BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF009E15

Length=543
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006348142.1|  PREDICTED: aspartic proteinase-like              53.9    1e-05   Solanum tuberosum [potatoes]
ref|XP_004232695.1|  PREDICTED: aspartic proteinase                   53.9    2e-05   Solanum lycopersicum
ref|XP_004231616.1|  PREDICTED: aspartic proteinase                   50.8    2e-04   Solanum lycopersicum
ref|XP_006350474.1|  PREDICTED: aspartic proteinase-like              50.1    3e-04   Solanum tuberosum [potatoes]
ref|XP_006383885.1|  hypothetical protein POPTR_0004s00900g           50.1    4e-04   
emb|CDP04424.1|  unnamed protein product                              49.7    4e-04   Coffea canephora [robusta coffee]
ref|XP_006467404.1|  PREDICTED: aspartic proteinase-like isoform X1   49.3    6e-04   
ref|XP_009629448.1|  PREDICTED: aspartic proteinase-like              48.9    8e-04   Nicotiana tomentosiformis



>ref|XP_006348142.1| PREDICTED: aspartic proteinase-like [Solanum tuberosum]
Length=511

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  400  MGVKAlvvtlflsslvfplAFSKSNDGFVRIGLKKMKIDKNNRIAARL  543
            MGVKA +VT FLS+L+FPLAFS SNDG VRIGLKK+K D+NNR+AARL
Sbjct  1    MGVKAFLVTFFLSTLLFPLAFSTSNDGLVRIGLKKIKYDQNNRLAARL  48



>ref|XP_004232695.1| PREDICTED: aspartic proteinase [Solanum lycopersicum]
 ref|XP_010316578.1| PREDICTED: aspartic proteinase [Solanum lycopersicum]
Length=511

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  400  MGVKAlvvtlflsslvfplAFSKSNDGFVRIGLKKMKIDKNNRIAARL  543
            MGVKA +V  FLS+L+FPLAFS SNDG VRIGLKK+K D+NNR+AARL
Sbjct  1    MGVKAFLVAFFLSTLLFPLAFSTSNDGLVRIGLKKIKYDQNNRLAARL  48



>ref|XP_004231616.1| PREDICTED: aspartic proteinase [Solanum lycopersicum]
Length=510

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARL  543
            S SNDGFVRIGLKKMK D+NNR+AARL
Sbjct  21   SSSNDGFVRIGLKKMKFDQNNRLAARL  47



>ref|XP_006350474.1| PREDICTED: aspartic proteinase-like [Solanum tuberosum]
Length=510

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARL  543
            S SNDGFVRIGLKKMK D NNR+AARL
Sbjct  21   SSSNDGFVRIGLKKMKFDHNNRLAARL  47



>ref|XP_006383885.1| hypothetical protein POPTR_0004s00900g [Populus trichocarpa]
 gb|ERP61682.1| hypothetical protein POPTR_0004s00900g [Populus trichocarpa]
Length=552

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARL  543
            S SNDG +RIGLKK+K+DKNNRIAARL
Sbjct  64   SASNDGLLRIGLKKVKLDKNNRIAARL  90



>emb|CDP04424.1| unnamed protein product [Coffea canephora]
Length=513

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARL  543
            AFS SNDG VRIGLKK+K D+NNR+A+RL
Sbjct  22   AFSSSNDGLVRIGLKKIKFDQNNRLASRL  50



>ref|XP_006467404.1| PREDICTED: aspartic proteinase-like isoform X1 [Citrus sinensis]
Length=598

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARL  543
            S SNDG VRIGLKKMK+D NNR+AARL
Sbjct  108  SVSNDGLVRIGLKKMKLDPNNRLAARL  134



>ref|XP_009629448.1| PREDICTED: aspartic proteinase-like [Nicotiana tomentosiformis]
Length=512

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  400  MGVKAlvvtlflsslvfplAFSKSNDGFVRIGLKKMKIDKNNRIAARL  543
            MG KA +VT+ LSSL+FPLA S SNDG VRIGLKK+K D+NNR+AAR+
Sbjct  1    MGAKAFLVTILLSSLLFPLALSTSNDGLVRIGLKKIKFDQNNRLAARV  48



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490