbjct  10   LERVFDKNLHDLVRGIR--NHKDDEAKFIAQCIDEIKQELRQDNIAVKANAVAKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ S+  F +KRI YLAA+ SF
Sbjct  68   L-GYDISWAAFNVIEVMSSNKFTFKRIGYLAASQSF  102



>ref|XP_001750781.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ84380.1| predicted protein [Monosiga brevicollis MX1]
Length=1150

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 43/93 (46%), Positives = 64/93 (69%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F+++L DLI+GIR       E+ +IS  +DE R+E+K+ D   KA A+ KLTYL  + G
Sbjct  1    MFEKNLSDLIRGIRAHPDD--ETKYISNCMDECRKELKNPDLDVKANAIAKLTYLQML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             D+SWA+F  +E+ +++ FL+KRI YLAA  SF
Sbjct  58   FDISWASFQIVEVMTSKKFLHKRIGYLAAAQSF  90



>ref|XP_002563394.1| Pc20g08980 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP86227.1| Pc20g08980 [Penicillium rubens Wisconsin 54-1255]
Length=955

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 45/93 (48%), Positives = 61/93 (66%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F++SL DLIKG+R   GG  E  +I  ++ E + EIK+ D   KATAL KL YL  + G
Sbjct  1    MFEKSLYDLIKGLRGHKGGENE--YIQSSLRECKAEIKTQDMDKKATALLKLIYLE-MFG  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH +E+ S+  +L KR+ YL A  SF
Sbjct  58   YDMSWASFHVLEVMSSAKYLQKRVGYLGAVQSF  90



>ref|XP_007712477.1| hypothetical protein COCCADRAFT_5236 [Bipolaris zeicola 26-R-13]
 gb|EUC33213.1| hypothetical protein COCCADRAFT_5236 [Bipolaris zeicola 26-R-13]
Length=1066

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 45/93 (48%), Positives = 63/93 (68%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            LF++SL DLI+G+R   G   E  +I++++ E R+EI++ D   KATAL KLTYL  + G
Sbjct  11   LFEKSLFDLIRGLRNHKGN--EREYIAESIKECRKEIRTNDMDLKATALMKLTYLE-MFG  67

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+F+ +E+ S+  F  KR  YLAA  SF
Sbjct  68   HDMSWASFNVLEVMSSSKFKQKRTGYLAAVQSF  100



>gb|EUN26163.1| hypothetical protein COCVIDRAFT_27471 [Bipolaris victoriae FI3]
Length=1067

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 45/93 (48%), Positives = 63/93 (68%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            LF++SL DLI+G+R   G   E  +I++++ E R+EI++ D   KATAL KLTYL  + G
Sbjct  11   LFEKSLFDLIRGLRNHKGN--EREYIAESIKECRKEIRTNDMDLKATALMKLTYLE-MFG  67

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+F+ +E+ S+  F  KR  YLAA  SF
Sbjct  68   HDMSWASFNVLEVMSSSKFKQKRTGYLAAVQSF  100



>ref|XP_003788905.1| PREDICTED: AP-3 complex subunit delta-1 [Otolemur garnettii]
Length=1210

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+ SF
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQSF  102



>ref|NP_003929.4| AP-3 complex subunit delta-1 isoform 2 [Homo sapiens]
 sp|O14617.1|AP3D1_HUMAN RecName: Full=AP-3 complex subunit delta-1; AltName: Full=AP-3 
complex subunit delta; AltName: Full=Adaptor-related protein 
complex 3 subunit delta-1; AltName: Full=Delta-adaptin [Homo 
sapiens]
 gb|AAC51761.1| delta-adaptin [Homo sapiens]
 gb|EAW69412.1| hCG2004350, isoform CRA_a [Homo sapiens]
Length=1153

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+ SF
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQSF  102



>ref|XP_004059739.1| PREDICTED: AP-3 complex subunit delta-1 isoform 2 [Gorilla gorilla 
gorilla]
Length=1153

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+ SF
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQSF  102



>ref|XP_002801055.1| PREDICTED: AP-3 complex subunit delta-1-like isoform 1 [Macaca 
mulatta]
Length=1155

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+ SF
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQSF  102



>ref|XP_001149847.1| PREDICTED: AP-3 complex subunit delta-1 isoform X1 [Pan troglodytes]
Length=1215

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+ SF
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQSF  102



>ref|XP_007337124.1| Adaptor protein complex AP-3 delta subunit [Auricularia delicata 
TFB-10046 SS5]
 gb|EJD54241.1| Adaptor protein complex AP-3 delta subunit [Auricularia delicata 
TFB-10046 SS5]
Length=878

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 66/93 (71%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +    ES FI++A+DEIR+E+KS D + K  A+ KLTYL  + G
Sbjct  1    MWERTLKDLIRGLR--AHKHDESKFIAQAIDEIRQEVKSKDMELKTAAILKLTYLEML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DM WA+F+ +E+ S+Q F +K + YLAA  SF
Sbjct  58   YDMGWASFNILEVMSSQRFHHKAVGYLAAGQSF  90



>ref|XP_004059738.1| PREDICTED: AP-3 complex subunit delta-1 isoform 1 [Gorilla gorilla 
gorilla]
Length=1213

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+ SF
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQSF  102



>ref|XP_009191363.1| PREDICTED: LOW QUALITY PROTEIN: AP-3 complex subunit delta-1 
[Papio anubis]
Length=1189

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+ SF
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQSF  102



>ref|NP_001248755.1| AP-3 complex subunit delta-1 isoform 3 [Homo sapiens]
 dbj|BAG10594.1| AP-3 complex subunit delta-1 [synthetic construct]
Length=1215

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+ SF
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQSF  102



>gb|EHH29436.1| hypothetical protein EGK_09867 [Macaca mulatta]
Length=1217

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+ SF
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQSF  102



>ref|XP_003928649.1| PREDICTED: AP-3 complex subunit delta-1 [Saimiri boliviensis 
boliviensis]
Length=1218

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+ SF
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQSF  102



>ref|XP_010599778.1| PREDICTED: LOW QUALITY PROTEIN: AP-3 complex subunit delta-1 
[Loxodonta africana]
Length=1148

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>emb|CDR46823.1| CYFA0S26e00474g1_1 [Cyberlindnera fabianii]
Length=901

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 43/93 (46%), Positives = 58/93 (62%), Gaps = 1/93 (1%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
             F++SL DLIKGIR       +  F+  A+ E R+E+KS D   K  A+ KL+YL  ++G
Sbjct  16   FFEKSLTDLIKGIRANRDPEAQLRFLQDAIAECRKEVKSRDMDVKTMAVLKLSYLE-MYG  74

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DM WA FH +E+ S+Q F  KR+ YLAA  SF
Sbjct  75   FDMGWANFHVLEVMSSQKFQQKRVGYLAAIQSF  107



>ref|XP_006722995.1| PREDICTED: AP-3 complex subunit delta-1 isoform X1 [Homo sapiens]
Length=1203

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+ SF
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQSF  102



>ref|XP_009432590.1| PREDICTED: AP-3 complex subunit delta-1 isoform X2 [Pan troglodytes]
Length=1203

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+ SF
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQSF  102



>gb|EFX01470.1| ap-3 complex subunit [Grosmannia clavigera kw1407]
Length=1089

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 60/92 (65%), Gaps = 3/92 (3%)
 Frame = +1

Query  235  FQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHGV  414
            F++SL DLI+G+R   G   E  +I K++ E R E++S D   KATAL KL YL  + G 
Sbjct  59   FEKSLLDLIRGLRYHKGN--EKEYIQKSLKECRAEVRSQDMDVKATALLKLVYLEMV-GH  115

Query  415  DMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            DMSWA+FH +E+ S+Q    KRI YLAA  SF
Sbjct  116  DMSWASFHVLEVMSSQKLHQKRIGYLAAVQSF  147



>gb|KFD46939.1| hypothetical protein M513_12185 [Trichuris suis]
Length=1699

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 65/96 (68%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            +E +F+++  D+I+GIR  +    ES +I + +DEI+ E+KS  P  KA A+ KLTYL  
Sbjct  58   IERMFEKTPTDMIRGIR--ASKENESKYIGQCIDEIKVELKSEYPSVKANAVAKLTYLQM  115

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ S   F+ KRI YLAA+ +F
Sbjct  116  L-GYDISWAAFNIIEVMSCPKFVSKRIGYLAASQAF  150



>ref|XP_007992896.1| PREDICTED: AP-3 complex subunit delta-1 [Chlorocebus sabaeus]
Length=1213

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+ SF
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQSF  102



>ref|XP_007390989.1| hypothetical protein PHACADRAFT_83114 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM61582.1| hypothetical protein PHACADRAFT_83114 [Phanerochaete carnosa 
HHB-10118-sp]
Length=815

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 64/93 (69%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +    E+ FI++AV+EIRREI+  D + KA A  KLTY+H + G
Sbjct  1    MWERTLQDLIRGLR--ANKKDEAKFIAQAVEEIRREIRGKDMELKAGAALKLTYVHML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH +E+ S+     K + YLAA  SF
Sbjct  58   YDMSWASFHVVEVMSSSKNHLKTVGYLAAVQSF  90



>gb|AAD03777.1| AP-3 complex delta subunit [Homo sapiens]
Length=1112

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+ SF
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQSF  102



>ref|XP_002801056.1| PREDICTED: AP-3 complex subunit delta-1-like isoform 2 [Macaca 
mulatta]
Length=1112

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+ SF
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQSF  102



>gb|EAW69416.1| hCG2004350, isoform CRA_d [Homo sapiens]
Length=1112

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+ SF
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQSF  102



>gb|EAW69414.1| hCG2004350, isoform CRA_c [Homo sapiens]
Length=1114

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+ SF
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQSF  102



>ref|XP_003648865.1| hypothetical protein THITE_2106790 [Thielavia terrestris NRRL 
8126]
 gb|AEO62529.1| hypothetical protein THITE_2106790 [Thielavia terrestris NRRL 
8126]
Length=1080

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 45/93 (48%), Positives = 60/93 (65%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F++SL DLI+G+R   G   E  +I   + E R EI+S D   KATAL KL YL  + G
Sbjct  1    MFEKSLYDLIRGLRNHKGN--EKEYIQSCLKECRSEIRSQDMDVKATALLKLVYLEMV-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH +E+ S+Q +  KR+ YLAA  SF
Sbjct  58   HDMSWASFHVLEVMSSQKYHQKRVGYLAAVQSF  90



>ref|XP_008187663.1| PREDICTED: AP-3 complex subunit delta-1 [Acyrthosiphon pisum]
Length=1097

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 41/96 (43%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            +E +F ++L DL++GIR  +    E+ +I++ ++EI++E++  +   KATA+ KLTYL  
Sbjct  10   IERMFDKNLTDLVRGIR--NSKENEAKYIAQCMEEIKQELRQENIAVKATAVAKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWA F+ IE+ S+  F YKRI YLA++ SF
Sbjct  68   L-GYDISWAGFNIIEVMSSSKFTYKRIGYLASSQSF  102



>ref|XP_006259093.1| PREDICTED: AP-3 complex subunit delta-1 [Alligator mississippiensis]
Length=1197

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>emb|CEJ94524.1| hypothetical protein VHEMI10048 [Torrubiella hemipterigena]
Length=1022

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 60/94 (64%), Gaps = 3/94 (3%)
 Frame = +1

Query  229  SLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIH  408
            ++F++SL DLIKGIR   G   E  +I K + E R E++S D   KATAL KL YL  + 
Sbjct  21   TMFEKSLYDLIKGIRSHKGN--EKQYIQKVLKECRAEVRSQDMDVKATALLKLVYLEMV-  77

Query  409  GVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            G DMSWA+FH +E+ S+  +  KR+ YL A  SF
Sbjct  78   GHDMSWASFHVLEVMSSPKYHQKRVGYLGAVQSF  111



>gb|KIK71432.1| hypothetical protein GYMLUDRAFT_148356 [Gymnopus luxurians FD-317 
M1]
Length=911

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +  A ES FI+KA++EIR+E+KS D   K+ A+ KLTYL  + G
Sbjct  1    MWERTLQDLIRGLR--ANKADESKFIAKAIEEIRQEVKSDDMALKSGAVLKLTYL-DMMG  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DM WA+F+ +E+ S+     K + YLAAT SF
Sbjct  58   YDMGWASFNVVEVMSSPKLHLKTVGYLAATQSF  90



>gb|EMD90835.1| hypothetical protein COCHEDRAFT_1136907 [Bipolaris maydis C5]
Length=1019

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 63/93 (68%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F++SL DLI+G+R   G   E  +I++++ E R+EI++ D   KATAL KLTYL  + G
Sbjct  1    MFEKSLFDLIRGLRNHKGN--EREYIAESIKECRKEIRTNDMDLKATALMKLTYLE-MFG  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+F+ +E+ S+  F  KR  YLAA  SF
Sbjct  58   HDMSWASFNVLEVMSSSKFKQKRTGYLAAVQSF  90



>ref|XP_011276163.1| AP-3 complex subunit delta [Wickerhamomyces ciferrii]
 emb|CCH41962.1| AP-3 complex subunit delta [Wickerhamomyces ciferrii]
Length=953

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 39/89 (44%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F++SL DL+KGIR       ++ F+ +A+ E R+E++S+D   K  A+ KL YL  ++G
Sbjct  19   VFEKSLSDLVKGIRSHKDPESQAKFLQEAIQECRKEVRSSDMDLKTMAVLKLAYLE-MYG  77

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAA  498
             DMSWA FH +E+ S+  F  KR+ YLAA
Sbjct  78   FDMSWANFHVLEVMSSSKFQQKRVGYLAA  106



>ref|XP_006037222.1| PREDICTED: AP-3 complex subunit delta-1 isoform X2 [Alligator 
sinensis]
Length=1204

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>ref|XP_007434059.1| PREDICTED: AP-3 complex subunit delta-1 isoform X2 [Python bivittatus]
Length=1206

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>ref|XP_007434058.1| PREDICTED: AP-3 complex subunit delta-1 isoform X1 [Python bivittatus]
Length=1207

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>ref|XP_749144.1| AP-3 complex subunit delta [Aspergillus fumigatus Af293]
 gb|EAL87106.1| AP-3 complex subunit delta, putative [Aspergillus fumigatus Af293]
Length=953

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 46/93 (49%), Positives = 60/93 (65%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F++SL DLIKG+R   G   E  FI +++ E R EIKS D   KATAL K+ YL  + G
Sbjct  1    MFEKSLYDLIKGLRNHKGA--EEEFIQESLRECRTEIKSQDMDKKATALLKIIYLE-MFG  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH +E+ S+  +L KR  YL A  SF
Sbjct  58   YDMSWASFHVLEVMSSSRYLQKRAGYLGAVQSF  90



>ref|XP_011286865.1| PREDICTED: AP-3 complex subunit delta-1 [Felis catus]
Length=1150

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>ref|XP_008587465.1| PREDICTED: AP-3 complex subunit delta-1 [Galeopterus variegatus]
Length=1278

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>ref|XP_006037223.1| PREDICTED: AP-3 complex subunit delta-1 isoform X3 [Alligator 
sinensis]
Length=1153

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>ref|XP_006037221.1| PREDICTED: AP-3 complex subunit delta-1 isoform X1 [Alligator 
sinensis]
Length=1206

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>gb|EHB06581.1| AP-3 complex subunit delta-1 [Heterocephalus glaber]
Length=1252

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>gb|KHJ44674.1| adaptin region [Trichuris suis]
Length=1165

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 65/96 (68%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            +E +F+++  D+I+GIR  +    ES +I + +DEI+ E+KS  P  KA A+ KLTYL  
Sbjct  22   IERMFEKTPTDMIRGIR--ASKENESKYIGQCIDEIKVELKSEYPSVKANAVAKLTYLQM  79

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ S   F+ KRI YLAA+ +F
Sbjct  80   L-GYDISWAAFNIIEVMSCPKFVSKRIGYLAASQAF  114



>ref|XP_005505615.1| PREDICTED: AP-3 complex subunit delta-1 [Columba livia]
Length=1253

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  43   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  100

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  101  L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  135



>ref|XP_007949190.1| PREDICTED: AP-3 complex subunit delta-1 isoform X1 [Orycteropus 
afer afer]
Length=1214

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>ref|XP_005531388.1| PREDICTED: AP-3 complex subunit delta-1 isoform X1 [Pseudopodoces 
humilis]
Length=1217

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>ref|XP_005496329.1| PREDICTED: AP-3 complex subunit delta-1 [Zonotrichia albicollis]
Length=1150

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>ref|XP_005427354.1| PREDICTED: AP-3 complex subunit delta-1 [Geospiza fortis]
Length=1153

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>ref|XP_007762502.1| Adaptor protein complex AP-3 delta subunit [Coniophora puteana 
RWD-64-598 SS2]
 gb|EIW87162.1| Adaptor protein complex AP-3 delta subunit [Coniophora puteana 
RWD-64-598 SS2]
Length=754

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/93 (46%), Positives = 63/93 (68%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +    E+ FI++A+DEIR+E +S D + KA A+ KL YL  + G
Sbjct  1    MWERTLQDLIRGLR--ANKNDEAKFIAQAIDEIRKETRSKDMELKAAAIMKLAYLDML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWAAFH +E+ S+     K + YLAA  SF
Sbjct  58   YDMSWAAFHIVEVMSSPRIHLKSVGYLAAAQSF  90



>gb|KIJ53612.1| hypothetical protein M422DRAFT_222276 [Sphaerobolus stellatus 
SS14]
Length=893

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 63/93 (68%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +    E+ FI++A+DEIR+E+ S D   KA A+ KLTYL  + G
Sbjct  1    MWERTLQDLIRGLR--ANKKDEAKFIAQAIDEIRKEVSSKDMDLKAGAVLKLTYLDML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DM WA+FH +E+ S+  F  K + YLAA  SF
Sbjct  58   YDMKWASFHVVEVMSSPKFHLKSVGYLAAIQSF  90



>ref|XP_007844550.1| ap3d1 protein [Moniliophthora roreri MCA 2997]
 gb|ESK96155.1| ap3d1 protein [Moniliophthora roreri MCA 2997]
Length=903

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/93 (46%), Positives = 64/93 (69%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +    E+ FI+KA++EIR+EI+  D + KA A+ KLTYL  + G
Sbjct  1    MWERTLQDLIRGLR--ANRKDEAKFIAKAIEEIRQEIRGDDMELKAGAVMKLTYL-DMMG  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+FH +E+ S+     K + YLAA  SF
Sbjct  58   YDMSWASFHVVEVMSSPRIHLKSVGYLAAGQSF  90



>ref|XP_008031374.1| hypothetical protein SETTUDRAFT_143720 [Setosphaeria turcica 
Et28A]
 gb|EOA80747.1| hypothetical protein SETTUDRAFT_143720 [Setosphaeria turcica 
Et28A]
Length=1055

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 63/93 (68%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +F++SL DLI+G+R   G   E  +I++++ E R+EI++ D   KATAL KLTYL  + G
Sbjct  1    MFEKSLFDLIRGLRNHKGN--EREYIAESIKECRKEIRTNDMDLKATALMKLTYLE-MFG  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+F+ +E+ S+  F  KR  YLAA  SF
Sbjct  58   HDMSWASFNVLEVMSSSKFKQKRTGYLAAVQSF  90



>gb|KFD62221.1| hypothetical protein M514_12185 [Trichuris suis]
Length=1187

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 65/96 (68%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            +E +F+++  D+I+GIR  +    ES +I + +DEI+ E+KS  P  KA A+ KLTYL  
Sbjct  22   IERMFEKTPTDMIRGIR--ASKENESKYIGQCIDEIKVELKSEYPSVKANAVAKLTYLQM  79

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ S   F+ KRI YLAA+ +F
Sbjct  80   L-GYDISWAAFNIIEVMSCPKFVSKRIGYLAASQAF  114



>gb|EMG47168.1| putative clathrin-associated protein AP-3 complex component [Candida 
maltosa Xu316]
Length=1041

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +1

Query  235  FQRSLDDLIKGIRLFSGGAGES--GFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIH  408
            F++SL+DLIKGIR  S  + ES   F+  A+ E R E+ +TD +TKA A+ KL YL  ++
Sbjct  22   FEKSLNDLIKGIRAHSKESPESLANFLDVAIQECRNELNTTDLETKAMAILKLAYLE-MY  80

Query  409  GVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            G DMSW  F  +E+ S+  F  KR+ YLAA  SF
Sbjct  81   GFDMSWCNFQILEVMSSSKFQQKRVGYLAAIQSF  114



>ref|XP_008637238.1| PREDICTED: AP-3 complex subunit delta-1 [Corvus brachyrhynchos]
Length=1153

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>ref|XP_005531389.1| PREDICTED: AP-3 complex subunit delta-1 isoform X2 [Pseudopodoces 
humilis]
Length=1153

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>ref|XP_002194075.1| PREDICTED: AP-3 complex subunit delta-1 isoform 1 [Taeniopygia 
guttata]
Length=1153

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>ref|XP_003642902.1| PREDICTED: AP-3 complex subunit delta-1 isoform X1 [Gallus gallus]
Length=1153

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>dbj|BAF62313.1| adaptor-related protein complex 3, delta-1 subunit [Sus scrofa]
Length=1201

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  3    IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  60

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  61   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  95



>ref|XP_009095100.1| PREDICTED: AP-3 complex subunit delta-1 isoform X2 [Serinus canaria]
Length=1153

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>ref|XP_008928906.1| PREDICTED: AP-3 complex subunit delta-1 isoform X1 [Manacus vitellinus]
Length=1156

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>ref|XP_008169551.1| PREDICTED: AP-3 complex subunit delta-1 [Chrysemys picta bellii]
Length=1211

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>ref|XP_007949191.1| PREDICTED: AP-3 complex subunit delta-1 isoform X2 [Orycteropus 
afer afer]
Length=1156

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>ref|XP_006743758.1| PREDICTED: AP-3 complex subunit delta-1 isoform X2 [Leptonychotes 
weddellii]
Length=1214

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>ref|XP_004948822.1| PREDICTED: AP-3 complex subunit delta-1 isoform X2 [Gallus gallus]
Length=1218

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>gb|KIK97687.1| hypothetical protein PAXRUDRAFT_200770 [Paxillus rubicundulus 
Ve08.2h10]
Length=892

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 46/93 (49%), Positives = 63/93 (68%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R  +    E  FIS+A +EIRREIKS D + KA A+ KLTYL  + G
Sbjct  1    MWERTLQDLIRGLR--ANKNDEVKFISQANEEIRREIKSKDMELKAGAVMKLTYLDML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+F+ IE+ S+     K + YLAA  SF
Sbjct  58   YDMSWASFYVIEVMSSSKIHLKTVGYLAAVQSF  90



>ref|XP_010564917.1| PREDICTED: AP-3 complex subunit delta-1 [Haliaeetus leucocephalus]
Length=1217

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>ref|XP_009095099.1| PREDICTED: AP-3 complex subunit delta-1 isoform X1 [Serinus canaria]
Length=1217

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>ref|XP_009561068.1| PREDICTED: AP-3 complex subunit delta-1 [Cuculus canorus]
Length=1221

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>gb|EJU02826.1| Adaptor protein complex AP-3 delta subunit [Dacryopinax sp. DJM-731 
SS1]
Length=722

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 45/93 (48%), Positives = 64/93 (69%), Gaps = 3/93 (3%)
 Frame = +1

Query  232  LFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIHG  411
            +++R+L DLI+G+R   G   E+ F+ KA+DEIR EIK  D Q KA A+ KLTYL+ + G
Sbjct  1    MWERTLQDLIRGLRANKGD--ENKFVQKAIDEIRVEIKGKDMQLKAGAVLKLTYLNML-G  57

Query  412  VDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
             DMSWA+F+ +E+ S+  +  K I +LAA  SF
Sbjct  58   YDMSWASFYVVEVMSSPRYYLKNIGHLAACQSF  90



>ref|XP_005060053.1| PREDICTED: AP-3 complex subunit delta-1 [Ficedula albicollis]
Length=1153

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>gb|KGU11907.1| hypothetical protein MEY_02688 [Candida albicans 19F]
Length=1099

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +1

Query  235  FQRSLDDLIKGIRLFSGGAGES--GFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIH  408
            F++SL+DLIKGIR  +  + ES   F+  A+ E R E+ +TD +TKA A+ KL YL  ++
Sbjct  22   FEKSLNDLIKGIRAHTKESPESLGNFLDVAIQECRNELTTTDLETKAMAILKLAYLE-MY  80

Query  409  GVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            G DMSW  F  +E+ S+  F  KRI YLAA  SF
Sbjct  81   GFDMSWCNFQILEVMSSSKFQQKRIGYLAAIQSF  114



>ref|XP_009883352.1| PREDICTED: AP-3 complex subunit delta-1 isoform X2 [Charadrius 
vociferus]
Length=1153

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>gb|KFO53542.1| AP-3 complex subunit delta-1 [Corvus brachyrhynchos]
Length=1154

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>gb|ETE69298.1| AP-3 complex subunit delta-1 [Ophiophagus hannah]
Length=1199

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>gb|EDL89242.1| adaptor-related protein complex 3, delta 1 subunit, isoform CRA_a 
[Rattus norvegicus]
Length=997

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 42/96 (44%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KR+ YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRVGYLAASQCF  102



>ref|XP_008928907.1| PREDICTED: AP-3 complex subunit delta-1 isoform X2 [Manacus vitellinus]
Length=1206

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +1

Query  223  MESLFQRSLDDLIKGIRLFSGGAGESGFISKAVDEIRREIKSTDPQTKATALQKLTYLHS  402
            ++ +F ++L DL++GIR  +    E+ +IS+ +DEI++E+K  +   KA A+ KLTYL  
Sbjct  10   IDRMFDKNLQDLVRGIR--NHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQM  67

Query  403  IHGVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            + G D+SWAAF+ IE+ SA  F +KRI YLAA+  F
Sbjct  68   L-GYDISWAAFNIIEVMSASKFTFKRIGYLAASQCF  102



>gb|KGQ99568.1| hypothetical protein MG1_02731 [Candida albicans GC75]
Length=1100

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +1

Query  235  FQRSLDDLIKGIRLFSGGAGES--GFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIH  408
            F++SL+DLIKGIR  +  + ES   F+  A+ E R E+ +TD +TKA A+ KL YL  ++
Sbjct  22   FEKSLNDLIKGIRAHTKESPESLGNFLDVAIQECRNELTTTDLETKAMAILKLAYLE-MY  80

Query  409  GVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            G DMSW  F  +E+ S+  F  KRI YLAA  SF
Sbjct  81   GFDMSWCNFQILEVMSSSKFQQKRIGYLAAIQSF  114



>gb|KHC78440.1| hypothetical protein MGS_02713 [Candida albicans P78042]
Length=1098

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +1

Query  235  FQRSLDDLIKGIRLFSGGAGES--GFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIH  408
            F++SL+DLIKGIR  +  + ES   F+  A+ E R E+ +TD +TKA A+ KL YL  ++
Sbjct  22   FEKSLNDLIKGIRAHTKESPESLGNFLDVAIQECRNELTTTDLETKAMAILKLAYLE-MY  80

Query  409  GVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            G DMSW  F  +E+ S+  F  KRI YLAA  SF
Sbjct  81   GFDMSWCNFQILEVMSSSKFQQKRIGYLAAIQSF  114



>gb|KGU31824.1| hypothetical protein MGK_02712 [Candida albicans P57055]
Length=1098

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +1

Query  235  FQRSLDDLIKGIRLFSGGAGES--GFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIH  408
            F++SL+DLIKGIR  +  + ES   F+  A+ E R E+ +TD +TKA A+ KL YL  ++
Sbjct  22   FEKSLNDLIKGIRAHTKESPESLGNFLDVAIQECRNELTTTDLETKAMAILKLAYLE-MY  80

Query  409  GVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            G DMSW  F  +E+ S+  F  KRI YLAA  SF
Sbjct  81   GFDMSWCNFQILEVMSSSKFQQKRIGYLAAIQSF  114



>gb|KGU27120.1| hypothetical protein MG7_02726 [Candida albicans P34048]
Length=1098

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +1

Query  235  FQRSLDDLIKGIRLFSGGAGES--GFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIH  408
            F++SL+DLIKGIR  +  + ES   F+  A+ E R E+ +TD +TKA A+ KL YL  ++
Sbjct  22   FEKSLNDLIKGIRAHTKESPESLGNFLDVAIQECRNELTTTDLETKAMAILKLAYLE-MY  80

Query  409  GVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            G DMSW  F  +E+ S+  F  KRI YLAA  SF
Sbjct  81   GFDMSWCNFQILEVMSSSKFQQKRIGYLAAIQSF  114



>gb|KGQ87886.1| hypothetical protein MEO_02685 [Candida albicans P94015]
Length=1098

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +1

Query  235  FQRSLDDLIKGIRLFSGGAGES--GFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIH  408
            F++SL+DLIKGIR  +  + ES   F+  A+ E R E+ +TD +TKA A+ KL YL  ++
Sbjct  22   FEKSLNDLIKGIRAHTKESPESLGNFLDVAIQECRNELTTTDLETKAMAILKLAYLE-MY  80

Query  409  GVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            G DMSW  F  +E+ S+  F  KRI YLAA  SF
Sbjct  81   GFDMSWCNFQILEVMSSSKFQQKRIGYLAAIQSF  114



>gb|EEQ44317.1| conserved hypothetical protein [Candida albicans WO-1]
Length=1098

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +1

Query  235  FQRSLDDLIKGIRLFSGGAGES--GFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIH  408
            F++SL+DLIKGIR  +  + ES   F+  A+ E R E+ +TD +TKA A+ KL YL  ++
Sbjct  22   FEKSLNDLIKGIRAHTKESPESLGNFLDVAIQECRNELTTTDLETKAMAILKLAYLE-MY  80

Query  409  GVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            G DMSW  F  +E+ S+  F  KRI YLAA  SF
Sbjct  81   GFDMSWCNFQILEVMSSSKFQQKRIGYLAAIQSF  114



>gb|KGR17376.1| hypothetical protein MG9_02724 [Candida albicans P37037]
Length=1099

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +1

Query  235  FQRSLDDLIKGIRLFSGGAGES--GFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIH  408
            F++SL+DLIKGIR  +  + ES   F+  A+ E R E+ +TD +TKA A+ KL YL  ++
Sbjct  22   FEKSLNDLIKGIRAHTKESPESLGNFLDVAIQECRNELTTTDLETKAMAILKLAYLE-MY  80

Query  409  GVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            G DMSW  F  +E+ S+  F  KRI YLAA  SF
Sbjct  81   GFDMSWCNFQILEVMSSSKFQQKRIGYLAAIQSF  114



>gb|KGR12647.1| hypothetical protein MG3_02731 [Candida albicans P78048]
Length=1099

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +1

Query  235  FQRSLDDLIKGIRLFSGGAGES--GFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIH  408
            F++SL+DLIKGIR  +  + ES   F+  A+ E R E+ +TD +TKA A+ KL YL  ++
Sbjct  22   FEKSLNDLIKGIRAHTKESPESLGNFLDVAIQECRNELTTTDLETKAMAILKLAYLE-MY  80

Query  409  GVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            G DMSW  F  +E+ S+  F  KRI YLAA  SF
Sbjct  81   GFDMSWCNFQILEVMSSSKFQQKRIGYLAAIQSF  114



>ref|XP_720078.1| potential clathrin-associated protein AP-3 complex component 
[Candida albicans SC5314]
 ref|XP_719947.1| potential clathrin-associated protein AP-3 complex component 
[Candida albicans SC5314]
 gb|EAL01087.1| potential clathrin-associated protein AP-3 complex component 
[Candida albicans SC5314]
 gb|EAL01222.1| potential clathrin-associated protein AP-3 complex component 
[Candida albicans SC5314]
Length=1099

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +1

Query  235  FQRSLDDLIKGIRLFSGGAGES--GFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIH  408
            F++SL+DLIKGIR  +  + ES   F+  A+ E R E+ +TD +TKA A+ KL YL  ++
Sbjct  22   FEKSLNDLIKGIRAHTKESPESLGNFLDVAIQECRNELTTTDLETKAMAILKLAYLE-MY  80

Query  409  GVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            G DMSW  F  +E+ S+  F  KRI YLAA  SF
Sbjct  81   GFDMSWCNFQILEVMSSSKFQQKRIGYLAAIQSF  114



>gb|KHC78813.1| hypothetical protein W5Q_02773 [Candida albicans SC5314]
Length=1100

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +1

Query  235  FQRSLDDLIKGIRLFSGGAGES--GFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIH  408
            F++SL+DLIKGIR  +  + ES   F+  A+ E R E+ +TD +TKA A+ KL YL  ++
Sbjct  22   FEKSLNDLIKGIRAHTKESPESLGNFLDVAIQECRNELTTTDLETKAMAILKLAYLE-MY  80

Query  409  GVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            G DMSW  F  +E+ S+  F  KRI YLAA  SF
Sbjct  81   GFDMSWCNFQILEVMSSSKFQQKRIGYLAAIQSF  114



>gb|KHC70002.1| hypothetical protein MGI_02692 [Candida albicans P75016]
Length=1100

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +1

Query  235  FQRSLDDLIKGIRLFSGGAGES--GFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIH  408
            F++SL+DLIKGIR  +  + ES   F+  A+ E R E+ +TD +TKA A+ KL YL  ++
Sbjct  22   FEKSLNDLIKGIRAHTKESPESLGNFLDVAIQECRNELTTTDLETKAMAILKLAYLE-MY  80

Query  409  GVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            G DMSW  F  +E+ S+  F  KRI YLAA  SF
Sbjct  81   GFDMSWCNFQILEVMSSSKFQQKRIGYLAAIQSF  114



>gb|KHC56647.1| hypothetical protein MGC_02714 [Candida albicans P37039]
 gb|KHC87403.1| hypothetical protein I503_02759 [Candida albicans SC5314]
Length=1100

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +1

Query  235  FQRSLDDLIKGIRLFSGGAGES--GFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIH  408
            F++SL+DLIKGIR  +  + ES   F+  A+ E R E+ +TD +TKA A+ KL YL  ++
Sbjct  22   FEKSLNDLIKGIRAHTKESPESLGNFLDVAIQECRNELTTTDLETKAMAILKLAYLE-MY  80

Query  409  GVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            G DMSW  F  +E+ S+  F  KRI YLAA  SF
Sbjct  81   GFDMSWCNFQILEVMSSSKFQQKRIGYLAAIQSF  114



>gb|KHC43674.1| hypothetical protein W5O_02725 [Candida albicans Ca6]
Length=1100

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +1

Query  235  FQRSLDDLIKGIRLFSGGAGES--GFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIH  408
            F++SL+DLIKGIR  +  + ES   F+  A+ E R E+ +TD +TKA A+ KL YL  ++
Sbjct  22   FEKSLNDLIKGIRAHTKESPESLGNFLDVAIQECRNELTTTDLETKAMAILKLAYLE-MY  80

Query  409  GVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            G DMSW  F  +E+ S+  F  KRI YLAA  SF
Sbjct  81   GFDMSWCNFQILEVMSSSKFQQKRIGYLAAIQSF  114



>gb|KHC37604.1| hypothetical protein MGQ_02700 [Candida albicans P76067]
Length=1100

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +1

Query  235  FQRSLDDLIKGIRLFSGGAGES--GFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIH  408
            F++SL+DLIKGIR  +  + ES   F+  A+ E R E+ +TD +TKA A+ KL YL  ++
Sbjct  22   FEKSLNDLIKGIRAHTKESPESLGNFLDVAIQECRNELTTTDLETKAMAILKLAYLE-MY  80

Query  409  GVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            G DMSW  F  +E+ S+  F  KRI YLAA  SF
Sbjct  81   GFDMSWCNFQILEVMSSSKFQQKRIGYLAAIQSF  114



>gb|KGU31091.1| hypothetical protein MGM_02712 [Candida albicans P75063]
Length=1100

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +1

Query  235  FQRSLDDLIKGIRLFSGGAGES--GFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIH  408
            F++SL+DLIKGIR  +  + ES   F+  A+ E R E+ +TD +TKA A+ KL YL  ++
Sbjct  22   FEKSLNDLIKGIRAHTKESPESLGNFLDVAIQECRNELTTTDLETKAMAILKLAYLE-MY  80

Query  409  GVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            G DMSW  F  +E+ S+  F  KRI YLAA  SF
Sbjct  81   GFDMSWCNFQILEVMSSSKFQQKRIGYLAAIQSF  114



>gb|KGU12737.1| hypothetical protein MEM_02719 [Candida albicans L26]
Length=1100

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +1

Query  235  FQRSLDDLIKGIRLFSGGAGES--GFISKAVDEIRREIKSTDPQTKATALQKLTYLHSIH  408
            F++SL+DLIKGIR  +  + ES   F+  A+ E R E+ +TD +TKA A+ KL YL  ++
Sbjct  22   FEKSLNDLIKGIRAHTKESPESLGNFLDVAIQECRNELTTTDLETKAMAILKLAYLE-MY  80

Query  409  GVDMSWAAFHAIELSSAQSFLYKRIAYLAATLSF  510
            G DMSW  F  +E+ S+  F  KRI YLAA  SF
Sbjct  81   GFDMSWCNFQILEVMSSSKFQQKRIGYLAAIQSF  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557408213115