BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF009F22

Length=603
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011099984.1|  PREDICTED: uncharacterized protein At1g04910...    168   2e-45   Sesamum indicum [beniseed]
gb|EYU30935.1|  hypothetical protein MIMGU_mgv1a004530mg                163   9e-44   Erythranthe guttata [common monkey flower]
ref|XP_011099981.1|  PREDICTED: uncharacterized protein At1g04910...    163   9e-44   Sesamum indicum [beniseed]
gb|EYU30936.1|  hypothetical protein MIMGU_mgv1a004530mg                163   9e-44   Erythranthe guttata [common monkey flower]
ref|XP_009783617.1|  PREDICTED: uncharacterized protein At1g04910...    162   2e-43   Nicotiana sylvestris
emb|CDP01562.1|  unnamed protein product                                159   3e-42   Coffea canephora [robusta coffee]
ref|XP_009623753.1|  PREDICTED: uncharacterized protein At1g04910...    157   1e-41   
gb|EYU39303.1|  hypothetical protein MIMGU_mgv1a004838mg                155   9e-41   Erythranthe guttata [common monkey flower]
ref|XP_004143441.1|  PREDICTED: DUF246 domain-containing protein ...    155   1e-40   Cucumis sativus [cucumbers]
ref|XP_002533683.1|  conserved hypothetical protein                     155   1e-40   Ricinus communis
ref|XP_008440542.1|  PREDICTED: uncharacterized protein At1g04910       154   2e-40   Cucumis melo [Oriental melon]
gb|KJB44062.1|  hypothetical protein B456_007G232700                    150   2e-40   Gossypium raimondii
ref|XP_007047791.1|  O-fucosyltransferase family protein isoform 1      154   3e-40   
ref|XP_010312650.1|  PREDICTED: uncharacterized protein At1g04910...    153   4e-40   Solanum lycopersicum
ref|XP_009797993.1|  PREDICTED: uncharacterized protein At1g04910...    153   4e-40   Nicotiana sylvestris
ref|XP_006353172.1|  PREDICTED: uncharacterized protein At1g04910...    153   5e-40   
ref|XP_010312647.1|  PREDICTED: uncharacterized protein At1g04910...    153   5e-40   
ref|XP_009623754.1|  PREDICTED: uncharacterized protein At1g04910...    153   5e-40   Nicotiana tomentosiformis
ref|XP_011097478.1|  PREDICTED: uncharacterized protein At1g04910...    152   1e-39   Sesamum indicum [beniseed]
gb|KJB44060.1|  hypothetical protein B456_007G232700                    151   1e-39   Gossypium raimondii
ref|XP_010664406.1|  PREDICTED: uncharacterized protein At1g04910...    151   1e-39   Vitis vinifera
ref|XP_008236140.1|  PREDICTED: uncharacterized protein At1g04910...    152   1e-39   Prunus mume [ume]
ref|XP_010254530.1|  PREDICTED: uncharacterized protein At1g04910...    152   2e-39   Nelumbo nucifera [Indian lotus]
gb|KJB44059.1|  hypothetical protein B456_007G232700                    151   2e-39   Gossypium raimondii
gb|KHG05570.1|  hypothetical protein F383_31127                         151   2e-39   Gossypium arboreum [tree cotton]
gb|KDO81174.1|  hypothetical protein CISIN_1g020969mg                   148   3e-39   Citrus sinensis [apfelsine]
ref|XP_002283844.1|  PREDICTED: uncharacterized protein At1g04910...    151   3e-39   Vitis vinifera
ref|XP_003613049.1|  DUF246 domain-containing protein                   151   3e-39   Medicago truncatula
gb|KDP29763.1|  hypothetical protein JCGZ_18698                         150   4e-39   Jatropha curcas
gb|AAX20003.1|  unknown protein                                         145   5e-39   Iris tectorum
ref|XP_004288516.2|  PREDICTED: uncharacterized protein At1g04910       150   8e-39   Fragaria vesca subsp. vesca
ref|XP_009364252.1|  PREDICTED: uncharacterized protein At1g04910...    149   1e-38   Pyrus x bretschneideri [bai li]
ref|XP_009797995.1|  PREDICTED: uncharacterized protein At1g04910...    149   1e-38   Nicotiana sylvestris
ref|XP_006353173.1|  PREDICTED: uncharacterized protein At1g04910...    149   1e-38   Solanum tuberosum [potatoes]
ref|XP_010312648.1|  PREDICTED: uncharacterized protein At1g04910...    149   1e-38   
ref|XP_004509777.1|  PREDICTED: uncharacterized protein At1g04910...    149   2e-38   Cicer arietinum [garbanzo]
ref|XP_006472461.1|  PREDICTED: uncharacterized protein At1g04910...    149   2e-38   Citrus sinensis [apfelsine]
ref|XP_010277498.1|  PREDICTED: uncharacterized protein At1g04910...    147   2e-38   
ref|XP_006433827.1|  hypothetical protein CICLE_v10000880mg             148   3e-38   Citrus clementina [clementine]
ref|XP_009350347.1|  PREDICTED: uncharacterized protein At1g04910...    147   4e-38   Pyrus x bretschneideri [bai li]
ref|XP_002310868.1|  hypothetical protein POPTR_0007s14280g             147   5e-38   Populus trichocarpa [western balsam poplar]
ref|XP_010277497.1|  PREDICTED: uncharacterized protein At1g04910...    147   5e-38   Nelumbo nucifera [Indian lotus]
gb|KJB18181.1|  hypothetical protein B456_003G038000                    146   6e-38   Gossypium raimondii
ref|XP_011021848.1|  PREDICTED: uncharacterized protein At1g04910       147   7e-38   Populus euphratica
ref|XP_010939815.1|  PREDICTED: uncharacterized protein At1g04910...    147   9e-38   
ref|XP_007207425.1|  hypothetical protein PRUPE_ppa004921mg             146   9e-38   
ref|XP_009401410.1|  PREDICTED: uncharacterized protein At1g04910...    147   9e-38   
gb|KHG22139.1|  hypothetical protein F383_05782                         146   1e-37   Gossypium arboreum [tree cotton]
gb|KJB18179.1|  hypothetical protein B456_003G038000                    146   1e-37   Gossypium raimondii
ref|XP_010519195.1|  PREDICTED: uncharacterized protein At1g04910...    146   1e-37   Tarenaya hassleriana [spider flower]
gb|KJB18182.1|  hypothetical protein B456_003G038000                    146   1e-37   Gossypium raimondii
ref|XP_008347790.1|  PREDICTED: uncharacterized protein At1g04910...    146   1e-37   
gb|KJB58884.1|  hypothetical protein B456_009G229500                    142   3e-37   Gossypium raimondii
ref|XP_010523312.1|  PREDICTED: uncharacterized protein At1g04910...    145   3e-37   Tarenaya hassleriana [spider flower]
ref|XP_006472463.1|  PREDICTED: uncharacterized protein At1g04910...    145   3e-37   
ref|XP_004152738.1|  PREDICTED: DUF246 domain-containing protein ...    145   3e-37   Cucumis sativus [cucumbers]
gb|AFK40388.1|  unknown                                                 145   3e-37   Lotus japonicus
ref|XP_010523308.1|  PREDICTED: uncharacterized protein At1g04910...    145   4e-37   Tarenaya hassleriana [spider flower]
ref|XP_006433826.1|  hypothetical protein CICLE_v10000880mg             145   5e-37   
ref|XP_003517397.1|  PREDICTED: uncharacterized protein At1g04910...    144   5e-37   Glycine max [soybeans]
gb|KHN14510.1|  DUF246 domain-containing protein                        144   5e-37   Glycine soja [wild soybean]
ref|XP_008444924.1|  PREDICTED: uncharacterized protein At1g04910...    144   8e-37   Cucumis melo [Oriental melon]
ref|XP_007207426.1|  hypothetical protein PRUPE_ppa004921mg             144   8e-37   
ref|XP_006587571.1|  PREDICTED: uncharacterized protein At1g04910...    144   8e-37   Glycine max [soybeans]
gb|KJB58885.1|  hypothetical protein B456_009G229500                    142   9e-37   Gossypium raimondii
ref|XP_006338062.1|  PREDICTED: uncharacterized protein At1g04910...    144   1e-36   Solanum tuberosum [potatoes]
ref|XP_010113429.1|  hypothetical protein L484_026763                   144   1e-36   
ref|XP_008236135.1|  PREDICTED: uncharacterized protein At1g04910...    143   2e-36   Prunus mume [ume]
ref|XP_008802622.1|  PREDICTED: uncharacterized protein At1g04910...    143   2e-36   Phoenix dactylifera
gb|KJB58883.1|  hypothetical protein B456_009G229500                    143   2e-36   Gossypium raimondii
ref|XP_009150636.1|  PREDICTED: uncharacterized protein At1g04910       143   2e-36   Brassica rapa
ref|XP_010444520.1|  PREDICTED: uncharacterized protein At1g04910...    143   2e-36   Camelina sativa [gold-of-pleasure]
gb|KDO60569.1|  hypothetical protein CISIN_1g009234mg                   142   2e-36   Citrus sinensis [apfelsine]
gb|KJB58881.1|  hypothetical protein B456_009G229500                    143   2e-36   Gossypium raimondii
ref|XP_010680342.1|  PREDICTED: uncharacterized protein At1g04910       143   2e-36   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG27420.1|  hypothetical protein F383_15612                         143   2e-36   Gossypium arboreum [tree cotton]
ref|XP_010547595.1|  PREDICTED: uncharacterized protein At1g04910...    143   2e-36   Tarenaya hassleriana [spider flower]
ref|XP_006280335.1|  hypothetical protein CARUB_v10026260mg             142   3e-36   
ref|XP_008385667.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    142   3e-36   Malus domestica [apple tree]
ref|XP_002268599.2|  PREDICTED: uncharacterized protein At1g04910       142   3e-36   Vitis vinifera
ref|XP_010523344.1|  PREDICTED: uncharacterized protein At1g04910       142   3e-36   Tarenaya hassleriana [spider flower]
ref|XP_006394027.1|  hypothetical protein EUTSA_v10004041mg             142   3e-36   Eutrema salsugineum [saltwater cress]
ref|XP_006426272.1|  hypothetical protein CICLE_v10025329mg             142   3e-36   Citrus clementina [clementine]
ref|NP_194184.2|  O-fucosyltransferase family protein                   142   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006466306.1|  PREDICTED: uncharacterized protein At1g04910...    142   4e-36   Citrus sinensis [apfelsine]
emb|CDY14569.1|  BnaC03g48900D                                          142   4e-36   Brassica napus [oilseed rape]
ref|XP_010433755.1|  PREDICTED: uncharacterized protein At1g04910...    142   5e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010448552.1|  PREDICTED: uncharacterized protein At1g04910...    142   6e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010463027.1|  PREDICTED: uncharacterized protein At1g04910...    142   6e-36   Camelina sativa [gold-of-pleasure]
ref|XP_006413418.1|  hypothetical protein EUTSA_v10024936mg             141   7e-36   Eutrema salsugineum [saltwater cress]
ref|XP_010439017.1|  PREDICTED: uncharacterized protein At1g04910...    141   7e-36   
ref|XP_004501643.1|  PREDICTED: uncharacterized protein At1g04910...    141   7e-36   Cicer arietinum [garbanzo]
gb|KJB48896.1|  hypothetical protein B456_008G092600                    141   8e-36   Gossypium raimondii
ref|XP_010484355.1|  PREDICTED: uncharacterized protein At1g04910...    141   9e-36   Camelina sativa [gold-of-pleasure]
ref|XP_003602912.1|  PsRT17-1 like protein                              141   1e-35   Medicago truncatula
gb|KGN62755.1|  hypothetical protein Csa_2G370540                       144   1e-35   Cucumis sativus [cucumbers]
ref|XP_002864958.1|  hypothetical protein ARALYDRAFT_496780             141   1e-35   
ref|XP_009364251.1|  PREDICTED: uncharacterized protein At1g04910...    141   1e-35   Pyrus x bretschneideri [bai li]
ref|XP_006573005.1|  PREDICTED: uncharacterized protein At1g04910...    140   1e-35   Glycine max [soybeans]
ref|XP_007136338.1|  hypothetical protein PHAVU_009G0371000g            140   1e-35   Phaseolus vulgaris [French bean]
ref|NP_201350.2|  O-fucosyltransferase family protein                   140   2e-35   Arabidopsis thaliana [mouse-ear cress]
gb|AAM13166.1|  unknown protein                                         140   2e-35   Arabidopsis thaliana [mouse-ear cress]
emb|CDP11502.1|  unnamed protein product                                140   2e-35   Coffea canephora [robusta coffee]
gb|EPS73888.1|  hypothetical protein M569_00867                         140   2e-35   Genlisea aurea
ref|XP_003534239.1|  PREDICTED: uncharacterized protein At1g04910...    140   2e-35   Glycine max [soybeans]
ref|XP_007158370.1|  hypothetical protein PHAVU_002G147300g             140   2e-35   Phaseolus vulgaris [French bean]
gb|AGV54860.1|  O-fucosyltransferase family protein                     140   2e-35   Phaseolus vulgaris [French bean]
ref|XP_010937178.1|  PREDICTED: uncharacterized protein At1g04910...    140   3e-35   Elaeis guineensis
ref|XP_006394028.1|  hypothetical protein EUTSA_v10004041mg             139   3e-35   
ref|XP_009350346.1|  PREDICTED: uncharacterized protein At1g04910...    139   4e-35   Pyrus x bretschneideri [bai li]
ref|XP_009138156.1|  PREDICTED: uncharacterized protein At1g04910       139   4e-35   Brassica rapa
ref|XP_006285210.1|  hypothetical protein CARUB_v10006569mg             139   5e-35   Capsella rubella
ref|XP_007018221.1|  O-fucosyltransferase family protein                139   5e-35   
emb|CDY03446.1|  BnaC01g16360D                                          139   6e-35   
ref|XP_002867661.1|  predicted protein                                  138   1e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_008347789.1|  PREDICTED: uncharacterized protein At1g04910...    138   1e-34   
ref|XP_004237994.1|  PREDICTED: uncharacterized protein At1g04910       137   2e-34   Solanum lycopersicum
emb|CDY34289.1|  BnaA01g13920D                                          139   2e-34   Brassica napus [oilseed rape]
emb|CDY33958.1|  BnaC02g43790D                                          137   3e-34   Brassica napus [oilseed rape]
gb|KDP41479.1|  hypothetical protein JCGZ_15886                         136   4e-34   Jatropha curcas
gb|KHN09000.1|  DUF246 domain-containing protein                        136   4e-34   Glycine soja [wild soybean]
emb|CAN78778.1|  hypothetical protein VITISV_029752                     136   4e-34   Vitis vinifera
ref|XP_003526543.1|  PREDICTED: uncharacterized protein At1g04910...    136   5e-34   Glycine max [soybeans]
ref|XP_010061545.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    136   5e-34   Eucalyptus grandis [rose gum]
ref|XP_004301363.1|  PREDICTED: uncharacterized protein At1g04910       136   5e-34   Fragaria vesca subsp. vesca
gb|KFK28724.1|  hypothetical protein AALP_AA7G039000                    136   6e-34   Arabis alpina [alpine rockcress]
ref|XP_002301095.2|  hypothetical protein POPTR_0002s10600g             135   8e-34   
ref|XP_002514041.1|  conserved hypothetical protein                     135   2e-33   Ricinus communis
dbj|BAB11569.1|  unnamed protein product                                135   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009785662.1|  PREDICTED: uncharacterized protein At1g04910...    135   2e-33   Nicotiana sylvestris
ref|XP_009624657.1|  PREDICTED: uncharacterized protein At1g04910...    134   3e-33   Nicotiana tomentosiformis
gb|EPS72903.1|  hypothetical protein M569_01846                         134   4e-33   Genlisea aurea
ref|XP_003523785.1|  PREDICTED: uncharacterized protein At1g04910...    134   4e-33   Glycine max [soybeans]
gb|KHN08263.1|  DUF246 domain-containing protein                        134   4e-33   Glycine soja [wild soybean]
ref|XP_008368388.1|  PREDICTED: uncharacterized protein At1g04910...    134   4e-33   
ref|XP_008339020.1|  PREDICTED: uncharacterized protein LOC103402048    133   5e-33   
ref|XP_011016934.1|  PREDICTED: uncharacterized protein At1g04910...    133   5e-33   Populus euphratica
emb|CDY37829.1|  BnaAnng04900D                                          133   6e-33   Brassica napus [oilseed rape]
ref|XP_009130514.1|  PREDICTED: uncharacterized protein At1g04910...    133   6e-33   Brassica rapa
ref|XP_011016933.1|  PREDICTED: uncharacterized protein At1g04910...    133   6e-33   Populus euphratica
ref|XP_010027954.1|  PREDICTED: uncharacterized protein At1g04910       133   7e-33   Eucalyptus grandis [rose gum]
gb|KCW54609.1|  hypothetical protein EUGRSUZ_I00557                     133   8e-33   Eucalyptus grandis [rose gum]
ref|XP_010692399.1|  PREDICTED: uncharacterized protein At1g04910       132   8e-33   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAK06980.1|  predicted protein                                      132   1e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC84568.1|  hypothetical protein OsI_31345                          132   1e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_009130513.1|  PREDICTED: uncharacterized protein At1g04910...    132   2e-32   Brassica rapa
ref|NP_001063155.1|  Os09g0412200                                       131   2e-32   
ref|XP_004956798.1|  PREDICTED: uncharacterized protein At1g04910...    130   4e-32   Setaria italica
gb|EEE69695.1|  hypothetical protein OsJ_29339                          131   1e-31   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001150199.1|  LOC100283829                                       129   2e-31   Zea mays [maize]
ref|XP_006661225.1|  PREDICTED: uncharacterized protein At1g04910...    127   4e-31   
ref|XP_002462371.1|  hypothetical protein SORBIDRAFT_02g024540          125   3e-30   Sorghum bicolor [broomcorn]
ref|XP_007222858.1|  hypothetical protein PRUPE_ppa004255mg             124   7e-30   Prunus persica
ref|XP_010107675.1|  hypothetical protein L484_007693                   124   1e-29   
ref|XP_010312649.1|  PREDICTED: uncharacterized protein At1g04910...    123   2e-29   Solanum lycopersicum
ref|XP_009376221.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    123   3e-29   Pyrus x bretschneideri [bai li]
gb|KHN33918.1|  DUF246 domain-containing protein                        117   3e-29   Glycine soja [wild soybean]
tpg|DAA61415.1|  TPA: hypothetical protein ZEAMMB73_640362              122   4e-29   
gb|KCW68511.1|  hypothetical protein EUGRSUZ_F02148                     120   1e-28   Eucalyptus grandis [rose gum]
ref|XP_008219267.1|  PREDICTED: uncharacterized protein At1g04910...    119   9e-28   Prunus mume [ume]
gb|KCW54611.1|  hypothetical protein EUGRSUZ_I00557                     113   6e-26   Eucalyptus grandis [rose gum]
gb|AGE09594.1|  UP7-like protein                                        111   6e-26   Eucalyptus cladocalyx
ref|XP_003578106.1|  PREDICTED: uncharacterized protein At1g04910...    113   8e-26   Brachypodium distachyon [annual false brome]
ref|XP_008651492.1|  PREDICTED: LOC100283829 isoform X1                 111   3e-25   Zea mays [maize]
gb|ABJ96379.1|  expressed protein                                       110   8e-25   Prunus persica
ref|XP_006852943.1|  hypothetical protein AMTR_s00033p00238220          107   9e-24   
ref|XP_008378640.1|  PREDICTED: uncharacterized protein At1g04910...    104   9e-23   
ref|XP_010523310.1|  PREDICTED: uncharacterized protein At1g04910...    102   3e-22   
ref|XP_007047792.1|  O-fucosyltransferase family protein isoform 2      102   4e-22   
ref|XP_002967262.1|  hypothetical protein SELMODRAFT_87093              102   6e-22   
gb|KHN11061.1|  DUF246 domain-containing protein                      98.2    9e-22   Glycine soja [wild soybean]
ref|XP_002960458.1|  hypothetical protein SELMODRAFT_75338              101   9e-22   
emb|CAA23010.1|  PsRT17-1 like protein                                97.8    2e-20   Arabidopsis thaliana [mouse-ear cress]
gb|AAB72114.1|  PsRT17-1                                              89.0    2e-17   Pisum sativum [garden pea]
ref|XP_001777077.1|  predicted protein                                89.0    3e-17   
gb|AAK84479.1|  putative auxin growth promotor protein                86.7    3e-16   Solanum lycopersicum
ref|XP_006387762.1|  hypothetical protein POPTR_0603s002103g          75.1    3e-14   
ref|XP_011096470.1|  PREDICTED: uncharacterized protein At1g04910     80.5    4e-14   Sesamum indicum [beniseed]
ref|XP_011074208.1|  PREDICTED: uncharacterized protein At1g04910     80.1    6e-14   Sesamum indicum [beniseed]
gb|EYU22809.1|  hypothetical protein MIMGU_mgv1a003510mg              80.1    6e-14   Erythranthe guttata [common monkey flower]
emb|CBI18521.3|  unnamed protein product                              79.3    9e-14   Vitis vinifera
ref|XP_002272758.2|  PREDICTED: uncharacterized protein At1g04910     79.3    1e-13   Vitis vinifera
ref|XP_009594772.1|  PREDICTED: uncharacterized protein At1g04910     77.4    4e-13   Nicotiana tomentosiformis
gb|KHG28222.1|  hypothetical protein F383_11890                       76.6    5e-13   Gossypium arboreum [tree cotton]
ref|XP_010104480.1|  hypothetical protein L484_025449                 75.1    6e-13   
ref|XP_009781764.1|  PREDICTED: uncharacterized protein At1g04910     77.0    6e-13   Nicotiana sylvestris
gb|AGV54211.1|  O-fucosyltransferase family protein                   76.6    7e-13   Phaseolus vulgaris [French bean]
gb|KJB28878.1|  hypothetical protein B456_005G074200                  76.3    7e-13   Gossypium raimondii
gb|KDP34835.1|  hypothetical protein JCGZ_11197                       76.6    9e-13   Jatropha curcas
gb|KJB28879.1|  hypothetical protein B456_005G074200                  76.3    9e-13   Gossypium raimondii
gb|KJB28877.1|  hypothetical protein B456_005G074200                  76.6    9e-13   Gossypium raimondii
ref|XP_004501690.1|  PREDICTED: uncharacterized protein At1g04910...  76.3    1e-12   
ref|XP_009390063.1|  PREDICTED: uncharacterized protein At1g04910...  76.3    1e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390064.1|  PREDICTED: uncharacterized protein At1g04910...  76.3    1e-12   
ref|XP_011003993.1|  PREDICTED: uncharacterized protein At1g04910     76.3    1e-12   Populus euphratica
ref|XP_006349651.1|  PREDICTED: uncharacterized protein At1g04910...  75.9    1e-12   Solanum tuberosum [potatoes]
ref|XP_010098633.1|  hypothetical protein L484_012746                 75.9    1e-12   
ref|XP_008459666.1|  PREDICTED: uncharacterized protein At1g04910     75.9    1e-12   Cucumis melo [Oriental melon]
ref|XP_010025942.1|  PREDICTED: uncharacterized protein At1g04910...  75.9    1e-12   Eucalyptus grandis [rose gum]
ref|XP_010025946.1|  PREDICTED: uncharacterized protein At1g04910...  75.9    1e-12   Eucalyptus grandis [rose gum]
ref|XP_010025951.1|  PREDICTED: uncharacterized protein At1g04910...  75.5    2e-12   Eucalyptus grandis [rose gum]
ref|XP_006434582.1|  hypothetical protein CICLE_v10000533mg           75.1    2e-12   Citrus clementina [clementine]
ref|XP_006473173.1|  PREDICTED: uncharacterized protein At1g04910...  75.1    2e-12   Citrus sinensis [apfelsine]
ref|XP_002533585.1|  conserved hypothetical protein                   75.5    2e-12   Ricinus communis
ref|XP_002325978.2|  hypothetical protein POPTR_0019s11020g           75.5    2e-12   
emb|CBI19199.3|  unnamed protein product                              75.5    2e-12   Vitis vinifera
ref|XP_010664349.1|  PREDICTED: uncharacterized protein At1g04910     75.5    2e-12   Vitis vinifera
ref|XP_006434581.1|  hypothetical protein CICLE_v10000533mg           75.5    2e-12   
ref|XP_006473172.1|  PREDICTED: uncharacterized protein At1g04910...  75.1    2e-12   
gb|KDO83867.1|  hypothetical protein CISIN_1g008308mg                 75.1    2e-12   Citrus sinensis [apfelsine]
ref|XP_004141562.1|  PREDICTED: DUF246 domain-containing protein ...  75.1    2e-12   Cucumis sativus [cucumbers]
ref|XP_006473171.1|  PREDICTED: uncharacterized protein At1g04910...  75.1    2e-12   
ref|XP_006434583.1|  hypothetical protein CICLE_v10000533mg           75.1    2e-12   
gb|KDO83868.1|  hypothetical protein CISIN_1g008308mg                 74.7    3e-12   Citrus sinensis [apfelsine]
ref|XP_010680244.1|  PREDICTED: uncharacterized protein At1g04910...  75.1    3e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010680324.1|  PREDICTED: uncharacterized protein At1g04910...  75.1    3e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010061980.1|  PREDICTED: uncharacterized protein At1g04910...  74.3    3e-12   
ref|XP_010930789.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  74.7    3e-12   
gb|KHN26223.1|  DUF246 domain-containing protein                      74.7    3e-12   Glycine soja [wild soybean]
ref|XP_003516326.1|  PREDICTED: uncharacterized protein At1g04910...  74.7    4e-12   Glycine max [soybeans]
ref|XP_002891187.1|  hypothetical protein ARALYDRAFT_473680           74.7    4e-12   
ref|XP_004499554.1|  PREDICTED: uncharacterized protein At1g04910...  74.3    4e-12   Cicer arietinum [garbanzo]
gb|KCW69027.1|  hypothetical protein EUGRSUZ_F02582                   74.3    4e-12   Eucalyptus grandis [rose gum]
ref|XP_010061979.1|  PREDICTED: uncharacterized protein At1g04910...  74.3    5e-12   Eucalyptus grandis [rose gum]
ref|XP_004499553.1|  PREDICTED: uncharacterized protein At1g04910...  74.3    5e-12   Cicer arietinum [garbanzo]
ref|XP_007020036.1|  O-fucosyltransferase family protein isoform 2    74.3    5e-12   Theobroma cacao [chocolate]
gb|EPS61677.1|  hypothetical protein M569_13117                       73.6    5e-12   Genlisea aurea
ref|XP_007020035.1|  O-fucosyltransferase family protein isoform 1    74.3    6e-12   
gb|AES98123.2|  auxin-independent growth promoter-like protein        73.9    6e-12   Medicago truncatula
tpg|DAA38994.1|  TPA: hypothetical protein ZEAMMB73_412482            72.0    6e-12   
ref|XP_008781543.1|  PREDICTED: uncharacterized protein At1g04910...  73.6    6e-12   
ref|XP_003602836.1|  DUF246 domain-containing protein                 73.9    7e-12   
ref|XP_008781542.1|  PREDICTED: uncharacterized protein At1g04910...  73.6    7e-12   
ref|XP_004152623.1|  PREDICTED: DUF246 domain-containing protein ...  73.9    7e-12   Cucumis sativus [cucumbers]
ref|XP_003615165.1|  DUF246 domain-containing protein                 73.9    7e-12   
ref|XP_009618695.1|  PREDICTED: uncharacterized protein LOC104110842  70.5    7e-12   Nicotiana tomentosiformis
ref|XP_003544811.1|  PREDICTED: uncharacterized protein At1g04910...  73.6    7e-12   
ref|XP_010319880.1|  PREDICTED: uncharacterized protein At1g04910...  73.6    7e-12   Solanum lycopersicum
ref|XP_010538926.1|  PREDICTED: uncharacterized protein At1g04910...  73.6    9e-12   Tarenaya hassleriana [spider flower]
ref|XP_003598018.1|  DUF246 domain-containing protein                 73.6    9e-12   
ref|XP_007207136.1|  hypothetical protein PRUPE_ppa002471mg           73.6    9e-12   Prunus persica
gb|KHN35489.1|  DUF246 domain-containing protein                      73.2    9e-12   Glycine soja [wild soybean]
gb|AAK93632.1|  putative growth regulator protein                     73.2    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564461.1|  O-fucosyltransferase-like protein                   73.2    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AAF79365.1|AC007887_24  F15O4.45                                   73.6    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KHM98943.1|  DUF246 domain-containing protein                      73.2    1e-11   Glycine soja [wild soybean]
ref|XP_009362464.1|  PREDICTED: uncharacterized protein At1g04910...  72.8    1e-11   Pyrus x bretschneideri [bai li]
ref|XP_004490384.1|  PREDICTED: uncharacterized protein At1g04910...  72.8    1e-11   Cicer arietinum [garbanzo]
ref|XP_004490385.1|  PREDICTED: uncharacterized protein At1g04910...  72.8    1e-11   Cicer arietinum [garbanzo]
ref|XP_006576578.1|  PREDICTED: uncharacterized protein At1g04910...  73.2    1e-11   
emb|CDY10050.1|  BnaC08g44010D                                        72.4    1e-11   Brassica napus [oilseed rape]
ref|XP_001761221.1|  predicted protein                                72.4    2e-11   
ref|XP_008669810.1|  PREDICTED: uncharacterized protein At1g04910...  72.0    2e-11   
ref|XP_009362462.1|  PREDICTED: uncharacterized protein At1g04910...  72.8    2e-11   Pyrus x bretschneideri [bai li]
ref|XP_003578848.1|  PREDICTED: uncharacterized protein At1g04910...  72.4    2e-11   Brachypodium distachyon [annual false brome]
ref|XP_008669808.1|  PREDICTED: uncharacterized protein At1g04910...  72.0    2e-11   Zea mays [maize]
ref|XP_008669809.1|  PREDICTED: uncharacterized protein At1g04910...  72.0    2e-11   Zea mays [maize]
ref|XP_010250060.1|  PREDICTED: uncharacterized protein At1g04910...  72.0    2e-11   Nelumbo nucifera [Indian lotus]
ref|XP_007018708.1|  O-fucosyltransferase family protein              72.4    2e-11   
ref|XP_008669807.1|  PREDICTED: uncharacterized protein At1g04910...  72.0    2e-11   Zea mays [maize]
gb|KEH36621.1|  GDP-fucose protein O-fucosyltransferase               72.4    2e-11   Medicago truncatula
ref|XP_004977274.1|  PREDICTED: uncharacterized protein At1g04910...  72.0    2e-11   
ref|XP_010044058.1|  PREDICTED: uncharacterized protein At1g04910     72.4    2e-11   Eucalyptus grandis [rose gum]
ref|XP_010478945.1|  PREDICTED: uncharacterized protein At1g04910...  72.0    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010535322.1|  PREDICTED: uncharacterized protein At1g04910...  71.6    2e-11   Tarenaya hassleriana [spider flower]
gb|KCW86055.1|  hypothetical protein EUGRSUZ_B02760                   72.4    2e-11   Eucalyptus grandis [rose gum]
ref|XP_002441904.1|  hypothetical protein SORBIDRAFT_08g004650        72.0    2e-11   
ref|XP_008355708.1|  PREDICTED: uncharacterized protein At1g04910...  72.4    3e-11   Malus domestica [apple tree]
ref|XP_008669805.1|  PREDICTED: uncharacterized protein At1g04910...  72.0    3e-11   Zea mays [maize]
ref|XP_009398160.1|  PREDICTED: uncharacterized protein At1g04910...  72.0    3e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010461317.1|  PREDICTED: uncharacterized protein At1g04910...  72.0    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_004237568.1|  PREDICTED: uncharacterized protein At1g04910...  72.0    3e-11   Solanum lycopersicum
ref|XP_010500036.1|  PREDICTED: uncharacterized protein At1g04910...  72.0    3e-11   Camelina sativa [gold-of-pleasure]
gb|KJB76860.1|  hypothetical protein B456_012G110800                  72.0    3e-11   Gossypium raimondii
ref|XP_010535312.1|  PREDICTED: uncharacterized protein At1g04910...  72.0    3e-11   Tarenaya hassleriana [spider flower]
ref|XP_010535316.1|  PREDICTED: uncharacterized protein At1g04910...  72.0    3e-11   Tarenaya hassleriana [spider flower]
ref|XP_006304663.1|  hypothetical protein CARUB_v10011867mg           72.0    3e-11   Capsella rubella
ref|XP_008368399.1|  PREDICTED: uncharacterized protein At1g04910...  71.2    3e-11   
emb|CDY03127.1|  BnaC06g08460D                                        72.0    3e-11   
ref|XP_010650286.1|  PREDICTED: uncharacterized protein At1g04910...  71.6    3e-11   
ref|XP_009370260.1|  PREDICTED: uncharacterized protein At1g04910...  72.0    3e-11   
ref|XP_009370233.1|  PREDICTED: uncharacterized protein At1g04910...  72.0    3e-11   
ref|XP_008339228.1|  PREDICTED: uncharacterized protein At1g04910...  71.2    3e-11   
emb|CBI17217.3|  unnamed protein product                              71.6    3e-11   
ref|XP_006581527.1|  PREDICTED: uncharacterized protein At1g04910...  71.6    3e-11   
ref|XP_004506640.1|  PREDICTED: uncharacterized protein At1g04910...  72.0    3e-11   
ref|XP_006581526.1|  PREDICTED: uncharacterized protein At1g04910...  71.6    4e-11   
gb|KHN08953.1|  DUF246 domain-containing protein                      71.2    4e-11   
gb|KHN27381.1|  DUF246 domain-containing protein                      71.6    4e-11   
ref|XP_006397450.1|  hypothetical protein EUTSA_v10001813mg           71.6    4e-11   
ref|XP_006582446.1|  PREDICTED: uncharacterized protein At1g04910...  71.2    4e-11   
ref|XP_006578315.1|  PREDICTED: uncharacterized protein At1g04910...  71.2    4e-11   
ref|XP_008368398.1|  PREDICTED: uncharacterized protein At1g04910...  71.2    4e-11   
ref|XP_006351561.1|  PREDICTED: uncharacterized protein At1g04910...  71.2    5e-11   
emb|CDP10650.1|  unnamed protein product                              71.2    5e-11   
ref|XP_008239791.1|  PREDICTED: uncharacterized protein At1g04910...  71.2    5e-11   
gb|KJB46611.1|  hypothetical protein B456_007G377900                  71.2    5e-11   
ref|XP_003526401.1|  PREDICTED: uncharacterized protein At1g04910...  71.2    5e-11   
ref|XP_009804174.1|  PREDICTED: uncharacterized protein At1g04910...  70.9    5e-11   
ref|XP_008444860.1|  PREDICTED: uncharacterized protein At1g04910     70.9    6e-11   
gb|AES87023.2|  GDP-fucose O-fucosyltransferase-like protein          71.2    6e-11   
emb|CDP04442.1|  unnamed protein product                              69.7    6e-11   
ref|NP_001066285.2|  Os12g0174100                                     70.9    6e-11   
dbj|BAJ95065.1|  predicted protein                                    70.9    6e-11   
ref|XP_010926334.1|  PREDICTED: uncharacterized protein At1g04910...  70.9    6e-11   
gb|EEE52851.1|  hypothetical protein OsJ_35390                        70.9    7e-11   
gb|KFK44342.1|  hypothetical protein AALP_AA1G245400                  70.9    7e-11   
ref|XP_010926335.1|  PREDICTED: uncharacterized protein At1g04910...  70.5    7e-11   
gb|KFK44341.1|  hypothetical protein AALP_AA1G245400                  70.9    7e-11   
ref|XP_002279576.2|  PREDICTED: uncharacterized protein At1g04910     70.9    7e-11   
gb|KFK27807.1|  hypothetical protein AALP_AA8G431600                  70.9    7e-11   
gb|EMS55867.1|  hypothetical protein TRIUR3_34733                     70.5    7e-11   
ref|XP_008782174.1|  PREDICTED: uncharacterized protein At1g04910...  70.5    7e-11   
ref|XP_008352830.1|  PREDICTED: uncharacterized protein YGR130C-like  70.9    7e-11   
ref|XP_010267002.1|  PREDICTED: uncharacterized protein At1g04910...  70.5    7e-11   
ref|XP_002893230.1|  hypothetical protein ARALYDRAFT_472486           70.5    8e-11   
ref|XP_004485909.1|  PREDICTED: uncharacterized protein At1g04910...  70.5    8e-11   
emb|CDY66921.1|  BnaAnng23210D                                        70.5    8e-11   
gb|EEC68940.1|  hypothetical protein OsI_37646                        70.5    8e-11   
dbj|BAJ97328.1|  predicted protein                                    70.5    8e-11   
ref|XP_002522229.1|  conserved hypothetical protein                   70.5    8e-11   
ref|XP_002450409.1|  hypothetical protein SORBIDRAFT_05g004890        70.5    8e-11   
ref|XP_006579000.1|  PREDICTED: uncharacterized protein At1g04910...  70.5    8e-11   
ref|XP_009772998.1|  PREDICTED: uncharacterized protein At1g04910     70.5    8e-11   
ref|XP_009114709.1|  PREDICTED: uncharacterized protein At1g04910     70.5    9e-11   
gb|EMT33054.1|  hypothetical protein F775_09106                       70.1    9e-11   
ref|XP_007141214.1|  hypothetical protein PHAVU_008G176800g           70.5    9e-11   
ref|XP_009112144.1|  PREDICTED: uncharacterized protein At1g04910     70.1    9e-11   
ref|XP_007148603.1|  hypothetical protein PHAVU_005G000400g           70.5    9e-11   
gb|KHN47089.1|  DUF246 domain-containing protein                      70.5    1e-10   
ref|XP_006433927.1|  hypothetical protein CICLE_v10000706mg           70.1    1e-10   
ref|XP_010246042.1|  PREDICTED: uncharacterized protein At1g04910...  70.1    1e-10   
ref|XP_006578999.1|  PREDICTED: uncharacterized protein At1g04910...  70.1    1e-10   
ref|XP_004299893.1|  PREDICTED: uncharacterized protein At1g04910     70.1    1e-10   
ref|XP_006433928.1|  hypothetical protein CICLE_v10000706mg           70.1    1e-10   
ref|XP_008798044.1|  PREDICTED: uncharacterized protein At1g04910...  70.1    1e-10   
ref|XP_006433925.1|  hypothetical protein CICLE_v10000706mg           69.3    1e-10   
ref|XP_006664382.1|  PREDICTED: uncharacterized protein At1g04910...  69.7    1e-10   
ref|XP_004236554.2|  PREDICTED: uncharacterized protein At1g04910     69.7    1e-10   
emb|CDP01105.1|  unnamed protein product                              70.1    1e-10   
ref|XP_011016822.1|  PREDICTED: uncharacterized protein At1g04910...  69.7    1e-10   
ref|XP_006433926.1|  hypothetical protein CICLE_v10000706mg           70.1    1e-10   
ref|XP_010246041.1|  PREDICTED: uncharacterized protein At1g04910...  70.1    1e-10   
ref|XP_006363293.1|  PREDICTED: uncharacterized protein At1g04910...  69.7    1e-10   
ref|XP_001765585.1|  predicted protein                                69.7    1e-10   
gb|KHG19055.1|  hypothetical protein F383_06473                       69.7    1e-10   
gb|KFK28149.1|  hypothetical protein AALP_AA8G479000                  69.7    1e-10   
ref|XP_010498714.1|  PREDICTED: uncharacterized protein At1g04910...  69.7    2e-10   
gb|KJB64222.1|  hypothetical protein B456_010G038100                  69.7    2e-10   
ref|XP_006433929.1|  hypothetical protein CICLE_v10000706mg           69.7    2e-10   
gb|KJB64220.1|  hypothetical protein B456_010G038100                  69.7    2e-10   
gb|AFY26903.1|  duf246 domain-containing protein                      69.7    2e-10   
ref|XP_010246043.1|  PREDICTED: uncharacterized protein At1g04910...  69.3    2e-10   
ref|XP_010498715.1|  PREDICTED: uncharacterized protein At1g04910...  69.3    2e-10   
ref|XP_010246040.1|  PREDICTED: uncharacterized protein At1g04910...  69.7    2e-10   
ref|XP_009417593.1|  PREDICTED: uncharacterized protein At1g04910...  69.7    2e-10   
gb|KHG20341.1|  hypothetical protein F383_05466                       69.7    2e-10   
ref|XP_010477505.1|  PREDICTED: uncharacterized protein At1g04910     69.7    2e-10   
ref|XP_003519179.1|  PREDICTED: uncharacterized protein At1g04910...  69.3    2e-10   
ref|XP_008349206.1|  PREDICTED: uncharacterized protein At1g04910...  69.7    2e-10   
ref|XP_008349205.1|  PREDICTED: uncharacterized protein At1g04910...  69.7    2e-10   
ref|XP_007026820.1|  O-fucosyltransferase family protein isoform 2    69.3    2e-10   
gb|KHG19054.1|  hypothetical protein F383_06473                       69.7    2e-10   
ref|XP_010040214.1|  PREDICTED: uncharacterized protein At1g04910     69.3    2e-10   
ref|XP_011039415.1|  PREDICTED: uncharacterized protein At1g04910...  69.3    2e-10   
ref|XP_008219343.1|  PREDICTED: uncharacterized protein At1g04910...  69.3    2e-10   
ref|XP_010543575.1|  PREDICTED: uncharacterized protein At1g04910...  69.7    2e-10   
ref|XP_010262721.1|  PREDICTED: uncharacterized protein At1g04910...  69.7    2e-10   
ref|XP_002527876.1|  conserved hypothetical protein                   69.7    2e-10   
ref|XP_002513963.1|  conserved hypothetical protein                   69.3    2e-10   
ref|XP_007026819.1|  O-fucosyltransferase family protein isoform 1    69.7    2e-10   
ref|XP_007221810.1|  hypothetical protein PRUPE_ppa004094mg           69.3    2e-10   
ref|XP_008805903.1|  PREDICTED: uncharacterized protein At1g04910...  68.9    2e-10   
ref|XP_010543593.1|  PREDICTED: uncharacterized protein At1g04910...  69.3    2e-10   
ref|XP_010913449.1|  PREDICTED: uncharacterized protein At1g04910...  69.3    2e-10   
gb|KJB57392.1|  hypothetical protein B456_009G161400                  69.3    2e-10   
ref|XP_004172258.1|  PREDICTED: DUF246 domain-containing protein ...  69.3    2e-10   
ref|XP_010493605.1|  PREDICTED: uncharacterized protein At1g04910...  69.3    2e-10   
ref|XP_004133993.1|  PREDICTED: DUF246 domain-containing protein ...  69.3    2e-10   
ref|XP_010475159.1|  PREDICTED: uncharacterized protein At1g04910...  69.3    2e-10   
ref|XP_011039413.1|  PREDICTED: uncharacterized protein At1g04910...  69.3    2e-10   
ref|XP_010484389.1|  PREDICTED: uncharacterized protein At1g04910...  68.9    2e-10   
ref|XP_011039414.1|  PREDICTED: uncharacterized protein At1g04910...  68.9    2e-10   
ref|XP_011039411.1|  PREDICTED: uncharacterized protein At1g04910...  69.3    2e-10   
gb|EYU31451.1|  hypothetical protein MIMGU_mgv1a0047671mg             66.2    2e-10   
gb|EYU31450.1|  hypothetical protein MIMGU_mgv1a0047671mg             66.2    2e-10   
ref|XP_010457549.1|  PREDICTED: uncharacterized protein At1g04910...  68.9    2e-10   
gb|AES62612.2|  GDP-fucose protein O-fucosyltransferase               68.9    2e-10   
ref|XP_010674227.1|  PREDICTED: uncharacterized protein At1g04910...  68.9    2e-10   
ref|XP_009398945.1|  PREDICTED: uncharacterized protein At1g04910...  68.6    3e-10   
ref|XP_004237944.1|  PREDICTED: uncharacterized protein At1g04910     68.9    3e-10   
ref|XP_008805902.1|  PREDICTED: uncharacterized protein At1g04910...  68.9    3e-10   
ref|XP_008805901.1|  PREDICTED: uncharacterized protein At1g04910...  68.9    3e-10   
ref|XP_010674228.1|  PREDICTED: uncharacterized protein At1g04910...  68.9    3e-10   
ref|XP_004305155.1|  PREDICTED: uncharacterized protein At1g04910     68.9    3e-10   
ref|XP_004299674.1|  PREDICTED: uncharacterized protein At1g04910...  68.9    3e-10   
ref|XP_011464606.1|  PREDICTED: uncharacterized protein At1g04910...  68.9    3e-10   
gb|AFW56213.1|  hypothetical protein ZEAMMB73_697257                  68.9    3e-10   
ref|XP_008359322.1|  PREDICTED: uncharacterized protein At1g04910...  68.6    3e-10   
ref|XP_010912508.1|  PREDICTED: uncharacterized protein At1g04910...  68.9    3e-10   
ref|XP_008359321.1|  PREDICTED: uncharacterized protein At1g04910...  68.6    3e-10   
ref|XP_008661414.1|  PREDICTED: uncharacterized protein LOC100193...  68.9    3e-10   
ref|XP_009624336.1|  PREDICTED: uncharacterized protein At1g04910     68.9    3e-10   
ref|XP_006416197.1|  hypothetical protein EUTSA_v10007232mg           68.6    3e-10   
ref|XP_001768745.1|  predicted protein                                68.6    3e-10   
ref|XP_010272985.1|  PREDICTED: uncharacterized protein At1g04910...  68.6    3e-10   
gb|EPS58265.1|  hypothetical protein M569_16550                       68.2    3e-10   
gb|EMT24938.1|  hypothetical protein F775_20364                       68.2    3e-10   
ref|XP_010423912.1|  PREDICTED: uncharacterized protein At1g04910...  68.6    3e-10   
ref|XP_009379852.1|  PREDICTED: uncharacterized protein At1g04910...  68.6    4e-10   
ref|XP_010272984.1|  PREDICTED: uncharacterized protein At1g04910...  68.6    4e-10   
ref|XP_011041933.1|  PREDICTED: uncharacterized protein At1g04910...  68.6    4e-10   
ref|XP_011041937.1|  PREDICTED: uncharacterized protein At1g04910...  68.6    4e-10   
ref|XP_006373066.1|  hypothetical protein POPTR_0017s08410g           68.6    4e-10   
ref|XP_011006967.1|  PREDICTED: uncharacterized protein At1g04910...  68.6    4e-10   
ref|XP_009352745.1|  PREDICTED: uncharacterized protein At1g04910...  68.6    4e-10   
ref|XP_009352742.1|  PREDICTED: uncharacterized protein At1g04910...  68.6    4e-10   
ref|XP_011006970.1|  PREDICTED: uncharacterized protein At1g04910...  68.2    4e-10   
ref|XP_006373067.1|  hypothetical protein POPTR_0017s08410g           68.2    4e-10   
ref|XP_008388105.1|  PREDICTED: uncharacterized protein At1g04910     68.6    4e-10   
ref|XP_009632007.1|  PREDICTED: uncharacterized protein At1g04910...  68.2    4e-10   
ref|XP_006472560.1|  PREDICTED: uncharacterized protein At1g04910...  68.2    4e-10   
ref|XP_004160299.1|  PREDICTED: DUF246 domain-containing protein ...  68.2    4e-10   
ref|XP_009632006.1|  PREDICTED: uncharacterized protein At1g04910...  68.2    4e-10   
ref|XP_009358826.1|  PREDICTED: uncharacterized protein At1g04910...  68.6    4e-10   
ref|XP_006449523.1|  hypothetical protein CICLE_v10014718mg           68.2    5e-10   
ref|XP_006472559.1|  PREDICTED: uncharacterized protein At1g04910...  68.2    5e-10   
ref|XP_006377544.1|  hypothetical protein POPTR_0011s07160g           68.2    5e-10   
ref|XP_006827996.1|  hypothetical protein AMTR_s00008p00236930        68.2    5e-10   
ref|XP_002316818.2|  hypothetical protein POPTR_0011s07160g           68.2    5e-10   
ref|XP_010452025.1|  PREDICTED: uncharacterized protein At1g04910...  68.2    5e-10   
ref|XP_010452026.1|  PREDICTED: uncharacterized protein At1g04910...  68.2    5e-10   
ref|XP_010452024.1|  PREDICTED: uncharacterized protein At1g04910...  68.2    5e-10   
ref|XP_010023452.1|  PREDICTED: uncharacterized protein At1g04910     68.2    5e-10   
ref|XP_003592361.1|  Phosphoglucomutase                               68.6    5e-10   
ref|XP_011009570.1|  PREDICTED: uncharacterized protein At1g04910...  68.2    5e-10   
ref|XP_011101549.1|  PREDICTED: uncharacterized protein At1g04910     68.2    5e-10   
gb|KHG04968.1|  hypothetical protein F383_30616                       67.8    5e-10   
ref|XP_007222914.1|  hypothetical protein PRUPE_ppa003660mg           68.2    5e-10   
gb|KDP32763.1|  hypothetical protein JCGZ_12055                       68.2    5e-10   
ref|XP_010913450.1|  PREDICTED: uncharacterized protein At1g04910...  67.8    5e-10   
ref|XP_008221889.1|  PREDICTED: uncharacterized protein At1g04910     68.2    6e-10   
ref|XP_009388776.1|  PREDICTED: uncharacterized protein At1g04910...  67.8    6e-10   
ref|XP_006420975.1|  hypothetical protein CICLE_v10004740mg           67.8    6e-10   
emb|CDP03096.1|  unnamed protein product                              68.2    6e-10   
ref|XP_008378761.1|  PREDICTED: uncharacterized protein At1g04910     67.8    6e-10   
ref|XP_002305063.2|  hypothetical protein POPTR_0004s05760g           67.8    6e-10   
ref|XP_010460001.1|  PREDICTED: uncharacterized protein At1g04910...  67.8    6e-10   
emb|CDP13245.1|  unnamed protein product                              67.8    6e-10   
ref|XP_011024396.1|  PREDICTED: uncharacterized protein At1g04910     67.8    6e-10   
ref|XP_010913447.1|  PREDICTED: uncharacterized protein At1g04910...  67.8    7e-10   
ref|XP_010460000.1|  PREDICTED: uncharacterized protein At1g04910...  67.8    7e-10   
ref|XP_011071301.1|  PREDICTED: uncharacterized protein At1g04910     68.2    7e-10   
ref|XP_002322236.1|  hypothetical protein POPTR_0015s10470g           67.8    7e-10   
gb|KDP21114.1|  hypothetical protein JCGZ_21585                       67.4    7e-10   
ref|XP_008238170.1|  PREDICTED: uncharacterized protein At1g04910...  67.4    7e-10   
ref|XP_010060050.1|  PREDICTED: uncharacterized protein At1g04910...  67.8    7e-10   
ref|XP_009352746.1|  PREDICTED: uncharacterized protein At1g04910...  67.8    7e-10   
ref|XP_002888034.1|  hypothetical protein ARALYDRAFT_475111           67.8    7e-10   
ref|XP_010473452.1|  PREDICTED: uncharacterized protein At1g04910...  67.8    7e-10   
emb|CDY18704.1|  BnaA09g06910D                                        67.4    7e-10   
ref|XP_010444223.1|  PREDICTED: uncharacterized protein At1g04910...  67.8    7e-10   
ref|XP_002864909.1|  hypothetical protein ARALYDRAFT_496672           67.4    8e-10   
ref|XP_006848051.1|  hypothetical protein AMTR_s00029p00193940        67.8    8e-10   
ref|XP_006303975.1|  hypothetical protein CARUB_v10008864mg           67.4    8e-10   
gb|KEH43753.1|  GDP-fucose protein O-fucosyltransferase               64.7    8e-10   
ref|XP_010675873.1|  PREDICTED: uncharacterized protein At1g04910     67.4    8e-10   
ref|XP_007209981.1|  hypothetical protein PRUPE_ppa005103mg           67.4    8e-10   
ref|XP_002436782.1|  hypothetical protein SORBIDRAFT_10g008680        67.4    8e-10   
ref|XP_002284399.1|  PREDICTED: uncharacterized protein At1g04910...  67.4    8e-10   
emb|CBI19065.3|  unnamed protein product                              67.4    8e-10   
ref|XP_007222464.1|  hypothetical protein PRUPE_ppa003505mg           67.4    9e-10   
ref|XP_006858424.1|  hypothetical protein AMTR_s00071p00069340        67.4    9e-10   
ref|XP_008784225.1|  PREDICTED: uncharacterized protein At1g04910...  67.4    9e-10   
emb|CDX78207.1|  BnaA09g34020D                                        67.4    9e-10   
ref|XP_004157938.1|  PREDICTED: DUF246 domain-containing protein ...  67.4    9e-10   
ref|XP_001765982.1|  predicted protein                                67.0    9e-10   
ref|XP_010655536.1|  PREDICTED: uncharacterized protein At1g04910...  67.4    9e-10   
ref|XP_008459785.1|  PREDICTED: uncharacterized protein At1g04910...  67.4    9e-10   
ref|NP_171983.2|  O-fucosyltransferase-like protein                   67.4    9e-10   
gb|KDO77884.1|  hypothetical protein CISIN_1g007320mg                 67.4    9e-10   
ref|XP_008459769.1|  PREDICTED: uncharacterized protein At1g04910...  67.4    9e-10   
gb|KGN60506.1|  hypothetical protein Csa_2G000150                     67.4    9e-10   
ref|XP_007136275.1|  hypothetical protein PHAVU_009G032800g           67.4    9e-10   
ref|XP_010664246.1|  PREDICTED: uncharacterized protein At1g04910...  67.4    9e-10   
gb|EYU27099.1|  hypothetical protein MIMGU_mgv1a004188mg              67.4    9e-10   
gb|AAF40446.1|AC004809_4  Similar to the auxin-independent growth...  67.0    9e-10   
gb|KFK42839.1|  hypothetical protein AALP_AA1G045700                  67.0    1e-09   
ref|XP_002892251.1|  hypothetical protein ARALYDRAFT_470476           67.0    1e-09   
ref|XP_010655535.1|  PREDICTED: uncharacterized protein At1g04910...  67.4    1e-09   
ref|XP_010922337.1|  PREDICTED: uncharacterized protein At1g04910...  67.4    1e-09   
gb|KJB50269.1|  hypothetical protein B456_008G161400                  67.0    1e-09   
ref|XP_009116096.1|  PREDICTED: uncharacterized protein At1g04910     67.4    1e-09   
ref|XP_010509241.1|  PREDICTED: uncharacterized protein At1g04910...  67.4    1e-09   
dbj|BAJ90349.1|  predicted protein                                    65.5    1e-09   
ref|XP_006306504.1|  hypothetical protein CARUB_v10012492mg           67.0    1e-09   
emb|CDY56371.1|  BnaAnng14240D                                        65.1    1e-09   
ref|XP_006418082.1|  hypothetical protein EUTSA_v10007374mg           67.0    1e-09   
emb|CAN71444.1|  hypothetical protein VITISV_036923                   67.0    1e-09   
ref|XP_010430282.1|  PREDICTED: uncharacterized protein At1g04910...  67.4    1e-09   



>ref|XP_011099984.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Sesamum indicum]
Length=517

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = +3

Query  198  FTSRGGAMaallllllpaffptlfttfIYASPSILSESIIAKPRHSSLFKSALQRETTPE  377
            +  RGG MA  L+LLLP  FP+LFT F +A PS+LSE    KPRHS L KSALQR+T+ E
Sbjct  10   YKQRGGTMAGALVLLLPFLFPSLFTPFSHALPSVLSEWNAPKPRHSRLLKSALQRQTSDE  69

Query  378  EKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILN  557
            ++AE+WMPLA+QGW+P   SG  S   EKS+GY+QVFLDGGLNQQRMGICDAVA+AKILN
Sbjct  70   QQAELWMPLAHQGWRPCARSGSTSTLPEKSQGYIQVFLDGGLNQQRMGICDAVALAKILN  129

Query  558  ATLVIPYLEVNPVWQ  602
            ATL+IP+LEVNPVWQ
Sbjct  130  ATLIIPHLEVNPVWQ  144



>gb|EYU30935.1| hypothetical protein MIMGU_mgv1a004530mg [Erythranthe guttata]
Length=522

 Score =   163 bits (413),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +3

Query  207  RGGAMaallllllpaffptlfttfIYASPSILSESIIAKPRHSSLFKSALQRETTPEEKA  386
            RGGAM A ++LLLP  FP LFT F +A PS+LSE    K RHS L KSALQRET+ E+ +
Sbjct  8    RGGAMVAAVVLLLPFLFPNLFTPFTHALPSLLSEWNAPKLRHSRLLKSALQRETSDEQLS  67

Query  387  EIWMPLANQGWKPVPDSGLF-SKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNAT  563
            E+WMPL+NQGWKP   S +  S  +EKS+GY+QVFLDGGLNQQRMGICDAVA+AKILNAT
Sbjct  68   ELWMPLSNQGWKPCIRSDIITSSLTEKSQGYIQVFLDGGLNQQRMGICDAVALAKILNAT  127

Query  564  LVIPYLEVNPVWQ  602
            L+IPYLEVNPVWQ
Sbjct  128  LIIPYLEVNPVWQ  140



>ref|XP_011099981.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Sesamum indicum]
 ref|XP_011099982.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Sesamum indicum]
 ref|XP_011099983.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Sesamum indicum]
Length=518

 Score =   163 bits (413),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 110/136 (81%), Gaps = 1/136 (1%)
 Frame = +3

Query  198  FTSRGGAMaallllllpaffptlfttfIYASPSILSESIIAKPRHSSLFKSALQRETTPE  377
            +  RGG MA  L+LLLP  FP+LFT F +A PS+LSE    KPRHS L KSALQR+T+ E
Sbjct  10   YKQRGGTMAGALVLLLPFLFPSLFTPFSHALPSVLSEWNAPKPRHSRLLKSALQRQTSDE  69

Query  378  EKAEIWMPLANQGWKPVPDSGLFSK-FSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKIL  554
            ++AE+WMPLA+QGW+P   SG  S    EKS+GY+QVFLDGGLNQQRMGICDAVA+AKIL
Sbjct  70   QQAELWMPLAHQGWRPCARSGSTSTALPEKSQGYIQVFLDGGLNQQRMGICDAVALAKIL  129

Query  555  NATLVIPYLEVNPVWQ  602
            NATL+IP+LEVNPVWQ
Sbjct  130  NATLIIPHLEVNPVWQ  145



>gb|EYU30936.1| hypothetical protein MIMGU_mgv1a004530mg [Erythranthe guttata]
 gb|EYU30937.1| hypothetical protein MIMGU_mgv1a004530mg [Erythranthe guttata]
Length=511

 Score =   163 bits (413),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +3

Query  207  RGGAMaallllllpaffptlfttfIYASPSILSESIIAKPRHSSLFKSALQRETTPEEKA  386
            RGGAM A ++LLLP  FP LFT F +A PS+LSE    K RHS L KSALQRET+ E+ +
Sbjct  8    RGGAMVAAVVLLLPFLFPNLFTPFTHALPSLLSEWNAPKLRHSRLLKSALQRETSDEQLS  67

Query  387  EIWMPLANQGWKPVPDSGLF-SKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNAT  563
            E+WMPL+NQGWKP   S +  S  +EKS+GY+QVFLDGGLNQQRMGICDAVA+AKILNAT
Sbjct  68   ELWMPLSNQGWKPCIRSDIITSSLTEKSQGYIQVFLDGGLNQQRMGICDAVALAKILNAT  127

Query  564  LVIPYLEVNPVWQ  602
            L+IPYLEVNPVWQ
Sbjct  128  LIIPYLEVNPVWQ  140



>ref|XP_009783617.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=512

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +ASPSI SE    KPRHS L KSALQR+T+ EE++++WMPL  QGWKP  +S + S   E
Sbjct  35   HASPSIFSEWNAPKPRHSRLLKSALQRQTSSEEQSDLWMPLPYQGWKPCSESVIASTLPE  94

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KSEGY+QVFLDGGLNQQRM ICDAV VAKILNATLVIP+LEVNPVWQ
Sbjct  95   KSEGYIQVFLDGGLNQQRMAICDAVVVAKILNATLVIPHLEVNPVWQ  141



>emb|CDP01562.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +ASPS++SE    KPRHS L K ALQRET+ E+++E+W PL  Q WK    SG+ S+  E
Sbjct  36   HASPSVISEWNTPKPRHSRLLKGALQRETSLEQQSELWTPLPKQEWKTCKVSGMASRLPE  95

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
             SEGY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ
Sbjct  96   SSEGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  142



>ref|XP_009623753.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nicotiana tomentosiformis]
Length=504

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +ASP+IL +    K RHS L KSALQR+T+ EE++E+W PLA+QGWKP  +S   S   E
Sbjct  26   HASPTILKDLNAPKFRHSRLAKSALQRQTSNEEQSELWTPLAHQGWKPCTESDAASTVPE  85

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KSEGY+QVFLDGGLNQQRMGICDAV VAKILNATLVIP LEVNPVWQ
Sbjct  86   KSEGYVQVFLDGGLNQQRMGICDAVVVAKILNATLVIPQLEVNPVWQ  132



>gb|EYU39303.1| hypothetical protein MIMGU_mgv1a004838mg [Erythranthe guttata]
Length=507

 Score =   155 bits (391),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +A PS+LSE    KPRHS L KSALQRET+  E+AE+WMPLA Q  KP       S   E
Sbjct  43   HALPSVLSEWNAPKPRHSRLLKSALQRETSDREQAELWMPLAQQQLKPCVQFASTSSLPE  102

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KS GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVW+
Sbjct  103  KSNGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWK  149



>ref|XP_004143441.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 ref|XP_004160919.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 gb|KGN48703.1| hypothetical protein Csa_6G498990 [Cucumis sativus]
Length=513

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +ASPS  SE    KPRH  L KSALQR+++  +++++W PLA++GW+P  DS   S   E
Sbjct  36   HASPSTFSEWNTPKPRHLRLLKSALQRQSSKPDQSDLWAPLADEGWRPCVDSSKASSLPE  95

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KSEGY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVW+
Sbjct  96   KSEGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWK  142



>ref|XP_002533683.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28699.1| conserved hypothetical protein [Ricinus communis]
Length=509

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +ASPS  SE  + KPRH +L KSALQRET+ E++A++W PLA+QGW+   +S        
Sbjct  31   HASPSTFSEWNVPKPRHLALLKSALQRETSQEKQADLWAPLADQGWRTCAESKSVPSLPA  90

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIP+ E+NPVW+
Sbjct  91   KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHFEINPVWR  137



>ref|XP_008440542.1| PREDICTED: uncharacterized protein At1g04910 [Cucumis melo]
Length=513

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +ASPS  SE    KPRH  L KSALQR ++  +++++W PLA++GW+P  DS   S   E
Sbjct  36   HASPSTFSEWNTPKPRHLRLLKSALQRRSSKPDQSDLWAPLADEGWRPCVDSSKASSLPE  95

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KSEGY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVW+
Sbjct  96   KSEGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWK  142



>gb|KJB44062.1| hypothetical protein B456_007G232700 [Gossypium raimondii]
Length=308

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +ASPS  SE  + KPRH  L +SALQRE    E++++W PLA+QGW+P   S       +
Sbjct  40   HASPSTFSEWNVPKPRHLRLLRSALQRERLTGEQSDLWAPLADQGWRPYLGSVNAPSLPQ  99

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQ
Sbjct  100  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQ  146



>ref|XP_007047791.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOX91948.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
Length=518

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +ASPS  SE  + KPRH  L +SALQRE +  E++++W PLA+QGW+P  +  +     +
Sbjct  40   HASPSTFSEWNVPKPRHLPLLRSALQRENSNGEQSDLWAPLADQGWRPCLECVIAPSLPQ  99

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQ
Sbjct  100  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQ  146



>ref|XP_010312650.1| PREDICTED: uncharacterized protein At1g04910 isoform X4 [Solanum 
lycopersicum]
Length=468

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            Y SP+ILS+    K RHS L KSA+QR+T+ EE++ +W PL +QGWKP   S   S   E
Sbjct  28   YGSPTILSDLNAPKFRHSRLAKSAIQRQTSNEEQSRLWTPLEHQGWKPCTKSDAASTVPE  87

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KSEGY+QVFLDGGLNQQRMGICDAV VAKILNATLVIP LEVNPVWQ
Sbjct  88   KSEGYVQVFLDGGLNQQRMGICDAVVVAKILNATLVIPQLEVNPVWQ  134



>ref|XP_009797993.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009797994.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nicotiana sylvestris]
Length=504

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +ASP+IL +    K RHS L KSAL R+T+ EE++E+W PLA+QGWKP  +S   S   E
Sbjct  26   HASPTILKDLNAPKFRHSRLAKSALLRQTSNEEQSELWTPLAHQGWKPCTESDGASTVPE  85

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KSEGY+QVFLDGGLNQQRMGICDAV VAKILNATLVIP LEVNPVWQ
Sbjct  86   KSEGYVQVFLDGGLNQQRMGICDAVVVAKILNATLVIPQLEVNPVWQ  132



>ref|XP_006353172.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum tuberosum]
Length=506

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +ASP+ILS+    K RHS L KSA+QR+T+ EE +++W PL +QGWKP  +S   S   E
Sbjct  28   HASPTILSDLNAPKFRHSRLAKSAIQRQTSNEEVSQLWTPLEHQGWKPCSESDAASTVPE  87

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KSEGY+QVFLDGGLNQQRMGICDAV VAKILNATLVIP LEVNPVWQ
Sbjct  88   KSEGYVQVFLDGGLNQQRMGICDAVVVAKILNATLVIPQLEVNPVWQ  134



>ref|XP_010312647.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Solanum 
lycopersicum]
Length=506

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            Y SP+ILS+    K RHS L KSA+QR+T+ EE++ +W PL +QGWKP   S   S   E
Sbjct  28   YGSPTILSDLNAPKFRHSRLAKSAIQRQTSNEEQSRLWTPLEHQGWKPCTKSDAASTVPE  87

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KSEGY+QVFLDGGLNQQRMGICDAV VAKILNATLVIP LEVNPVWQ
Sbjct  88   KSEGYVQVFLDGGLNQQRMGICDAVVVAKILNATLVIPQLEVNPVWQ  134



>ref|XP_009623754.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nicotiana tomentosiformis]
Length=503

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 87/107 (81%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +ASP+IL +    K RHS L KSALQR+T+ EE++E+W PLA+QGWKP  +S   S   E
Sbjct  26   HASPTILKDLNAPKFRHSRLAKSALQRQTSNEEQSELWTPLAHQGWKPCTESDAAS-IPE  84

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KSEGY+QVFLDGGLNQQRMGICDAV VAKILNATLVIP LEVNPVWQ
Sbjct  85   KSEGYVQVFLDGGLNQQRMGICDAVVVAKILNATLVIPQLEVNPVWQ  131



>ref|XP_011097478.1| PREDICTED: uncharacterized protein At1g04910-like [Sesamum indicum]
Length=516

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +A PS+ SE    KPRHS L KSALQR+T  E+ A++W PLA Q WK    S   S   E
Sbjct  38   HALPSVFSEWNAPKPRHSRLLKSALQRQTPDEQLADLWRPLAQQQWKRCARSDSVSSLPE  97

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KS+GY+QVFLDGGLNQQRMGICDAVAVAKILNATL+IP+LEVNPVWQ
Sbjct  98   KSQGYIQVFLDGGLNQQRMGICDAVAVAKILNATLIIPHLEVNPVWQ  144



>gb|KJB44060.1| hypothetical protein B456_007G232700 [Gossypium raimondii]
Length=428

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +ASPS  SE  + KPRH  L +SALQRE    E++++W PLA+QGW+P   S       +
Sbjct  40   HASPSTFSEWNVPKPRHLRLLRSALQRERLTGEQSDLWAPLADQGWRPYLGSVNAPSLPQ  99

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQ
Sbjct  100  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQ  146



>ref|XP_010664406.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Vitis 
vinifera]
Length=446

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASPSI SE    KPRH  L K ALQ +T   ++A +W PLANQGWKP  DS       +K
Sbjct  37   ASPSIFSEWNAPKPRHLQLLKGALQLQTPDRQQANLWSPLANQGWKPCVDSADTPLLPKK  96

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S+GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQ
Sbjct  97   SQGYVQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQ  142



>ref|XP_008236140.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Prunus 
mume]
Length=518

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +ASPS+LSE  + K RH  L KSALQR+T+  E +++W PLANQ  KP  +S +     +
Sbjct  40   HASPSMLSEWNVPKSRHQRLLKSALQRQTSEGELSDLWTPLANQSLKPCAESSIAPSLPD  99

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KSEG++QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVW+
Sbjct  100  KSEGFIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWR  146



>ref|XP_010254530.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=522

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +ASPS+ SE    KPRH  L K ALQR+++  +++++W PLA+QGWKP  +S   S   E
Sbjct  36   HASPSVFSEWNAPKPRHLPLLKGALQRQSSDRQQSDLWSPLADQGWKPCINSANPSVIPE  95

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KS+GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+ EVNPVWQ
Sbjct  96   KSQGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHFEVNPVWQ  142



>gb|KJB44059.1| hypothetical protein B456_007G232700 [Gossypium raimondii]
Length=518

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +ASPS  SE  + KPRH  L +SALQRE    E++++W PLA+QGW+P   S       +
Sbjct  40   HASPSTFSEWNVPKPRHLRLLRSALQRERLTGEQSDLWAPLADQGWRPYLGSVNAPSLPQ  99

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQ
Sbjct  100  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQ  146



>gb|KHG05570.1| hypothetical protein F383_31127 [Gossypium arboreum]
Length=518

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 88/108 (81%), Gaps = 1/108 (1%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDS-GLFSKFS  458
            YASPS  SE  + KPRH SL +SAL+ +++ +E++++W PLA+QGW+P  +S    S   
Sbjct  39   YASPSTFSEWNVIKPRHLSLLRSALEGKSSNKEQSDLWTPLADQGWRPCLESVNTPSALP  98

Query  459  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            + SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ
Sbjct  99   QNSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  146



>gb|KDO81174.1| hypothetical protein CISIN_1g020969mg [Citrus sinensis]
Length=319

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASP++LSE    KPRHSSL K AL R+   E+++E+W PL +QGW+P  +S   S   +K
Sbjct  40   ASPTMLSEWNAPKPRHSSLLKIALHRQIPTEQQSELWSPLVSQGWRPCAESTGTSSLPKK  99

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S GY+QVFLDGGLNQQRMGICDAVAVAKILNATLV+P+LEVNPVW+
Sbjct  100  SRGYVQVFLDGGLNQQRMGICDAVAVAKILNATLVLPHLEVNPVWR  145



>ref|XP_002283844.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Vitis 
vinifera]
 emb|CBI19265.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASPSI SE    KPRH  L K ALQ +T   ++A +W PLANQGWKP  DS       +K
Sbjct  37   ASPSIFSEWNAPKPRHLQLLKGALQLQTPDRQQANLWSPLANQGWKPCVDSADTPLLPKK  96

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S+GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQ
Sbjct  97   SQGYVQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQ  142



>ref|XP_003613049.1| DUF246 domain-containing protein [Medicago truncatula]
 gb|AES96007.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=503

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            +S S+ SE    KPRHS L +SA+QRET   + +EIW PL NQGWK   +SG      EK
Sbjct  26   SSSSMYSEMNPIKPRHSRLLRSAVQRETPTSQLSEIWAPLENQGWKSCDESGNRPTLPEK  85

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            SEGY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLE+NPVW+
Sbjct  86   SEGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLELNPVWK  131



>gb|KDP29763.1| hypothetical protein JCGZ_18698 [Jatropha curcas]
Length=509

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +AS S  SES + KPRH  L  SALQ ET+ E+++++W+PLA+QGW+   +S       E
Sbjct  31   HASLSTFSESHVPKPRHLPLLNSALQHETSQEKQSDLWVPLADQGWRTCAESTNAPSLPE  90

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KSEGYLQ+FLDGGLNQQRMGICDAVAVAKILNATLVIP+ EVNPVW+
Sbjct  91   KSEGYLQIFLDGGLNQQRMGICDAVAVAKILNATLVIPHFEVNPVWR  137



>gb|AAX20003.1| unknown protein [Iris tectorum]
Length=251

 Score =   145 bits (366),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +ASPS  SE    K RH SL K ALQRE + E+KAE+W PL  QGWKP   S   +    
Sbjct  35   HASPSTFSEWNAPKSRHLSLLKGALQREISEEQKAELWSPLKAQGWKPCIRSASNALLPT  94

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KS GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVW+
Sbjct  95   KSGGYVQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWK  141



>ref|XP_004288516.2| PREDICTED: uncharacterized protein At1g04910 [Fragaria vesca 
subsp. vesca]
Length=529

 Score =   150 bits (378),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 87/118 (74%), Gaps = 11/118 (9%)
 Frame = +3

Query  282  YASPSILSE-----------SIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPV  428
            +ASPS+LSE             + K RH  L KSALQR+T+ EE +E+W PLA+Q WKP 
Sbjct  40   HASPSMLSEWNVMVKSNAQEGNVPKSRHQRLLKSALQRQTSEEELSELWTPLADQAWKPC  99

Query  429  PDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
             +  +     EKSEG++QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVW+
Sbjct  100  IEPSIAPSLPEKSEGFIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWR  157



>ref|XP_009364252.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Pyrus 
x bretschneideri]
Length=513

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +ASPS+ SE  + K +H  L KSALQR+T+  E +++W PLAN+ WKP  +S +     E
Sbjct  35   HASPSMYSEWNVPKSKHLRLLKSALQRQTSEGELSDLWTPLANESWKPCAESSIAPSLPE  94

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
             SEG++QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVW+
Sbjct  95   NSEGFIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWR  141



>ref|XP_009797995.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nicotiana sylvestris]
Length=503

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +ASP+IL +    K RHS L KSAL R+T+ EE++E+W PLA+QGWKP  +S   S   E
Sbjct  26   HASPTILKDLNAPKFRHSRLAKSALLRQTSNEEQSELWTPLAHQGWKPCTESDGAS-IPE  84

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KSEGY+QVFLDGGLNQQRMGICDAV VAKILNATLVIP LEVNPVWQ
Sbjct  85   KSEGYVQVFLDGGLNQQRMGICDAVVVAKILNATLVIPQLEVNPVWQ  131



>ref|XP_006353173.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Solanum tuberosum]
Length=505

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +ASP+ILS+    K RHS L KSA+QR+T+ EE +++W PL +QGWKP  +S   S   E
Sbjct  28   HASPTILSDLNAPKFRHSRLAKSAIQRQTSNEEVSQLWTPLEHQGWKPCSESDAAS-IPE  86

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KSEGY+QVFLDGGLNQQRMGICDAV VAKILNATLVIP LEVNPVWQ
Sbjct  87   KSEGYVQVFLDGGLNQQRMGICDAVVVAKILNATLVIPQLEVNPVWQ  133



>ref|XP_010312648.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Solanum 
lycopersicum]
Length=505

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 84/107 (79%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            Y SP+ILS+    K RHS L KSA+QR+T+ EE++ +W PL +QGWKP   S   S   E
Sbjct  28   YGSPTILSDLNAPKFRHSRLAKSAIQRQTSNEEQSRLWTPLEHQGWKPCTKSDAAS-IPE  86

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KSEGY+QVFLDGGLNQQRMGICDAV VAKILNATLVIP LEVNPVWQ
Sbjct  87   KSEGYVQVFLDGGLNQQRMGICDAVVVAKILNATLVIPQLEVNPVWQ  133



>ref|XP_004509777.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=501

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +3

Query  321  KPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGG  500
            KPRHS L +SA+QRET   + +EIW PL NQGWKP  +S       EKSEGY+QVFLDGG
Sbjct  36   KPRHSRLLRSAVQRETPTSQLSEIWTPLENQGWKPCDESRNKPTLPEKSEGYIQVFLDGG  95

Query  501  LNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            LNQQRMGICDAVAVAKILNATLVIPYLE+NPVW+
Sbjct  96   LNQQRMGICDAVAVAKILNATLVIPYLELNPVWR  129



>ref|XP_006472461.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Citrus sinensis]
 ref|XP_006472462.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Citrus sinensis]
Length=517

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASP++LSE    KPRHSSL K AL R+   E+++E+W PL +QGW+P  +S   S   +K
Sbjct  40   ASPTMLSEWNAPKPRHSSLLKIALHRQIPTEQQSELWSPLVSQGWRPCAESTGTSSLPKK  99

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S GY+QVFLDGGLNQQRMGICDAVAVAKILNATLV+P+LEVNPVW+
Sbjct  100  SRGYVQVFLDGGLNQQRMGICDAVAVAKILNATLVLPHLEVNPVWR  145



>ref|XP_010277498.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nelumbo nucifera]
Length=396

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +ASPS+ SE    KP+H  L K ALQR+ +  +++E+W PLA+QGWKP   S   S   +
Sbjct  36   HASPSLFSEWNAPKPKHLPLLKGALQRQPSGRQQSELWSPLADQGWKPCLKSASSSVLPK  95

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KS+GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+ EVNPVWQ
Sbjct  96   KSQGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHFEVNPVWQ  142



>ref|XP_006433827.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
 gb|ESR47067.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
Length=517

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASP++ SE    +PRHSSL K AL R+   E+++E+W PL NQGW+P  +S   S   +K
Sbjct  40   ASPTMFSEWNAPQPRHSSLLKIALHRQIPTEQQSELWSPLVNQGWRPCAESTGTSSLPKK  99

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S GY+QVFLDGGLNQQRMGICDAVAVAKILNATLV+P+LEVNPVW+
Sbjct  100  SRGYVQVFLDGGLNQQRMGICDAVAVAKILNATLVLPHLEVNPVWR  145



>ref|XP_009350347.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Pyrus x bretschneideri]
Length=513

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +ASPS+ SE  + K +H  L +SALQR+T+  E +++W PLA++ WKP  +S +     E
Sbjct  35   HASPSMYSEWNVPKSKHQRLLRSALQRQTSEGELSDLWAPLASESWKPCAESSVAPSLPE  94

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KSEG++QVFLDGGLNQQRMGICDAVAVA+ILNATLVIPYLEVNPVW+
Sbjct  95   KSEGFIQVFLDGGLNQQRMGICDAVAVARILNATLVIPYLEVNPVWR  141



>ref|XP_002310868.1| hypothetical protein POPTR_0007s14280g [Populus trichocarpa]
 gb|ABK95421.1| unknown [Populus trichocarpa]
 gb|EEE91318.1| hypothetical protein POPTR_0007s14280g [Populus trichocarpa]
Length=506

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 85/108 (79%), Gaps = 1/108 (1%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDS-GLFSKFS  458
            +ASPS+LSE    KPRH  L KSALQ  T+ E+++++W PL +QGW+P  +S        
Sbjct  28   HASPSVLSEWNAPKPRHLPLLKSALQLPTSNEKQSDLWTPLDDQGWRPCAESTNSPPSLP  87

Query  459  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIP+ EVNPVWQ
Sbjct  88   EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHFEVNPVWQ  135



>ref|XP_010277497.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nelumbo nucifera]
Length=514

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +ASPS+ SE    KP+H  L K ALQR+ +  +++E+W PLA+QGWKP   S   S   +
Sbjct  36   HASPSLFSEWNAPKPKHLPLLKGALQRQPSGRQQSELWSPLADQGWKPCLKSASSSVLPK  95

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KS+GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+ EVNPVWQ
Sbjct  96   KSQGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHFEVNPVWQ  142



>gb|KJB18181.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=451

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 83/108 (77%), Gaps = 1/108 (1%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSK-FS  458
            +ASPS   E  + KPRH  L  SALQRE++  E  ++W PLA+QGW+P     + +    
Sbjct  39   HASPSTFLEWSVPKPRHLQLLSSALQRESSDGEPTDLWAPLADQGWRPCLGGSVNAPPLP  98

Query  459  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            +KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ
Sbjct  99   QKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  146



>ref|XP_011021848.1| PREDICTED: uncharacterized protein At1g04910 [Populus euphratica]
Length=506

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 85/108 (79%), Gaps = 1/108 (1%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKP-VPDSGLFSKFS  458
            +ASPS+LSE    KPRH  L KSALQ  T+ E+++++W PL +QGW+P V  +       
Sbjct  28   HASPSVLSEWNAPKPRHLPLLKSALQLPTSNEKQSDLWTPLDDQGWRPCVESTNSPPSLP  87

Query  459  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIP+ EVNPVWQ
Sbjct  88   EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHFEVNPVWQ  135



>ref|XP_010939815.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=558

 Score =   147 bits (371),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 87/109 (80%), Gaps = 3/109 (3%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFS-  458
            +ASPS+ SE    KPRH SL K ALQR+   E+K+E+W PLA+QGW+P  +S  +S  S 
Sbjct  82   HASPSMFSEWNAPKPRHMSLLKGALQRQILDEQKSELWAPLAHQGWRPCIESA-YSPVSL  140

Query  459  -EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
              +S GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVW+
Sbjct  141  PTRSTGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWK  189



>ref|XP_007207425.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
 gb|EMJ08624.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
Length=474

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = +3

Query  297  ILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGY  476
            +LSE  + K RH  L KSALQR+T+  E +++W PLANQ  KP  +S + +   EKSEG+
Sbjct  1    MLSEWNVPKSRHQRLLKSALQRQTSEGELSDLWTPLANQSLKPCAESSIATSLPEKSEGF  60

Query  477  LQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            +QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVW+
Sbjct  61   IQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWR  102



>ref|XP_009401410.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009401411.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=518

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +A PS+ SE    KP H SL + AL+R+T+ ++++E+W PLA+QGWKP  +S   S    
Sbjct  43   HAFPSLFSEWNAPKPMHLSLLRDALERKTSIDQQSELWAPLASQGWKPCIESTSTSSLPS  102

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KS GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLE+NPVW+
Sbjct  103  KSNGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEINPVWR  149



>gb|KHG22139.1| hypothetical protein F383_05782 [Gossypium arboreum]
Length=467

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 83/108 (77%), Gaps = 1/108 (1%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSK-FS  458
            +ASPS   E  + KPRH  L  SALQRE++  E  ++W PLA+QGW+P     + +    
Sbjct  39   HASPSTFLEWNVPKPRHLRLLTSALQRESSNGEPTDLWAPLADQGWRPCLGGSVNAPPLP  98

Query  459  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            +KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ
Sbjct  99   QKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  146



>gb|KJB18179.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
 gb|KJB18180.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
 gb|KJB18183.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
 gb|KJB18184.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=518

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 83/108 (77%), Gaps = 1/108 (1%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSK-FS  458
            +ASPS   E  + KPRH  L  SALQRE++  E  ++W PLA+QGW+P     + +    
Sbjct  39   HASPSTFLEWSVPKPRHLQLLSSALQRESSDGEPTDLWAPLADQGWRPCLGGSVNAPPLP  98

Query  459  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            +KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ
Sbjct  99   QKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  146



>ref|XP_010519195.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=518

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 83/106 (78%), Gaps = 2/106 (2%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            A+ S  SE    KPRH SL KS+LQR +   E++++W PL +QGW+P  DSG      EK
Sbjct  41   AASSTSSEWNTVKPRHLSLLKSSLQRPSG--EQSDLWRPLTDQGWRPCIDSGNGPSLPEK  98

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            SEGY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ
Sbjct  99   SEGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  144



>gb|KJB18182.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=519

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 83/109 (76%), Gaps = 2/109 (2%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFS--KF  455
            +ASPS   E  + KPRH  L  SALQRE++  E  ++W PLA+QGW+P     + +    
Sbjct  39   HASPSTFLEWSVPKPRHLQLLSSALQRESSDGEPTDLWAPLADQGWRPCLGGSVNAPPAL  98

Query  456  SEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
             +KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ
Sbjct  99   PQKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  147



>ref|XP_008347790.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Malus domestica]
Length=513

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +ASPS+ SE  + K +H  L  SALQR+T+  E +++W PLA++ WKP  +S +     E
Sbjct  35   HASPSMYSEWNVPKSKHQRLLXSALQRQTSEGELSDLWAPLASESWKPCAESSVAPSLPE  94

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KSEG++QVFLDGGLNQQRMGICDAVAVA+ILNATLVIPYLEVNPVW+
Sbjct  95   KSEGFIQVFLDGGLNQQRMGICDAVAVARILNATLVIPYLEVNPVWR  141



>gb|KJB58884.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
Length=330

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASPS+ SE    KPRH SL + AL  +T  ++  ++W PL NQGWKP  DS       E+
Sbjct  41   ASPSLFSEWNAPKPRHLSLLEVALHWKTPIKQLFDLWSPLPNQGWKPCIDSADTPSLPER  100

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S+GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQ
Sbjct  101  SQGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQ  146



>ref|XP_010523312.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=517

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 83/107 (78%), Gaps = 2/107 (2%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +A+ S  SE    KPRH SL KSA+QR +   E++++W PL +QGWKP  D G      E
Sbjct  41   HAASSKSSEWNAVKPRHLSLLKSAVQRSSG--EQSDLWRPLTDQGWKPCIDPGNAPSIPE  98

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KSEGY+QVFLDGGLNQQRMGICDAVAVAKILNATLV+PYLEVNPVWQ
Sbjct  99   KSEGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVVPYLEVNPVWQ  145



>ref|XP_006472463.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Citrus sinensis]
Length=514

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 84/106 (79%), Gaps = 3/106 (3%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASP++LSE    KPRHSSL K AL R+   E+++E+W PL +QGW+P  +S    K   K
Sbjct  40   ASPTMLSEWNAPKPRHSSLLKIALHRQIPTEQQSELWSPLVSQGWRPCAESTALPK---K  96

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S GY+QVFLDGGLNQQRMGICDAVAVAKILNATLV+P+LEVNPVW+
Sbjct  97   SRGYVQVFLDGGLNQQRMGICDAVAVAKILNATLVLPHLEVNPVWR  142



>ref|XP_004152738.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 ref|XP_004163454.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
Length=515

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASPS+ SE I  KPRH+ L  SAL R TT E++ EIW PL+NQGWKP            K
Sbjct  39   ASPSLFSEWISPKPRHTILLDSALHRITTFEDQKEIWSPLSNQGWKPCLKPTRMELSQRK  98

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S+GY+QVFLDGGLNQQRMGICDAVAVA+ILNATL+IP+LE+N VW+
Sbjct  99   SQGYIQVFLDGGLNQQRMGICDAVAVARILNATLIIPHLEINAVWK  144



>gb|AFK40388.1| unknown [Lotus japonicus]
Length=502

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 78/94 (83%), Gaps = 1/94 (1%)
 Frame = +3

Query  321  KPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGG  500
            KPRHS L +SA+QRET   + +EIW PL NQGWKPV +S       EKSEGY+QVFLDGG
Sbjct  38   KPRHSRLLRSAVQRETPTSQLSEIWSPLENQGWKPV-ESRNKPTLPEKSEGYIQVFLDGG  96

Query  501  LNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            LNQQRMGICDAVAVAKILNATLVIPYLE+NPVW+
Sbjct  97   LNQQRMGICDAVAVAKILNATLVIPYLELNPVWR  130



>ref|XP_010523308.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010523309.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Tarenaya hassleriana]
Length=517

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 83/107 (78%), Gaps = 2/107 (2%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +A+ S  SE    KPRH SL KSA+QR +   E++++W PL +QGWKP  D G      E
Sbjct  41   HAASSKPSEWNAVKPRHLSLLKSAVQRSSG--EQSDLWRPLTDQGWKPCIDPGNAPSIPE  98

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KSEGY+QVFLDGGLNQQRMGICDAVAVAKILNATLV+PYLEVNPVWQ
Sbjct  99   KSEGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVVPYLEVNPVWQ  145



>ref|XP_006433826.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
 gb|ESR47066.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
Length=514

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 83/106 (78%), Gaps = 3/106 (3%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASP++ SE    +PRHSSL K AL R+   E+++E+W PL NQGW+P  +S    K   K
Sbjct  40   ASPTMFSEWNAPQPRHSSLLKIALHRQIPTEQQSELWSPLVNQGWRPCAESTALPK---K  96

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S GY+QVFLDGGLNQQRMGICDAVAVAKILNATLV+P+LEVNPVW+
Sbjct  97   SRGYVQVFLDGGLNQQRMGICDAVAVAKILNATLVLPHLEVNPVWR  142



>ref|XP_003517397.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
Length=516

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = +3

Query  288  SPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKS  467
            S S+  E    KPRHS L +SA+QRET   + +E+W PL +QGWKP  +S   +   EKS
Sbjct  40   SSSVFPELNPIKPRHSRLLRSAVQRETPTSQLSELWSPLESQGWKPYVESNKPTALPEKS  99

Query  468  EGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            EGY+QVFLDGGLNQQ+MGICDAVAVAKILNATLVIPYLE+NPVW+
Sbjct  100  EGYIQVFLDGGLNQQKMGICDAVAVAKILNATLVIPYLELNPVWR  144



>gb|KHN14510.1| DUF246 domain-containing protein [Glycine soja]
Length=516

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = +3

Query  288  SPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKS  467
            S S+  E    KPRHS L +SA+QRET   + +E+W PL +QGWKP  +S   +   EKS
Sbjct  40   SSSVFPELNPIKPRHSRLLRSAVQRETPTSQLSELWSPLESQGWKPYVESNKPTALPEKS  99

Query  468  EGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            EGY+QVFLDGGLNQQ+MGICDAVAVAKILNATLVIPYLE+NPVW+
Sbjct  100  EGYIQVFLDGGLNQQKMGICDAVAVAKILNATLVIPYLELNPVWR  144



>ref|XP_008444924.1| PREDICTED: uncharacterized protein At1g04910-like [Cucumis melo]
Length=515

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASPS+ SE I  KPRH+ L  SAL R TT E++ EIW PL+NQGWKP            K
Sbjct  39   ASPSLFSEWISPKPRHTILLDSALHRITTFEDQKEIWSPLSNQGWKPCLKPTRRELSRRK  98

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S+GY+QVFLDGGLNQQRMGICDAVAVA+ILNATL+IP+LE+N VW+
Sbjct  99   SQGYIQVFLDGGLNQQRMGICDAVAVARILNATLIIPHLEINAVWK  144



>ref|XP_007207426.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
 gb|EMJ08625.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
Length=485

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  IAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLD  494
            + K RH  L KSALQR+T+  E +++W PLANQ  KP  +S + +   EKSEG++QVFLD
Sbjct  18   VPKSRHQRLLKSALQRQTSEGELSDLWTPLANQSLKPCAESSIATSLPEKSEGFIQVFLD  77

Query  495  GGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            GGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVW+
Sbjct  78   GGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWR  113



>ref|XP_006587571.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=516

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +3

Query  321  KPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGG  500
            KPRHS L +SA+Q ET   + +EIW PL +QGWKP  +S   +   EKSEGY+QVFLDGG
Sbjct  51   KPRHSRLLRSAVQHETPTSQLSEIWSPLESQGWKPYVESNKPTALPEKSEGYIQVFLDGG  110

Query  501  LNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            LNQQRMGICDAVAVAKILNATLVIPYLE+NPVW+
Sbjct  111  LNQQRMGICDAVAVAKILNATLVIPYLELNPVWR  144



>gb|KJB58885.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
Length=399

 Score =   142 bits (359),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASPS+ SE    KPRH SL + AL  +T  ++  ++W PL NQGWKP  DS       E+
Sbjct  41   ASPSLFSEWNAPKPRHLSLLEVALHWKTPIKQLFDLWSPLPNQGWKPCIDSADTPSLPER  100

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S+GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQ
Sbjct  101  SQGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQ  146



>ref|XP_006338062.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum tuberosum]
Length=516

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = +3

Query  291  PSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSE  470
            PS+ SE    +P HS L   ALQ++T+  ++AE+W PL NQGW+   D         KS+
Sbjct  43   PSVFSEWNAPRPMHSHLLNRALQQQTSKAQEAELWSPLPNQGWEACADKQDTQSLGRKSQ  102

Query  471  GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ
Sbjct  103  GYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  146



>ref|XP_010113429.1| hypothetical protein L484_026763 [Morus notabilis]
 gb|EXC35456.1| hypothetical protein L484_026763 [Morus notabilis]
Length=553

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  IAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLD  494
            + KPRHS L KSALQ ET+  +++++W PL NQGWK   +S +     EKS GY+QVFLD
Sbjct  89   VPKPRHSWLLKSALQAETSNTQQSDLWTPLGNQGWKQCVESSVGPTLPEKSTGYIQVFLD  148

Query  495  GGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            GGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVW+
Sbjct  149  GGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWR  184



>ref|XP_008236135.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Prunus 
mume]
Length=529

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 86/118 (73%), Gaps = 11/118 (9%)
 Frame = +3

Query  282  YASPSILS-----------ESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPV  428
            +ASPS+LS           E  + K RH  L KSALQR+T+  E +++W PLANQ  KP 
Sbjct  40   HASPSMLSGLNVMMKSNFQEWNVPKSRHQRLLKSALQRQTSEGELSDLWTPLANQSLKPC  99

Query  429  PDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
             +S +     +KSEG++QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVW+
Sbjct  100  AESSIAPSLPDKSEGFIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWR  157



>ref|XP_008802622.1| PREDICTED: uncharacterized protein At1g04910-like, partial [Phoenix 
dactylifera]
Length=495

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFS-KFS  458
            +ASPS+ SE    KPRH SL K ALQR+ + ++K+EIW PLA+QGW+   +S        
Sbjct  79   HASPSLFSEWNAPKPRHISLVKGALQRQISNDQKSEIWAPLAHQGWRTCIESANNPVSLP  138

Query  459  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
             KS GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVW+
Sbjct  139  AKSTGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWK  186



>gb|KJB58883.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
Length=489

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASPS+ SE    KPRH SL + AL  +T  ++  ++W PL NQGWKP  DS       E+
Sbjct  41   ASPSLFSEWNAPKPRHLSLLEVALHWKTPIKQLFDLWSPLPNQGWKPCIDSADTPSLPER  100

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S+GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQ
Sbjct  101  SQGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQ  146



>ref|XP_009150636.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
 emb|CDY08790.1| BnaA06g24340D [Brassica napus]
Length=503

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +3

Query  312  IIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFL  491
            I  KPRH SL KSALQR +   E++E+W P+ +QGW P  D G      EK+EGY+QVFL
Sbjct  35   ITIKPRHLSLLKSALQRPSG--EQSELWRPMTDQGWSPCLDLGNSPSLPEKTEGYIQVFL  92

Query  492  DGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            DGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ
Sbjct  93   DGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  129



>ref|XP_010444520.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=507

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 78/100 (78%), Gaps = 2/100 (2%)
 Frame = +3

Query  303  SESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQ  482
            S+ I  KPRH SL KSALQR +   E++++W PL +QGW P  D G       KSEGY+Q
Sbjct  36   SDVITIKPRHLSLLKSALQRSSG--EQSDLWRPLTDQGWSPCIDLGNSPSLPVKSEGYIQ  93

Query  483  VFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            VFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ
Sbjct  94   VFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  133



>gb|KDO60569.1| hypothetical protein CISIN_1g009234mg [Citrus sinensis]
Length=473

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +3

Query  321  KPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGG  500
            KPRH  LFKSALQR +   +++++W+PLANQGW+    S       +KS+GY+QVFLDGG
Sbjct  8    KPRHLPLFKSALQRPSANAKQSDLWLPLANQGWRSCAQSANNPSLPQKSQGYIQVFLDGG  67

Query  501  LNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            LNQQRMGICDAVAV KILNATLVIPYLEVNPVWQ
Sbjct  68   LNQQRMGICDAVAVTKILNATLVIPYLEVNPVWQ  101



>gb|KJB58881.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
 gb|KJB58882.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
Length=518

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASPS+ SE    KPRH SL + AL  +T  ++  ++W PL NQGWKP  DS       E+
Sbjct  41   ASPSLFSEWNAPKPRHLSLLEVALHWKTPIKQLFDLWSPLPNQGWKPCIDSADTPSLPER  100

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S+GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQ
Sbjct  101  SQGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQ  146



>ref|XP_010680342.1| PREDICTED: uncharacterized protein At1g04910 [Beta vulgaris subsp. 
vulgaris]
Length=506

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            +SP++ SE + AKPRHS+L K AL  ET+P E +E+W PL +QGW+P   +G  +K    
Sbjct  31   SSPNLFSEWMSAKPRHSNLLKYALTSETSPGEPSELWSPLPDQGWRPCGVNGGAAK-PAN  89

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIP LEVNPVW+
Sbjct  90   SSGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPLLEVNPVWK  135



>gb|KHG27420.1| hypothetical protein F383_15612 [Gossypium arboreum]
Length=498

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 84/111 (76%), Gaps = 3/111 (3%)
 Frame = +3

Query  279  IYASPSILSESI---IAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFS  449
             Y S +I S+ +   + KPRH  L +SALQRE    E++++W PLA+QGW+P   S    
Sbjct  16   FYLSWNIQSDMVEWNVPKPRHLRLLRSALQRERLTGEQSDLWAPLADQGWRPYLGSVNAP  75

Query  450  KFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
               +KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQ
Sbjct  76   SLPQKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQ  126



>ref|XP_010547595.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=513

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 77/96 (80%), Gaps = 2/96 (2%)
 Frame = +3

Query  315  IAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLD  494
            I KPRH SL KSALQR     E++++W PL +QGWKP  DSG      EKSEGY+QVFLD
Sbjct  48   IVKPRHLSLLKSALQRPGG--EQSDLWRPLTDQGWKPCIDSGNAPSLPEKSEGYIQVFLD  105

Query  495  GGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            GGLNQQRMGICDAVAVAKILNATLVIP+LEVN VWQ
Sbjct  106  GGLNQQRMGICDAVAVAKILNATLVIPFLEVNSVWQ  141



>ref|XP_006280335.1| hypothetical protein CARUB_v10026260mg [Capsella rubella]
 gb|EOA13233.1| hypothetical protein CARUB_v10026260mg [Capsella rubella]
Length=508

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 77/99 (78%), Gaps = 2/99 (2%)
 Frame = +3

Query  306  ESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQV  485
            E I  KPRH SL KSALQR +   E++++W PL +QGW P  D G       KSEGY+QV
Sbjct  38   EVITIKPRHLSLLKSALQRSSG--EQSDLWRPLTDQGWSPCIDLGNSPALPVKSEGYIQV  95

Query  486  FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ
Sbjct  96   FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  134



>ref|XP_008385667.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910 
[Malus domestica]
Length=524

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 87/118 (74%), Gaps = 11/118 (9%)
 Frame = +3

Query  282  YASPSILSE-SIIAKP----------RHSSLFKSALQRETTPEEKAEIWMPLANQGWKPV  428
            +ASPS+ S   ++ KP          +H  L KSALQR+T+  E +++W PLAN+ WKP 
Sbjct  35   HASPSMYSGLDVMTKPTFQEWNVPKSKHLRLLKSALQRQTSEGELSDLWTPLANESWKPC  94

Query  429  PDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
             +S +     EKSEG++QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVW+
Sbjct  95   AESSIAPSLPEKSEGFIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWR  152



>ref|XP_002268599.2| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
 emb|CBI38269.3| unnamed protein product [Vitis vinifera]
Length=510

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +ASPS+ SE    KPRHS L KS LQ +++  E++++W PL NQGWK    S       +
Sbjct  33   HASPSVFSEWNAPKPRHSRLLKSVLQGQSSNVEQSDLWTPLVNQGWKACELSASTPGLPQ  92

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            +++GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVW+
Sbjct  93   ETQGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWR  139



>ref|XP_010523344.1| PREDICTED: uncharacterized protein At1g04910 [Tarenaya hassleriana]
 ref|XP_010523345.1| PREDICTED: uncharacterized protein At1g04910 [Tarenaya hassleriana]
Length=519

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = +3

Query  291  PSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSE  470
            PS+ SE    +PRH  L + AL RE    ++ E+W PL +QGWKP  +S   S  SEKS+
Sbjct  42   PSLFSEWNAPRPRHLRLLEGALSREIPIRQQVELWSPLPDQGWKPCTESYTVSSLSEKSQ  101

Query  471  GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            G+LQVFLDGGLNQQRMGICDAVAVAKILN TLVIP+ EVNPVWQ
Sbjct  102  GFLQVFLDGGLNQQRMGICDAVAVAKILNVTLVIPHFEVNPVWQ  145



>ref|XP_006394027.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
 gb|ESQ31313.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
Length=506

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 78/99 (79%), Gaps = 2/99 (2%)
 Frame = +3

Query  306  ESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQV  485
            E+I  KPRH SL KSALQR +   E++ +W P+ +QGW P  D G      +K+EGY+QV
Sbjct  36   EAITIKPRHLSLLKSALQRSSG--EQSNLWRPMIDQGWSPCIDFGNSPSLPDKTEGYIQV  93

Query  486  FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ
Sbjct  94   FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  132



>ref|XP_006426272.1| hypothetical protein CICLE_v10025329mg [Citrus clementina]
 gb|ESR39512.1| hypothetical protein CICLE_v10025329mg [Citrus clementina]
 gb|KDO60568.1| hypothetical protein CISIN_1g009234mg [Citrus sinensis]
Length=539

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +3

Query  321  KPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGG  500
            KPRH  LFKSALQR +   +++++W+PLANQGW+    S       +KS+GY+QVFLDGG
Sbjct  74   KPRHLPLFKSALQRPSANAKQSDLWLPLANQGWRSCAQSANNPSLPQKSQGYIQVFLDGG  133

Query  501  LNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            LNQQRMGICDAVAV KILNATLVIPYLEVNPVWQ
Sbjct  134  LNQQRMGICDAVAVTKILNATLVIPYLEVNPVWQ  167



>ref|NP_194184.2| O-fucosyltransferase family protein [Arabidopsis thaliana]
 gb|AAP68214.1| At4g24530 [Arabidopsis thaliana]
 dbj|BAE99793.1| PsRT17-1 like protein [Arabidopsis thaliana]
 gb|AEE84921.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=519

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASPS+ SE    +PRH SL + AL R+ +  ++ E+W PLA+QGWKP  +S   +   EK
Sbjct  41   ASPSLFSEWNAPRPRHLSLLQGALDRQISIRQQVELWSPLADQGWKPCTESYRGASLPEK  100

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            SEG+LQVFLDGGLNQQRMGICDAVAVAKI+N TLVIP LEVN VWQ
Sbjct  101  SEGFLQVFLDGGLNQQRMGICDAVAVAKIMNVTLVIPRLEVNTVWQ  146



>ref|XP_006466306.1| PREDICTED: uncharacterized protein At1g04910-like [Citrus sinensis]
Length=539

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +3

Query  321  KPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGG  500
            KPRH  LFKSALQR +   +++++W+PLANQGW+    S       +KS+GY+QVFLDGG
Sbjct  74   KPRHLPLFKSALQRPSANAKQSDLWLPLANQGWRSCAQSANNPSLPQKSQGYIQVFLDGG  133

Query  501  LNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            LNQQRMGICDAVAV KILNATLVIPYLEVNPVWQ
Sbjct  134  LNQQRMGICDAVAVTKILNATLVIPYLEVNPVWQ  167



>emb|CDY14569.1| BnaC03g48900D [Brassica napus]
Length=503

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +3

Query  312  IIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFL  491
            I  KPRH SL KSALQR +   E++E+W P+ +QGW P  D G      +K+EGY+QVFL
Sbjct  35   ITIKPRHLSLLKSALQRPSG--EQSELWRPMTDQGWSPCLDLGNSPSLPDKTEGYIQVFL  92

Query  492  DGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            DGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ
Sbjct  93   DGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  129



>ref|XP_010433755.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=529

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASPS+ SE    +PRH  L + AL RE +  ++ E+W PL +QGWKP   S   S   EK
Sbjct  51   ASPSLFSEWNAPRPRHMRLLQGALDREISIRQQVELWSPLPDQGWKPCTQSYRGSPLPEK  110

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S+G+LQVFLDGGLNQQRMGICDAVAVAKI+N TLVIP LEVNPVWQ
Sbjct  111  SQGFLQVFLDGGLNQQRMGICDAVAVAKIMNVTLVIPRLEVNPVWQ  156



>ref|XP_010448552.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=518

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASPS+ SE    +PRH  L + AL RE +  ++ E+W PL +QGWKP   S   S   EK
Sbjct  40   ASPSLFSEWNAPRPRHMRLLQGALDREISIRQQVELWSPLPDQGWKPCTQSFRGSPLPEK  99

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S+G+LQVFLDGGLNQQRMGICDAVAVAKI+N TLVIP LEVNPVWQ
Sbjct  100  SQGFLQVFLDGGLNQQRMGICDAVAVAKIMNVTLVIPRLEVNPVWQ  145



>ref|XP_010463027.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=508

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 77/99 (78%), Gaps = 2/99 (2%)
 Frame = +3

Query  306  ESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQV  485
            + I  KPRH SL KSALQR +   E++++W PL +QGW P  D G       KSEGY+QV
Sbjct  38   DVITIKPRHLSLLKSALQRSSG--EQSDLWRPLTDQGWSPCIDLGNSPSLPVKSEGYIQV  95

Query  486  FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ
Sbjct  96   FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  134



>ref|XP_006413418.1| hypothetical protein EUTSA_v10024936mg [Eutrema salsugineum]
 gb|ESQ54871.1| hypothetical protein EUTSA_v10024936mg [Eutrema salsugineum]
Length=518

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = +3

Query  291  PSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSE  470
            PS+ SE    +PRH  L   AL R+ +  ++ E+W PLA+QGWKP  +S   S   EKS+
Sbjct  42   PSLFSEWNAPRPRHLRLLHGALDRQISIRQQVELWSPLADQGWKPCTESYRVSPLPEKSQ  101

Query  471  GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            G+LQVFLDGGLNQQRMGICDAVAVAKILN TLVIP LEVNPVWQ
Sbjct  102  GFLQVFLDGGLNQQRMGICDAVAVAKILNVTLVIPRLEVNPVWQ  145



>ref|XP_010439017.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
 ref|XP_010439018.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
 ref|XP_010439019.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
Length=518

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASPS+ SE    +PRH  L + AL RE +  ++ E+W PL +QGWKP   S   S   EK
Sbjct  40   ASPSLFSEWNAPRPRHMRLLQGALDREISIRQQVELWSPLPDQGWKPCTQSYKGSPLPEK  99

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S+G+LQVFLDGGLNQQRMGICDAVAVAKI+N TLVIP LEVNPVWQ
Sbjct  100  SQGFLQVFLDGGLNQQRMGICDAVAVAKIMNVTLVIPRLEVNPVWQ  145



>ref|XP_004501643.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=513

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASPS+ SE I  KPRH +L ++ALQ +T+ E +  +W PLA QGWKP           EK
Sbjct  36   ASPSLFSEWIAPKPRHVTLLQAALQHKTSVEVQTNLWSPLAYQGWKPCTMPPKSPSLPEK  95

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S+GY+QVFLDGGLNQQ+MGICDAVAVAKILN TLVIP+ EVNPVWQ
Sbjct  96   SQGYIQVFLDGGLNQQKMGICDAVAVAKILNVTLVIPHFEVNPVWQ  141



>gb|KJB48896.1| hypothetical protein B456_008G092600, partial [Gossypium raimondii]
Length=495

 Score =   141 bits (355),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  IAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLD  494
            + KPRH SL +SAL+ +++  EK+++W PLA+QGW+P  +S       + SEGYLQVFLD
Sbjct  4    VIKPRHLSLLRSALEGKSSNGEKSDLWTPLADQGWRPCLESVNTPSLPQNSEGYLQVFLD  63

Query  495  GGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            GGLNQQRMG+CDAVAVAKILNATLVIPYLEVNPVWQ
Sbjct  64   GGLNQQRMGLCDAVAVAKILNATLVIPYLEVNPVWQ  99



>ref|XP_010484355.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=508

 Score =   141 bits (355),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 77/99 (78%), Gaps = 2/99 (2%)
 Frame = +3

Query  306  ESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQV  485
            + I  KPRH SL KSALQR +   E++++W PL +QGW P  D G       KSEGY+QV
Sbjct  38   DVITIKPRHLSLLKSALQRSSG--EQSDLWRPLTDQGWSPCIDLGNSPSLPIKSEGYIQV  95

Query  486  FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ
Sbjct  96   FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  134



>ref|XP_003602912.1| PsRT17-1 like protein [Medicago truncatula]
 gb|AES73163.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=517

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASPSI SE I  KPRH +L + ALQR  + E +  +W PLA QGWKP           EK
Sbjct  40   ASPSIFSEWIAPKPRHVTLLQGALQRRISVEVQTNLWSPLAYQGWKPCTVPPKSPSLPEK  99

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S GY+QVFLDGGLNQQ+MGICDAVAVAKILN TLVIP+ EVNPVWQ
Sbjct  100  SRGYIQVFLDGGLNQQKMGICDAVAVAKILNVTLVIPHFEVNPVWQ  145



>gb|KGN62755.1| hypothetical protein Csa_2G370540 [Cucumis sativus]
Length=1445

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +3

Query  285   ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
             ASPS+ SE I  KPRH+ L  SAL R TT E++ EIW PL+NQGWKP            K
Sbjct  969   ASPSLFSEWISPKPRHTILLDSALHRITTFEDQKEIWSPLSNQGWKPCLKPTRMELSQRK  1028

Query  465   SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
             S+GY+QVFLDGGLNQQRMGICDAVAVA+ILNATL+IP+LE+N VW+
Sbjct  1029  SQGYIQVFLDGGLNQQRMGICDAVAVARILNATLIIPHLEINAVWK  1074



>ref|XP_002864958.1| hypothetical protein ARALYDRAFT_496780 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41217.1| hypothetical protein ARALYDRAFT_496780 [Arabidopsis lyrata subsp. 
lyrata]
Length=504

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 77/99 (78%), Gaps = 2/99 (2%)
 Frame = +3

Query  306  ESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQV  485
            E I  KPRH SL KSALQR +   E++++W PL +QGW P  D G      +K+ GY+QV
Sbjct  34   EVITIKPRHLSLLKSALQRSSG--EQSDLWRPLTDQGWSPCIDLGNSPSLPDKTAGYVQV  91

Query  486  FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ
Sbjct  92   FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  130



>ref|XP_009364251.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Pyrus 
x bretschneideri]
Length=524

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +3

Query  294  SILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEG  473
            S   E  + K +H  L KSALQR+T+  E +++W PLAN+ WKP  +S +     E SEG
Sbjct  50   STFQEWNVPKSKHLRLLKSALQRQTSEGELSDLWTPLANESWKPCAESSIAPSLPENSEG  109

Query  474  YLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            ++QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVW+
Sbjct  110  FIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWR  152



>ref|XP_006573005.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=515

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 81/105 (77%), Gaps = 1/105 (1%)
 Frame = +3

Query  288  SPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKS  467
            S S+  E    KPRHS L +SA+QRET   + +E+W PL +QGWKP  +S       EKS
Sbjct  40   SSSVFPELNPIKPRHSRLLRSAVQRETPTSQLSELWSPLESQGWKPYVESNK-PTLPEKS  98

Query  468  EGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            EGY+QVFLDGGLNQQ+MGICDAVAVAKILNATLVIPYLE+NPVW+
Sbjct  99   EGYIQVFLDGGLNQQKMGICDAVAVAKILNATLVIPYLELNPVWR  143



>ref|XP_007136338.1| hypothetical protein PHAVU_009G0371000g, partial [Phaseolus vulgaris]
 gb|ESW08332.1| hypothetical protein PHAVU_009G0371000g, partial [Phaseolus vulgaris]
Length=449

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASPS+ SE I  +P H SL + ALQR+ + E +  +W PLA QGWKP  +        EK
Sbjct  41   ASPSMFSEWIAPRPMHVSLLEGALQRQISVELQTSLWSPLAFQGWKPCTERPKPPSLPEK  100

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S GY+QVFLDGGLNQQ+MGICDAVAVAKILNATLVIP+ EVNPVWQ
Sbjct  101  SRGYIQVFLDGGLNQQKMGICDAVAVAKILNATLVIPHFEVNPVWQ  146



>ref|NP_201350.2| O-fucosyltransferase family protein [Arabidopsis thaliana]
 dbj|BAE99053.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED98060.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=504

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 77/99 (78%), Gaps = 2/99 (2%)
 Frame = +3

Query  306  ESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQV  485
            E I  KPRH SL KSALQR +   E++++W PL +QGW P  D G      +K+ GY+QV
Sbjct  34   EVITIKPRHLSLLKSALQRSSG--EQSDLWRPLTDQGWSPCIDLGNSPSLPDKTAGYVQV  91

Query  486  FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ
Sbjct  92   FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  130



>gb|AAM13166.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91219.1| unknown protein [Arabidopsis thaliana]
Length=504

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 77/99 (78%), Gaps = 2/99 (2%)
 Frame = +3

Query  306  ESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQV  485
            E I  KPRH SL KSALQR +   E++++W PL +QGW P  D G      +K+ GY+QV
Sbjct  34   EVITIKPRHLSLLKSALQRSSG--EQSDLWRPLTDQGWSPCIDLGNSPSLPDKTAGYVQV  91

Query  486  FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ
Sbjct  92   FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  130



>emb|CDP11502.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            A PS+ SE    +P H  L   ALQ++T+ E+++E+W PL +QGWK   DS   S   +K
Sbjct  40   AYPSLFSEWNAPRPMHLELMNGALQQQTSGEQESELWSPLPDQGWKRCADSHAKSSLPKK  99

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S+GY+QVFLDGGLNQQRMGICDAVAVAKILNATLV+P+ EVNPVWQ
Sbjct  100  SQGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVLPHFEVNPVWQ  145



>gb|EPS73888.1| hypothetical protein M569_00867, partial [Genlisea aurea]
Length=498

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 83/108 (77%), Gaps = 1/108 (1%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSK-FS  458
            +ASPS+LSE    KP+HS+L KSAL+R+TT E + E+W PL++QGW     S        
Sbjct  32   HASPSVLSEWNPVKPQHSTLLKSALERQTTDERRTELWKPLSHQGWSSCASSRSSPSTLP  91

Query  459  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            EKS+GYLQVFLDGGLNQQRMGICDAVA+AKILNATLVIP  EV+ VWQ
Sbjct  92   EKSQGYLQVFLDGGLNQQRMGICDAVALAKILNATLVIPQFEVHSVWQ  139



>ref|XP_003534239.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
 gb|KHN38876.1| DUF246 domain-containing protein [Glycine soja]
Length=515

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 76/94 (81%), Gaps = 1/94 (1%)
 Frame = +3

Query  321  KPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGG  500
            KPRHS L +SA+Q ET   + +EIW PL +QGWKP  +S       EKSEGY+QVFLDGG
Sbjct  51   KPRHSRLLRSAVQHETPTSQLSEIWSPLESQGWKPYVESNK-PTLPEKSEGYIQVFLDGG  109

Query  501  LNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            LNQQRMGICDAVAVAKILNATLVIPYLE+NPVW+
Sbjct  110  LNQQRMGICDAVAVAKILNATLVIPYLELNPVWR  143



>ref|XP_007158370.1| hypothetical protein PHAVU_002G147300g [Phaseolus vulgaris]
 gb|ESW30364.1| hypothetical protein PHAVU_002G147300g [Phaseolus vulgaris]
Length=514

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = +3

Query  321  KPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGG  500
            KPRHS L +SA+QRET   + +E+W PL +QGWK   +S    K  EKSEGY+QVFLDGG
Sbjct  50   KPRHSRLLRSAVQRETPASQLSELWSPLESQGWKSYVESNK-PKLPEKSEGYIQVFLDGG  108

Query  501  LNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            LNQQRMGICDAVAVAKILNATLVIPYLE+NPVW+
Sbjct  109  LNQQRMGICDAVAVAKILNATLVIPYLELNPVWR  142



>gb|AGV54860.1| O-fucosyltransferase family protein [Phaseolus vulgaris]
Length=516

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASPS+ SE I  +P H SL + ALQR+ + E +  +W PLA QGWKP  +        EK
Sbjct  39   ASPSMFSEWIAPRPMHVSLLEGALQRQISVELQTSLWSPLAFQGWKPCTERPKPPSLPEK  98

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S GY+QVFLDGGLNQQ+MGICDAVAVAKILNATLVIP+ EVNPVWQ
Sbjct  99   SRGYIQVFLDGGLNQQKMGICDAVAVAKILNATLVIPHFEVNPVWQ  144



>ref|XP_010937178.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=560

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 82/108 (76%), Gaps = 1/108 (1%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDS-GLFSKFS  458
            +A PSI SE    KPRH SL K ALQR+ + E+ +E+W  LA+QGW+P  +S        
Sbjct  84   HALPSIFSEWNAPKPRHMSLLKGALQRQISDEQNSELWASLAHQGWRPCIESENNPVSLP  143

Query  459  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
             KS GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVW+
Sbjct  144  TKSTGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWK  191



>ref|XP_006394028.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
 gb|ESQ31314.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
Length=507

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 79/100 (79%), Gaps = 3/100 (3%)
 Frame = +3

Query  306  ESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLF-SKFSEKSEGYLQ  482
            E+I  KPRH SL KSALQR +   E++ +W P+ +QGW P  D G   S   +K+EGY+Q
Sbjct  36   EAITIKPRHLSLLKSALQRSSG--EQSNLWRPMIDQGWSPCIDFGNSPSALPDKTEGYIQ  93

Query  483  VFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            VFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ
Sbjct  94   VFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  133



>ref|XP_009350346.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Pyrus x bretschneideri]
Length=524

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +3

Query  294  SILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEG  473
            S   E  + K +H  L +SALQR+T+  E +++W PLA++ WKP  +S +     EKSEG
Sbjct  50   STFQEWNVPKSKHQRLLRSALQRQTSEGELSDLWAPLASESWKPCAESSVAPSLPEKSEG  109

Query  474  YLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            ++QVFLDGGLNQQRMGICDAVAVA+ILNATLVIPYLEVNPVW+
Sbjct  110  FIQVFLDGGLNQQRMGICDAVAVARILNATLVIPYLEVNPVWR  152



>ref|XP_009138156.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
Length=515

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASPS+ SE    +PRH  L + AL R+ +  ++ E+W PL +Q WKP   S   S   EK
Sbjct  37   ASPSLFSEWNAPRPRHLRLLEGALHRQISIRQQVELWSPLPDQSWKPCTQSFTGSPLPEK  96

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S+G+LQVFLDGGLNQQRMGICDAVAVAKILN TLVIP LEVNPVWQ
Sbjct  97   SQGFLQVFLDGGLNQQRMGICDAVAVAKILNVTLVIPRLEVNPVWQ  142



>ref|XP_006285210.1| hypothetical protein CARUB_v10006569mg [Capsella rubella]
 gb|EOA18108.1| hypothetical protein CARUB_v10006569mg [Capsella rubella]
Length=521

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASPS+ SE    +PRH  L + AL R+ +  ++ E+W PL +QGWKP   S   S   EK
Sbjct  43   ASPSLFSEWNAPRPRHLRLLQGALDRQISIRQQVELWSPLPDQGWKPCTLSYRGSPLPEK  102

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S+G+LQVFLDGGLNQQRMGICDAVAVAKI+N TLVIP LEVNPVWQ
Sbjct  103  SQGFLQVFLDGGLNQQRMGICDAVAVAKIMNVTLVIPRLEVNPVWQ  148



>ref|XP_007018221.1| O-fucosyltransferase family protein [Theobroma cacao]
 gb|EOY15446.1| O-fucosyltransferase family protein [Theobroma cacao]
Length=540

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 88/128 (69%), Gaps = 22/128 (17%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSG--------  440
            ASPS+ SE    KPRH  L + AL R+++ ++++++W PL NQGWKP  DS         
Sbjct  41   ASPSLFSEWNAPKPRHLPLVEVALHRKSSFKQQSDLWSPLPNQGWKPCIDSANIPRKCLE  100

Query  441  --------LFSKFS------EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPY  578
                    L S FS      EKS+GY+QVFLDGGLNQQRMGICDAVAVAK+LNATLVIP+
Sbjct  101  IEMGIFFFLISLFSLLEVLPEKSQGYIQVFLDGGLNQQRMGICDAVAVAKVLNATLVIPH  160

Query  579  LEVNPVWQ  602
            LEVNPVWQ
Sbjct  161  LEVNPVWQ  168



>emb|CDY03446.1| BnaC01g16360D [Brassica napus]
Length=613

 Score =   139 bits (351),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASPS+ SE    +PRH  L + AL R+ +  ++ E+W PL +Q WKP   S   S   EK
Sbjct  135  ASPSLFSEWNAPRPRHLRLLEGALHRQISIRQQVELWSPLPDQSWKPCTQSFTGSPLPEK  194

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S+G+LQVFLDGGLNQQRMGICDAVAVAKILN TLVIP LEVNPVWQ
Sbjct  195  SQGFLQVFLDGGLNQQRMGICDAVAVAKILNVTLVIPRLEVNPVWQ  240



>ref|XP_002867661.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43920.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=519

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASPS+ SE    + RH  L + AL R+ +  ++ E+W PLA+QGWKP  +S       EK
Sbjct  41   ASPSLFSEWNAPRARHLRLLQGALDRQISIRQQVELWSPLADQGWKPCTESYRGVPLPEK  100

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S+G+LQVFLDGGLNQQRMGICDAVAVAKI+N TLVIP LEVNPVWQ
Sbjct  101  SQGFLQVFLDGGLNQQRMGICDAVAVAKIMNVTLVIPRLEVNPVWQ  146



>ref|XP_008347789.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Malus domestica]
Length=524

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = +3

Query  288  SPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKS  467
            + S   E  + K +H  L  SALQR+T+  E +++W PLA++ WKP  +S +     EKS
Sbjct  48   TKSTFQEWNVPKSKHQRLLXSALQRQTSEGELSDLWAPLASESWKPCAESSVAPSLPEKS  107

Query  468  EGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            EG++QVFLDGGLNQQRMGICDAVAVA+ILNATLVIPYLEVNPVW+
Sbjct  108  EGFIQVFLDGGLNQQRMGICDAVAVARILNATLVIPYLEVNPVWR  152



>ref|XP_004237994.1| PREDICTED: uncharacterized protein At1g04910 [Solanum lycopersicum]
Length=516

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +3

Query  291  PSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSE  470
            PS+ SE    +P HS L   ALQ++T+  ++AE+W PL +QGW+             KS+
Sbjct  43   PSVFSEWNAPRPMHSHLLNRALQQQTSKPQEAELWSPLPDQGWEACAYKQETQSLGRKSQ  102

Query  471  GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ
Sbjct  103  GYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  146



>emb|CDY34289.1| BnaA01g13920D [Brassica napus]
Length=792

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASPS+ SE    +PRH  L + AL R+ +  ++ E+W PL +Q WKP   S   S   EK
Sbjct  314  ASPSLFSEWNAPRPRHLRLLEGALHRQISIRQQVELWSPLPDQSWKPCTQSFTGSPLPEK  373

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S+G+LQVFLDGGLNQQRMGICDAVAVAKILN TLVIP LEVNPVWQ
Sbjct  374  SQGFLQVFLDGGLNQQRMGICDAVAVAKILNVTLVIPRLEVNPVWQ  419



>emb|CDY33958.1| BnaC02g43790D [Brassica napus]
Length=505

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 78/99 (79%), Gaps = 2/99 (2%)
 Frame = +3

Query  306  ESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQV  485
            E+I  KPRH SL KSALQR +   E++++W P+ +QGW P  D        +K++GY+QV
Sbjct  35   EAITIKPRHLSLLKSALQRASG--EQSDLWKPMTDQGWSPCIDLEDSPSLPDKTKGYIQV  92

Query  486  FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            FLDGGLNQQRMGICDAVAVAKILNATLVIP+LE+NPVWQ
Sbjct  93   FLDGGLNQQRMGICDAVAVAKILNATLVIPFLEINPVWQ  131



>gb|KDP41479.1| hypothetical protein JCGZ_15886 [Jatropha curcas]
Length=513

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +3

Query  291  PSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSE  470
            PS+ SE    KPRH  L K+AL R     +++E+W PL +QGWKP  +        + S 
Sbjct  41   PSLFSEWNAPKPRHLPLLKAALNRPILSRQQSELWSPLPDQGWKPCIEPVTIPSLPQTSR  100

Query  471  GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQ
Sbjct  101  GYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQ  144



>gb|KHN09000.1| DUF246 domain-containing protein [Glycine soja]
Length=510

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            +SPS+ SE    +P H +L + ALQR+T+ E +  +W PLA QGWKP  +        EK
Sbjct  38   SSPSVFSEWNAPRPMHVALLEGALQRQTSVELQTSLWSPLAFQGWKPCTERPKPHSLPEK  97

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S GY+QVFLDGGLNQQ+MG+CDAVAVAKILNATLV+P+ EVNPVWQ
Sbjct  98   SRGYIQVFLDGGLNQQKMGVCDAVAVAKILNATLVLPHFEVNPVWQ  143



>emb|CAN78778.1| hypothetical protein VITISV_029752 [Vitis vinifera]
Length=507

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 78/109 (72%), Gaps = 3/109 (3%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPE---EKAEIWMPLANQGWKPVPDSGLFSKF  455
            ASPSI SE    KPRH  L K ALQ +T       K     PLANQGWKP  DS      
Sbjct  37   ASPSIFSEWNAPKPRHLQLLKGALQLQTVSGLIGNKPISRSPLANQGWKPCVDSADTPLL  96

Query  456  SEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
             +KS+GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQ
Sbjct  97   PKKSQGYVQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQ  145



>ref|XP_003526543.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=511

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            +SPS+ SE    +P H +L + ALQR+T+ E +  +W PLA QGWKP  +        EK
Sbjct  39   SSPSVFSEWNAPRPMHVALLEGALQRQTSVELQTSLWSPLAFQGWKPCTERPKPHSLPEK  98

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S GY+QVFLDGGLNQQ+MG+CDAVAVAKILNATLV+P+ EVNPVWQ
Sbjct  99   SRGYIQVFLDGGLNQQKMGVCDAVAVAKILNATLVLPHFEVNPVWQ  144



>ref|XP_010061545.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910 
[Eucalyptus grandis]
Length=517

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASPS+ SE    KPRH  L K+A+QR+    ++ ++W PL +QGWKP   S        K
Sbjct  40   ASPSMFSEWNAPKPRHLPLLKAAIQRQIPFRQQLDLWSPLPDQGWKPCIRSADDMPLPGK  99

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S GY+Q FLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQ
Sbjct  100  SMGYIQXFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQ  145



>ref|XP_004301363.1| PREDICTED: uncharacterized protein At1g04910 [Fragaria vesca 
subsp. vesca]
Length=513

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 81/107 (76%), Gaps = 1/107 (1%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASPSI SE    KPRH  L ++AL  +++ E++ ++W PL NQGWK  P+    +    K
Sbjct  38   ASPSIFSEWNAPKPRHLHLLEAALSTQSSVEQQIKVWAPLGNQGWKHCPEEPKSASLKPK  97

Query  465  -SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
             S GY+QVFLDGGLNQQ+MGICDAVAVAKILNATLV+P+LEVNPVWQ
Sbjct  98   GSNGYIQVFLDGGLNQQKMGICDAVAVAKILNATLVLPHLEVNPVWQ  144



>gb|KFK28724.1| hypothetical protein AALP_AA7G039000 [Arabis alpina]
Length=513

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 79/109 (72%), Gaps = 3/109 (3%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSG---LFSKF  455
            +SPS+ SE    +PRH  L + AL R+ +  ++ E+W PL +QG+KP  DS    LF   
Sbjct  31   SSPSLFSEWNTPRPRHLRLLQGALDRQISIRQQVELWSPLPDQGYKPCTDSNKGRLFVSL  90

Query  456  SEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
             EKS  +LQVFLDGGLNQQRMGICDAVAVAKILN TLVIP LEVNPVWQ
Sbjct  91   PEKSLRFLQVFLDGGLNQQRMGICDAVAVAKILNVTLVIPRLEVNPVWQ  139



>ref|XP_002301095.2| hypothetical protein POPTR_0002s10600g [Populus trichocarpa]
 gb|EEE80368.2| hypothetical protein POPTR_0002s10600g [Populus trichocarpa]
Length=513

 Score =   135 bits (341),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = +3

Query  291  PSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSE  470
            PS+ SE    KPRH  L K+AL R     +K E+W PL  QGWKP  +         KS+
Sbjct  38   PSLFSEWNAPKPRHLPLLKAALDRHIPVRQKNELWSPLPYQGWKPCIEPTTIHTLPTKSQ  97

Query  471  GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVN VWQ
Sbjct  98   GYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNAVWQ  141



>ref|XP_002514041.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48624.1| conserved hypothetical protein [Ricinus communis]
Length=519

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 78/107 (73%), Gaps = 1/107 (1%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFS-KFSE  461
            A PS+ SE    KPRH  L ++AL R     E++E+W PL  QGWKP  +  +      +
Sbjct  37   AYPSLFSEWNAPKPRHFPLLRAALNRPILSREQSELWSPLPYQGWKPCTEPNIIQPSLPQ  96

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KS+ Y+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQ
Sbjct  97   KSQVYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQ  143



>dbj|BAB11569.1| unnamed protein product [Arabidopsis thaliana]
Length=523

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 78/116 (67%), Gaps = 17/116 (15%)
 Frame = +3

Query  306  ESIIAKPRHSSLFKSALQR-----------------ETTPEEKAEIWMPLANQGWKPVPD  434
            E I  KPRH SL KSALQR                 + +  E++++W PL +QGW P  D
Sbjct  34   EVITIKPRHLSLLKSALQRVKLDDFIKVSLSISFRFQKSSGEQSDLWRPLTDQGWSPCID  93

Query  435  SGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
             G      +K+ GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ
Sbjct  94   LGNSPSLPDKTAGYVQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  149



>ref|XP_009785662.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=516

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +3

Query  291  PSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSE  470
            PS+ SE    K  H  L   ALQ++T+  ++A++W PL NQGW+   D+        KS+
Sbjct  43   PSLFSEWNAPKSMHVHLLNRALQQQTSNAQEADLWSPLRNQGWESCADNQDTQSLHRKSQ  102

Query  471  GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
             Y+QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ
Sbjct  103  VYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  146



>ref|XP_009624657.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
tomentosiformis]
Length=516

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +3

Query  291  PSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSE  470
            PS+ SE    K  H  L   ALQ++T+  ++A++W PL NQGW+   D+        KS+
Sbjct  43   PSLFSEWNAPKSMHVHLLNRALQQQTSNAQEADLWSPLPNQGWEACADNQDTQSLHRKSQ  102

Query  471  GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
             Y+QVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ
Sbjct  103  VYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  146



>gb|EPS72903.1| hypothetical protein M569_01846, partial [Genlisea aurea]
Length=497

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 80/107 (75%), Gaps = 1/107 (1%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKP-VPDSGLFSKFSE  461
            A PS+ SE    KPRHS L KSALQ +T+  +K ++W  L +Q WK  +  S   S   +
Sbjct  25   AFPSVFSEWNAPKPRHSRLLKSALQHQTSDVQKDDLWKQLPSQNWKSCIHFSYKSSALPD  84

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            KS+GY+QVFLDGGLNQQRMGICDAVAVAK+LNATLVIPYLEVN VWQ
Sbjct  85   KSQGYIQVFLDGGLNQQRMGICDAVAVAKLLNATLVIPYLEVNSVWQ  131



>ref|XP_003523785.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=511

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASPS  SE    +P H +L + ALQR+T+ E +  IW PLA QGWKP  +        EK
Sbjct  39   ASPSTFSEWNAPRPMHVALLEGALQRQTSVELQTSIWSPLAFQGWKPCTERPKPPSLPEK  98

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S GY+QVFLDGGLNQQ++GICDAVAVAKILNATLV+P+ EVNPVWQ
Sbjct  99   SWGYIQVFLDGGLNQQKIGICDAVAVAKILNATLVLPHFEVNPVWQ  144



>gb|KHN08263.1| DUF246 domain-containing protein [Glycine soja]
Length=511

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASPS  SE    +P H +L + ALQR+T+ E +  IW PLA QGWKP  +        EK
Sbjct  39   ASPSTFSEWNAPRPMHVALLEGALQRQTSVELQTSIWSPLAFQGWKPCTERPKPPSLPEK  98

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            S GY+QVFLDGGLNQQ++GICDAVAVAKILNATLV+P+ EVNPVWQ
Sbjct  99   SWGYIQVFLDGGLNQQKIGICDAVAVAKILNATLVLPHFEVNPVWQ  144



>ref|XP_008368388.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=519

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 83/108 (77%), Gaps = 1/108 (1%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGL-FSKFS  458
            +ASPSI SE    +PRHS L   AL  +++ ++++++W PL +QGWK  P+     S   
Sbjct  42   HASPSIFSEWNAPQPRHSRLLSPALLLQSSVDQQSKLWAPLPDQGWKHCPEEPRSLSSSP  101

Query  459  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            ++S GY+QVFLDGGLNQQ+MGICDAVAVAKILNATLVIP+LEVNPVWQ
Sbjct  102  KESTGYIQVFLDGGLNQQKMGICDAVAVAKILNATLVIPHLEVNPVWQ  149



>ref|XP_008339020.1| PREDICTED: uncharacterized protein LOC103402048 [Malus domestica]
Length=483

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 83/108 (77%), Gaps = 1/108 (1%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGL-FSKFS  458
            +ASPSI SE    +PRHS L   AL  +++ ++++++W PL +QGWK  P+     S   
Sbjct  42   HASPSIFSEWNAPQPRHSRLLSPALLLQSSVDQQSKLWAPLPDQGWKHCPEEPRSLSSSP  101

Query  459  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            ++S GY+QVFLDGGLNQQ+MGICDAVAVAKILNATLVIP+LEVNPVWQ
Sbjct  102  KESTGYIQVFLDGGLNQQKMGICDAVAVAKILNATLVIPHLEVNPVWQ  149



>ref|XP_011016934.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Populus 
euphratica]
Length=495

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 73/104 (70%), Gaps = 0/104 (0%)
 Frame = +3

Query  291  PSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSE  470
            P + SE    KPRH  L K+AL R     +K E+W PL  QGWKP  +         KS+
Sbjct  38   PFLFSEWNAPKPRHLPLLKAALDRHIPVRQKNELWSPLPYQGWKPCIEPTTIHTLPTKSQ  97

Query  471  GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVN VWQ
Sbjct  98   GYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNAVWQ  141



>emb|CDY37829.1| BnaAnng04900D [Brassica napus]
Length=505

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 77/99 (78%), Gaps = 2/99 (2%)
 Frame = +3

Query  306  ESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQV  485
            E+I  KPRH SL KSALQR +   E++++W P+ +QGW P  D        +K++ Y+QV
Sbjct  35   EAITIKPRHLSLLKSALQRPSG--EQSDLWKPMTDQGWSPCIDLEDPPSLPDKTKSYIQV  92

Query  486  FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            FLDGGLNQQRMGICDAVAVAKILNATLVIP+LE+NPVWQ
Sbjct  93   FLDGGLNQQRMGICDAVAVAKILNATLVIPFLEINPVWQ  131



>ref|XP_009130514.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Brassica rapa]
Length=505

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 77/99 (78%), Gaps = 2/99 (2%)
 Frame = +3

Query  306  ESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQV  485
            E+I  KPRH SL KSALQR +   E++++W P+ +QGW P  D        +K++ Y+QV
Sbjct  35   EAITIKPRHLSLLKSALQRPSG--EQSDLWKPMTDQGWSPCIDLEDPPSLPDKTKSYIQV  92

Query  486  FLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            FLDGGLNQQRMGICDAVAVAKILNATLVIP+LE+NPVWQ
Sbjct  93   FLDGGLNQQRMGICDAVAVAKILNATLVIPFLEINPVWQ  131



>ref|XP_011016933.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Populus 
euphratica]
Length=513

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 73/104 (70%), Gaps = 0/104 (0%)
 Frame = +3

Query  291  PSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSE  470
            P + SE    KPRH  L K+AL R     +K E+W PL  QGWKP  +         KS+
Sbjct  38   PFLFSEWNAPKPRHLPLLKAALDRHIPVRQKNELWSPLPYQGWKPCIEPTTIHTLPTKSQ  97

Query  471  GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVN VWQ
Sbjct  98   GYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNAVWQ  141



>ref|XP_010027954.1| PREDICTED: uncharacterized protein At1g04910 [Eucalyptus grandis]
 gb|KCW54610.1| hypothetical protein EUGRSUZ_I00557 [Eucalyptus grandis]
Length=505

 Score =   133 bits (334),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = +3

Query  294  SILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEG  473
            S  SE    KPRH  L KSA++R+++   + E W PL++ GW+P   +       EKS G
Sbjct  32   SAFSEWNAIKPRHMHLLKSAVERQSSDSVQNEFWNPLSDPGWRPCIQTTNAPSLPEKSRG  91

Query  474  YLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            Y+QVFLDGGLNQQRM +CDAVAVAKILNATLVIPYLEVNPVWQ
Sbjct  92   YVQVFLDGGLNQQRMAVCDAVAVAKILNATLVIPYLEVNPVWQ  134



>gb|KCW54609.1| hypothetical protein EUGRSUZ_I00557 [Eucalyptus grandis]
Length=506

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = +3

Query  294  SILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEG  473
            S  SE    KPRH  L KSA++R+++   + E W PL++ GW+P   +       EKS G
Sbjct  32   SAFSEWNAIKPRHMHLLKSAVERQSSDSVQNEFWNPLSDPGWRPCIQTTNAPSLPEKSRG  91

Query  474  YLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            Y+QVFLDGGLNQQRM +CDAVAVAKILNATLVIPYLEVNPVWQ
Sbjct  92   YVQVFLDGGLNQQRMAVCDAVAVAKILNATLVIPYLEVNPVWQ  134



>ref|XP_010692399.1| PREDICTED: uncharacterized protein At1g04910 [Beta vulgaris subsp. 
vulgaris]
Length=503

 Score =   132 bits (333),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = +3

Query  294  SILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEG  473
            S+ SE    + RH  L + ALQ +T  +++ E+W PL++QGWKP  DS       EKS G
Sbjct  45   SLFSEWNAPQSRHVRLLQGALQWQTPFKQQLELWTPLSHQGWKPCHDSQKPHSLPEKSRG  104

Query  474  YLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            Y+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVN VWQ
Sbjct  105  YIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNSVWQ  147



>dbj|BAK06980.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=512

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            A PS+ SE    KP H SLF  +L+     E+K ++W PL +QGWKP   S +      +
Sbjct  39   AFPSLFSEWNAPKPMHESLFNESLRWTIPDEQKRDLWTPLPDQGWKPCIRSSITRGLPSQ  98

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
              GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVW+
Sbjct  99   PSGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWK  144



>gb|EEC84568.1| hypothetical protein OsI_31345 [Oryza sativa Indica Group]
Length=519

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            A PS+ SE    KP H SL   AL+R  + E+K E+W PL  QGWKP   S        +
Sbjct  40   AFPSLFSEWNAPKPMHESLLNEALRRTISNEQKRELWSPLPYQGWKPCLKSSSVHGVPLE  99

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
              GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVW+
Sbjct  100  PTGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWK  145



>ref|XP_009130513.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Brassica rapa]
Length=506

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 78/100 (78%), Gaps = 3/100 (3%)
 Frame = +3

Query  306  ESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPD-SGLFSKFSEKSEGYLQ  482
            E+I  KPRH SL KSALQR +   E++++W P+ +QGW P  D     S   +K++ Y+Q
Sbjct  35   EAITIKPRHLSLLKSALQRPSG--EQSDLWKPMTDQGWSPCIDLEDPPSALPDKTKSYIQ  92

Query  483  VFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            VFLDGGLNQQRMGICDAVAVAKILNATLVIP+LE+NPVWQ
Sbjct  93   VFLDGGLNQQRMGICDAVAVAKILNATLVIPFLEINPVWQ  132



>ref|NP_001063155.1| Os09g0412200 [Oryza sativa Japonica Group]
 dbj|BAD28369.1| putative auxin-independent growth promoter [Oryza sativa Japonica 
Group]
 dbj|BAF25069.1| Os09g0412200 [Oryza sativa Japonica Group]
 dbj|BAG90088.1| unnamed protein product [Oryza sativa Japonica Group]
Length=512

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            A PS+ SE    KP H SL   AL+R  + E+K E+W PL  QGWKP   S        +
Sbjct  40   AFPSLFSEWNAPKPMHESLLNEALRRTISNEQKRELWSPLPYQGWKPCLKSSSVHGVPLE  99

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
              GY+QVFLDGGLNQQRMGICDAVAVAKILNA+LVIP+LEVNPVW+
Sbjct  100  PTGYIQVFLDGGLNQQRMGICDAVAVAKILNASLVIPHLEVNPVWK  145



>ref|XP_004956798.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=512

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +A PS+ SE    KP H SL   AL+     E+K E+W PL+ QGWKP   S +      
Sbjct  38   HAFPSLFSEWNAPKPMHPSLLNEALRWAIPGEQKRELWSPLSYQGWKPCLKSSISHALPL  97

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            +  GY+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVW+
Sbjct  98   EPSGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWK  144



>gb|EEE69695.1| hypothetical protein OsJ_29339 [Oryza sativa Japonica Group]
Length=722

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            A PS+ SE    KP H SL   AL+R  + E+K E+W PL  QGWKP   S        +
Sbjct  40   AFPSLFSEWNAPKPMHESLLNEALRRTISNEQKRELWSPLPYQGWKPCLKSSSVHGVPLE  99

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
              GY+QVFLDGGLNQQRMGICDAVAVAKILNA+LVIP+LEVNPVW+
Sbjct  100  PTGYIQVFLDGGLNQQRMGICDAVAVAKILNASLVIPHLEVNPVWK  145



>ref|NP_001150199.1| LOC100283829 [Zea mays]
 gb|ACG38224.1| psRT17-1 like protein [Zea mays]
 tpg|DAA61416.1| TPA: psRT17-1 like protein [Zea mays]
Length=511

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +A PS+ SE    KP H SL   AL+   T  +K ++W PL  QGWKP     +  K   
Sbjct  38   HAFPSVFSEWNAPKPMHPSLLNEALRWTATDGQKKDLWSPLPYQGWKPCLTPSVSHKLPL  97

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            +  GY+QVFLDGGLNQQRMGICDA+AVAKILNATLVIP+LEVNPVW+
Sbjct  98   EPSGYIQVFLDGGLNQQRMGICDAIAVAKILNATLVIPHLEVNPVWK  144



>ref|XP_006661225.1| PREDICTED: uncharacterized protein At1g04910-like, partial [Oryza 
brachyantha]
Length=492

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 74/106 (70%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            A PS+ SE    KP H +L   AL++  + E+K E+W PL  QGWKP            +
Sbjct  20   AFPSLFSEWNAPKPMHETLLNEALRQAISNEQKRELWSPLPYQGWKPCLKLSSVHGVPSE  79

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
              GY+QVFLDGGLNQQRMGICDAVAVAK+LNATLVIP+LEVNPVW+
Sbjct  80   PTGYIQVFLDGGLNQQRMGICDAVAVAKVLNATLVIPHLEVNPVWK  125



>ref|XP_002462371.1| hypothetical protein SORBIDRAFT_02g024540 [Sorghum bicolor]
 gb|EER98892.1| hypothetical protein SORBIDRAFT_02g024540 [Sorghum bicolor]
Length=511

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +A PS+ SE    KP H SL   AL+   T ++K  +W PL  QGWKP     +      
Sbjct  38   HAFPSLFSEWNAPKPMHPSLLNEALRWAVTDKQKTGLWSPLPYQGWKPCLKPSVSHTLPL  97

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            +  G++QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVW+
Sbjct  98   EPSGFIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWK  144



>ref|XP_007222858.1| hypothetical protein PRUPE_ppa004255mg [Prunus persica]
 gb|EMJ24057.1| hypothetical protein PRUPE_ppa004255mg [Prunus persica]
Length=520

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 78/107 (73%), Gaps = 1/107 (1%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKP-VPDSGLFSKFSE  461
            ASPS  SE    K RH  L   AL  +++ E+++++W PL NQGWK  + +    S   +
Sbjct  43   ASPSFFSEWNAPKARHLHLLNPALLSQSSVEQQSKLWSPLPNQGWKHCLEEPKSLSLTPK  102

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
             S GY+QVFLDGGLNQQ+MGICDAVAVAKILNATLV+P+LEVNPVWQ
Sbjct  103  GSTGYIQVFLDGGLNQQKMGICDAVAVAKILNATLVVPHLEVNPVWQ  149



>ref|XP_010107675.1| hypothetical protein L484_007693 [Morus notabilis]
 gb|EXC16648.1| hypothetical protein L484_007693 [Morus notabilis]
Length=529

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 79/117 (68%), Gaps = 11/117 (9%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRET---TPE-----EKAEIWMPLANQGWKPVPDSG  440
            A PS+ SE    KP H  L   AL+R T   +PE     ++  +W PLANQGW+P  D  
Sbjct  41   AFPSLFSEWNAPKPMHLHLLNGALERHTVSSSPEPPSVQQQKNLWSPLANQGWRPCLDFE  100

Query  441  LFSKFS---EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
                     +KS GY+QVFLDGGLNQQ+MGICDAVAVAKILNATLVIP+L+VNPVWQ
Sbjct  101  GPRDVPLSLKKSNGYIQVFLDGGLNQQKMGICDAVAVAKILNATLVIPHLDVNPVWQ  157



>ref|XP_010312649.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Solanum 
lycopersicum]
Length=470

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +3

Query  375  EEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKIL  554
            EE++ +W PL +QGWKP   S   S   EKSEGY+QVFLDGGLNQQRMGICDAV VAKIL
Sbjct  23   EEQSRLWTPLEHQGWKPCTKSDAASTVPEKSEGYVQVFLDGGLNQQRMGICDAVVVAKIL  82

Query  555  NATLVIPYLEVNPVWQ  602
            NATLVIP LEVNPVWQ
Sbjct  83   NATLVIPQLEVNPVWQ  98



>ref|XP_009376221.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910 
[Pyrus x bretschneideri]
Length=520

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 80/108 (74%), Gaps = 1/108 (1%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDS-GLFSKFS  458
            +A+PSI SE    KPRH  L   AL  ++  ++++++W PL NQGWK  P+     S   
Sbjct  42   HAAPSIFSEWNAPKPRHLRLLNPALLLQSYVDQQSKLWAPLPNQGWKHCPEEPNSLSSSP  101

Query  459  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            ++S  Y+QVFLDGGLNQ++MGICDAVAVAKILNATLVIP+LEVNPVWQ
Sbjct  102  KESTWYIQVFLDGGLNQKKMGICDAVAVAKILNATLVIPHLEVNPVWQ  149



>gb|KHN33918.1| DUF246 domain-containing protein [Glycine soja]
Length=169

 Score =   117 bits (294),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 69/94 (73%), Gaps = 5/94 (5%)
 Frame = +3

Query  321  KPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGG  500
            KPRHS L +S         + +E+W PL +QGWKP  +S   +   EK EGY+QVFLDGG
Sbjct  78   KPRHSRLLRSV-----PTSQLSELWSPLESQGWKPYVESNKPTALLEKLEGYIQVFLDGG  132

Query  501  LNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            LNQQ++GICDAV VAKILNAT VIPYLE+NPVW+
Sbjct  133  LNQQKLGICDAVVVAKILNATPVIPYLELNPVWR  166



>tpg|DAA61415.1| TPA: hypothetical protein ZEAMMB73_640362 [Zea mays]
Length=486

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  321  KPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGG  500
            KP H SL   AL+   T  +K ++W PL  QGWKP     +  K   +  GY+QVFLDGG
Sbjct  16   KPMHPSLLNEALRWTATDGQKKDLWSPLPYQGWKPCLTPSVSHKLPLEPSGYIQVFLDGG  75

Query  501  LNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            LNQQRMGICDA+AVAKILNATLVIP+LEVNPVW+
Sbjct  76   LNQQRMGICDAIAVAKILNATLVIPHLEVNPVWK  109



>gb|KCW68511.1| hypothetical protein EUGRSUZ_F02148 [Eucalyptus grandis]
Length=491

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 73/106 (69%), Gaps = 11/106 (10%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            ASPS+ SE    KPRH  L K+A+QR+    ++ ++W PL +QGWKP   S         
Sbjct  25   ASPSMFSEWNAPKPRHLPLLKAAIQRQIPFRQQLDLWSPLPDQGWKPCIRSA--------  76

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
                  +FLDGGLNQQRMGICDAVAVAKILNATLVIP+LEVNPVWQ
Sbjct  77   ---DDMLFLDGGLNQQRMGICDAVAVAKILNATLVIPHLEVNPVWQ  119



>ref|XP_008219267.1| PREDICTED: uncharacterized protein At1g04910-like [Prunus mume]
Length=520

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 78/107 (73%), Gaps = 1/107 (1%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKP-VPDSGLFSKFSE  461
            ASPSI SE    K RH  L   AL  +++ E+++++W PL NQGWK  + +    S   +
Sbjct  43   ASPSIFSEWNAPKARHLHLLNPALLLQSSVEQQSKLWSPLPNQGWKHCLEEPKSLSLTPK  102

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
             S GY+QVFLDGGLNQQ+MGICDAVAVAKIL ATLV+P+LEVNPVWQ
Sbjct  103  GSTGYIQVFLDGGLNQQKMGICDAVAVAKILKATLVVPHLEVNPVWQ  149



>gb|KCW54611.1| hypothetical protein EUGRSUZ_I00557 [Eucalyptus grandis]
Length=484

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  387  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  566
            E W PL++ GW+P   +       EKS GY+QVFLDGGLNQQRM +CDAVAVAKILNATL
Sbjct  42   EFWNPLSDPGWRPCIQTTNAPSLPEKSRGYVQVFLDGGLNQQRMAVCDAVAVAKILNATL  101

Query  567  VIPYLEVNPVWQ  602
            VIPYLEVNPVWQ
Sbjct  102  VIPYLEVNPVWQ  113



>gb|AGE09594.1| UP7-like protein, partial [Eucalyptus cladocalyx]
Length=297

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  387  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  566
            E W PL+  GW+P   +       EKS GY+QVFLDGGLNQQRM +CDAVAVAKILNATL
Sbjct  7    EFWNPLSEPGWRPCIQTTNAPSLPEKSRGYIQVFLDGGLNQQRMAVCDAVAVAKILNATL  66

Query  567  VIPYLEVNPVWQ  602
            VIPYLEVNPVWQ
Sbjct  67   VIPYLEVNPVWQ  78



>ref|XP_003578106.1| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=512

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 67/106 (63%), Gaps = 0/106 (0%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEK  464
            A PS+ SE    KP H  L   AL+     + K  +W  L  QGWKP            +
Sbjct  39   AFPSLFSEWNAPKPMHEFLLNEALRWTILDDHKKNLWTSLPFQGWKPCLKPSTAHGLPLE  98

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
               Y+QVFLDGGLNQQRMGICDAVAVAKILNATLVIP+L++NPVW+
Sbjct  99   PSRYIQVFLDGGLNQQRMGICDAVAVAKILNATLVIPHLDINPVWK  144



>ref|XP_008651492.1| PREDICTED: LOC100283829 isoform X1 [Zea mays]
 gb|ACF82519.1| unknown [Zea mays]
 tpg|DAA61414.1| TPA: hypothetical protein ZEAMMB73_640362 [Zea mays]
Length=447

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = +3

Query  378  EKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILN  557
            +K ++W PL  QGWKP     +  K   +  GY+QVFLDGGLNQQRMGICDA+AVAKILN
Sbjct  6    QKKDLWSPLPYQGWKPCLTPSVSHKLPLEPSGYIQVFLDGGLNQQRMGICDAIAVAKILN  65

Query  558  ATLVIPYLEVNPVWQ  602
            ATLVIP+LEVNPVW+
Sbjct  66   ATLVIPHLEVNPVWK  80



>gb|ABJ96379.1| expressed protein [Prunus persica]
Length=517

 Score =   110 bits (276),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = +3

Query  285  ASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKP-VPDSGLFSKFSE  461
            ASPS  SE    K RH  L   AL  +++ E+++++W PL NQGWK  + +    S   +
Sbjct  43   ASPSFFSEWNAPKARHLHLLNPALLSQSSVEQQSKLWSPLPNQGWKHCLEEPKSLSLTPK  102

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
             S GY+QVFLDGGLNQQ+MG+   VAVAKILNATLV+P+LEVNPVWQ
Sbjct  103  GSTGYIQVFLDGGLNQQKMGV---VAVAKILNATLVVPHLEVNPVWQ  146



>ref|XP_006852943.1| hypothetical protein AMTR_s00033p00238220 [Amborella trichopoda]
 gb|ERN14410.1| hypothetical protein AMTR_s00033p00238220 [Amborella trichopoda]
Length=446

 Score =   107 bits (266),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +3

Query  375  EEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKIL  554
            ++++++W PL +QGWK             +S+GY+QVFLDGGLNQQRMGICDAVAVAKIL
Sbjct  3    DKQSDLWSPLPSQGWKACNAPFSTPVLPRRSQGYIQVFLDGGLNQQRMGICDAVAVAKIL  62

Query  555  NATLVIPYLEVNPVWQ  602
            NATLVIP+ EVNPVW+
Sbjct  63   NATLVIPHFEVNPVWR  78



>ref|XP_008378640.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=441

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 62/79 (78%), Gaps = 3/79 (4%)
 Frame = +3

Query  375  EEKAEIWMPLANQGWKPVPDS-GLFSKFSEKSEGYLQVFLDGGLNQQRMGICD--AVAVA  545
            ++++++W PL N GWK  P+     S   ++S GY+QVFLD GLNQQ+MGICD  AVAVA
Sbjct  126  DQQSKLWAPLPNHGWKHCPEEPNSLSSSPKESTGYIQVFLDEGLNQQKMGICDAVAVAVA  185

Query  546  KILNATLVIPYLEVNPVWQ  602
            KILNATLVIP+LEVNPVWQ
Sbjct  186  KILNATLVIPHLEVNPVWQ  204



>ref|XP_010523310.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Tarenaya hassleriana]
Length=445

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +3

Query  459  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            EKSEGY+QVFLDGGLNQQRMGICDAVAVAKILNATLV+PYLEVNPVWQ
Sbjct  26   EKSEGYIQVFLDGGLNQQRMGICDAVAVAKILNATLVVPYLEVNPVWQ  73



>ref|XP_007047792.1| O-fucosyltransferase family protein isoform 2, partial [Theobroma 
cacao]
 gb|EOX91949.1| O-fucosyltransferase family protein isoform 2, partial [Theobroma 
cacao]
Length=403

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 65/91 (71%), Gaps = 2/91 (2%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +ASPS  SE  + KPRH  L +SALQRE +  E++++W PLA+QGW+P  +  +     +
Sbjct  40   HASPSTFSEWNVPKPRHLPLLRSALQRENSNGEQSDLWAPLADQGWRPCLECVIAPSLPQ  99

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKIL  554
            KSEGYLQVFLDGGLNQQRMG  D +++ K L
Sbjct  100  KSEGYLQVFLDGGLNQQRMG--DDISIVKEL  128



>ref|XP_002967262.1| hypothetical protein SELMODRAFT_87093 [Selaginella moellendorffii]
 gb|EFJ31861.1| hypothetical protein SELMODRAFT_87093 [Selaginella moellendorffii]
Length=476

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 67/105 (64%), Gaps = 4/105 (4%)
 Frame = +3

Query  294  SILSESIIAKPR--HSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKS  467
            SIL   ++  PR      F   +Q  +   E A +W P  N GW P     + S  S  S
Sbjct  12   SILVYFVLYAPRVFLFYFFPFVVQNSSRSGESALLWHPPDNDGWAPCLRQSVGSISS--S  69

Query  468  EGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
              YLQVFL+GGLNQQRMG+CDAVAVAKILNATLV+P+L+VNPVWQ
Sbjct  70   NFYLQVFLEGGLNQQRMGVCDAVAVAKILNATLVVPHLDVNPVWQ  114



>gb|KHN11061.1| DUF246 domain-containing protein, partial [Glycine soja]
Length=178

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 58/73 (79%), Gaps = 3/73 (4%)
 Frame = +3

Query  384  AEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNAT  563
            +++W PL +QGWKP  +S   +   EKSEGY+QVFLDGGLNQQ+MG    + VAKILNAT
Sbjct  51   SKLWSPLESQGWKPYVESNKPTALLEKSEGYIQVFLDGGLNQQKMGF---IVVAKILNAT  107

Query  564  LVIPYLEVNPVWQ  602
            LVIPYLE+NPVW+
Sbjct  108  LVIPYLELNPVWR  120



>ref|XP_002960458.1| hypothetical protein SELMODRAFT_75338 [Selaginella moellendorffii]
 gb|EFJ37997.1| hypothetical protein SELMODRAFT_75338 [Selaginella moellendorffii]
Length=464

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 60/88 (68%), Gaps = 2/88 (2%)
 Frame = +3

Query  339  LFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRM  518
             F   +Q  +   E A +W P  N GW P     + S  S  S  YLQVFL+GGLNQQRM
Sbjct  17   FFPFVVQNNSRSGESALLWHPPDNDGWAPCLRESVGSISS--SNFYLQVFLEGGLNQQRM  74

Query  519  GICDAVAVAKILNATLVIPYLEVNPVWQ  602
            G+CDAVAVAKILNATLV+P+L+VNPVWQ
Sbjct  75   GVCDAVAVAKILNATLVVPHLDVNPVWQ  102



>emb|CAA23010.1| PsRT17-1 like protein [Arabidopsis thaliana]
 emb|CAB79363.1| PsRT17-1 like protein [Arabidopsis thaliana]
Length=431

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  441  LFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            LF+   EKSEG+LQVFLDGGLNQQRMGICDAVAVAKI+N TLVIP LEVN VWQ
Sbjct  5    LFAALPEKSEGFLQVFLDGGLNQQRMGICDAVAVAKIMNVTLVIPRLEVNTVWQ  58



>gb|AAB72114.1| PsRT17-1 [Pisum sativum]
Length=406

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  459  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            EKSEGY+QVFLDGGLNQQRMG   AV VAKILNATLVIPYLE+NPVW+
Sbjct  23   EKSEGYIQVFLDGGLNQQRMGYVIAVVVAKILNATLVIPYLELNPVWK  70



>ref|XP_001777077.1| predicted protein [Physcomitrella patens]
 gb|EDQ58070.1| predicted protein, partial [Physcomitrella patens]
Length=437

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +3

Query  465  SEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            + GYLQVFL+GGLNQQRMGICDAVAVAKILNATLV+P+ +VNPVW+
Sbjct  11   TNGYLQVFLEGGLNQQRMGICDAVAVAKILNATLVLPHFDVNPVWK  56



>gb|AAK84479.1| putative auxin growth promotor protein [Solanum lycopersicum]
Length=478

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 59/107 (55%), Gaps = 28/107 (26%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            Y SP+ILS+    K RHS L KSA+QR+T+ EE++ +W PL +QGWKP   S   S    
Sbjct  28   YGSPTILSDLNAPKFRHSRLAKSAIQRQTSNEEQSRLWTPLEHQGWKPCTKSDAAS----  83

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
                                    + VAKILNATLVIP LEVNPVWQ
Sbjct  84   ------------------------IVVAKILNATLVIPQLEVNPVWQ  106



>ref|XP_006387762.1| hypothetical protein POPTR_0603s002103g, partial [Populus trichocarpa]
 gb|ERP46676.1| hypothetical protein POPTR_0603s002103g, partial [Populus trichocarpa]
Length=76

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +3

Query  393  WMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVI  572
            W P  +Q WKP   S        +S G+L +  +GGLNQQR+ ICDAVAVA +LNATLVI
Sbjct  5    WDPKLHQAWKPSGISNYSDAELPESNGFLIIEANGGLNQQRLSICDAVAVAGLLNATLVI  64

Query  573  PYLEVNPVWQ  602
            P+  +N VW+
Sbjct  65   PFFHLNSVWR  74



>ref|XP_011096470.1| PREDICTED: uncharacterized protein At1g04910 [Sesamum indicum]
Length=586

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 52/77 (68%), Gaps = 7/77 (9%)
 Frame = +3

Query  387  EIWMPLANQGWKP-----VPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKI  551
             +W P   QGWKP     V  SGL S+F  KS G+L +  +GGLNQQR+ ICDAVAVA +
Sbjct  144  NVWNPKLRQGWKPCIKQTVIQSGL-SEFP-KSNGFLIIEANGGLNQQRLSICDAVAVAGL  201

Query  552  LNATLVIPYLEVNPVWQ  602
            LNATLVIP   +N VWQ
Sbjct  202  LNATLVIPIFHLNSVWQ  218



>ref|XP_011074208.1| PREDICTED: uncharacterized protein At1g04910 [Sesamum indicum]
Length=537

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 59/107 (55%), Gaps = 9/107 (8%)
 Frame = +3

Query  282  YASPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSE  461
            +A P +L   +IA+    +  K +L  ET       +W PL N+ + P  D         
Sbjct  74   FAHPHVLEAPLIAQKLRGA--KRSLNLET-------LWKPLPNRDYAPCTDPSSSYSTPP  124

Query  462  KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            +S GYL V  +GGLNQ R GICD VAVA+I+NATLVIP L+    WQ
Sbjct  125  ESRGYLLVHANGGLNQMRAGICDMVAVARIINATLVIPELDKRSYWQ  171



>gb|EYU22809.1| hypothetical protein MIMGU_mgv1a003510mg [Erythranthe guttata]
Length=580

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +3

Query  384  AEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNAT  563
            + +W P   QGWKP     +      +S G+L +  +GGLNQQR+ ICDAVAVA +LNAT
Sbjct  140  SNVWNPKMKQGWKPCIKQTVSQSELSQSNGFLIIEANGGLNQQRISICDAVAVAGLLNAT  199

Query  564  LVIPYLEVNPVWQ  602
            LVIP   +N VWQ
Sbjct  200  LVIPIFHLNSVWQ  212



>emb|CBI18521.3| unnamed protein product [Vitis vinifera]
Length=492

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +3

Query  390  IWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLV  569
            +W P  +Q WKP  +  + +    KS GY  +  +GGLNQQR+ ICDAVAVA +LNATLV
Sbjct  54   VWHPKPHQSWKPCVNQRISAAELPKSNGYFIIEANGGLNQQRLSICDAVAVAGLLNATLV  113

Query  570  IPYLEVNPVWQ  602
            IP   +N VW+
Sbjct  114  IPMFHLNSVWR  124



>ref|XP_002272758.2| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
Length=582

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +3

Query  390  IWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLV  569
            +W P  +Q WKP  +  + +    KS GY  +  +GGLNQQR+ ICDAVAVA +LNATLV
Sbjct  144  VWHPKPHQSWKPCVNQRISAAELPKSNGYFIIEANGGLNQQRLSICDAVAVAGLLNATLV  203

Query  570  IPYLEVNPVWQ  602
            IP   +N VW+
Sbjct  204  IPMFHLNSVWR  214



>ref|XP_009594772.1| PREDICTED: uncharacterized protein At1g04910 [Nicotiana tomentosiformis]
Length=564

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 48/75 (64%), Gaps = 3/75 (4%)
 Frame = +3

Query  384  AEIWMPLANQGWKP--VPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILN  557
              +W P  +Q WKP  V   G   +   KS GYL +  +GGLNQQR+ ICDAVAVA +LN
Sbjct  123  TNVWNPKLHQVWKPCTVSQEGFIDQLP-KSNGYLIIEANGGLNQQRLSICDAVAVAGLLN  181

Query  558  ATLVIPYLEVNPVWQ  602
            ATLVIP   +N VW+
Sbjct  182  ATLVIPIFHLNSVWR  196



>gb|KHG28222.1| hypothetical protein F383_11890 [Gossypium arboreum]
Length=444

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 52/74 (70%), Gaps = 5/74 (7%)
 Frame = +3

Query  393  WMPLANQGWKPVPDSGLFSK--FSE--KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNA  560
            W    +QGWKP  +S + SK  FSE  KS G+L +  +GGLNQQR+ ICDAVAVA +LNA
Sbjct  72   WNLKMHQGWKPCVNS-IISKTGFSELPKSNGFLIIEANGGLNQQRLSICDAVAVAWLLNA  130

Query  561  TLVIPYLEVNPVWQ  602
            TLVIP   +N VW+
Sbjct  131  TLVIPIFHLNSVWR  144



>ref|XP_010104480.1| hypothetical protein L484_025449 [Morus notabilis]
 gb|EXC01081.1| hypothetical protein L484_025449 [Morus notabilis]
Length=290

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 54/90 (60%), Gaps = 12/90 (13%)
 Frame = +3

Query  354  LQRETTPEEKA--EIWMPLANQGWKP-----VPDSGLFSKFSEKSEGYLQVFLDGGLNQQ  512
            +Q E+   E A   +W    +Q WKP     +P +GL      KS G+  +  +GGLNQQ
Sbjct  116  MQAESNGSENAMMSVWNSTVHQVWKPCLHRDIPKAGL-----PKSNGFFIIEANGGLNQQ  170

Query  513  RMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
            R+ ICDAVAVA +LNATL+IP   +N VW+
Sbjct  171  RLSICDAVAVAGLLNATLLIPIFHLNSVWR  200



>ref|XP_009781764.1| PREDICTED: uncharacterized protein At1g04910 [Nicotiana sylvestris]
Length=565

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 49/74 (66%), Gaps = 3/74 (4%)
 Frame = +3

Query  387  EIWMPLANQGWKP--VPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNA  560
             +W P  +Q WKP  V   G  ++   KS GYL +  +GGLNQQR+ ICDAVAVA +LNA
Sbjct  125  NVWNPKLHQVWKPCSVSQEGFTAQLP-KSNGYLIIEANGGLNQQRLSICDAVAVAGLLNA  183

Query  561  TLVIPYLEVNPVWQ  602
            TLVIP   +N VW+
Sbjct  184  TLVIPIFHLNSVWR  197



>gb|AGV54211.1| O-fucosyltransferase family protein [Phaseolus vulgaris]
Length=511

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = +3

Query  321  KPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGG  500
            KPRHS L +SA+QRET   + +E+W PL +QGWK   +S    K  EKSEGY+QVFLDGG
Sbjct  50   KPRHSRLLRSAVQRETPASQLSELWSPLESQGWKSYVESNK-PKLPEKSEGYIQVFLDGG  108

Query  501  LNQQRMG  521
            LN +  G
Sbjct  109  LNHKGWG  115



>gb|KJB28878.1| hypothetical protein B456_005G074200 [Gossypium raimondii]
Length=461

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 52/74 (70%), Gaps = 5/74 (7%)
 Frame = +3

Query  393  WMPLANQGWKPVPDSGLFSK--FSE--KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNA  560
            W    +QGWKP  +S + SK  FSE  KS G+L +  +GGLNQQR+ ICDAVAVA +LNA
Sbjct  137  WNLKMHQGWKPCVNS-IISKTGFSELPKSNGFLIIEANGGLNQQRLSICDAVAVAWLLNA  195

Query  561  TLVIPYLEVNPVWQ  602
            TLVIP   +N VW+
Sbjct  196  TLVIPIFHLNSVWR  209



>gb|KDP34835.1| hypothetical protein JCGZ_11197 [Jatropha curcas]
Length=594

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = +3

Query  393  WMPLANQGWKPVPDSGLFSKFSE--KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  566
            W P    GWKP  +    +  +E  KS G+L +  +GGLNQQR+ ICDAVAVA +LNATL
Sbjct  149  WDPKLRNGWKPCGNGNNETSEAELPKSNGFLIIEANGGLNQQRLSICDAVAVAGLLNATL  208

Query  567  VIPYLEVNPVWQ  602
            VIP   +N VWQ
Sbjct  209  VIPIFHLNSVWQ  220



>gb|KJB28879.1| hypothetical protein B456_005G074200 [Gossypium raimondii]
Length=547

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 52/74 (70%), Gaps = 5/74 (7%)
 Frame = +3

Query  393  WMPLANQGWKPVPDSGLFSK--FSE--KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNA  560
            W    +QGWKP  +S + SK  FSE  KS G+L +  +GGLNQQR+ ICDAVAVA +LNA
Sbjct  109  WNLKMHQGWKPCVNS-IISKTGFSELPKSNGFLIIEANGGLNQQRLSICDAVAVAWLLNA  167

Query  561  TLVIPYLEVNPVWQ  602
            TLVIP   +N VW+
Sbjct  168  TLVIPIFHLNSVWR  181



>gb|KJB28877.1| hypothetical protein B456_005G074200 [Gossypium raimondii]
Length=575

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 52/74 (70%), Gaps = 5/74 (7%)
 Frame = +3

Query  393  WMPLANQGWKPVPDSGLFSK--FSE--KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNA  560
            W    +QGWKP  +S + SK  FSE  KS G+L +  +GGLNQQR+ ICDAVAVA +LNA
Sbjct  137  WNLKMHQGWKPCVNS-IISKTGFSELPKSNGFLIIEANGGLNQQRLSICDAVAVAWLLNA  195

Query  561  TLVIPYLEVNPVWQ  602
            TLVIP   +N VW+
Sbjct  196  TLVIPIFHLNSVWR  209



>ref|XP_004501690.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=549

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 57/105 (54%), Gaps = 8/105 (8%)
 Frame = +3

Query  288  SPSILSESIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKS  467
            +P  LS+++++ P+        L       +   +W P  N G++P        K S  S
Sbjct  93   APPHLSKALLSAPK--------LNDSRGDPDYETLWKPPPNHGFQPCTKPTPDYKSSANS  144

Query  468  EGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
             GYL V  +GGLNQ R GICD VA+A+I+NATLVIP L+    WQ
Sbjct  145  RGYLLVHTNGGLNQMRAGICDMVAIARIINATLVIPELDKKSFWQ  189



>ref|XP_009390063.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=541

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 55/111 (50%), Gaps = 16/111 (14%)
 Frame = +3

Query  279  IYASPSILSE---SIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFS  449
            +Y SP +  E    + A   HSS   +A             W   A Q WKP     L  
Sbjct  87   VYRSPRLFHELWAFMQADVNHSSALMTA-------------WHQKATQKWKPRLPKRLLQ  133

Query  450  KFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
                 S GYL +  +GGLNQQRM ICDAVAVA +LNATLVIP    N VW+
Sbjct  134  AELPPSNGYLIIEANGGLNQQRMSICDAVAVAGLLNATLVIPIFHFNSVWR  184



>ref|XP_009390064.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=521

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 55/111 (50%), Gaps = 16/111 (14%)
 Frame = +3

Query  279  IYASPSILSE---SIIAKPRHSSLFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFS  449
            +Y SP +  E    + A   HSS   +A             W   A Q WKP     L  
Sbjct  87   VYRSPRLFHELWAFMQADVNHSSALMTA-------------WHQKATQKWKPRLPKRLLQ  133

Query  450  KFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVWQ  602
                 S GYL +  +GGLNQQRM ICDAVAVA +LNATLVIP    N VW+
Sbjct  134  AELPPSNGYLIIEANGGLNQQRMSICDAVAVAGLLNATLVIPIFHFNSVWR  184



>ref|XP_011003993.1| PREDICTED: uncharacterized protein At1g04910 [Populus euphratica]
Length=590

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 52/74 (70%), Gaps = 8/74 (11%)
 Frame = +3

Query  393  WMPLANQGWKPVPDSGLFSKFSE----KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNA  560
            W P  +Q WKP   SG+ S +S+    +S G+L +  +GGLNQQR+ ICDAVAVA +LNA
Sbjct  157  WDPKLHQAWKP---SGI-SNYSDAELPESNGFLIIEANGGLNQQRLSICDAVAVAGLLNA  212

Query  561  TLVIPYLEVNPVWQ  602
            TLVIP+  +N VW+
Sbjct  213  TLVIPFFHLNSVWR  226



>ref|XP_006349651.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum tuberosum]
Length=571

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 50/75 (67%), Gaps = 3/75 (4%)
 Frame = +3

Query  387  EIWMPLANQGWKPVPDSGLFSK-FSE--KSEGYLQVFLDGGLNQQRMGICDAVAVAKILN  557
             +W P  +Q WKP     +  + F+E  KS GYL +  +GGLNQQR+ ICDAVAVA +LN
Sbjct  129  NVWNPKLHQVWKPCIAHTVSQEGFAELPKSNGYLIIEANGGLNQQRLSICDAVAVAGLLN  188

Query  558  ATLVIPYLEVNPVWQ  602
            ATLVIP   +N VW+
Sbjct  189  ATLVIPIFHLNSVWR  203



>ref|XP_010098633.1| hypothetical protein L484_012746 [Morus notabilis]
 gb|EXB75372.1| hypothetical protein L484_012746 [Morus notabilis]
Length=518

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +3

Query  387  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  566
            ++W P +N+ + P  + GL      +S GYL V  +GGLNQ R GICD VAVA+I+NATL
Sbjct  96   KLWKPPSNRDFIPCAEPGLNYTPPAESRGYLLVHTNGGLNQMRAGICDMVAVARIINATL  155

Query  567  VIPYLEVNPVWQ  602
            VIP L+    WQ
Sbjct  156  VIPELDKRSFWQ  167



>ref|XP_008459666.1| PREDICTED: uncharacterized protein At1g04910 [Cucumis melo]
 ref|XP_008459667.1| PREDICTED: uncharacterized protein At1g04910 [Cucumis melo]
Length=556

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 52/87 (60%), Gaps = 1/87 (1%)
 Frame = +3

Query  342  FKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMG  521
            F  A  R +T    +  W    +  WKP  +S   ++   KS G+L +  +GGLNQQR+ 
Sbjct  110  FMEAESRNSTTHALSTAWNSRVHNVWKPCINSSTVTELP-KSNGFLIIEANGGLNQQRLS  168

Query  522  ICDAVAVAKILNATLVIPYLEVNPVWQ  602
            ICDAVAVA +LNA+LVIP   +N VW+
Sbjct  169  ICDAVAVAGLLNASLVIPIFHLNSVWR  195



>ref|XP_010025942.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Eucalyptus 
grandis]
 gb|KCW83081.1| hypothetical protein EUGRSUZ_B00039 [Eucalyptus grandis]
Length=563

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +3

Query  387  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  566
            ++W P +N+ + P  + GL       S+GYL V  +GGLNQ R GICD VAVA+I+NATL
Sbjct  127  KLWKPPSNRDFVPCTEPGLDYTSPRGSQGYLLVSTNGGLNQMRAGICDMVAVARIINATL  186

Query  567  VIPYLEVNPVWQ  602
            VIP L+    WQ
Sbjct  187  VIPELDKRSFWQ  198



>ref|XP_010025946.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Eucalyptus 
grandis]
Length=562

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +3

Query  387  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  566
            ++W P +N+ + P  + GL       S+GYL V  +GGLNQ R GICD VAVA+I+NATL
Sbjct  126  KLWKPPSNRDFVPCTEPGLDYTSPRGSQGYLLVSTNGGLNQMRAGICDMVAVARIINATL  185

Query  567  VIPYLEVNPVWQ  602
            VIP L+    WQ
Sbjct  186  VIPELDKRSFWQ  197



>ref|XP_010025951.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Eucalyptus 
grandis]
Length=533

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +3

Query  387  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  566
            ++W P +N+ + P  + GL       S+GYL V  +GGLNQ R GICD VAVA+I+NATL
Sbjct  97   KLWKPPSNRDFVPCTEPGLDYTSPRGSQGYLLVSTNGGLNQMRAGICDMVAVARIINATL  156

Query  567  VIPYLEVNPVWQ  602
            VIP L+    WQ
Sbjct  157  VIPELDKRSFWQ  168



>ref|XP_006434582.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 gb|ESR47822.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
Length=445

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +3

Query  393  WMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVI  572
            W    +Q WKP  D    +    KS G+L +  +GGLNQQR+ ICDAVAVA +LNATLVI
Sbjct  7    WNSKVHQPWKPCADRSNSNAELPKSNGFLIIEANGGLNQQRLSICDAVAVAGLLNATLVI  66

Query  573  PYLEVNPVWQ  602
            P   +N VW+
Sbjct  67   PIFHLNSVWR  76



>ref|XP_006473173.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Citrus sinensis]
 gb|KDO83869.1| hypothetical protein CISIN_1g008308mg [Citrus sinensis]
Length=445

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +3

Query  393  WMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVI  572
            W    +Q WKP  D    +    KS G+L +  +GGLNQQR+ ICDAVAVA +LNATLVI
Sbjct  7    WNSKVHQPWKPCADRSNSNAELPKSNGFLIIEANGGLNQQRLSICDAVAVAGLLNATLVI  66

Query  573  PYLEVNPVWQ  602
            P   +N VW+
Sbjct  67   PIFHLNSVWR  76



>ref|XP_002533585.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28803.1| conserved hypothetical protein [Ricinus communis]
Length=587

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +3

Query  384  AEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNAT  563
            A+ W     +GWKP   + +      KS GYL +  +GGLNQQR+ ICDAVAVA +LNAT
Sbjct  144  AKAWDVKLLEGWKPCGSNTISEAELPKSNGYLIIEANGGLNQQRLSICDAVAVAGLLNAT  203

Query  564  LVIPYLEVNPVWQ  602
            LVIP   +N +WQ
Sbjct  204  LVIPIFHLNSIWQ  216



>ref|XP_002325978.2| hypothetical protein POPTR_0019s11020g [Populus trichocarpa]
 gb|EEF00360.2| hypothetical protein POPTR_0019s11020g [Populus trichocarpa]
Length=584

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 51/74 (69%), Gaps = 8/74 (11%)
 Frame = +3

Query  393  WMPLANQGWKPVPDSGLFSKFSE----KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNA  560
            W P   Q WKP   SG+ S +S+    +S G+L +  +GGLNQQR+ ICDAVAVA +LNA
Sbjct  151  WDPKLRQAWKP---SGI-SNYSDAELPESNGFLIIEANGGLNQQRLSICDAVAVAGLLNA  206

Query  561  TLVIPYLEVNPVWQ  602
            TLVIP+  +N VW+
Sbjct  207  TLVIPFFHLNSVWR  220



>emb|CBI19199.3| unnamed protein product [Vitis vinifera]
Length=536

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = +3

Query  387  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  566
            ++W P  N+ + P  D G       +S+GYL V  +GGLNQ R GICD VAVA+I+NATL
Sbjct  98   KLWKPPQNRDFVPCVDPGANYTSPAESQGYLLVHTNGGLNQMRAGICDMVAVARIINATL  157

Query  567  VIPYLEVNPVWQ  602
            VIP L+    WQ
Sbjct  158  VIPELDKRSFWQ  169



>ref|XP_010664349.1| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
Length=535

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = +3

Query  387  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  566
            ++W P  N+ + P  D G       +S+GYL V  +GGLNQ R GICD VAVA+I+NATL
Sbjct  98   KLWKPPQNRDFVPCVDPGANYTSPAESQGYLLVHTNGGLNQMRAGICDMVAVARIINATL  157

Query  567  VIPYLEVNPVWQ  602
            VIP L+    WQ
Sbjct  158  VIPELDKRSFWQ  169



>ref|XP_006434581.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 gb|ESR47821.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
Length=656

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +3

Query  393  WMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVI  572
            W    +Q WKP  D    +    KS G+L +  +GGLNQQR+ ICDAVAVA +LNATLVI
Sbjct  218  WNSKVHQPWKPCADRSNSNAELPKSNGFLIIEANGGLNQQRLSICDAVAVAGLLNATLVI  277

Query  573  PYLEVNPVWQ  602
            P   +N VW+
Sbjct  278  PIFHLNSVWR  287



>ref|XP_006473172.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Citrus sinensis]
Length=450

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +3

Query  393  WMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVI  572
            W    +Q WKP  D    +    KS G+L +  +GGLNQQR+ ICDAVAVA +LNATLVI
Sbjct  132  WNSKVHQPWKPCADRSNSNAELPKSNGFLIIEANGGLNQQRLSICDAVAVAGLLNATLVI  191

Query  573  PYLEVNPVWQ  602
            P   +N VW+
Sbjct  192  PIFHLNSVWR  201



>gb|KDO83867.1| hypothetical protein CISIN_1g008308mg [Citrus sinensis]
Length=523

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +3

Query  393  WMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVI  572
            W    +Q WKP  D    +    KS G+L +  +GGLNQQR+ ICDAVAVA +LNATLVI
Sbjct  132  WNSKVHQPWKPCADRSNSNAELPKSNGFLIIEANGGLNQQRLSICDAVAVAGLLNATLVI  191

Query  573  PYLEVNPVWQ  602
            P   +N VW+
Sbjct  192  PIFHLNSVWR  201



>ref|XP_004141562.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 ref|XP_004162859.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 gb|KGN52707.1| hypothetical protein Csa_5G651650 [Cucumis sativus]
Length=573

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 51/87 (59%), Gaps = 1/87 (1%)
 Frame = +3

Query  342  FKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMG  521
            F  A  R +T    +  W    +  WKP   S   ++   KS G+L +  +GGLNQQR+ 
Sbjct  127  FMEAESRNSTTHALSTAWNSKVHHVWKPCISSSTVTELP-KSNGFLIIEANGGLNQQRLS  185

Query  522  ICDAVAVAKILNATLVIPYLEVNPVWQ  602
            ICDAVAVA +LNA+LVIP   +N VW+
Sbjct  186  ICDAVAVAGLLNASLVIPIFHLNSVWR  212



>ref|XP_006473171.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Citrus sinensis]
 gb|KDO83865.1| hypothetical protein CISIN_1g008308mg [Citrus sinensis]
 gb|KDO83866.1| hypothetical protein CISIN_1g008308mg [Citrus sinensis]
Length=570

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +3

Query  393  WMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVI  572
            W    +Q WKP  D    +    KS G+L +  +GGLNQQR+ ICDAVAVA +LNATLVI
Sbjct  132  WNSKVHQPWKPCADRSNSNAELPKSNGFLIIEANGGLNQQRLSICDAVAVAGLLNATLVI  191

Query  573  PYLEVNPVWQ  602
            P   +N VW+
Sbjct  192  PIFHLNSVWR  201



>ref|XP_006434583.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 ref|XP_006434584.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 gb|ESR47823.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 gb|ESR47824.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
Length=570

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +3

Query  393  WMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVI  572
            W    +Q WKP  D    +    KS G+L +  +GGLNQQR+ ICDAVAVA +LNATLVI
Sbjct  132  WNSKVHQPWKPCADRSNSNAELPKSNGFLIIEANGGLNQQRLSICDAVAVAGLLNATLVI  191

Query  573  PYLEVNPVWQ  602
            P   +N VW+
Sbjct  192  PIFHLNSVWR  201



>gb|KDO83868.1| hypothetical protein CISIN_1g008308mg [Citrus sinensis]
Length=455

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +3

Query  393  WMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVI  572
            W    +Q WKP  D    +    KS G+L +  +GGLNQQR+ ICDAVAVA +LNATLVI
Sbjct  132  WNSKVHQPWKPCADRSNSNAELPKSNGFLIIEANGGLNQQRLSICDAVAVAGLLNATLVI  191

Query  573  PYLEVNPVWQ  602
            P   +N VW+
Sbjct  192  PIFHLNSVWR  201



>ref|XP_010680244.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=598

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 49/85 (58%), Gaps = 2/85 (2%)
 Frame = +3

Query  354  LQRETTPEEKA--EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGIC  527
            LQ E      A   +W     +GWKP  ++        KS GY  +  +GGLNQQR+ IC
Sbjct  145  LQDEANHSTNALTTVWPTRYQRGWKPCINNSAVETELPKSNGYFIIEANGGLNQQRLSIC  204

Query  528  DAVAVAKILNATLVIPYLEVNPVWQ  602
            DAVAVA +LNATLVIP   +N VW+
Sbjct  205  DAVAVAGLLNATLVIPIFHLNSVWR  229



>ref|XP_010680324.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=596

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 49/85 (58%), Gaps = 2/85 (2%)
 Frame = +3

Query  354  LQRETTPEEKA--EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGIC  527
            LQ E      A   +W     +GWKP  ++        KS GY  +  +GGLNQQR+ IC
Sbjct  145  LQDEANHSTNALTTVWPTRYQRGWKPCINNSAVETELPKSNGYFIIEANGGLNQQRLSIC  204

Query  528  DAVAVAKILNATLVIPYLEVNPVWQ  602
            DAVAVA +LNATLVIP   +N VW+
Sbjct  205  DAVAVAGLLNATLVIPIFHLNSVWR  229



>ref|XP_010061980.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Eucalyptus 
grandis]
Length=454

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 47/73 (64%), Gaps = 3/73 (4%)
 Frame = +3

Query  393  WMPLANQGWKPVPD---SGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNAT  563
            W P  +Q WKP      S + SK   +S G+L +  +GGLNQQR+ ICD VAVA +LNAT
Sbjct  129  WSPTLHQSWKPCGSMTISQIGSKQLPESNGFLIIEANGGLNQQRLSICDVVAVAGLLNAT  188

Query  564  LVIPYLEVNPVWQ  602
            LVIP   +N VWQ
Sbjct  189  LVIPIFHLNSVWQ  201



>ref|XP_010930789.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910-like 
[Elaeis guineensis]
Length=553

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +3

Query  393  WMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVI  572
            W   A+Q WKP  +  L       S GYL +  +GGLNQQR+ ICDAVAVA +LNATLVI
Sbjct  127  WHQKASQRWKPCVNKRLSHAELPLSNGYLIIEANGGLNQQRLSICDAVAVAGLLNATLVI  186

Query  573  PYLEVNPVWQ  602
            P   +N VW+
Sbjct  187  PIFHLNSVWR  196



>gb|KHN26223.1| DUF246 domain-containing protein [Glycine soja]
Length=509

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 65/103 (63%), Gaps = 9/103 (9%)
 Frame = +3

Query  303  SESIIAKPR---HSSLFKSALQRETTPEEKAEIWM-PLANQGWKPVPDSGLFSKFSEKSE  470
            ++ ++++ R    +S+ K  L+R TTPE    IWM P +++ +K V       +  +K+ 
Sbjct  44   AQRVVSEARTGTETSMPKRVLERLTTPE----IWMKPNSDKYYKCVSRPRNVIRL-KKTN  98

Query  471  GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVW  599
            GYL V  +GGLNQ R GICD VAVAKI+NATLV+P L+ +  W
Sbjct  99   GYLLVHANGGLNQMRTGICDMVAVAKIMNATLVLPSLDHDSFW  141



>ref|XP_003516326.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
Length=639

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 65/103 (63%), Gaps = 9/103 (9%)
 Frame = +3

Query  303  SESIIAKPR---HSSLFKSALQRETTPEEKAEIWM-PLANQGWKPVPDSGLFSKFSEKSE  470
            ++ ++++ R    +S+ K  L+R TTPE    IWM P +++ +K V       +  +K+ 
Sbjct  174  AQRVVSEARTGTETSMPKRVLERLTTPE----IWMKPNSDKYYKCVSRPRNVIRL-KKTN  228

Query  471  GYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVW  599
            GYL V  +GGLNQ R GICD VAVAKI+NATLV+P L+ +  W
Sbjct  229  GYLLVHANGGLNQMRTGICDMVAVAKIMNATLVLPSLDHDSFW  271



>ref|XP_002891187.1| hypothetical protein ARALYDRAFT_473680 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67446.1| hypothetical protein ARALYDRAFT_473680 [Arabidopsis lyrata subsp. 
lyrata]
Length=569

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = +3

Query  387  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  566
            E+W P     WKP   + + S     S GY  +  +GGLNQQR+ ICDAVAVA +LNATL
Sbjct  135  EVWKPRVKSIWKPCISTNV-SAAGSNSNGYFIIEANGGLNQQRLSICDAVAVAGLLNATL  193

Query  567  VIPYLEVNPVWQ  602
            VIP   +N VW+
Sbjct  194  VIPIFHLNSVWR  205



>ref|XP_004499554.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Cicer arietinum]
Length=508

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +3

Query  393  WMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVI  572
            W    ++ WKP  +  L      KS GYL +  +GGLNQQR+ ICDAVAVA +LNATLVI
Sbjct  114  WNVKEDRHWKPCANKTLSQIELPKSNGYLIIEANGGLNQQRLSICDAVAVAGLLNATLVI  173

Query  573  PYLEVNPVWQ  602
            P   +N VW+
Sbjct  174  PIFHLNSVWR  183



>gb|KCW69027.1| hypothetical protein EUGRSUZ_F02582 [Eucalyptus grandis]
Length=524

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 47/73 (64%), Gaps = 3/73 (4%)
 Frame = +3

Query  393  WMPLANQGWKPVPD---SGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNAT  563
            W P  +Q WKP      S + SK   +S G+L +  +GGLNQQR+ ICD VAVA +LNAT
Sbjct  129  WSPTLHQSWKPCGSMTISQIGSKQLPESNGFLIIEANGGLNQQRLSICDVVAVAGLLNAT  188

Query  564  LVIPYLEVNPVWQ  602
            LVIP   +N VWQ
Sbjct  189  LVIPIFHLNSVWQ  201



>ref|XP_010061979.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Eucalyptus 
grandis]
 gb|KCW69026.1| hypothetical protein EUGRSUZ_F02582 [Eucalyptus grandis]
Length=562

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 47/73 (64%), Gaps = 3/73 (4%)
 Frame = +3

Query  393  WMPLANQGWKPVPD---SGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNAT  563
            W P  +Q WKP      S + SK   +S G+L +  +GGLNQQR+ ICD VAVA +LNAT
Sbjct  129  WSPTLHQSWKPCGSMTISQIGSKQLPESNGFLIIEANGGLNQQRLSICDVVAVAGLLNAT  188

Query  564  LVIPYLEVNPVWQ  602
            LVIP   +N VWQ
Sbjct  189  LVIPIFHLNSVWQ  201



>ref|XP_004499553.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Cicer arietinum]
Length=553

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +3

Query  393  WMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVI  572
            W    ++ WKP  +  L      KS GYL +  +GGLNQQR+ ICDAVAVA +LNATLVI
Sbjct  114  WNVKEDRHWKPCANKTLSQIELPKSNGYLIIEANGGLNQQRLSICDAVAVAGLLNATLVI  173

Query  573  PYLEVNPVWQ  602
            P   +N VW+
Sbjct  174  PIFHLNSVWR  183



>ref|XP_007020036.1| O-fucosyltransferase family protein isoform 2 [Theobroma cacao]
 gb|EOY17261.1| O-fucosyltransferase family protein isoform 2 [Theobroma cacao]
Length=525

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 51/74 (69%), Gaps = 5/74 (7%)
 Frame = +3

Query  393  WMPLANQGWKPVPDSGLFSK--FSE--KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNA  560
            W    +QGWKP   S + S+  FSE  KS G+L +  +GGLNQQR+ ICDAVAVA +LNA
Sbjct  139  WNLKMHQGWKPCASS-IISRTGFSELPKSNGFLIIEANGGLNQQRLSICDAVAVAWLLNA  197

Query  561  TLVIPYLEVNPVWQ  602
            TL+IP   +N VW+
Sbjct  198  TLLIPIFHLNSVWR  211



>gb|EPS61677.1| hypothetical protein M569_13117, partial [Genlisea aurea]
Length=421

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 48/73 (66%), Gaps = 2/73 (3%)
 Frame = +3

Query  390  IWMPLANQGWKPVPDSGLFSKFSE--KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNAT  563
            +W P  ++ WKP  D  L    ++   S GYL +  +GGLNQQR+ ICDAVAVA +LNAT
Sbjct  104  VWSPKLHKEWKPSIDQSLPPVDTDFPTSNGYLIIEANGGLNQQRLSICDAVAVAGLLNAT  163

Query  564  LVIPYLEVNPVWQ  602
            LV+P   +N VW+
Sbjct  164  LVVPIFHLNSVWR  176



>ref|XP_007020035.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOY17260.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
Length=588

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 51/74 (69%), Gaps = 5/74 (7%)
 Frame = +3

Query  393  WMPLANQGWKPVPDSGLFSK--FSE--KSEGYLQVFLDGGLNQQRMGICDAVAVAKILNA  560
            W    +QGWKP   S + S+  FSE  KS G+L +  +GGLNQQR+ ICDAVAVA +LNA
Sbjct  139  WNLKMHQGWKPCASS-IISRTGFSELPKSNGFLIIEANGGLNQQRLSICDAVAVAWLLNA  197

Query  561  TLVIPYLEVNPVWQ  602
            TL+IP   +N VW+
Sbjct  198  TLLIPIFHLNSVWR  211



>gb|AES98123.2| auxin-independent growth promoter-like protein [Medicago truncatula]
Length=525

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 50/88 (57%), Gaps = 0/88 (0%)
 Frame = +3

Query  339  LFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRM  518
            L  S L R     +  ++W P +N+G+ P            +S GYL V  +GGLNQ R 
Sbjct  69   LSTSKLNRLRGDSDYVKLWKPPSNRGFLPCTKPTPNYTAPAESRGYLLVHTNGGLNQMRS  128

Query  519  GICDAVAVAKILNATLVIPYLEVNPVWQ  602
            GICD VAVA+I+NATLVIP L+    WQ
Sbjct  129  GICDMVAVARIINATLVIPELDKRSFWQ  156



>tpg|DAA38994.1| TPA: hypothetical protein ZEAMMB73_412482 [Zea mays]
Length=293

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +3

Query  417  WKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPV  596
            W+P    GL       S G+L V  +GGLNQQR+ ICDA+AVAKILNATLV P   +N V
Sbjct  163  WEPCISKGLIHSELPPSNGFLIVEANGGLNQQRISICDAIAVAKILNATLVTPAFHLNSV  222

Query  597  WQ  602
            W+
Sbjct  223  WR  224



>ref|XP_008781543.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Phoenix dactylifera]
Length=423

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +3

Query  393  WMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVI  572
            W   A+Q WKP  +  L       S G+L +  +GGLNQQR+ ICDAVAVA +LNATLVI
Sbjct  123  WHQKASQRWKPCLNKRLSHAELPPSNGFLIIEANGGLNQQRLSICDAVAVAGLLNATLVI  182

Query  573  PYLEVNPVWQ  602
            P   +N VW+
Sbjct  183  PMFHLNSVWR  192



>ref|XP_003602836.1| DUF246 domain-containing protein [Medicago truncatula]
 gb|AES73087.1| auxin-independent growth promoter-like protein [Medicago truncatula]
Length=545

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = +3

Query  387  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  566
            ++W P  N G+ P           E S+GYL V  +GGLNQ R GICD VA+A+I+NATL
Sbjct  114  KLWKPPPNHGFLPCTKPTPNYTTPENSQGYLLVHTNGGLNQMRAGICDMVAIARIINATL  173

Query  567  VIPYLEVNPVWQ  602
            VIP L+    WQ
Sbjct  174  VIPELDKKSFWQ  185



>ref|XP_008781542.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Phoenix dactylifera]
Length=461

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +3

Query  393  WMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVI  572
            W   A+Q WKP  +  L       S G+L +  +GGLNQQR+ ICDAVAVA +LNATLVI
Sbjct  123  WHQKASQRWKPCLNKRLSHAELPPSNGFLIIEANGGLNQQRLSICDAVAVAGLLNATLVI  182

Query  573  PYLEVNPVWQ  602
            P   +N VW+
Sbjct  183  PMFHLNSVWR  192



>ref|XP_004152623.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 ref|XP_004162223.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
Length=534

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = +3

Query  387  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  566
            ++W P +N+ + P  D  +      +S GYL V  +GGLNQ R GICD VAVA+I+NATL
Sbjct  97   KLWKPPSNRDFLPCVDPSVNYTAPMESRGYLLVHTNGGLNQMRAGICDMVAVARIINATL  156

Query  567  VIPYLEVNPVWQ  602
            VIP L+    WQ
Sbjct  157  VIPELDKQSFWQ  168



>ref|XP_003615165.1| DUF246 domain-containing protein [Medicago truncatula]
Length=552

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 50/88 (57%), Gaps = 0/88 (0%)
 Frame = +3

Query  339  LFKSALQRETTPEEKAEIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRM  518
            L  S L R     +  ++W P +N+G+ P            +S GYL V  +GGLNQ R 
Sbjct  69   LSTSKLNRLRGDSDYVKLWKPPSNRGFLPCTKPTPNYTAPAESRGYLLVHTNGGLNQMRS  128

Query  519  GICDAVAVAKILNATLVIPYLEVNPVWQ  602
            GICD VAVA+I+NATLVIP L+    WQ
Sbjct  129  GICDMVAVARIINATLVIPELDKRSFWQ  156



>ref|XP_009618695.1| PREDICTED: uncharacterized protein LOC104110842 [Nicotiana tomentosiformis]
Length=168

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +3

Query  387  EIWMPLANQGWKP-VPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNAT  563
            ++W P  N+ + P V  S +++   E S GYL V  +GGLNQ R GICD VAVA+I+NAT
Sbjct  94   KLWKPPPNRDYVPCVALSPIYTSPPE-SRGYLLVHTNGGLNQMRAGICDMVAVARIINAT  152

Query  564  LVIPYLEVNPVWQ  602
            LVIP L+   +WQ
Sbjct  153  LVIPELDKRSLWQ  165



>ref|XP_003544811.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
 ref|XP_006596351.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
 ref|XP_006596352.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Glycine max]
Length=525

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +3

Query  387  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  566
            ++W P +N+G+ P  +         +S+GYL V  +GGLNQ R GICD VAVA+I+NATL
Sbjct  87   KLWKPPSNRGFLPCTNPTPNYNTPAESQGYLLVHTNGGLNQMRSGICDMVAVARIINATL  146

Query  567  VIPYLEVNPVWQ  602
            VIP L+    WQ
Sbjct  147  VIPELDKRSFWQ  158



>ref|XP_010319880.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Solanum 
lycopersicum]
Length=568

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = +3

Query  387  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  566
             +W    +Q WKP     +  +   KS GYL +  +GGLNQQR+ ICDAVAVA +LNATL
Sbjct  129  NVWNLKLHQVWKPCIAHTVSQEELPKSNGYLIIEANGGLNQQRLSICDAVAVAGLLNATL  188

Query  567  VIPYLEVNPVWQ  602
            VIP   +N VW+
Sbjct  189  VIPIFHLNSVWR  200



>ref|XP_010538926.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=571

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +3

Query  393  WMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVI  572
            W P A   WKP  ++ + S     S G+  +  +GGLNQQR+ ICDAVAVA +LNATLVI
Sbjct  142  WYPRAKNVWKPCINTNV-SAAGSNSNGFFIIEANGGLNQQRLSICDAVAVAGLLNATLVI  200

Query  573  PYLEVNPVWQ  602
            P   +N VW+
Sbjct  201  PIFHLNSVWR  210



>ref|XP_003598018.1| DUF246 domain-containing protein [Medicago truncatula]
 gb|AES68269.1| O-fucosyltransferase family protein [Medicago truncatula]
Length=577

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +3

Query  393  WMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVI  572
            W    ++ WKP  +  L      KS GYL +  +GGLNQQR+ ICDAVAVA +LNATLVI
Sbjct  123  WTVKEDRQWKPCANKTLPQIEFPKSNGYLIIEANGGLNQQRLSICDAVAVAGLLNATLVI  182

Query  573  PYLEVNPVWQ  602
            P   +N VW+
Sbjct  183  PIFHLNSVWR  192



>ref|XP_007207136.1| hypothetical protein PRUPE_ppa002471mg [Prunus persica]
 gb|EMJ08335.1| hypothetical protein PRUPE_ppa002471mg [Prunus persica]
Length=669

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 58/102 (57%), Gaps = 5/102 (5%)
 Frame = +3

Query  297  ILSESIIAKPRHSSLFKSALQRETTPEEKAEIWM-PLANQGWKPVPDSGLFSKFSEKSEG  473
            +L    +++   S++FK  L+R  TPE    IW  P ++   K +       +   K+ G
Sbjct  203  VLERERLSESEPSTMFKRLLERSPTPE----IWRKPNSDNFDKCIARPKNRIRTGSKTNG  258

Query  474  YLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVW  599
            YL V  +GGLNQ R GICD VAVAKI+NATLV+P L+    W
Sbjct  259  YLLVHANGGLNQMRTGICDMVAVAKIMNATLVLPLLDHQSFW  300



>gb|KHN35489.1| DUF246 domain-containing protein [Glycine soja]
Length=525

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +3

Query  387  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  566
            ++W P +N+G+ P  +         +S+GYL V  +GGLNQ R GICD VAVA+I+NATL
Sbjct  87   KLWKPPSNRGFLPCTNPTPNYTTPAESQGYLLVHTNGGLNQMRSGICDMVAVARIINATL  146

Query  567  VIPYLEVNPVWQ  602
            VIP L+    WQ
Sbjct  147  VIPELDKRSFWQ  158



>gb|AAK93632.1| putative growth regulator protein [Arabidopsis thaliana]
Length=568

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +3

Query  387  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  566
            E W P     WKP   + + S     S GY  +  +GGLNQQR+ ICDAVAVA +LNATL
Sbjct  134  EAWKPRVKSVWKPCISTNV-SAAGSNSNGYFIIEANGGLNQQRLSICDAVAVAGLLNATL  192

Query  567  VIPYLEVNPVWQ  602
            VIP   +N VW+
Sbjct  193  VIPIFHLNSVWR  204



>ref|NP_564461.1| O-fucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAN12984.1| putative growth regulator [Arabidopsis thaliana]
 gb|AEE31802.1| O-fucosyltransferase-like protein [Arabidopsis thaliana]
Length=568

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +3

Query  387  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  566
            E W P     WKP   + + S     S GY  +  +GGLNQQR+ ICDAVAVA +LNATL
Sbjct  134  EAWKPRVKSVWKPCISTNV-SAAGSNSNGYFIIEANGGLNQQRLSICDAVAVAGLLNATL  192

Query  567  VIPYLEVNPVWQ  602
            VIP   +N VW+
Sbjct  193  VIPIFHLNSVWR  204



>gb|AAF79365.1|AC007887_24 F15O4.45 [Arabidopsis thaliana]
Length=668

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +3

Query  387  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  566
            E W P     WKP   + + S     S GY  +  +GGLNQQR+ ICDAVAVA +LNATL
Sbjct  154  EAWKPRVKSVWKPCISTNV-SAAGSNSNGYFIIEANGGLNQQRLSICDAVAVAGLLNATL  212

Query  567  VIPYLEVNPVWQ  602
            VIP   +N VW+
Sbjct  213  VIPIFHLNSVWR  224



>gb|KHM98943.1| DUF246 domain-containing protein [Glycine soja]
Length=508

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 68/107 (64%), Gaps = 13/107 (12%)
 Frame = +3

Query  297  ILSESIIAKPR---HSSLFKSALQRETTPEEKAEIWM-PLANQGWKPV--PDSGLFSKFS  458
            + ++ ++++ R    +S+ K  L+R TTPE    IWM P +++ +K V  P + +  K  
Sbjct  42   VSAQRVVSESRTRTETSMPKRVLERLTTPE----IWMKPNSDKYYKCVSPPRNVIRPK--  95

Query  459  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVW  599
             ++ GYL V  +GGLNQ R GICD VAVAKI+NATLV+P L+ +  W
Sbjct  96   -QTNGYLLVHANGGLNQMRTGICDMVAVAKIMNATLVLPSLDHDSFW  141



>ref|XP_009362464.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Pyrus x bretschneideri]
Length=442

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  390  IWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLV  569
            +W     Q WKP   + + ++   KS G+  +  +GGLNQQR+ ICDAVAVA +LNATL+
Sbjct  9    VWNSKVRQVWKPCISNNISNEGLPKSNGFFIIEANGGLNQQRLSICDAVAVAGLLNATLL  68

Query  570  IPYLEVNPVWQ  602
            IP   +N VW+
Sbjct  69   IPIFHLNSVWK  79



>ref|XP_004490384.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Cicer arietinum]
Length=524

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = +3

Query  387  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  566
            ++W P +N+G+ P            +S GYL V  +GGLNQ R GICD VAVA+ILNATL
Sbjct  87   KLWKPPSNRGFLPCTKPTPNYTAPAESRGYLLVHTNGGLNQMRSGICDMVAVARILNATL  146

Query  567  VIPYLEVNPVWQ  602
            VIP L+    WQ
Sbjct  147  VIPELDKRSFWQ  158



>ref|XP_004490385.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Cicer arietinum]
Length=451

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = +3

Query  387  EIWMPLANQGWKPVPDSGLFSKFSEKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATL  566
            ++W P +N+G+ P            +S GYL V  +GGLNQ R GICD VAVA+ILNATL
Sbjct  14   KLWKPPSNRGFLPCTKPTPNYTAPAESRGYLLVHTNGGLNQMRSGICDMVAVARILNATL  73

Query  567  VIPYLEVNPVWQ  602
            VIP L+    WQ
Sbjct  74   VIPELDKRSFWQ  85



>ref|XP_006576578.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=637

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 68/107 (64%), Gaps = 13/107 (12%)
 Frame = +3

Query  297  ILSESIIAKPR---HSSLFKSALQRETTPEEKAEIWM-PLANQGWKPV--PDSGLFSKFS  458
            + ++ ++++ R    +S+ K  L+R TTPE    IWM P +++ +K V  P + +  K  
Sbjct  171  VSAQRVVSESRTRTETSMPKRVLERLTTPE----IWMKPNSDKYYKCVSPPRNVIRPK--  224

Query  459  EKSEGYLQVFLDGGLNQQRMGICDAVAVAKILNATLVIPYLEVNPVW  599
             ++ GYL V  +GGLNQ R GICD VAVAKI+NATLV+P L+ +  W
Sbjct  225  -QTNGYLLVHANGGLNQMRTGICDMVAVAKIMNATLVLPSLDHDSFW  270



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370