BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF009E06

Length=537
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009781211.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    191   5e-56   Nicotiana sylvestris
ref|XP_010318075.1|  PREDICTED: LOW QUALITY PROTEIN: 7-deoxylogan...    178   6e-50   
ref|XP_006361974.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       174   5e-49   
ref|XP_004235055.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    176   5e-49   Solanum lycopersicum
emb|CDP05607.1|  unnamed protein product                                157   1e-41   Coffea canephora [robusta coffee]
ref|XP_006361975.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       155   2e-41   
emb|CDP05611.1|  unnamed protein product                                152   5e-40   Coffea canephora [robusta coffee]
ref|XP_010262684.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    142   2e-36   Nelumbo nucifera [Indian lotus]
ref|XP_009597174.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    141   3e-36   Nicotiana tomentosiformis
ref|XP_010277669.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    140   7e-36   Nelumbo nucifera [Indian lotus]
emb|CAN68538.1|  hypothetical protein VITISV_039646                     138   3e-35   Vitis vinifera
gb|AGX93071.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    138   5e-35   Vinca minor [common periwinkle]
emb|CBI31575.3|  unnamed protein product                                137   8e-35   Vitis vinifera
ref|XP_002276823.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    137   9e-35   Vitis vinifera
ref|XP_010658496.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    136   2e-34   
ref|XP_010262685.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    135   7e-34   Nelumbo nucifera [Indian lotus]
gb|AGX93067.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    134   1e-33   Cinchona calisaya [quinine]
ref|XP_002276617.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    134   1e-33   
ref|XP_002276771.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    134   2e-33   Vitis vinifera
gb|AIE12477.1|  UGT4                                                    133   3e-33   Panax ginseng [Asiatic ginseng]
gb|AGX93066.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    133   3e-33   Lonicera japonica [Japanese honeysuckle]
ref|XP_007009131.1|  UDP-glucosyltransferase family 1 protein           133   3e-33   
ref|XP_009597175.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    131   1e-32   Nicotiana tomentosiformis
gb|KDO69251.1|  hypothetical protein CISIN_1g011832mg                   131   1e-32   Citrus sinensis [apfelsine]
ref|XP_007009133.1|  UDP-glucosyltransferase family 1 protein           130   2e-32   Theobroma cacao [chocolate]
ref|XP_011038346.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    130   2e-32   Populus euphratica
gb|AIS39472.1|  flavonoid UDP-glucosyltransferase 3                     130   3e-32   Citrus x paradisi [grapefruit]
ref|XP_002280470.2|  PREDICTED: LOW QUALITY PROTEIN: 7-deoxylogan...    130   3e-32   Vitis vinifera
ref|XP_006486448.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       130   3e-32   Citrus sinensis [apfelsine]
ref|XP_006435571.1|  hypothetical protein CICLE_v10031408mg             130   3e-32   Citrus clementina [clementine]
ref|XP_009802463.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    130   4e-32   Nicotiana sylvestris
gb|AGX93069.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    129   5e-32   Rauvolfia serpentina [devilpepper]
ref|XP_002281029.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    129   1e-31   Vitis vinifera
ref|XP_006435573.1|  hypothetical protein CICLE_v10031368mg             127   2e-31   Citrus clementina [clementine]
gb|ACS87994.1|  UDP-glucosyltransferase family 1 protein                127   2e-31   Citrus sinensis [apfelsine]
ref|XP_002280624.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    127   5e-31   Vitis vinifera
emb|CDP04614.1|  unnamed protein product                                127   5e-31   Coffea canephora [robusta coffee]
gb|KDP44850.1|  hypothetical protein JCGZ_01350                         126   6e-31   Jatropha curcas
ref|XP_006379615.1|  hypothetical protein POPTR_0008s06270g             125   1e-30   Populus trichocarpa [western balsam poplar]
dbj|BAP90373.1|  UDP-glycose: glycosyltransferase UGT709H1              125   2e-30   Fagopyrum esculentum
ref|XP_009608691.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    124   4e-30   Nicotiana tomentosiformis
gb|AFJ53009.1|  UDP-glycosyltransferase 1                               124   4e-30   Linum usitatissimum
ref|XP_002280528.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    124   6e-30   Vitis vinifera
ref|XP_007009137.1|  UDP-glucosyltransferase family 1 protein, pu...    123   8e-30   
gb|AGX93072.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    123   9e-30   Catharanthus longifolius
sp|U3U992.1|UGT8_CATRO  RecName: Full=7-deoxyloganetic acid gluco...    123   9e-30   Catharanthus roseus [chatas]
gb|AFJ53010.1|  UDP-glycosyltransferase 1                               123   9e-30   Linum usitatissimum
gb|AGX93065.1|  7-deoxyloganetic acid UDP-glucosyltransferase           123   9e-30   Catharanthus roseus [chatas]
gb|AGX93068.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    122   2e-29   Amsonia hubrichtii
ref|XP_008811497.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       121   6e-29   Phoenix dactylifera
emb|CDP16024.1|  unnamed protein product                                119   2e-28   Coffea canephora [robusta coffee]
emb|CBI36709.3|  unnamed protein product                                119   3e-28   Vitis vinifera
ref|XP_010650608.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    119   3e-28   Vitis vinifera
ref|XP_010650643.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    118   5e-28   Vitis vinifera
ref|XP_004149949.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       117   9e-28   Cucumis sativus [cucumbers]
ref|XP_004171873.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       117   1e-27   
emb|CDP19645.1|  unnamed protein product                                115   1e-27   Coffea canephora [robusta coffee]
emb|CAN77812.1|  hypothetical protein VITISV_010344                     117   3e-27   Vitis vinifera
ref|XP_010923186.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    116   3e-27   Elaeis guineensis
gb|AGX93070.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    116   3e-27   Tabernaemontana elegans
ref|XP_009613526.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    116   4e-27   Nicotiana tomentosiformis
ref|XP_009795416.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    115   5e-27   Nicotiana sylvestris
gb|EYU19962.1|  hypothetical protein MIMGU_mgv1a005720mg                115   9e-27   Erythranthe guttata [common monkey flower]
ref|XP_011076758.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    114   1e-26   Sesamum indicum [beniseed]
ref|XP_010923185.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    114   1e-26   Elaeis guineensis
ref|XP_006850413.1|  hypothetical protein AMTR_s00165p00028990          111   1e-26   
ref|XP_009590620.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    114   1e-26   Nicotiana tomentosiformis
gb|KHN04919.1|  UDP-glycosyltransferase 85A3                            114   3e-26   Glycine soja [wild soybean]
ref|XP_004235101.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    113   3e-26   Solanum lycopersicum
ref|XP_010032068.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    113   3e-26   Eucalyptus grandis [rose gum]
ref|XP_011100060.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    113   4e-26   Sesamum indicum [beniseed]
gb|EYU19961.1|  hypothetical protein MIMGU_mgv1a005050mg                113   4e-26   Erythranthe guttata [common monkey flower]
dbj|BAK55741.1|  UDP-glucose glucosyltransferase                        113   4e-26   Gardenia jasminoides
ref|XP_010905381.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    112   5e-26   
ref|XP_002276555.2|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    112   1e-25   
emb|CBI31566.3|  unnamed protein product                                112   1e-25   Vitis vinifera
gb|EYU19963.1|  hypothetical protein MIMGU_mgv1a005336mg                112   1e-25   Erythranthe guttata [common monkey flower]
ref|XP_006435572.1|  hypothetical protein CICLE_v10031404mg             111   1e-25   Citrus clementina [clementine]
ref|XP_008464643.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       112   1e-25   
gb|KDO69253.1|  hypothetical protein CISIN_1g011848mg                   111   1e-25   Citrus sinensis [apfelsine]
ref|XP_004239922.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    111   2e-25   Solanum lycopersicum
ref|XP_003517692.2|  PREDICTED: UDP-glycosyltransferase 85A3-like       111   2e-25   Glycine max [soybeans]
ref|XP_006355163.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       111   2e-25   Solanum tuberosum [potatoes]
emb|CDP19644.1|  unnamed protein product                                111   2e-25   Coffea canephora [robusta coffee]
ref|XP_007009132.1|  UDP-glucosyltransferase family 1 protein           111   2e-25   
gb|KHG01935.1|  UDP-glycosyltransferase 85A1                            113   2e-25   Gossypium arboreum [tree cotton]
gb|KHG01936.1|  UDP-glycosyltransferase 85A1                            113   2e-25   Gossypium arboreum [tree cotton]
ref|XP_006367216.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       110   3e-25   Solanum tuberosum [potatoes]
gb|AFJ53008.1|  UDP-glycosyltransferase 1                               110   5e-25   Linum usitatissimum
gb|KJB74149.1|  hypothetical protein B456_011G275600                    109   7e-25   Gossypium raimondii
ref|XP_010674287.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    109   8e-25   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB74138.1|  hypothetical protein B456_011G275100                    109   1e-24   Gossypium raimondii
gb|KJB74139.1|  hypothetical protein B456_011G275100                    109   1e-24   Gossypium raimondii
dbj|BAK55740.1|  UDP-glucose glucosyltransferase                        108   2e-24   Gardenia jasminoides
ref|XP_011084983.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    108   2e-24   Sesamum indicum [beniseed]
ref|XP_006367215.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       108   2e-24   Solanum tuberosum [potatoes]
ref|XP_009804549.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    108   2e-24   Nicotiana sylvestris
ref|XP_010032069.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    108   2e-24   Eucalyptus grandis [rose gum]
ref|XP_004150246.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       107   3e-24   Cucumis sativus [cucumbers]
ref|XP_009589440.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    107   4e-24   Nicotiana tomentosiformis
gb|EPS60746.1|  hypothetical protein M569_14056                         107   5e-24   Genlisea aurea
ref|XP_007158359.1|  hypothetical protein PHAVU_002G146200g             107   5e-24   Phaseolus vulgaris [French bean]
ref|XP_003613025.1|  UDP-glucuronosyltransferase 1-1                    107   5e-24   Medicago truncatula
ref|XP_006355679.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       107   6e-24   Solanum tuberosum [potatoes]
ref|XP_006362115.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       107   8e-24   Solanum tuberosum [potatoes]
ref|XP_003517688.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       106   8e-24   Glycine max [soybeans]
ref|XP_009800319.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    106   1e-23   Nicotiana sylvestris
ref|XP_008359771.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       106   1e-23   
ref|XP_008388093.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       106   2e-23   
ref|NP_001148991.1|  cytokinin-O-glucosyltransferase 2                  105   2e-23   
gb|KHG08953.1|  hypothetical protein F383_15475                         105   2e-23   Gossypium arboreum [tree cotton]
emb|CDP19643.1|  unnamed protein product                                105   2e-23   Coffea canephora [robusta coffee]
gb|ACF88457.1|  unknown                                                 105   2e-23   Zea mays [maize]
ref|XP_007158356.1|  hypothetical protein PHAVU_002G145900g             105   2e-23   Phaseolus vulgaris [French bean]
gb|KJB74137.1|  hypothetical protein B456_011G275000                    105   3e-23   Gossypium raimondii
ref|XP_003613028.1|  Cis-zeatin O-glucosyltransferase                   105   3e-23   Medicago truncatula
gb|EAZ03904.1|  hypothetical protein OsI_26038                          105   3e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_008785470.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       105   3e-23   Phoenix dactylifera
ref|XP_010318076.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    105   3e-23   Solanum lycopersicum
ref|XP_008353149.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       105   4e-23   
ref|XP_011084985.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    105   4e-23   Sesamum indicum [beniseed]
gb|ACU19718.1|  unknown                                                 102   5e-23   Glycine max [soybeans]
ref|XP_008388092.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       104   5e-23   
gb|KJB74141.1|  hypothetical protein B456_011G2752001                   103   5e-23   Gossypium raimondii
ref|XP_008785471.1|  PREDICTED: UDP-glycosyltransferase 85A4-like       104   5e-23   Phoenix dactylifera
ref|XP_007158358.1|  hypothetical protein PHAVU_002G146100g             104   5e-23   Phaseolus vulgaris [French bean]
ref|XP_006355680.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       103   9e-23   Solanum tuberosum [potatoes]
ref|XP_011084978.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    103   1e-22   Sesamum indicum [beniseed]
ref|XP_003542333.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       103   1e-22   Glycine max [soybeans]
gb|KJB76813.1|  hypothetical protein B456_012G109200                    103   2e-22   Gossypium raimondii
gb|KDO61155.1|  hypothetical protein CISIN_1g037374mg                   103   2e-22   Citrus sinensis [apfelsine]
ref|XP_004512576.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       102   3e-22   
ref|XP_008388178.1|  PREDICTED: UDP-glycosyltransferase 85A3-like     99.0    3e-22   
ref|XP_007141191.1|  hypothetical protein PHAVU_008G174700g             102   4e-22   Phaseolus vulgaris [French bean]
gb|KJB74136.1|  hypothetical protein B456_011G274900                    100   5e-22   Gossypium raimondii
ref|XP_004231996.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    101   6e-22   Solanum lycopersicum
gb|KJB74150.1|  hypothetical protein B456_011G275700                    101   7e-22   Gossypium raimondii
ref|XP_011085130.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    100   1e-21   
ref|XP_007141200.1|  hypothetical protein PHAVU_008G175500g             101   1e-21   Phaseolus vulgaris [French bean]
ref|XP_011000049.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    100   1e-21   Populus euphratica
gb|KHN42553.1|  UDP-glycosyltransferase 85A2                            100   1e-21   Glycine soja [wild soybean]
ref|XP_003544800.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       100   1e-21   Glycine max [soybeans]
gb|EAZ03903.1|  hypothetical protein OsI_26037                          100   2e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_006357782.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       100   2e-21   Solanum tuberosum [potatoes]
ref|XP_008464907.1|  PREDICTED: UDP-glycosyltransferase 85A3-like...    100   2e-21   Cucumis melo [Oriental melon]
gb|KDO69252.1|  hypothetical protein CISIN_1g011848mg                   100   2e-21   Citrus sinensis [apfelsine]
ref|XP_002530397.1|  UDP-glucuronosyltransferase, putative              100   2e-21   
emb|CDO99846.1|  unnamed protein product                              99.8    2e-21   Coffea canephora [robusta coffee]
ref|XP_002323535.1|  hypothetical protein POPTR_0016s10020g           99.4    2e-21   
emb|CBI36705.3|  unnamed protein product                              99.4    2e-21   Vitis vinifera
gb|KEH28097.1|  UDP-glucosyltransferase family protein                  100   2e-21   Medicago truncatula
ref|XP_004150244.1|  PREDICTED: UDP-glycosyltransferase 85A4-like     99.4    2e-21   
ref|XP_004957723.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     99.8    3e-21   Setaria italica
gb|KJB74134.1|  hypothetical protein B456_011G274800                  99.8    3e-21   Gossypium raimondii
ref|XP_006850415.1|  hypothetical protein AMTR_s00165p00030470        95.9    3e-21   
ref|NP_001175205.1|  Os07g0489200                                     99.8    3e-21   
ref|XP_010316061.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...  99.8    3e-21   Solanum lycopersicum
ref|XP_011076757.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...  99.8    3e-21   Sesamum indicum [beniseed]
ref|XP_004162780.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     99.4    5e-21   
gb|KGN50615.1|  UDP-glucosyltransferase family 1 protein              99.4    5e-21   Cucumis sativus [cucumbers]
ref|XP_010666054.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...  99.0    6e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008370121.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     99.0    7e-21   Malus domestica [apple tree]
ref|XP_007158357.1|  hypothetical protein PHAVU_002G146000g           97.4    9e-21   Phaseolus vulgaris [French bean]
dbj|BAJ98857.1|  predicted protein                                    98.2    1e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006373896.1|  hypothetical protein POPTR_0016s10010g           98.6    1e-20   Populus trichocarpa [western balsam poplar]
ref|XP_008464908.1|  PREDICTED: UDP-glycosyltransferase 85A4-like     95.5    1e-20   Cucumis melo [Oriental melon]
ref|XP_010106101.1|  UDP-glycosyltransferase 85A3                     94.7    1e-20   
dbj|BAG80552.1|  UDP-glucose:glucosyltransferase                      97.8    2e-20   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_010666049.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...  98.2    2e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003613026.1|  UDP-glucuronosyltransferase 1-6                  97.4    2e-20   Medicago truncatula
ref|XP_003560193.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...  97.4    2e-20   Brachypodium distachyon [annual false brome]
ref|XP_004150245.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     97.4    3e-20   
ref|XP_010032067.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...  97.4    3e-20   Eucalyptus grandis [rose gum]
ref|XP_004955353.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     97.1    3e-20   
gb|ACD03242.1|  UDP-glycosyltransferase UGT709A10                     97.1    3e-20   Avena strigosa
ref|XP_008464906.1|  PREDICTED: UDP-glycosyltransferase 85A3-like...  96.7    4e-20   Cucumis melo [Oriental melon]
ref|XP_006357780.1|  PREDICTED: UDP-glycosyltransferase 85A1-like     96.7    4e-20   
ref|XP_009589441.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...  96.7    4e-20   Nicotiana tomentosiformis
emb|CAD27851.2|  glucosyltransferase                                  93.6    5e-20   Triticum aestivum [Canadian hard winter wheat]
gb|EAZ03912.1|  hypothetical protein OsI_26045                        96.7    5e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_004489451.1|  PREDICTED: UDP-glycosyltransferase 85A3-like     96.7    5e-20   Cicer arietinum [garbanzo]
gb|EAZ39850.1|  hypothetical protein OsJ_24290                        96.3    5e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010674283.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...  96.7    5e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001175206.1|  Os07g0489950                                     96.7    5e-20   
ref|XP_003544213.2|  PREDICTED: UDP-glycosyltransferase 85A2-like     96.3    5e-20   Glycine max [soybeans]
ref|XP_010674284.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...  96.3    5e-20   
ref|XP_009600396.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...  94.4    6e-20   Nicotiana tomentosiformis
gb|KHN24339.1|  UDP-glycosyltransferase 85A2                          96.3    6e-20   Glycine soja [wild soybean]
ref|XP_009759439.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...  96.3    6e-20   Nicotiana sylvestris
ref|XP_004237925.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  96.3    7e-20   Solanum lycopersicum
gb|KGN50614.1|  hypothetical protein Csa_5G196570                     95.9    7e-20   Cucumis sativus [cucumbers]
ref|XP_004172562.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     95.9    8e-20   
ref|XP_011014019.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...  95.9    1e-19   Populus euphratica
ref|XP_010923184.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...  95.5    1e-19   Elaeis guineensis
ref|XP_007026848.1|  UDP-glucosyl transferase 85A3, putative isof...  95.5    1e-19   
ref|XP_007009135.1|  UDP-glucosyltransferase family 1 protein, pu...  93.6    1e-19   
ref|XP_007026850.1|  UDP-glucosyl transferase 85A4-like protein i...  95.1    2e-19   
gb|KEH17174.1|  UDP-glucosyltransferase family protein                94.7    2e-19   Medicago truncatula
gb|EMT06489.1|  Cytokinin-O-glucosyltransferase 2                     94.4    2e-19   
gb|ACJ84649.1|  unknown                                               94.4    3e-19   Medicago truncatula
gb|AFK37311.1|  unknown                                               94.4    3e-19   Medicago truncatula
ref|XP_011014018.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...  94.7    3e-19   Populus euphratica
ref|XP_003615138.1|  Cytokinin-O-glucosyltransferase                  94.4    3e-19   Medicago truncatula
ref|XP_003576916.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...  94.4    3e-19   
gb|AFK33787.1|  unknown                                               94.4    3e-19   Medicago truncatula
gb|EYU41802.1|  hypothetical protein MIMGU_mgv1a0212491mg             91.7    3e-19   Erythranthe guttata [common monkey flower]
ref|XP_006658565.1|  PREDICTED: UDP-glycosyltransferase 85A5-like     94.4    3e-19   Oryza brachyantha
ref|XP_007026851.1|  UDP-Glycosyltransferase superfamily protein ...  94.4    4e-19   
ref|XP_003544799.1|  PREDICTED: UDP-glycosyltransferase 85A3-like     94.0    4e-19   Glycine max [soybeans]
ref|XP_006853219.1|  hypothetical protein AMTR_s00038p00218410        93.6    5e-19   
dbj|BAB86928.1|  glucosyltransferase-10                               93.6    5e-19   Vigna angularis [azuki bean]
ref|XP_003618663.1|  Cytokinin-O-glucosyltransferase                  93.6    6e-19   Medicago truncatula
ref|XP_010316060.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...  93.6    6e-19   Solanum lycopersicum
ref|XP_007026849.1|  UDP-glucosyl transferase 85A3, putative          93.2    6e-19   
gb|KHN04913.1|  UDP-glycosyltransferase 85A2                          93.2    6e-19   Glycine soja [wild soybean]
ref|XP_007018744.1|  UDP-glucosyl transferase 85A2                    93.6    6e-19   
ref|XP_010095928.1|  UDP-glycosyltransferase 85A5                     90.1    6e-19   
ref|XP_007042920.1|  UDP-glucosyl transferase 85A2                    93.6    8e-19   
gb|KJB74148.1|  hypothetical protein B456_011G275500                  90.1    9e-19   Gossypium raimondii
gb|KHN24338.1|  UDP-glycosyltransferase 85A3                          92.8    9e-19   Glycine soja [wild soybean]
gb|EMT25167.1|  Cytokinin-O-glucosyltransferase 2                     90.9    1e-18   
gb|EPS61663.1|  hypothetical protein M569_13131                       92.0    1e-18   Genlisea aurea
ref|XP_004302685.2|  PREDICTED: 7-deoxyloganetic acid glucosyltra...  92.4    2e-18   Fragaria vesca subsp. vesca
gb|AFK34769.1|  unknown                                               92.4    2e-18   Lotus japonicus
ref|XP_002285771.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase  92.0    2e-18   Vitis vinifera
gb|EMT13628.1|  Cytokinin-O-glucosyltransferase 2                     93.2    2e-18   
ref|XP_007026847.1|  UDP-glucosyl transferase 85A3, putative isof...  92.0    2e-18   
ref|XP_004489447.1|  PREDICTED: UDP-glycosyltransferase 85A7-like     92.0    2e-18   Cicer arietinum [garbanzo]
ref|XP_011016624.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  92.0    2e-18   Populus euphratica
gb|ADV71371.1|  glycosyltransferase GT14M03                           91.7    3e-18   Pueraria montana var. lobata [kudzu]
ref|XP_011045673.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  90.9    4e-18   Populus euphratica
ref|XP_006473006.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     88.6    4e-18   Citrus sinensis [apfelsine]
ref|XP_002462874.1|  hypothetical protein SORBIDRAFT_02g033570        90.9    5e-18   Sorghum bicolor [broomcorn]
ref|XP_010106102.1|  UDP-glycosyltransferase 85A5                     87.4    6e-18   
ref|XP_008808008.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     90.5    6e-18   Phoenix dactylifera
ref|XP_011045674.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  90.9    6e-18   Populus euphratica
ref|XP_002462875.1|  hypothetical protein SORBIDRAFT_02g033580        90.9    6e-18   
ref|XP_003563101.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...  90.5    6e-18   Brachypodium distachyon [annual false brome]
ref|XP_006853218.1|  hypothetical protein AMTR_s00038p00217680        90.5    7e-18   Amborella trichopoda
dbj|BAC57706.1|  putative glucosyltransferase-2                       90.5    7e-18   Oryza sativa Japonica Group [Japonica rice]
gb|AIL51400.1|  glycosyltransferase                                   90.5    7e-18   Actinidia deliciosa [Chinese gooseberry]
ref|XP_009387949.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     88.2    7e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007141201.1|  hypothetical protein PHAVU_008G175600g           90.5    8e-18   Phaseolus vulgaris [French bean]
gb|EAZ39839.1|  hypothetical protein OsJ_24280                        90.1    8e-18   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001059664.1|  Os07g0486700                                     90.5    8e-18   
ref|XP_009598263.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  86.7    8e-18   Nicotiana tomentosiformis
ref|XP_009346996.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...  90.1    8e-18   
gb|EMT24598.1|  Cytokinin-O-glucosyltransferase 2                     90.1    9e-18   
dbj|BAJ85877.1|  predicted protein                                    90.1    9e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006429243.1|  hypothetical protein CICLE_v10011602mg           90.1    9e-18   Citrus clementina [clementine]
dbj|BAJ89885.1|  predicted protein                                    90.1    9e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003618637.1|  Cytokinin-O-glucosyltransferase                  90.1    9e-18   Medicago truncatula
dbj|BAJ90455.1|  predicted protein                                    90.1    1e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009341756.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  90.1    1e-17   Pyrus x bretschneideri [bai li]
ref|XP_002285767.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase  90.1    1e-17   Vitis vinifera
gb|EMT03956.1|  Cytokinin-O-glucosyltransferase 2                     88.2    1e-17   
ref|XP_003526577.1|  PREDICTED: UDP-glycosyltransferase 85A3-like     89.7    1e-17   
gb|AFK38894.1|  unknown                                               89.7    1e-17   Medicago truncatula
dbj|BAM63146.1|  uncharacterized glucosyltransferase 2                89.4    2e-17   Ipomoea nil [qian niu]
ref|XP_008343335.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     85.9    2e-17   
emb|CBI19181.3|  unnamed protein product                              90.1    2e-17   Vitis vinifera
emb|CDX91674.1|  BnaC08g05930D                                        89.0    2e-17   
gb|KCW44218.1|  hypothetical protein EUGRSUZ_L023572                  85.5    2e-17   Eucalyptus grandis [rose gum]
gb|EMT13631.1|  Cytokinin-O-glucosyltransferase 2                     89.4    2e-17   
ref|XP_008219322.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     89.0    3e-17   Prunus mume [ume]
ref|XP_007026845.1|  UDP-glucosyl transferase 85A3, putative isof...  89.0    3e-17   
dbj|BAO51842.1|  UDP-glycosyltransferase 85A32                        88.6    3e-17   Ipomoea batatas [batate]
ref|XP_008219317.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     88.6    3e-17   Prunus mume [ume]
gb|AFK79038.1|  glycosyltransferase UGT6                              88.6    3e-17   Bupleurum chinense
ref|XP_007141198.1|  hypothetical protein PHAVU_008G175300g           88.6    3e-17   Phaseolus vulgaris [French bean]
ref|XP_006433961.1|  hypothetical protein CICLE_v10000958mg           88.6    4e-17   Citrus clementina [clementine]
ref|XP_002513938.1|  UDP-glucuronosyltransferase, putative            88.6    4e-17   Ricinus communis
gb|KJB59011.1|  hypothetical protein B456_009G235700                  88.2    4e-17   Gossypium raimondii
gb|KDO38337.1|  hypothetical protein CISIN_1g011531mg                 88.2    4e-17   Citrus sinensis [apfelsine]
ref|XP_010688868.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...  88.6    4e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010273031.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  87.8    5e-17   Nelumbo nucifera [Indian lotus]
ref|XP_007227225.1|  hypothetical protein PRUPE_ppa018697mg           87.8    5e-17   Prunus persica
ref|XP_007222804.1|  hypothetical protein PRUPE_ppa005043mg           87.8    5e-17   Prunus persica
gb|EMS63405.1|  UDP-glycosyltransferase 85A5                          85.9    6e-17   Triticum urartu
ref|XP_006858363.1|  hypothetical protein AMTR_s00064p00191380        85.1    6e-17   
gb|AGZ84549.1|  glycosyltransferase KGT31                             87.8    6e-17   
dbj|BAO51844.1|  UDP-glycosyltransferase 85A28                        87.8    7e-17   
gb|KHN34757.1|  UDP-glycosyltransferase 85A2                          87.4    7e-17   
ref|XP_002298702.2|  hypothetical protein POPTR_0001s32000g           87.4    8e-17   
ref|XP_010534080.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     87.4    8e-17   
ref|XP_009413654.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  85.1    1e-16   
ref|XP_004237928.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  87.0    1e-16   
ref|XP_007224069.1|  hypothetical protein PRUPE_ppa015357mg           87.0    1e-16   
ref|XP_008219318.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     87.0    1e-16   
ref|XP_007207189.1|  hypothetical protein PRUPE_ppa017055mg           87.0    1e-16   
ref|XP_010477495.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     87.0    1e-16   
ref|XP_011069754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  87.0    1e-16   
ref|XP_002893223.1|  transcription factor/ transferase, transferr...  87.0    1e-16   
ref|XP_008779905.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     86.7    1e-16   
ref|XP_004136284.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     86.7    1e-16   
gb|KGN54319.1|  hypothetical protein Csa_4G303180                     86.7    1e-16   
gb|EMS64262.1|  UDP-glycosyltransferase 85A2                          86.7    1e-16   
ref|XP_004958356.1|  PREDICTED: UDP-glycosyltransferase 85A3-like     86.7    2e-16   
ref|XP_002285770.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase  86.7    2e-16   
emb|CDP01078.1|  unnamed protein product                              86.7    2e-16   
gb|EAZ39840.1|  hypothetical protein OsJ_24281                        86.7    2e-16   
ref|XP_010087621.1|  UDP-glycosyltransferase 85A1                     86.3    2e-16   
gb|AIE12478.1|  UGT5                                                  86.3    2e-16   
ref|XP_009612691.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  86.3    2e-16   
ref|XP_004299647.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  86.3    2e-16   
ref|NP_001059665.1|  Os07g0487100                                     86.3    2e-16   
gb|EAZ03162.1|  hypothetical protein OsI_25314                        86.3    2e-16   
ref|NP_001062593.1|  Os09g0119600                                     86.3    2e-16   
ref|XP_008466222.1|  PREDICTED: UDP-glycosyltransferase 85A2          85.9    3e-16   
ref|XP_003575790.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...  85.9    3e-16   
ref|XP_007047909.1|  UDP-glucosyl transferase 85A2                    85.9    3e-16   
ref|XP_002513939.1|  UDP-glucuronosyltransferase, putative            84.7    3e-16   
ref|XP_004252531.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  85.9    3e-16   
ref|XP_006388801.1|  hypothetical protein POPTR_0098s002901g          84.3    3e-16   
ref|XP_002891115.1|  predicted protein                                85.9    3e-16   
gb|KFK44332.1|  hypothetical protein AALP_AA1G244400                  85.9    3e-16   
emb|CDY41486.1|  BnaA08g20880D                                        85.5    3e-16   
emb|CDP01076.1|  unnamed protein product                              85.5    3e-16   
gb|KJB74151.1|  hypothetical protein B456_011G275800                  85.5    4e-16   
gb|AID16084.1|  flavonoid 3-O-glucosyltransferase                     84.0    4e-16   
emb|CBI31560.3|  unnamed protein product                              83.6    4e-16   
ref|XP_006852717.1|  hypothetical protein AMTR_s00033p00056330        85.5    4e-16   
dbj|BAH56949.1|  AT1G22360                                            85.1    4e-16   
ref|XP_003570610.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  85.5    4e-16   
ref|XP_009380209.1|  PREDICTED: LOW QUALITY PROTEIN: 7-deoxylogan...  85.5    4e-16   
ref|XP_008804762.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     85.1    5e-16   
ref|NP_173653.1|  UDP-glucosyl transferase 85A2                       85.1    5e-16   
gb|AAL32657.1|  UDP-glucose glucosyltransferase                       85.1    5e-16   
ref|NP_001031078.1|  UDP-glucosyl transferase 85A2                    85.1    5e-16   
ref|XP_010498706.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     85.1    5e-16   
gb|AHL38933.1|  glycosyltransferase                                   85.1    5e-16   
dbj|BAK00666.1|  predicted protein                                    85.1    5e-16   
gb|KHG13575.1|  hypothetical protein F383_20274                       85.1    5e-16   
ref|XP_009145345.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...  85.1    5e-16   
ref|XP_008359320.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     85.1    5e-16   
ref|XP_002301060.1|  hypothetical protein POPTR_0002s09850g           85.1    5e-16   
ref|XP_006363270.1|  PREDICTED: UDP-glycosyltransferase 85A3-like     85.1    6e-16   
ref|XP_009110142.1|  PREDICTED: UDP-glycosyltransferase 85A5-like     85.1    6e-16   
ref|XP_003546715.1|  PREDICTED: UDP-glycosyltransferase 85A3          85.1    6e-16   
ref|XP_006416206.1|  hypothetical protein EUTSA_v100074991mg          81.6    6e-16   
ref|NP_001277170.1|  UDP-glycosyltransferase 85A2-like                85.1    6e-16   
ref|XP_002268845.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase  85.1    6e-16   
gb|KDP41398.1|  hypothetical protein JCGZ_15805                       85.1    6e-16   
gb|AAV32497.1|  UDP-glucuronosyltransferase                           85.1    6e-16   
ref|XP_006304493.1|  hypothetical protein CARUB_v10011262mg           85.1    6e-16   
ref|NP_001052455.1|  Os04g0319700                                     84.7    6e-16   
ref|XP_006661032.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     84.7    6e-16   
gb|EAZ30242.1|  hypothetical protein OsJ_14293                        84.7    7e-16   
emb|CDO97432.1|  unnamed protein product                              84.7    7e-16   
ref|XP_004299648.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  84.7    7e-16   
ref|XP_002893224.1|  UDP-glucosyl transferase 85A1                    84.7    7e-16   
ref|XP_011003867.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  84.7    7e-16   
ref|XP_009592743.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  84.7    7e-16   
ref|XP_002300186.1|  hypothetical protein POPTR_0001s31950g           84.7    7e-16   
ref|XP_003560194.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...  84.7    8e-16   
ref|XP_009775754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  84.7    8e-16   
ref|XP_006388604.1|  hypothetical protein POPTR_0140s002102g          81.6    8e-16   
emb|CBI38430.3|  unnamed protein product                              85.1    9e-16   
gb|EYU19971.1|  hypothetical protein MIMGU_mgv1a024760mg              84.3    9e-16   
gb|KEH25039.1|  UDP-glycosyltransferase superfamily protein           81.6    1e-15   
ref|XP_002461042.1|  hypothetical protein SORBIDRAFT_02g039670        84.3    1e-15   
ref|XP_006307366.1|  hypothetical protein CARUB_v10008992mg           84.3    1e-15   
ref|XP_010674580.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...  81.3    1e-15   
ref|XP_010060016.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  84.3    1e-15   
ref|XP_004237927.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  84.3    1e-15   
ref|XP_002323976.2|  hypothetical protein POPTR_0017s07920g           84.3    1e-15   
ref|NP_173655.2|  UDP-glucosyl transferase 85A3                       84.3    1e-15   
ref|XP_008219313.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     84.0    1e-15   
ref|XP_002532877.1|  UDP-glucuronosyltransferase, putative            84.0    1e-15   
ref|XP_011010105.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  84.0    1e-15   
ref|XP_010060018.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  84.0    1e-15   
gb|KFK44331.1|  hypothetical protein AALP_AA1G244300                  84.0    1e-15   
gb|EMS51148.1|  UDP-glycosyltransferase 85A3                          84.0    1e-15   
ref|XP_009341754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  84.0    1e-15   
gb|KHN13067.1|  UDP-glycosyltransferase 85A3                          84.0    1e-15   
ref|XP_003579871.2|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  84.3    1e-15   
ref|XP_006853263.1|  hypothetical protein AMTR_s00038p00232930        80.9    2e-15   
ref|XP_011465456.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  84.0    2e-15   
gb|EYU19972.1|  hypothetical protein MIMGU_mgv1a018325mg              82.8    2e-15   
ref|XP_002302305.1|  UDP-glucuronosyltransferase family protein       83.6    2e-15   
gb|KFK44336.1|  hypothetical protein AALP_AA1G244800                  83.6    2e-15   
ref|XP_009341757.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  83.6    2e-15   
ref|NP_001152029.1|  cytokinin-O-glucosyltransferase 2                83.6    2e-15   
sp|F8WLS6.1|UGT6_CATRO  RecName: Full=7-deoxyloganetin glucosyltr...  83.6    2e-15   
dbj|BAD93690.1|  glycosyltransferase                                  83.6    2e-15   
gb|KDP41399.1|  hypothetical protein JCGZ_15806                       83.6    2e-15   
ref|XP_004252533.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  83.6    2e-15   
gb|EAZ30249.1|  hypothetical protein OsJ_14299                        84.3    2e-15   
gb|KEH24968.1|  UDP-glucosyltransferase family protein                83.6    2e-15   
gb|EMT23576.1|  Cytokinin-O-glucosyltransferase 2                     81.6    2e-15   
ref|XP_008234165.1|  PREDICTED: UDP-glycosyltransferase 85A5-like     83.6    2e-15   
emb|CBI31568.3|  unnamed protein product                              82.0    2e-15   
ref|XP_008234196.1|  PREDICTED: UDP-glycosyltransferase 85A5-like     83.6    2e-15   
ref|XP_011009482.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  83.6    2e-15   
gb|AID16086.1|  flavonol-3-O-glucoside L-rhamnosyltransferase         83.2    2e-15   
ref|XP_008219458.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     83.2    2e-15   
ref|XP_009590778.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  83.2    2e-15   
ref|XP_002893221.1|  UDP-glycosyltransferase                          83.2    2e-15   
ref|XP_007224375.1|  hypothetical protein PRUPE_ppa021058mg           83.2    2e-15   
emb|CAN67315.1|  hypothetical protein VITISV_036458                   83.2    2e-15   
ref|XP_006388793.1|  hypothetical protein POPTR_0098s002201g          80.1    2e-15   
gb|KDP41396.1|  hypothetical protein JCGZ_15803                       83.2    2e-15   
ref|XP_002885822.1|  hypothetical protein ARALYDRAFT_319356           83.2    3e-15   
ref|XP_003544801.1|  PREDICTED: UDP-glycosyltransferase 85A3-like     83.2    3e-15   
ref|XP_011009478.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  83.2    3e-15   
ref|XP_002285778.2|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  83.2    3e-15   
ref|XP_006360268.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     83.2    3e-15   
ref|XP_006373048.1|  hypothetical protein POPTR_0017s079102g          80.1    3e-15   
ref|XP_002323978.2|  hypothetical protein POPTR_0017s07940g           82.8    3e-15   
emb|CDP05613.1|  unnamed protein product                              82.4    3e-15   
gb|ABW96222.1|  glucosyltransferase                                   82.8    3e-15   
ref|XP_010060024.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  82.8    3e-15   
ref|XP_006481394.1|  PREDICTED: UDP-glycosyltransferase 85A1-like     82.8    3e-15   
gb|KEH19454.1|  UDP-glucosyltransferase family protein                82.8    3e-15   
ref|XP_007009136.1|  UDP-glucosyltransferase family 1 protein, pu...  80.1    3e-15   
ref|XP_010248134.1|  PREDICTED: UDP-glycosyltransferase 85A5-like     79.3    3e-15   
ref|XP_010064217.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  82.8    4e-15   
ref|XP_010647463.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  81.6    4e-15   
ref|XP_008450117.1|  PREDICTED: UDP-glycosyltransferase 85A7-like     82.8    4e-15   
ref|XP_008386105.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     82.8    4e-15   
ref|XP_004252532.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  82.8    4e-15   
ref|XP_003618655.1|  UDP-glucuronosyltransferase                      82.8    4e-15   
gb|ACF82011.1|  unknown                                               81.6    4e-15   
gb|KCW66555.1|  hypothetical protein EUGRSUZ_F00353                   82.4    4e-15   
gb|KCW45339.1|  hypothetical protein EUGRSUZ_L009911                  79.3    4e-15   
gb|ABB88577.1|  UDP-glucosyltransferase                               82.4    4e-15   
ref|XP_009145346.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...  82.4    4e-15   
ref|NP_973885.1|  UDP-glucosyl transferase 85A5                       82.4    4e-15   
emb|CAN65645.1|  hypothetical protein VITISV_012510                   82.8    4e-15   
ref|XP_004237929.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  82.4    4e-15   
ref|XP_006853229.1|  hypothetical protein AMTR_s00038p00222010        80.5    4e-15   
gb|EMS49679.1|  UDP-glycosyltransferase 76C1                          83.6    4e-15   
gb|KJB76132.1|  hypothetical protein B456_012G074100                  79.3    5e-15   
ref|XP_011468341.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  82.4    5e-15   
ref|XP_010030926.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  83.2    5e-15   
emb|CDY14621.1|  BnaC02g24920D                                        82.4    5e-15   
ref|XP_003635298.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  82.4    5e-15   
ref|XP_010937416.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  82.4    5e-15   
ref|XP_003547073.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     82.4    5e-15   
gb|KHN33502.1|  UDP-glycosyltransferase 85A2                          82.4    5e-15   
ref|XP_004305167.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...  82.0    5e-15   
gb|KCW62086.1|  hypothetical protein EUGRSUZ_H04754                   82.0    6e-15   
gb|KCW45706.1|  hypothetical protein EUGRSUZ_L00512                   82.0    6e-15   
ref|XP_011009481.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  82.0    6e-15   
emb|CBI23550.3|  unnamed protein product                              81.6    6e-15   
ref|XP_010025429.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  82.0    6e-15   
emb|CDY21359.1|  BnaA09g30680D                                        81.6    6e-15   
ref|XP_006363269.1|  PREDICTED: UDP-glycosyltransferase 85A3-like     82.0    6e-15   
ref|XP_010267412.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  82.0    6e-15   
ref|XP_002323974.2|  hypothetical protein POPTR_0017s07880g           82.0    6e-15   
gb|ACJ85365.1|  unknown                                               79.7    6e-15   
ref|XP_002513937.1|  UDP-glucuronosyltransferase, putative            82.0    7e-15   
ref|XP_009145347.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...  82.0    7e-15   
sp|F8WKW1.1|UGT2_GARJA  RecName: Full=7-deoxyloganetin glucosyltr...  82.0    7e-15   
ref|XP_010459994.1|  PREDICTED: UDP-glycosyltransferase 85A1-like     82.0    7e-15   
dbj|BAG80542.1|  glycosyltransferase                                  81.6    8e-15   
ref|XP_008219315.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     81.6    8e-15   
ref|XP_003618656.1|  UDP-glucuronosyltransferase                      81.6    8e-15   
ref|XP_010498708.1|  PREDICTED: UDP-glycosyltransferase 85A1-like     82.0    8e-15   
ref|XP_007224968.1|  hypothetical protein PRUPE_ppa020820mg           81.6    8e-15   
emb|CDY26859.1|  BnaA02g18840D                                        81.6    8e-15   
ref|XP_004303932.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  81.6    9e-15   
gb|AFJ52995.1|  UDP-glycosyltransferase 1                             81.6    9e-15   
ref|XP_002525850.1|  UDP-glucuronosyltransferase, putative            81.6    9e-15   
ref|XP_010035387.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  81.6    9e-15   
ref|XP_007047907.1|  UDP-glucosyl transferase 85A2                    81.6    9e-15   
ref|XP_004975278.1|  PREDICTED: UDP-glycosyltransferase 85A3-like     81.6    1e-14   
ref|XP_006363268.1|  PREDICTED: UDP-glycosyltransferase 85A1-like     81.6    1e-14   
ref|XP_010060021.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  81.6    1e-14   
gb|AFJ52992.1|  UDP-glycosyltransferase 1                             81.3    1e-14   
ref|XP_011466515.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...  81.3    1e-14   
ref|XP_002323758.2|  hypothetical protein POPTR_0017s07930g           81.3    1e-14   
ref|XP_011016634.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase  81.3    1e-14   
ref|XP_010680524.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  81.3    1e-14   
dbj|BAK02647.1|  predicted protein                                    81.3    1e-14   
ref|XP_010044032.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...  81.3    1e-14   
gb|EMT17620.1|  Cytokinin-O-glucosyltransferase 2                     82.4    1e-14   
ref|XP_010521179.1|  PREDICTED: UDP-glycosyltransferase 85A3-like     81.3    1e-14   
ref|XP_009370709.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  81.3    1e-14   
ref|XP_007207791.1|  hypothetical protein PRUPE_ppa025605mg           81.3    1e-14   
ref|XP_002322562.2|  hypothetical protein POPTR_0016s02270g           81.3    1e-14   
gb|ABK95502.1|  unknown                                               78.2    1e-14   
gb|EMT15333.1|  Cytokinin-O-glucosyltransferase 2                     81.3    1e-14   
ref|XP_009391314.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  81.3    1e-14   
ref|XP_010910271.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  80.9    1e-14   
ref|XP_010477499.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...  81.3    1e-14   
gb|EMT29523.1|  Cytokinin-O-glucosyltransferase 2                     80.5    1e-14   
ref|XP_004300654.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  80.9    1e-14   
ref|XP_009377948.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  80.9    1e-14   
ref|XP_008229788.1|  PREDICTED: UDP-glycosyltransferase 85A5-like     80.9    1e-14   
gb|AEB61489.1|  UDP-glucosyltransferase                               80.9    2e-14   
ref|XP_010025433.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  80.9    2e-14   
ref|XP_008789348.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...  80.9    2e-14   
gb|EAY73885.1|  hypothetical protein OsI_01767                        80.9    2e-14   
ref|XP_002323188.2|  hypothetical protein POPTR_0016s02200g           80.9    2e-14   
gb|KFK44329.1|  hypothetical protein AALP_AA1G244100                  80.9    2e-14   
ref|XP_006416203.1|  hypothetical protein EUTSA_v10009957mg           81.6    2e-14   
emb|CDP21827.1|  unnamed protein product                              80.1    2e-14   
ref|XP_004957721.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     80.5    2e-14   
ref|XP_010030028.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  80.9    2e-14   



>ref|XP_009781211.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=352

 Score =   191 bits (486),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 134/179 (75%), Gaps = 9/179 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            + IFPFPAQ H+NSMLKLA LL LSNFH++F V  + H RLL  TDV S RF + F LQ+
Sbjct  10   VAIFPFPAQGHVNSMLKLAQLLSLSNFHVSFLVTVDTHDRLLNHTDVLS-RFGSEFHLQA  68

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIALDV  360
             P GI    +++++G+ +L  SL+TI KPFL++++A+      P TC I+D ++S+A DV
Sbjct  69   LPDGISLDEMNTRDGVGKLYDSLNTIAKPFLREFLAEP-----PVTCVIADGILSMAADV  123

Query  361  SEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLR  537
            +EE   +LP+ YFRTISACAFW+YFS+P+L +A ELP+K NG+D + +TKVKGMEDFLR
Sbjct  124  AEEI--NLPIIYFRTISACAFWSYFSIPELLQASELPLKLNGMDIT-LTKVKGMEDFLR  179



>ref|XP_010318075.1| PREDICTED: LOW QUALITY PROTEIN: 7-deoxyloganetic acid glucosyltransferase-like 
[Solanum lycopersicum]
Length=469

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 130/179 (73%), Gaps = 7/179 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            ++IFPFPAQ H+NSMLKLA LL LSNFHITF V  + H RLL  TDV S RF + F LQ 
Sbjct  7    VIIFPFPAQGHVNSMLKLAQLLSLSNFHITFLVTVDTHDRLLNHTDVLS-RFGSGFHLQP  65

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIALDV  360
             P GI    +++++GL  L +SL+ I K FL+++I  N +S  P TC I+D ++S+A DV
Sbjct  66   LPHGISMDVMNTRDGLSILYNSLNKIAKLFLREFIV-NMNS--PVTCLIADGILSMAGDV  122

Query  361  SEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLR  537
            ++E   +LP+ YFRTISACAFW+YF +P L +AG+LP+K N +D   +TKVKGME+FLR
Sbjct  123  AQEI--NLPLIYFRTISACAFWSYFCIPHLIQAGQLPLKENAMDLI-LTKVKGMENFLR  178



>ref|XP_006361974.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Solanum tuberosum]
Length=378

 Score =   174 bits (440),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 127/179 (71%), Gaps = 9/179 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            ++IFPFPAQ H+NSMLKLA LL LSNF +TF V  + H R++   DV S RF + F LQ+
Sbjct  7    VIIFPFPAQGHVNSMLKLAQLLSLSNFDVTFLVTVDTHDRVVNHIDVLS-RFGSVFHLQA  65

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIALDV  360
             P GI    +++++G+  L +SL+TI KPFL+++I  +       TC I D ++S+A DV
Sbjct  66   LPHGISMDGVNTRDGISMLYYSLNTIAKPFLREFIPNSS-----VTCLIVDGILSMAADV  120

Query  361  SEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLR  537
            +EE   +LP+ YFRT+SA +FW+YF +P+L +AGELP+K N  D + +TKVKGMEDFLR
Sbjct  121  AEEI--NLPIIYFRTVSASSFWSYFCIPELIQAGELPLKENAKDLT-LTKVKGMEDFLR  176



>ref|XP_004235055.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Solanum 
lycopersicum]
Length=468

 Score =   176 bits (445),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 126/179 (70%), Gaps = 8/179 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            ++IFPFPAQ H+NSMLKLA LL LSNF +TF V  + H RLL  TDV S RF + F LQ 
Sbjct  7    VIIFPFPAQGHVNSMLKLAQLLSLSNFQVTFLVTVDTHDRLLNHTDVLS-RFGSEFHLQP  65

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIALDV  360
             P GI    +++++GL  L  SL+ I KPFL+++IA +  +    TC I+D ++S+A DV
Sbjct  66   LPHGISMDVMNTRDGLSILYDSLNKIAKPFLREFIAYSPVT----TCLIADGILSMAGDV  121

Query  361  SEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLR  537
            +EE   +LP+ YFRT SA +FW+YF +PDL + GELP+K N  D + +TKVKGMEDFLR
Sbjct  122  AEEI--NLPIIYFRTASASSFWSYFCMPDLIQVGELPLKENAKDLT-LTKVKGMEDFLR  177



>emb|CDP05607.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 122/186 (66%), Gaps = 11/186 (6%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFPFPAQ H+NSMLKLA LL L+  +ITF V +NIH RLL  T+V S RF+    F L
Sbjct  11   VLIFPFPAQGHVNSMLKLAELLCLAGINITFLVSNNIHNRLLRHTNVVS-RFSKYPGFHL  69

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGL-----PFTCFISDLL  339
              +P    +  +   + +++LC +L ++ KPFLK+ ++++   G      PF+C I D  
Sbjct  70   DHYPDAYDESKVHIAQEIMDLCTALQSVVKPFLKELLSKDPAHGTRKDRPPFSCIIVDGF  129

Query  340  VSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKG  519
            +S+ALDV+EE    LP+  FRTISA AFWTYF +P L EAGELP  G+ ++  PI  VKG
Sbjct  130  LSLALDVAEEI--GLPLICFRTISAGAFWTYFCIPRLVEAGELPFPGDEMN-LPIENVKG  186

Query  520  MEDFLR  537
            ME FLR
Sbjct  187  MEGFLR  192



>ref|XP_006361975.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Solanum tuberosum]
Length=470

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 112/163 (69%), Gaps = 8/163 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            ++IFPFPAQ H+NSMLKLA LL LSNF ITF V  + H  LL  TDV S RF + F LQ+
Sbjct  7    VIIFPFPAQGHVNSMLKLAQLLSLSNFDITFLVTLDTHDHLLNHTDVIS-RFGSGFLLQA  65

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIALDV  360
             P GI    +++++G+  L  SL+ I KPFL+++I  +     P TC I+D L+S+A DV
Sbjct  66   LPHGISMDVMNTRDGISMLYDSLNKIAKPFLREFITYS-----PVTCLIADGLLSLAGDV  120

Query  361  SEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGI  489
            ++E   +LP+ YFRT SA +FW+YF +PDL + GELP+K  G+
Sbjct  121  AKEI--NLPIIYFRTASASSFWSYFCMPDLIQVGELPLKARGL  161



>emb|CDP05611.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 123/186 (66%), Gaps = 11/186 (6%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFPF AQ H+NSMLKLA LL L+  +ITF V  NIH RLL  TDV S RF+    F L
Sbjct  11   VLIFPFQAQGHVNSMLKLAELLCLAGINITFLVSYNIHNRLLRHTDVVS-RFSKYPGFNL  69

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQN--HDSGL---PFTCFISDLL  339
              +P    +  + + + ++EL  SL ++ KPFL+++++++  H +G     F+  I+D +
Sbjct  70   DHYPDAYDESKIHTAQQIMELYSSLQSVVKPFLREFMSKDPAHGTGKNRSRFSSIIADGI  129

Query  340  VSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKG  519
            +S+ALDV+EE    LP+ YFRTISA AFWTYF +P L EAGELP  G+ ++   I  VKG
Sbjct  130  LSLALDVAEEI--GLPLIYFRTISAGAFWTYFCIPQLVEAGELPFPGDDMNIR-IENVKG  186

Query  520  MEDFLR  537
            ME FLR
Sbjct  187  MEGFLR  192



>ref|XP_010262684.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
Length=483

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 106/184 (58%), Gaps = 7/184 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +L+ P P Q H+N M+KL+ LL L+ FH+TF    +IH RLL  T+++S RF     F  
Sbjct  10   VLLCPLPVQGHINPMIKLSELLSLAGFHVTFLTSEHIHRRLLRFTNLNSSRFARCPGFHF  69

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNH---DSGLPFTCFISDLLVS  345
             + P G+      S   L+EL  SL     P L++ +  N    D   P TC I+D L+S
Sbjct  70   ATIPDGLPFDHPRSGPQLVELFDSLKLTSIPLLREMLVSNRWGSDVRPPVTCIIADGLLS  129

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  525
              +DV+EE   ++P+  FRT SAC+FW YF +P L EAGELP  G+     P+T V GME
Sbjct  130  FTIDVAEEL--NIPIISFRTTSACSFWAYFCIPKLVEAGELPFGGDADMDCPVTCVPGME  187

Query  526  DFLR  537
             FLR
Sbjct  188  SFLR  191



>ref|XP_009597174.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=484

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 116/192 (60%), Gaps = 17/192 (9%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLS-NFHITFFVPSNIHARLLALTDVDS--GRFTTRFR  171
            ++IFPFPA  H++ ML LA LL LS N H+TF    +IH RLL  TD+ S  GRF   FR
Sbjct  11   VVIFPFPALGHVHPMLNLAELLSLSSNIHVTFINALSIHNRLLRCTDLQSRFGRFPG-FR  69

Query  172  LQSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQ-YIAQNHDSGL---------PFTC  321
             ++   G+ DG   + + ++ +  SL T  KP LK+ ++  N + G          P TC
Sbjct  70   FKTINLGLGDGLPHTSDDIMAVLKSLRTTAKPLLKELFLLDNCELGTTDKIIGQVPPVTC  129

Query  322  FISDLLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSP  501
             ISD ++ IAL+V+EE    +P ++FRT SA +FW Y+ +P L  AGELP  GN +D +P
Sbjct  130  LISDGILIIALEVAEE--RGIPTFHFRTSSASSFWAYYCIPQLIHAGELPFSGNDLD-TP  186

Query  502  ITKVKGMEDFLR  537
            I  VKGME FLR
Sbjct  187  IANVKGMESFLR  198



>ref|XP_010277669.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
Length=497

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 107/184 (58%), Gaps = 8/184 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTR--FRL  174
            +++FP P Q H+NSMLKL+ LL L+  H+TF    +IH RLL  T+V S RF     F  
Sbjct  22   VVVFPIPVQGHVNSMLKLSELLSLTGIHVTFLTFEHIHRRLLRFTNVTS-RFARWPGFHF  80

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNH---DSGLPFTCFISDLLVS  345
             + P  +     +S   L+E   SL     P L++ +  N    D   P TC I+D  +S
Sbjct  81   ATIPSDLPFDHPNSGPQLMEFFDSLKITSIPPLREMLVSNRRESDVRPPVTCIIADGTLS  140

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  525
              +DV++E   ++PV YFRTISAC+FW YFS+P L EAGELP  G+     PIT V GME
Sbjct  141  FTIDVAQEL--NIPVIYFRTISACSFWAYFSIPKLVEAGELPFGGDADMDCPITCVPGME  198

Query  526  DFLR  537
             FLR
Sbjct  199  SFLR  202



>emb|CAN68538.1| hypothetical protein VITISV_039646 [Vitis vinifera]
Length=450

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 108/184 (59%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFPFPAQ H+NSMLKLA LL ++  H+TF        RLL  TD+ + RF+    FR 
Sbjct  10   VLIFPFPAQGHVNSMLKLAELLSVAGLHVTFLNSEYNQHRLLLHTDIQT-RFSXYPGFRF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYI---AQNHDSGLPFTCFISDLLVS  345
            Q+   G+      + E +++L   L    KP  ++ +    Q  D+  P  C I+D ++S
Sbjct  69   QTISDGLTTDHPRTGERVMDLFEGLKATAKPIFRELVISRGQGSDTLPPVNCIIADGIMS  128

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  525
              +D++ E    +P+  FRTISAC+FW YFS   L E+GELP+KGN +D   +T + GME
Sbjct  129  FTIDIANEV--GIPIISFRTISACSFWAYFSALKLIESGELPLKGNDMD-QLVTSIPGME  185

Query  526  DFLR  537
             FLR
Sbjct  186  GFLR  189



>gb|AGX93071.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Vinca 
minor]
Length=482

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 113/185 (61%), Gaps = 10/185 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q H+NSML+LA LL L+   ITF V    H RL+  T+V S RF     F+ 
Sbjct  12   VLIFPLPIQGHVNSMLRLAELLCLAKLDITFVVSDFSHNRLIKHTNVAS-RFARYPGFQF  70

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNH----DSGLPFTCFISDLLV  342
            Q+   G+ D    + E ++++  S   +  P  K+ + +N+     +  P TC I+D ++
Sbjct  71   QTISDGLPDDHPRAGEKVMDILPSTKNVTGPLFKRMMIENNCFASSTRRPTTCIIADGVL  130

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
            S A D +EE  N +P+ YFRT+SACAFW  FS+P+L E+G++PIKGNG+D   +  V GM
Sbjct  131  SFAGDFAEE--NGVPLIYFRTVSACAFWACFSMPELIESGDIPIKGNGMDLL-VKGVAGM  187

Query  523  EDFLR  537
            E FLR
Sbjct  188  ETFLR  192



>emb|CBI31575.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 108/184 (59%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFPFPAQ H+NSMLKLA LL ++  H+TF        RLL  TD+ + RF+    FR 
Sbjct  10   VLIFPFPAQGHVNSMLKLAELLSVAGLHVTFLNSEYNQHRLLLHTDIQT-RFSGYPGFRF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYI---AQNHDSGLPFTCFISDLLVS  345
            Q+   G+      + E +++L   L    KP  ++ +    Q  D+  P  C I+D ++S
Sbjct  69   QTISDGLTTDHPRTGERVMDLFEGLKATAKPIFRELVISRGQGSDTLPPVNCIIADGIMS  128

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  525
              +D++ E    +P+  FRTISAC+FW YFS   L E+GELP+KGN +D   +T + GME
Sbjct  129  FTIDIANEV--GIPIISFRTISACSFWAYFSALKLIESGELPLKGNDMDQL-VTSIPGME  185

Query  526  DFLR  537
             FLR
Sbjct  186  GFLR  189



>ref|XP_002276823.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Vitis 
vinifera]
Length=480

 Score =   137 bits (345),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 108/184 (59%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFPFPAQ H+NSMLKLA LL ++  H+TF        RLL  TD+ + RF+    FR 
Sbjct  10   VLIFPFPAQGHVNSMLKLAELLSVAGLHVTFLNSEYNQHRLLLHTDIQT-RFSGYPGFRF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYI---AQNHDSGLPFTCFISDLLVS  345
            Q+   G+      + E +++L   L    KP  ++ +    Q  D+  P  C I+D ++S
Sbjct  69   QTISDGLTTDHPRTGERVMDLFEGLKATAKPIFRELVISRGQGSDTLPPVNCIIADGIMS  128

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  525
              +D++ E    +P+  FRTISAC+FW YFS   L E+GELP+KGN +D   +T + GME
Sbjct  129  FTIDIANEV--GIPIISFRTISACSFWAYFSALKLIESGELPLKGNDMDQL-VTSIPGME  185

Query  526  DFLR  537
             FLR
Sbjct  186  GFLR  189



>ref|XP_010658496.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Vitis 
vinifera]
Length=480

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 107/184 (58%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +L+FPFP Q H+NSMLKLA LL L+   ITF      H+RLL  T++   RFT    FR 
Sbjct  10   VLVFPFPIQGHVNSMLKLAELLSLAGLRITFLNSYYTHSRLLRYTNI-LDRFTRYPGFRF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYI---AQNHDSGLPFTCFISDLLVS  345
            Q+   G+      + E +++L   L    KP  ++ +    Q  D+  P  C I+D ++S
Sbjct  69   QTISDGLTTDHPRTGERVMDLFEGLKATAKPIFRELVISRGQGSDTLPPVNCIIADGIMS  128

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  525
              +D++ E    +P+  FRTISAC+FW YFS   L E+GELP+KGN +D   +T + GME
Sbjct  129  FTIDIANEV--GIPIISFRTISACSFWAYFSALKLIESGELPLKGNDMDQL-VTSIPGME  185

Query  526  DFLR  537
             FLR
Sbjct  186  GFLR  189



>ref|XP_010262685.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010262687.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010262688.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010262689.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
Length=483

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 108/184 (59%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTR--FRL  174
            +L+ P P Q H+NSMLKL+ L+ L+ FH+TF    +IH  LL  T+V S RF     F  
Sbjct  11   VLVLPIPLQGHINSMLKLSELISLAGFHVTFLNTEHIHRLLLHFTNVTS-RFARWPGFHF  69

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNH---DSGLPFTCFISDLLVS  345
             + P G+      S  GL+EL  SL     P L++ +  N    D   P TC I+D ++S
Sbjct  70   ATIPDGLPFDHPRSGPGLVELFDSLKITSIPLLREMLVSNRWGSDVRPPVTCIIADGIMS  129

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  525
              +DV+ +   ++P  +FRT+SAC+FW YF +P L EAGE+P +   +D  PIT V GME
Sbjct  130  FTIDVARDL--NIPTIFFRTVSACSFWAYFCVPKLIEAGEIPFRDADMD-CPITCVPGME  186

Query  526  DFLR  537
            +FLR
Sbjct  187  NFLR  190



>gb|AGX93067.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Cinchona 
calisaya]
Length=483

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 110/185 (59%), Gaps = 10/185 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q H+NSML+LA LL LS+  ITF V    H RLL  T V + RF     FR 
Sbjct  13   VLIFPLPIQGHVNSMLRLAELLCLSDLDITFIVSEFSHNRLLKHTSV-ALRFARYPGFRF  71

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNH----DSGLPFTCFISDLLV  342
            Q+   G+ D    + E ++++  ++  +  P  K+ + + +     +  P TC I+D ++
Sbjct  72   QTISDGLPDDHPRAGEQVMDIMPAIKNVTGPLFKRMMIEKNCFASANRRPITCIIADGVL  131

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
            S A D +E+    +P+ YFRT+SAC+FW  F +P L EAG++P+KG G+D  P+  V GM
Sbjct  132  SFAGDFAEQ--KRIPLVYFRTVSACSFWACFCMPQLIEAGDIPVKGEGMD-LPVKSVPGM  188

Query  523  EDFLR  537
            E FLR
Sbjct  189  EGFLR  193



>ref|XP_002276617.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Vitis 
vinifera]
 ref|XP_010658495.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Vitis 
vinifera]
Length=478

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 107/184 (58%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFPFP+Q H+NSMLKLA LL +   H+TF        RL   TD+ + RF+    FR 
Sbjct  10   VLIFPFPSQGHVNSMLKLAELLSVVGLHVTFLNSDYNQHRLFLHTDIQT-RFSRYPGFRF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYI---AQNHDSGLPFTCFISDLLVS  345
            Q+   G+      + E +++L   L    KP  ++ +    Q  D+  P +C I+D ++S
Sbjct  69   QTISDGLTTDHPRTGERVMDLFEGLKATAKPIFRELMISRGQGSDTRPPVSCIIADGMMS  128

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  525
              +D++ E    +P+  FRT+SAC+FW YFS   L E+GELP+KGN +D   +T + GME
Sbjct  129  FTIDIANEV--GIPIISFRTVSACSFWAYFSALKLIESGELPLKGNDMDQL-VTSIPGME  185

Query  526  DFLR  537
             FLR
Sbjct  186  GFLR  189



>ref|XP_002276771.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=480

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 107/184 (58%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFPFP+Q H+NSMLKLA LL +   H+TF        RL   TD+ + RF+    FR 
Sbjct  10   VLIFPFPSQGHVNSMLKLAELLSVVGLHVTFLNSDYNQHRLFLHTDIQT-RFSRYPGFRF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYI---AQNHDSGLPFTCFISDLLVS  345
            Q+   G+      + E +++L   L    KP  ++ +    Q  D+  P +C I+D ++S
Sbjct  69   QTISDGLTTDHPRTGERVMDLFEGLKATAKPIFRELMISRGQGSDTRPPVSCIIADGMMS  128

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  525
              +D++ E    +P+  FRT+SAC+FW YFS   L E+GELP+KGN +D   +T + GME
Sbjct  129  FTIDIANEV--GIPIISFRTVSACSFWAYFSALKLIESGELPLKGNDMDQL-VTSIPGME  185

Query  526  DFLR  537
             FLR
Sbjct  186  GFLR  189



>gb|AIE12477.1| UGT4 [Panax ginseng]
Length=478

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 106/186 (57%), Gaps = 14/186 (8%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q  +NSM KLA LL L+  HITF V   IH RLL  TD+ S RF     FRL
Sbjct  11   VLIFPLPLQGPVNSMFKLAELLCLAGIHITFLVTDFIHTRLLRYTDIHS-RFNRYPGFRL  69

Query  175  QSFPPGIYDGALDSKEG--LLELCHSLHTIGKPFLKQYIAQ---NHDSGLPFTCFISDLL  339
            ++   G+ +   D   G  ++EL  SL T  KP  K+ +       D G P TC I+D +
Sbjct  70   ETISDGMPE---DHPRGDRIMELFDSLKTNTKPLFKELLTTGSLGSDKGRPITCIIADGI  126

Query  340  VSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKG  519
            +    DV+ E    +P+ Y RTISAC  W +F LP+L EAGELP  G+ +D +PI  V G
Sbjct  127  MGFTCDVANEI--GIPIIYVRTISACCLWVFFCLPNLIEAGELPFNGDDLD-TPIKSVPG  183

Query  520  MEDFLR  537
             E+ LR
Sbjct  184  TENSLR  189



>gb|AGX93066.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Lonicera 
japonica]
Length=489

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 114/185 (62%), Gaps = 10/185 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +L+FP P Q H+NSMLKLA LL L++  ++F V    H RLL  T+++S RF+    FR 
Sbjct  12   VLVFPLPIQGHVNSMLKLAELLCLADLDVSFMVSDFSHTRLLRHTNIES-RFSKYPGFRF  70

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQN----HDSGLPFTCFISDLLV  342
            Q+   G+ D    + E ++++  S+  +  P  K+ + ++     +   P TC I+D ++
Sbjct  71   QTISDGLPDDHPRAGEKIMDIMPSIKNVTGPLFKKMMEESGCLVAEGRRPVTCIIADGVL  130

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
            S A D++EE    +P+ YFRT+SAC+FW  + + +L EA E+P+KGNG+D   +T V GM
Sbjct  131  SFAGDLAEE--KGIPLIYFRTVSACSFWACYCMEELIEADEIPVKGNGMDLL-VTSVPGM  187

Query  523  EDFLR  537
            + FLR
Sbjct  188  DGFLR  192



>ref|XP_007009131.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
 gb|EOY17941.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
Length=479

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 105/181 (58%), Gaps = 8/181 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +L+FP PAQ H+NSMLKLA L  L+   +TF    + H RL+  TDV   RF    RF+ 
Sbjct  13   VLLFPLPAQGHVNSMLKLAELFALAGLEVTFLNSDHNHERLVRHTDV-GFRFAKYPRFKF  71

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            ++ P G+ +         +EL  S+    KP L++ + + +    P  C I D  + + L
Sbjct  72   ETIPDGLREDHPRLGVSFMELFESMELRTKPILREMLVKINP---PVDCIIGDGALGLVL  128

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            DV++E    +P++ FRTISA   W YF++PD+ EAGELPI+GN      IT+V GME FL
Sbjct  129  DVADEL--GIPIFQFRTISASGIWAYFAIPDMIEAGELPIRGNEDMDRLITRVPGMETFL  186

Query  535  R  537
            R
Sbjct  187  R  187



>ref|XP_009597175.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=489

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 110/192 (57%), Gaps = 17/192 (9%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            ++IFPFP Q H+N MLKLA LL LS  H+TF    +I  RL   TD+ S RF     FR 
Sbjct  10   VVIFPFPVQGHVNPMLKLAELLCLSGIHVTFINTLSIQNRLSRNTDIQS-RFNRFPGFRF  68

Query  175  QSFPPGIYDGALDSKE---GLLELCHSLHTIGKPFLKQYI-AQNHDSGL-------PFTC  321
            ++ P G+ +    + +    ++ +  SL +  KP LK+ I A    SG        P TC
Sbjct  69   ETIPDGLSNKVPQTYQETHKVMVIFDSLRSTAKPILKEIILAAGCPSGSSEVTRQGPVTC  128

Query  322  FISDLLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSP  501
             I+D ++S+AL+V+E+    +P+ YFRT SA +FW Y  LP L + GELP  GN +D  P
Sbjct  129  VIADGILSVALEVAEDV--GIPILYFRTASAASFWIYLCLPQLIQNGELPFPGNELD-VP  185

Query  502  ITKVKGMEDFLR  537
            I  +KGME  LR
Sbjct  186  IASIKGMESLLR  197



>gb|KDO69251.1| hypothetical protein CISIN_1g011832mg [Citrus sinensis]
Length=476

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 106/182 (58%), Gaps = 9/182 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFT--TRFRL  174
            ILIFP P QSH+NSMLKLA +  L+   +TF    + H RL+  TD+   RF   + F+ 
Sbjct  10   ILIFPLPCQSHMNSMLKLAEIFGLAGLKVTFLNSKHNHERLIRYTDIHD-RFLQYSEFQF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            ++   G+      + + L+E+  SL    +P LKQ +    D+  P +C I D  +   +
Sbjct  69   KTISDGLPADHPRAGDQLMEMFDSLSLNTRPLLKQMLI---DTSPPVSCIIGDACMEFVV  125

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSP-ITKVKGMEDF  531
            DV+ E    +PV +FR ISAC+FW YFS+P++ +AGELP+K    D    ITKV GME F
Sbjct  126  DVATEL--EIPVIHFRAISACSFWAYFSIPEMIQAGELPMKAYDEDMDRLITKVPGMETF  183

Query  532  LR  537
            LR
Sbjct  184  LR  185



>ref|XP_007009133.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
 gb|EOY17943.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
Length=481

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 106/181 (59%), Gaps = 8/181 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q H+NSM KLA LL L+ F +TF    + H RL+  T+V S  F +   F  
Sbjct  13   VLIFPLPLQGHVNSMFKLAELLALTGFKVTFLYSEHNHGRLVKYTNV-SAHFASYPGFEF  71

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            ++ P G+ D    S +  LE+ +++ T  K  L++ +   +    P  C I D  +   L
Sbjct  72   RTVPDGLPDDHPRSGDWFLEMYYAMETKAKLSLREMLLNINP---PVDCIIGDGFLGFVL  128

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            DV++E    +PV+YFRT SAC FW Y+S+PD+ +AGE+PI+G    +  IT V GME FL
Sbjct  129  DVAKEL--GIPVFYFRTSSACCFWAYYSIPDIIQAGEIPIRGIEDMNRLITTVPGMETFL  186

Query  535  R  537
            R
Sbjct  187  R  187



>ref|XP_011038346.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Populus 
euphratica]
Length=481

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 104/181 (57%), Gaps = 8/181 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q H+NSMLKLA LL L+  +ITF    + H  L   T+++  RFT    F+ 
Sbjct  11   VLIFPLPCQGHVNSMLKLAELLSLAGINITFLNSEHNHELLARHTNIED-RFTKYPGFQF  69

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            Q+   G+      S + L+EL  ++  + KP  K+ + +      P  C I D ++    
Sbjct  70   QTIADGLPVDHPRSGDRLMELFDAMKVVAKPIFKKILLETKP---PVNCIIGDGVLGFVG  126

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            DV+ E    +P+ YFRTISAC+FW YFS+ D+ E G+LPI+GN      ITKV GME FL
Sbjct  127  DVAIEV--GVPIIYFRTISACSFWAYFSISDIIEGGQLPIRGNEDMDRLITKVPGMETFL  184

Query  535  R  537
            R
Sbjct  185  R  185



>gb|AIS39472.1| flavonoid UDP-glucosyltransferase 3 [Citrus x paradisi]
Length=476

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 106/182 (58%), Gaps = 9/182 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFT--TRFRL  174
            ILIFP P QSH+NSMLKLA +  L+   +TF    + H RL+  TD+   RF   + F+ 
Sbjct  10   ILIFPLPCQSHVNSMLKLAEIFGLAGLKVTFLNSKHNHERLIRYTDIHD-RFLQYSEFQF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            ++   G+      + + L+E+  SL    +P LKQ +    D+  P +C I D  +   +
Sbjct  69   KTISDGLPADHPRAGDRLMEIFDSLSLNTRPLLKQMLI---DTSPPVSCIIGDACMEFVV  125

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSP-ITKVKGMEDF  531
            DV+ E    +PV +FR ISAC+FW YFS+P++ +AGELP+K    D    ITKV GME F
Sbjct  126  DVATEL--EIPVIHFRAISACSFWAYFSIPEMIQAGELPMKAYDEDMDRLITKVPGMETF  183

Query  532  LR  537
            LR
Sbjct  184  LR  185



>ref|XP_002280470.2| PREDICTED: LOW QUALITY PROTEIN: 7-deoxyloganetic acid glucosyltransferase-like 
[Vitis vinifera]
Length=479

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 109/185 (59%), Gaps = 10/185 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFPFP Q ++NSMLKLA LL L+   +TF      H RLL+ +++ + RF+    FR 
Sbjct  10   VLIFPFPIQGNVNSMLKLAELLCLAGIQVTFLNCHYPHRRLLSYSNIQA-RFSRYPGFRF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKP-FLKQYIA---QNHDSGLPFTCFISDLLV  342
            ++   G+      + E  L++   + T  KP F+K  I+      D+  P TC I+D L+
Sbjct  69   ETISDGLPMEHPRTAEQFLDIVDGVKTTTKPLFMKMMISWCRSASDTRSPLTCVIADGLM  128

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
            S A+DV+ E    LPV  FR ISAC+FW YFSLP L EAGE+P +G  +D   +  V GM
Sbjct  129  SFAIDVANEV--GLPVIIFRAISACSFWAYFSLPQLIEAGEVPFRGGDMDRL-VASVPGM  185

Query  523  EDFLR  537
            E FLR
Sbjct  186  EGFLR  190



>ref|XP_006486448.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Citrus sinensis]
Length=476

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 106/182 (58%), Gaps = 9/182 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFT--TRFRL  174
            ILIFP P QSH+NSMLKLA +  L+   +TF    + H RL+  TD+   RF   + F+ 
Sbjct  10   ILIFPLPCQSHVNSMLKLAEIFGLAGLKVTFLNSKHNHERLIRYTDIHD-RFLQYSEFQF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            ++   G+      + + L+E+  SL    +P LKQ +    D+  P +C I D  +   +
Sbjct  69   KTISDGLPADHPRAGDRLMEIFDSLSLNTRPLLKQMLI---DTSPPVSCIIGDACMEFVV  125

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSP-ITKVKGMEDF  531
            DV+ E    +PV +FR ISAC+FW YFS+P++ +AGELP+K    D    ITKV GME F
Sbjct  126  DVATEL--EIPVIHFRAISACSFWAYFSIPEMIQAGELPMKAYDEDMDRLITKVPGMETF  183

Query  532  LR  537
            LR
Sbjct  184  LR  185



>ref|XP_006435571.1| hypothetical protein CICLE_v10031408mg [Citrus clementina]
 gb|ESR48811.1| hypothetical protein CICLE_v10031408mg [Citrus clementina]
Length=476

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 106/182 (58%), Gaps = 9/182 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFT--TRFRL  174
            ILIFP P QSH+NSMLKLA +  L+   +TF    + H RL+  TD+   RF   + F+ 
Sbjct  10   ILIFPLPCQSHVNSMLKLAEIFGLAGLKVTFLNSKHNHERLIRYTDIHD-RFLQYSEFQF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            ++   G+      + + L+E+  SL    +P LKQ +    D+  P +C I D  +   +
Sbjct  69   KTISDGLPADHPRAGDRLMEIFDSLSLNTRPLLKQMLI---DTSPPVSCIIGDACMEFVV  125

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSP-ITKVKGMEDF  531
            DV+ E    +PV +FR ISAC+FW YFS+P++ +AGELP+K    D    ITKV GME F
Sbjct  126  DVATEL--EIPVIHFRAISACSFWAYFSIPEMIQAGELPMKAYDEDMDRLITKVPGMETF  183

Query  532  LR  537
            LR
Sbjct  184  LR  185



>ref|XP_009802463.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=480

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 102/183 (56%), Gaps = 6/183 (3%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVD-SGRFTTRFRLQ  177
            +LIFPFP Q H+N MLKLA LL     H+TF     IH RLL+ TD+  S +       +
Sbjct  11   VLIFPFPVQGHVNCMLKLAQLLCREGLHVTFLNSDFIHRRLLSYTDIHLSYKQYPNLYFE  70

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGL---PFTCFISDLLVSI  348
            + P G+ D    + + +++L +S+ TI KP L + +     S L   P TC I+D ++  
Sbjct  71   TIPDGLSDDHPRTGDRVVDLFNSIDTITKPLLMEMLIARRFSTLDRPPLTCIITDGIMCF  130

Query  349  ALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMED  528
             +D+  E   ++P   FRTISA  FW +F LP L E GELPI G     + +T V GME 
Sbjct  131  TIDIGREL--NIPTILFRTISASCFWAFFCLPRLIEGGELPITGQSDMDTLLTNVAGMES  188

Query  529  FLR  537
            FLR
Sbjct  189  FLR  191



>gb|AGX93069.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Rauvolfia 
serpentina]
Length=482

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 112/185 (61%), Gaps = 10/185 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q H+NSML+LA LL L+   ITF V    H+RL+  TDV S RF     FR 
Sbjct  12   VLIFPLPIQGHVNSMLRLAELLCLAELDITFVVSEFSHSRLIKHTDVAS-RFARYPGFRF  70

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNH----DSGLPFTCFISDLLV  342
            Q+   G+ D    + E ++++  S   +  P  KQ + + +     +  P TC I+D ++
Sbjct  71   QTISDGLADDHPRAGERVMDILPSTKNVTGPLFKQMMLEKNCFASATRRPITCIIADGVL  130

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
            S A D +EE    +P+ YFRT+SAC+FW  F +P+L EAG++PIKGNG+D + +  V GM
Sbjct  131  SFAGDFAEE--KGIPLIYFRTVSACSFWACFCMPELIEAGDIPIKGNGMDLT-VKSVPGM  187

Query  523  EDFLR  537
            E FLR
Sbjct  188  ETFLR  192



>ref|XP_002281029.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=475

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 100/181 (55%), Gaps = 6/181 (3%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFT--TRFRL  174
            +L+FPFP Q H+NSMLKLA LL L+   ITF      H+RLL  T++   RFT    FR 
Sbjct  10   VLVFPFPIQGHVNSMLKLAELLSLAGLRITFLNSDYTHSRLLRYTNI-LDRFTRYAGFRF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            Q+   G+      +   L ++   +    KP  ++ I     S  P TC I+D ++  A+
Sbjct  69   QTISDGLPLDHPRTGVQLKDMFDGMKATTKPLFREMIMSWCRSSDPVTCIIADGIMGFAI  128

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            DV  E    +P   FRT S CAFW YFSLP L EAGE+P K + +D   +T V GME FL
Sbjct  129  DVGNEV--GVPTISFRTSSPCAFWAYFSLPQLIEAGEVPFKDDDMDQL-VTSVPGMEGFL  185

Query  535  R  537
            R
Sbjct  186  R  186



>ref|XP_006435573.1| hypothetical protein CICLE_v10031368mg [Citrus clementina]
 ref|XP_006486447.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
 gb|ESR48813.1| hypothetical protein CICLE_v10031368mg [Citrus clementina]
Length=484

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 104/181 (57%), Gaps = 7/181 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LI+P PA  H+NSMLKLA LL  +   ITF    + H RL+  +     R+     F+ 
Sbjct  18   VLIWPLPALGHVNSMLKLAELLSHAGIKITFLNSEHYHERLVRHSSDVFSRYMNLPGFQF  77

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            ++   G+      + +   EL +SL ++  P LK  +    D+  P  C ISD L+S A+
Sbjct  78   KTITDGLPKDHPQTVDNFHELLNSLASVTPPLLKDMLT---DAKSPVHCIISDGLMSFAI  134

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            DV+++    +P+ YFRT+SACAFW YF +P++ +AGELPIKGN      I  V GME FL
Sbjct  135  DVAKQV--GIPIIYFRTVSACAFWAYFCIPEIIDAGELPIKGNEDMDRLIKHVPGMEKFL  192

Query  535  R  537
            R
Sbjct  193  R  193



>gb|ACS87994.1| UDP-glucosyltransferase family 1 protein [Citrus sinensis]
Length=484

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 104/181 (57%), Gaps = 7/181 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LI+P PA  H+NSMLKLA LL  +   ITF    + H RL+  +     R+     F+ 
Sbjct  18   VLIWPLPALGHVNSMLKLAELLSHAGIKITFLNSEHYHERLVRHSSDVFSRYMNLPGFQF  77

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            ++   G+      + +   EL +SL ++  P LK  +    D+  P  C ISD L+S A+
Sbjct  78   KTITDGLPKDHPQTVDNFHELLNSLASVTPPLLKDMLT---DAKSPVHCIISDGLMSFAI  134

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            DV+++    +P+ YFRT+SACAFW YF +P++ +AGELPIKGN      I  V GME FL
Sbjct  135  DVAKQV--GIPIIYFRTVSACAFWAYFCIPEIIDAGELPIKGNEDMDRLIKHVPGMEKFL  192

Query  535  R  537
            R
Sbjct  193  R  193



>ref|XP_002280624.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=479

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 106/185 (57%), Gaps = 10/185 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFPFP Q ++NSMLKLA LL L++  +TF      H RLL+ +++ + RF+    FR 
Sbjct  10   VLIFPFPIQGNINSMLKLAELLCLADIQVTFLNCHYPHRRLLSYSNIQA-RFSRYPGFRF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQ----YIAQNHDSGLPFTCFISDLLV  342
            ++   G+      + E  L++   + T   P   +    +     D+  P TC I+D L+
Sbjct  69   ETISDGLPMEHPRTAEQFLDIVDGVKTTTAPLFMEMMISWCRSASDTRSPLTCIIADGLM  128

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
            S A+DV+ E    LPV  FR ISAC+FW YFSLP L EAGE+P +G  +D   +  V GM
Sbjct  129  SFAIDVANEV--GLPVIIFRPISACSFWAYFSLPQLIEAGEVPFRGGDMDRL-VASVPGM  185

Query  523  EDFLR  537
            E FLR
Sbjct  186  EGFLR  190



>emb|CDP04614.1| unnamed protein product [Coffea canephora]
Length=495

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 102/186 (55%), Gaps = 10/186 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS--GRFTTRFRL  174
            +LIFP P QS +NSMLKLA LL L+   +TF    + H RLL  T++ S   ++  RF L
Sbjct  11   VLIFPLPIQSPVNSMLKLAELLCLAGHRVTFLNTKHNHNRLLRCTNIQSRLDQYQGRFLL  70

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQ-----NHDSGLPFTCFISDLL  339
            +    G+ D    + E   E+  SL ++ +PFL++ +       N     P TC I+D  
Sbjct  71   EKVDDGLPDEDPRTAEQFTEILDSLQSVAEPFLREVLCGERFSCNSSKRPPITCIIADGS  130

Query  340  VSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKG  519
                LDV+EE    +P+ +F TIS C  W Y  +P L EAGELP KGN +D+  +  + G
Sbjct  131  YYYVLDVAEEM--GIPLIFFETISPCCLWVYMCVPKLIEAGELPFKGNDLDAE-VRSIPG  187

Query  520  MEDFLR  537
            ME  LR
Sbjct  188  MEGLLR  193



>gb|KDP44850.1| hypothetical protein JCGZ_01350 [Jatropha curcas]
Length=490

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 104/181 (57%), Gaps = 12/181 (7%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTR--FRL  174
            +LIFPFPAQ H+NSMLKLA LL LS   ITF    +    L   TD+ + RF     FR 
Sbjct  12   VLIFPFPAQGHVNSMLKLAELLSLSGLTITFLNTQHSQECLARFTDIKA-RFLKYPGFRF  70

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
             + P  +    +DS   + ++  +L    KP +++ + +   S     CFI D ++    
Sbjct  71   VTVPDSL---PIDSG-NVAKVLDALKLESKPVIEKLLIE---SNPRINCFIVDGILGFVT  123

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            D++ E    +P+ YFRTISACAFW+YF +PD+ EAGELPIKG       ITKV GME FL
Sbjct  124  DLASEL--AIPIIYFRTISACAFWSYFCIPDMIEAGELPIKGEEEMDRLITKVPGMETFL  181

Query  535  R  537
            R
Sbjct  182  R  182



>ref|XP_006379615.1| hypothetical protein POPTR_0008s06270g [Populus trichocarpa]
 gb|ERP57412.1| hypothetical protein POPTR_0008s06270g [Populus trichocarpa]
Length=481

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 102/181 (56%), Gaps = 8/181 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q H+NSMLKLA LL L+  +ITF    + H  L   T+++  RFT    F+ 
Sbjct  11   VLIFPLPCQGHVNSMLKLAELLSLAGINITFLNSEHNHELLARYTNIED-RFTKYPGFQF  69

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            Q+   G+      S   L+EL  ++  + KP  K+ + +      P  C I D ++    
Sbjct  70   QTIADGLPVDHPRSGGKLMELFEAMKLVTKPVFKKILLETKP---PVNCIIGDGILGFVG  126

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            DV+ E    +P  YFRT+SAC+FW YFS+ D+ E G+LPI+GN      ITKV GME FL
Sbjct  127  DVAIEV--GVPFIYFRTVSACSFWAYFSIFDIIEGGQLPIRGNEDMDRLITKVPGMETFL  184

Query  535  R  537
            R
Sbjct  185  R  185



>dbj|BAP90373.1| UDP-glycose: glycosyltransferase UGT709H1 [Fagopyrum esculentum]
Length=482

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 103/182 (57%), Gaps = 7/182 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS--GRFTTRFRL  174
            +LIFP P   H+N MLKLA LL L+  ++TF   +  H RLL  TDV++   RF   FR 
Sbjct  13   VLIFPVPMLGHINPMLKLAQLLCLAKLNVTFLNTAYNHRRLLQYTDVEARLARFPG-FRF  71

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDS-GLPFTCFISDLLVSIA  351
            +  P G+ D    S E   E+  SL     P LK+ + +  D    P TCFI+D +   A
Sbjct  72   EIIPDGLPDDHPRSGERANEVYRSLELTATPILKEILIRLRDDLNSPVTCFIADGMFGYA  131

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  531
             DV EE    +PV  FRTIS+C FW YF++P+L +A ++P + + +D   +  + GME F
Sbjct  132  YDVGEEV--GIPVIAFRTISSCCFWIYFNMPNLIDAEQIPFQDDDLDEL-VNNIPGMEAF  188

Query  532  LR  537
            LR
Sbjct  189  LR  190



>ref|XP_009608691.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=480

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 104/183 (57%), Gaps = 6/183 (3%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVD-SGRFTTRFRLQ  177
            +LIFPFP Q H+N MLKLA LL     H+TF     IH RLL+ T++  S +       +
Sbjct  11   VLIFPFPVQGHVNCMLKLAQLLCREGLHVTFLNSDFIHRRLLSYTNIHLSYKQYPNLYFE  70

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKP-FLKQYIAQNHD--SGLPFTCFISDLLVSI  348
            + P G+ D    + + +++L +S+ T+ KP F++  IA+        P TC I+D ++  
Sbjct  71   TIPDGLPDDHPRTGDRVVDLFNSIDTVTKPRFMEMLIARRFSILDRPPLTCIIADGIMCF  130

Query  349  ALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMED  528
             +D+  E   ++P   FRT+SA  FW +F LP L EAGELPI G     + +T V GME 
Sbjct  131  TIDIGREL--NIPTILFRTVSASCFWAFFCLPRLIEAGELPITGQSDMDTLLTNVVGMET  188

Query  529  FLR  537
            FLR
Sbjct  189  FLR  191



>gb|AFJ53009.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=485

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 102/183 (56%), Gaps = 9/183 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS--GRFTTRFRL  174
            +LIFP+P Q H+ SML LA LL LSN  +TFF   +I  RLL  T V S   ++   F  
Sbjct  11   VLIFPYPLQGHVTSMLNLAELLCLSNIRVTFFNSDHIQRRLLQFTSVQSRFAKYPYLFHF  70

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            Q+   G+      S + +L+L  S+ +I +P  K+ +  N     P  C ISD  +   +
Sbjct  71   QTISDGLPPDHSRSGKDVLDLFLSMSSITRPLFKELLISNQP---PIDCVISDGGLEFTV  127

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGID--SSPITKVKGMED  528
            +V++E    +P+ YFRTI A  FW YF +PD+ EAGELPI+    +     ITKV G E 
Sbjct  128  EVADEV--GIPLVYFRTIGASCFWVYFCIPDIIEAGELPIRVEEEEDMERVITKVPGAEG  185

Query  529  FLR  537
            FLR
Sbjct  186  FLR  188



>ref|XP_002280528.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=479

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 104/185 (56%), Gaps = 10/185 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFPFP Q ++NSMLKL  LL L+   +TF      H RLL+ +++ + RF+    FR 
Sbjct  10   VLIFPFPIQGNVNSMLKLTELLCLAGIQVTFLNCHYPHRRLLSYSNIQA-RFSRYPGFRF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQ----YIAQNHDSGLPFTCFISDLLV  342
            ++   G+      + E  L++   + T   P   +    +     D+  P TC I+D L+
Sbjct  69   ETISDGLPMEHPRTAEQFLDIVDGVKTTTAPLFMEMMISWCRSASDTRSPLTCIIADGLM  128

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
            S ++DV+ E    LPV  FR ISAC+FW YFSLP L EAGE+P +G  +D   +  V GM
Sbjct  129  SFSIDVANEV--GLPVIIFRAISACSFWAYFSLPQLIEAGEVPFRGGDMDRL-VASVPGM  185

Query  523  EDFLR  537
            E FLR
Sbjct  186  EGFLR  190



>ref|XP_007009137.1| UDP-glucosyltransferase family 1 protein, putative [Theobroma 
cacao]
 gb|EOY17947.1| UDP-glucosyltransferase family 1 protein, putative [Theobroma 
cacao]
Length=460

 Score =   123 bits (309),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 106/189 (56%), Gaps = 16/189 (8%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS--GRFTTRFRL  174
            +LIFP P Q H+NSM KLA LL L+ F +TF    + H RL+  T++ +   R+   F  
Sbjct  13   VLIFPLPLQGHVNSMFKLAELLALTGFKVTFLNSEHNHGRLVKHTNISAHFARYPG-FEF  71

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            ++ P G+ D    S    LE+ +++ T  K  L++ +   +    P  C I D  +   L
Sbjct  72   RTVPDGLPDDHPRSGNWFLEMYYAMETKAKLSLREMLLNINP---PVDCIIGDGFLGFVL  128

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG------NGIDSSP--ITK  510
            DV++E    +PV+Y RT SAC FW Y+S+PD+ +AGE+PIKG       GI+     IT 
Sbjct  129  DVAKEL--GIPVFYCRTSSACCFWAYYSIPDIIQAGEIPIKGVFVKKLKGIEDMDRLITT  186

Query  511  VKGMEDFLR  537
            V GME FLR
Sbjct  187  VPGMETFLR  195



>gb|AGX93072.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Catharanthus 
longifolius]
Length=482

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 110/185 (59%), Gaps = 10/185 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q H+NSML+LA LL L+   ITF V    H+RL+  T+V S RF     F+ 
Sbjct  12   VLIFPLPIQGHVNSMLRLAELLCLAELDITFIVSEFSHSRLIKHTNVAS-RFARYPGFQF  70

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNH----DSGLPFTCFISDLLV  342
            Q    G+ D    + E ++++  S   +  P  KQ + +N      +  P TC I+D ++
Sbjct  71   QPISDGLPDDHPRAGERVMDILPSTKNVTGPLFKQMMVENKCFSSATRRPITCIIADGVL  130

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
            S A D ++E    +P+ YFRT+SAC+FW  F +P+L E+G++PIKGNG+D   +  V GM
Sbjct  131  SFAGDFAQE--KGIPLIYFRTVSACSFWACFCMPELIESGDIPIKGNGMDLI-VKSVPGM  187

Query  523  EDFLR  537
            E FLR
Sbjct  188  ETFLR  192



>sp|U3U992.1|UGT8_CATRO RecName: Full=7-deoxyloganetic acid glucosyltransferase; AltName: 
Full=UDP-glucose glucosyltransferase 8; Short=CrUGT8; AltName: 
Full=UDP-glycosyltransferase 709C2 [Catharanthus roseus]
 dbj|BAO01109.1| UDP-glucose iridoid glucosyltransferase [Catharanthus roseus]
Length=482

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 110/185 (59%), Gaps = 10/185 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q H+NSML+LA LL L+   ITF V    H+RL+  T+V S RF     F+ 
Sbjct  12   VLIFPLPIQGHVNSMLRLAELLCLAELDITFIVSEFSHSRLIKHTNVAS-RFARYPGFQF  70

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNH----DSGLPFTCFISDLLV  342
            Q    G+ D    + E ++++  S   +  P  KQ + +N      +  P TC I+D ++
Sbjct  71   QPISDGLPDDHPRAGERVMDILPSTKNVTGPLFKQMMVENKCFSSATRRPITCIIADGVL  130

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
            S A D ++E    +P+ YFRT+SAC+FW  F +P+L E+G++PIKGNG+D   +  V GM
Sbjct  131  SFAGDFAQE--KGIPLIYFRTVSACSFWACFCMPELIESGDIPIKGNGMDLI-VKSVPGM  187

Query  523  EDFLR  537
            E FLR
Sbjct  188  ETFLR  192



>gb|AFJ53010.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=459

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 101/184 (55%), Gaps = 10/184 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS--GRFTTRFRL  174
            +LIFP+P Q H+ SML LA LL LSN  +TFF   +I  RLL  T V S   ++   F  
Sbjct  11   VLIFPYPLQGHVTSMLNLAELLCLSNIRVTFFNSDHIQRRLLQFTSVQSRFAKYPYLFHF  70

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            Q+   G+      S + +L+L  S+ TI +P  K+ +  N     P  C ISD  +   +
Sbjct  71   QTISDGLPSDHSRSGKDVLDLFLSMSTITRPLFKELLLSNQP---PIDCVISDGGLEFTV  127

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGID---SSPITKVKGME  525
            +V++E    +P+ YFRTI A  FW YF +PD+ EAGELPI+    +      ITKV G E
Sbjct  128  EVADEV--GIPLVYFRTIGASCFWIYFCIPDMIEAGELPIRVEVEEEDMERVITKVPGAE  185

Query  526  DFLR  537
              LR
Sbjct  186  GVLR  189



>gb|AGX93065.1| 7-deoxyloganetic acid UDP-glucosyltransferase [Catharanthus roseus]
 gb|AGX93073.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Catharanthus 
ovalis]
 gb|AHK60835.1| 7-deoxyloganetic acid-O-glucosyl transferase [Catharanthus roseus]
Length=482

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 110/185 (59%), Gaps = 10/185 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q H+NSML+LA LL L+   ITF V    H+RL+  T+V S RF     F+ 
Sbjct  12   VLIFPLPIQGHVNSMLRLAELLCLAELDITFIVSEFSHSRLIKHTNVAS-RFARYPGFQF  70

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNH----DSGLPFTCFISDLLV  342
            Q    G+ D    + E ++++  S   +  P  KQ + +N      +  P TC I+D ++
Sbjct  71   QPISDGLPDDHPRAGERVMDILPSTKNVTGPLFKQMMVENKCFSSATRRPITCIIADGVL  130

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
            S A D ++E    +P+ YFRT+SAC+FW  F +P+L E+G++PIKGNG+D   +  V GM
Sbjct  131  SFAGDFAQE--KGIPLIYFRTVSACSFWACFCMPELIESGDIPIKGNGMDLI-VKSVPGM  187

Query  523  EDFLR  537
            E FLR
Sbjct  188  ETFLR  192



>gb|AGX93068.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Amsonia 
hubrichtii]
Length=482

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 111/185 (60%), Gaps = 10/185 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q H+NSML+LA LL L+   ITF V    H+RL+  T++ S RF     F+ 
Sbjct  12   VLIFPLPIQGHVNSMLRLAELLCLAELDITFIVSEFSHSRLVKHTNIAS-RFARYPGFQF  70

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNH----DSGLPFTCFISDLLV  342
            Q+   G+ D    + E ++++  +   +  P  KQ + + +     +  P TC I+D ++
Sbjct  71   QTISDGLPDDHPRAGERVMDILPATKNVTGPLFKQMMVEKNFFATTTRRPITCIIADGVL  130

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
            S A D +EE    +P+ YFRT+SAC+FW  F +P+L EAG++PIKGNG+D   +  V GM
Sbjct  131  SFAGDFAEE--TGIPLIYFRTVSACSFWACFCMPELIEAGDIPIKGNGMDLI-VKSVPGM  187

Query  523  EDFLR  537
            E FLR
Sbjct  188  ECFLR  192



>ref|XP_008811497.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Phoenix dactylifera]
Length=499

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 99/184 (54%), Gaps = 7/184 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT-RFRLQ  177
            +LIFPFPAQ H+N MLKL  LL  +  H+TF      H RL   +   +    + RFR +
Sbjct  17   VLIFPFPAQGHVNCMLKLGELLTKTGLHVTFLNTDYNHHRLSRYSAAYALLAESPRFRFE  76

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQN--HDSGL--PFTCFISDLLVS  345
            S P G+ D    S   L++L  SL        ++ + +    D G   P TC I+D +++
Sbjct  77   SIPDGLADEDPRSVLHLMDLEESLRVRSAVLYRELLIKRGRRDDGKWPPVTCVIADGIMT  136

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  525
             A+D++EE    +P   FRT+SAC+FW YF LP L ++GELP         P+  V GME
Sbjct  137  FAVDIAEEL--GIPAIAFRTVSACSFWAYFRLPQLLQSGELPFPDEADLDEPVRSVPGME  194

Query  526  DFLR  537
             FLR
Sbjct  195  AFLR  198



>emb|CDP16024.1| unnamed protein product [Coffea canephora]
Length=483

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 104/184 (57%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +L+FP P Q  +N ML LA L  L + H+TF    ++  RL + +DV+S RF     FR 
Sbjct  12   VLVFPLPLQGPVNCMLNLAELFCLGDLHVTFINTDHVQDRLRSCSDVES-RFERYPNFRF  70

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQN---HDSGLPFTCFISDLLVS  345
             + P G+ + +  +   +L+L  SL  + +P  +  +      H+S  P TC I+D + S
Sbjct  71   HTIPDGLPEDSPRTGGHILKLIQSLEVVSQPIFRAMVTSGSLGHNSEKPATCIIADGIFS  130

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  525
             A+D+++E    +P+ YF TIS C  WTY  +P L EA E P KG+ +D +P++ ++ ME
Sbjct  131  FAVDIAKEI--GVPLIYFDTISPCGLWTYLCIPKLIEAQEFPFKGDDLD-APLSSLQEME  187

Query  526  DFLR  537
              +R
Sbjct  188  CIMR  191



>emb|CBI36709.3| unnamed protein product [Vitis vinifera]
Length=452

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 99/181 (55%), Gaps = 6/181 (3%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q H+N MLKLA LL L+   ITF      H RLL  T++   R+T    FR 
Sbjct  32   VLIFPLPVQGHVNPMLKLAELLSLAGLRITFLNSDYNHHRLLRYTNI-LDRYTRYPGFRF  90

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            Q+   G+      +  GL ++   +    KP  ++ +     S  P TC I+D L+S A+
Sbjct  91   QTISDGLPLDRPRTGAGLRDMMDGIKATTKPLFREMVISWCRSSDPVTCIIADGLMSFAI  150

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            DV+ E    +P+   RT+S C F  YFS  +L EAGE+P K + +D   +T+V GME FL
Sbjct  151  DVANEV--GVPIISCRTVSPCCFLAYFSFAELIEAGEVPFKDDDMDRL-VTRVPGMEGFL  207

Query  535  R  537
            R
Sbjct  208  R  208



>ref|XP_010650608.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=487

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 99/181 (55%), Gaps = 6/181 (3%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q H+N MLKLA LL L+   ITF      H RLL  T++   R+T    FR 
Sbjct  10   VLIFPLPVQGHVNPMLKLAELLSLAGLRITFLNSDYNHHRLLRYTNI-LDRYTRYPGFRF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            Q+   G+      +  GL ++   +    KP  ++ +     S  P TC I+D L+S A+
Sbjct  69   QTISDGLPLDRPRTGAGLRDMMDGIKATTKPLFREMVISWCRSSDPVTCIIADGLMSFAI  128

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            DV+ E    +P+   RT+S C F  YFS  +L EAGE+P K + +D   +T+V GME FL
Sbjct  129  DVANEV--GVPIISCRTVSPCCFLAYFSFAELIEAGEVPFKDDDMDRL-VTRVPGMEGFL  185

Query  535  R  537
            R
Sbjct  186  R  186



>ref|XP_010650643.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=476

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 99/181 (55%), Gaps = 6/181 (3%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q H+N MLKLA LL L+   ITF      H RLL  T++   R+T    FR 
Sbjct  10   VLIFPLPVQGHVNPMLKLAELLSLAGLRITFLNSDYNHHRLLRYTNI-LDRYTRYPGFRF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            Q+   G+      +  GL ++   +    KP  ++ +     S  P TC I+D L+S A+
Sbjct  69   QTISDGLPLDRPWTGAGLRDMMDGIKATTKPLFREMVISWCQSSDPVTCIIADGLMSFAI  128

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            DV+ E    +P+   RT+S C F  YFS  +L EAGE+P K + +D   +T+V GME FL
Sbjct  129  DVANEV--GVPIISCRTVSPCCFLAYFSFAELIEAGEVPFKDDDMDRL-VTRVPGMEGFL  185

Query  535  R  537
            R
Sbjct  186  R  186



>ref|XP_004149949.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis sativus]
 gb|KGN50608.1| hypothetical protein Csa_5G190520 [Cucumis sativus]
Length=478

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 103/181 (57%), Gaps = 9/181 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFPFPAQ H+NSMLKLA LL LS   ITF     IH +L   TD+ S RF+    F+ 
Sbjct  10   VLIFPFPAQGHVNSMLKLAELLTLSGLRITFLNILRIHQKLTLHTDIQS-RFSRFPNFQF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            Q+   G+ +  +D    L++   SL +I  P LKQ +        P TC I D L +  +
Sbjct  69   QTITDGLDNRLIDKFSDLID---SLKSITMPLLKQMLLSGEFGPTP-TCIILDGLFNFIV  124

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            DV  +   ++PV+ FRTISAC+F  Y  +P L E G+LPIKG       I+ + GME+ L
Sbjct  125  DV--DAHPNIPVFSFRTISACSFSAYSFVPKLIEDGQLPIKGEEDMDRIISGMGGMENVL  182

Query  535  R  537
            R
Sbjct  183  R  183



>ref|XP_004171873.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis sativus]
Length=478

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 103/181 (57%), Gaps = 9/181 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFPFPAQ H+NSMLKLA LL LS   ITF     IH +L   TD+ S RF+    F+ 
Sbjct  10   VLIFPFPAQGHVNSMLKLAELLTLSGLRITFLNILRIHQKLTLHTDIQS-RFSRFPNFQF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            Q+   G+ +  +D    L++   SL +I  P LKQ +        P TC I D L +  +
Sbjct  69   QTITDGLDNRLIDKFSDLID---SLKSITMPLLKQMLLSGEFGPTP-TCIILDGLFNFIV  124

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            DV  +   ++PV+ FRTISAC+F  Y  +P L E G+LPIKG       I+ + GME+ L
Sbjct  125  DV--DAHPNIPVFSFRTISACSFSAYSFVPKLIEDGQLPIKGEEDMDRIISGMGGMENVL  182

Query  535  R  537
            R
Sbjct  183  R  183



>emb|CDP19645.1| unnamed protein product [Coffea canephora]
Length=283

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 98/184 (53%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q  +NSMLKLA LL L+  HITF V  ++H RLL   ++ S RF     F+L
Sbjct  11   VLIFPLPLQGPVNSMLKLAELLCLAGLHITFVVTEHMHGRLLRYANIQS-RFECYPGFQL  69

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQ---NHDSGLPFTCFISDLLVS  345
            ++ P G+ +    S+     L  SL + GK   K  +     +H    P +  I+D  + 
Sbjct  70   KTIPDGLPEDDPRSRGKFAVLLDSLKSKGKLIFKDMLTSGCLSHQKRRPVSFIIADGCLG  129

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  525
               D + E    +P+ Y RT+S C  W  F LP L EAGE+P  G+ +D+  I  V GME
Sbjct  130  FTCDAANEV--GIPIVYVRTVSPCCLWVCFCLPRLIEAGEIPFNGDDLDTL-IKGVPGME  186

Query  526  DFLR  537
             FLR
Sbjct  187  SFLR  190



>emb|CAN77812.1| hypothetical protein VITISV_010344 [Vitis vinifera]
Length=642

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 99/181 (55%), Gaps = 6/181 (3%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q H+N MLKLA LL L+   ITF      H RLL  T++   R+T    FR 
Sbjct  10   VLIFPLPVQGHVNPMLKLAELLSLAGLRITFLNSDYNHHRLLRYTNI-LDRYTRYPGFRF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            Q+   G+      +  GL ++   +    KP  ++ +     S  P TC I+D L+S A+
Sbjct  69   QTISNGLPLDRPWTGAGLRDMMDGIKATTKPLFREMVISWCQSSDPVTCIIADGLMSFAI  128

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            DV+ E    +P+   RT+S C F  YFS  +L EAGE+P K + +D   +T+V GME FL
Sbjct  129  DVANEV--GVPIISCRTVSPCCFLAYFSFAELIEAGEVPFKDDDMDRL-VTRVPGMEGFL  185

Query  535  R  537
            R
Sbjct  186  R  186



>ref|XP_010923186.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Elaeis 
guineensis]
Length=484

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 93/185 (50%), Gaps = 9/185 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTR--FRL  174
            +L+FPFP Q  +N MLKLA LL  +  H+TF    + H RL   +   S R   R  FR 
Sbjct  11   VLVFPFPGQGMVNCMLKLADLLSGAGLHVTFLNTHHNHRRLSQFSGALS-RLAQRPKFRF  69

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIG----KPFLKQYIAQNHDSGLPFTCFISDLLV  342
             S P G+ +    S     +L  S+ T      +  L  Y  ++ D   P TC I+D L+
Sbjct  70   ASIPDGLSEEETRSVFNFFDLEESMRTRAATSFRDLLLAYRDKDTDGWPPVTCVIADGLM  129

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
               +DVSEE    +P   FRTISAC  W Y  +P+L E+GE+P         P+  V GM
Sbjct  130  PFTIDVSEEV--GIPAIMFRTISACCVWAYLCIPNLLESGEIPFPEGADLDEPVRGVAGM  187

Query  523  EDFLR  537
            E FLR
Sbjct  188  ESFLR  192



>gb|AGX93070.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Tabernaemontana 
elegans]
Length=482

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 107/185 (58%), Gaps = 10/185 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q H+NSML+LA LL L+   ITF V    H+RLL  T+V S RF     F+ 
Sbjct  12   VLIFPLPIQGHVNSMLRLAELLCLAELDITFIVSEFSHSRLLKHTNVAS-RFARYPGFQF  70

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNH----DSGLPFTCFISDLLV  342
            Q    G+ D    + E ++++  S   +  P  KQ + + +     +  P TC I+D ++
Sbjct  71   QGISDGLPDDHPRAGERVMDILPSTKNVTGPLFKQMMVEKNFFASATRRPITCMIADGVL  130

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
            S   D +E     + + YFRT+SAC+FW  F +P+L EAG++PIKGNG+D   +  V GM
Sbjct  131  SFVGDFAEA--TGISLIYFRTVSACSFWACFCMPELIEAGDIPIKGNGMDLV-VKSVPGM  187

Query  523  EDFLR  537
            + +LR
Sbjct  188  DKYLR  192



>ref|XP_009613526.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=498

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 99/185 (54%), Gaps = 10/185 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDL-SNFHITFFVPSNIHARLLALTDVDSGRFTT--RFR  171
            +LIFP P Q  +N MLKLA L  L  + H+TF    +I  RLL  TDV   RF     F+
Sbjct  27   VLIFPLPLQGPVNCMLKLAELFCLHQDIHVTFLNSEHIQQRLLNCTDVQI-RFKKYPNFK  85

Query  172  LQSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNH---DSGLPFTCFISDLLV  342
            + + P G+ +    + + +  L   +  +  P  ++ +       +S  P TC + D + 
Sbjct  86   IMTIPDGLPEDNPRTGDQVRNLVKGVEDVSSPLFREMVTSGSLSPNSEKPVTCLLVDGIF  145

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
              A+D++EE    +P+ YF TIS CA WTY  +P L EAGE+P KGN +D+  +  V GM
Sbjct  146  PFAVDIAEEI--GIPLLYFDTISPCALWTYLCIPKLIEAGEIPFKGNDLDAL-VNNVPGM  202

Query  523  EDFLR  537
            E  +R
Sbjct  203  EGVIR  207



>ref|XP_009795416.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=478

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 100/186 (54%), Gaps = 11/186 (6%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDL--SNFHITFFVPSNIHARLLALTDVDSGRFTT--RF  168
            +LIFP P Q  +N MLKLA L  L     H+TF    +I  RLL  TDV   RF     F
Sbjct  6    VLIFPLPIQGPVNCMLKLAELFCLHHQEIHVTFLNSEHIQQRLLNCTDVQI-RFKKYPNF  64

Query  169  RLQSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQ---NHDSGLPFTCFISDLL  339
            +  + P G+ +    + + +  L   +  +  P L++ +     + +S  P TC + D +
Sbjct  65   KFMTIPDGLAEDNPRTGDQVRNLVKGVEDVSSPLLREMVTSGLLSPNSEKPVTCLLVDGI  124

Query  340  VSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKG  519
            V+ A+D+++E    +P+ YF TIS CA WT   +P L EAGE+P KGN +D+  +  V G
Sbjct  125  VTFAVDIAKEV--GIPLLYFDTISPCALWTCLCVPKLIEAGEIPFKGNDLDAL-VNNVPG  181

Query  520  MEDFLR  537
            ME  +R
Sbjct  182  MEGVIR  187



>gb|EYU19962.1| hypothetical protein MIMGU_mgv1a005720mg [Erythranthe guttata]
Length=473

 Score =   115 bits (287),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 107/181 (59%), Gaps = 8/181 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q  +NSMLKLA LL L++ H+TF V   I+ARL   +++ + RF++   F +
Sbjct  11   VLIFPLPLQGPVNSMLKLAELLCLADLHVTFLVTDYIYARLQRHSNIQT-RFSSYPGFHI  69

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            ++   G+ +      +  LEL  SL T  KP  K  ++ N   G   +C I+D ++    
Sbjct  70   RTISDGLPENH-PRGDKFLELFESLMTNTKPLFKDMLS-NGSLGSRVSCIIADGILGFTC  127

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            DV+ +    +P++Y RTISA   W +F LP+L +AG+LP +G+ +D + +  V GME +L
Sbjct  128  DVANQI--RVPIFYVRTISAACLWVFFRLPELIQAGDLPFQGDDLDVA-VKSVPGMERYL  184

Query  535  R  537
            R
Sbjct  185  R  185



>ref|XP_011076758.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=475

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 106/181 (59%), Gaps = 12/181 (7%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q  +NS LKLA LL L++  +TF V  +IHARLL  +++ + RF++   FR+
Sbjct  10   VLIFPLPLQGPVNSTLKLAELLCLAHIDVTFLVTDHIHARLLRHSNIQT-RFSSYPGFRI  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            Q+   G+ + A    +  LEL  SL +  KP  K+ +         F+C I+D ++    
Sbjct  69   QTISDGLPE-AHPRGDRFLELFDSLKSKTKPLFKEVLRCGG-----FSCVIADGILGFTC  122

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            DV+ E    +P++Y RTISA   W +F +P + EAGE+P +G+ +D   +  V GME +L
Sbjct  123  DVANEV--RVPIFYIRTISAACLWVFFCIPKIIEAGEIPFEGDDLDIL-VKSVPGMERYL  179

Query  535  R  537
            R
Sbjct  180  R  180



>ref|XP_010923185.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Elaeis 
guineensis]
Length=484

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 99/184 (54%), Gaps = 8/184 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLL--ALTDVDSGRFTTRFRL  174
            +LIFPFPAQ H+ +MLKLA L  L+   ITF     IH RLL  + T     R   RFR 
Sbjct  10   VLIFPFPAQGHVPTMLKLAELFLLAGLRITFINTERIHRRLLLNSPTLPPLARLP-RFRF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIA---QNHDSGLPFTCFISDLLVS  345
            ++ P G+ +    +   L EL  S+ T  +   +  +A   ++ D     TC ++D  + 
Sbjct  69   RTIPDGLPEDDRRASVPLQELEESIRTRSREPYRDLLAPAGRDPDEWPSVTCVVADGSLP  128

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  525
            ++ +V+EE    +PV +FRT SACAFW Y+ +PDL + GE+P          +  V GME
Sbjct  129  LSWEVAEEV--GIPVIFFRTSSACAFWAYYRIPDLIKGGEIPFPEEADWDEKVRGVPGME  186

Query  526  DFLR  537
             FLR
Sbjct  187  SFLR  190



>ref|XP_006850413.1| hypothetical protein AMTR_s00165p00028990 [Amborella trichopoda]
 gb|ERN11994.1| hypothetical protein AMTR_s00165p00028990 [Amborella trichopoda]
Length=224

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 91/162 (56%), Gaps = 8/162 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHL-LDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  177
            +LIFPFPAQ H+NSMLKLA L + L+NFH+TF    + H RL    D        R   +
Sbjct  10   VLIFPFPAQGHINSMLKLAELFVSLTNFHVTFLNSEHNHKRLGLRAD----SLLERVHFE  65

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLP-FTCFISDLLVSIAL  354
            +   G+ +    S + +++L  SL    KP  ++ + +    G P  TC I D ++S  L
Sbjct  66   AITDGLPECHPRSADRIMDLFDSLKARTKPIFREMLREKAKRGEPPVTCVIGDAILSFIL  125

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG  480
            ++ EE    +PV  FRT+SAC+ W YFS+P L +A  LPI G
Sbjct  126  EIGEEV--GVPVIAFRTVSACSLWAYFSIPWLIDARVLPIPG  165



>ref|XP_009590620.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=524

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 97/185 (52%), Gaps = 10/185 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q  +NS  KLA LL +S  HITF +  NIH RL++ T++ S RF     F++
Sbjct  55   VLIFPLPLQGPVNSTFKLAELLCISGLHITFLLTENIHNRLVSHTNI-SSRFERFPGFQI  113

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSG----LPFTCFISDLLV  342
            ++   G+           +EL  SL    KP  K  +     S      P +C I+D ++
Sbjct  114  KTISDGLPQDHPRKGSKYMELFDSLKCKTKPLFKDMLTSGWLSSDGKRRPVSCIIADGVL  173

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
                DV+ E    +P++  RTIS C  W +F LP L E+GE P KG+ +D  PI  V G 
Sbjct  174  GFTCDVANEI--GIPIFSIRTISPCCLWIFFCLPQLIESGEYPFKGDDLD-EPIKSVPGA  230

Query  523  EDFLR  537
            E FLR
Sbjct  231  ETFLR  235



>gb|KHN04919.1| UDP-glycosyltransferase 85A3 [Glycine soja]
Length=486

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 107/182 (59%), Gaps = 6/182 (3%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFT-TRFRLQ  177
            + IFP PAQ H+++MLKLA LL L  FHITF     IH RL    D+++   T    + +
Sbjct  11   VAIFPCPAQGHVSTMLKLAQLLALHGFHITFLNTDFIHHRLHRFGDLEALLQTYPALQFK  70

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLP-FTCFISD-LLVSIA  351
            +FP G+      S +  ++L  S++   KP ++ +I  + D G P   CFI+D +  ++ 
Sbjct  71   TFPDGLPHHHPRSGQSAVDLFQSINLHAKPHIR-HILLSQDPGKPKINCFIADGVFGALT  129

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  531
            +DV+ +    +P+ +FRTISA  FWTYF +P+LF++ +LPI G+      IT + GME+ 
Sbjct  130  IDVAHQV--GIPIIHFRTISASCFWTYFCVPNLFQSNQLPITGDEDMDRVITCIPGMENM  187

Query  532  LR  537
             R
Sbjct  188  FR  189



>ref|XP_004235101.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Solanum 
lycopersicum]
Length=488

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 103/184 (56%), Gaps = 14/184 (8%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFT--TRFRL  174
            +LIFP P QS +NS L+LA LL L+   ++F   ++   RL+A ++V+S RF   T F+ 
Sbjct  10   VLIFPLPLQSTINSNLQLAELLCLAGLRVSFLNTNHNQQRLVANSNVES-RFKQYTGFQF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGL---PFTCFISDLLVS  345
             +   G+ +    S E   ++  SL T+ +P+LKQ +     SGL   P TC I D L  
Sbjct  69   LTISDGLPEDNPRSGEQFGDIISSLQTMAEPYLKQML-----SGLVKEPITCVILDGLFY  123

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  525
              +D+  E    +PV  F TIS   FW Y SLP L EAG LP KGN ID+  +T V  ME
Sbjct  124  YGVDIGNEM--GVPVVIFDTISPSCFWIYLSLPKLIEAGVLPFKGNDIDAL-VTHVPAME  180

Query  526  DFLR  537
             FLR
Sbjct  181  GFLR  184



>ref|XP_010032068.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW51453.1| hypothetical protein EUGRSUZ_J00977 [Eucalyptus grandis]
Length=479

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 99/181 (55%), Gaps = 8/181 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            ++IFP  AQ H+NSMLKLA LL LS   ITF    +IH RLL   D+ + RF     FR 
Sbjct  11   VVIFPLAAQGHVNSMLKLAELLALSGLRITFINSEHIHHRLLQHADIQA-RFAAYPDFRF  69

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            +    G       + +  L   + + +I K  L++ ++       P TC I+D ++S  +
Sbjct  70   KIISDGFPIDHPRAGDHALTTFNYVKSITKQLLEELVSA---PDRPVTCIIADGILSFTI  126

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            D + +    +PV  FRTISA  FW YF +P + E+G+LPIKG+      +T V GMED L
Sbjct  127  DFAGDL--GVPVIAFRTISASCFWAYFCIPRMIESGDLPIKGDEDMDRDVTSVPGMEDIL  184

Query  535  R  537
            R
Sbjct  185  R  185



>ref|XP_011100060.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=493

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 100/196 (51%), Gaps = 20/196 (10%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q H+NSMLKLA L  LSN H+T  +    H RL    +++S RF+    FR+
Sbjct  11   VLIFPLPMQGHINSMLKLAELFCLSNLHVTMLLSEYTHGRLRRHANIES-RFSRYPGFRV  69

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQN---HDSGL--PFTCFISDLL  339
             + P G+ +      E  +E+  SL  +G    ++ +       D G     TC I D +
Sbjct  70   ATIPDGLPEDHPRVGERTMEIVMSLLKVGGAEFRKLMETTDALSDGGARRRVTCLIMDGV  129

Query  340  VSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSP------  501
            +S A+ V+EE    +P  YFRT+ AC+FW  F   D+ EAGE P+KG             
Sbjct  130  LSFAVPVAEEM--GIPFIYFRTVGACSFWANFCFKDVIEAGEAPLKGKDEGKHEYWKKEE  187

Query  502  ----ITKVKGMEDFLR  537
                +T V GME +LR
Sbjct  188  LDLMVTSVPGMEGYLR  203



>gb|EYU19961.1| hypothetical protein MIMGU_mgv1a005050mg [Erythranthe guttata]
Length=499

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 72/196 (37%), Positives = 103/196 (53%), Gaps = 20/196 (10%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q H+NSMLKLA LL LS+ H++  +    H+RL     ++S RF+    FR+
Sbjct  20   VLIFPLPMQGHINSMLKLAELLCLSDIHVSMLISDYSHSRLRRHASIES-RFSRYPGFRV  78

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQN---HDSGL--PFTCFISDLL  339
             +   G+ D    + E  +++  SL  +G    ++ +       D G     +C I D +
Sbjct  79   ATMTDGLPDDHPRAGERSMDIVMSLVRVGGTEFRRVMETTDALSDGGARRRVSCLIMDGV  138

Query  340  VSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSS-------  498
             S A+ V EE    +P  YFRTISACAFW  F   ++ EAGE+P+KG   D         
Sbjct  139  FSFAVPVVEEM--GIPFLYFRTISACAFWANFCFKEVIEAGEIPLKGKDEDKYAYWKRED  196

Query  499  ---PITKVKGMEDFLR  537
               P+T V GME +LR
Sbjct  197  FDLPVTSVPGMEGYLR  212



>dbj|BAK55741.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=493

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 100/190 (53%), Gaps = 19/190 (10%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS--GRFTTRFRL  174
            +L+FP P Q  +N MLKLA LL  ++  +TF    ++  RLL+ TDV S   R+   FR 
Sbjct  13   VLLFPLPLQGPVNCMLKLAELLCFNHLQVTFLNTDHVQRRLLSCTDVSSRFKRYAGHFRF  72

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYI---------AQNHDSGLPFTCFI  327
            ++ P G+  G   + E + EL  S+  +  P  ++ +         AQN     P TC I
Sbjct  73   ETVPDGLPAGKTMTGEQIGELLDSMEAVSLPLFREIVRSSVHVSDGAQN-----PLTCII  127

Query  328  SDLLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPIT  507
            +D     A+D++ E    + + YF TIS C  W+  S   L +AG+ P K + +D +P+T
Sbjct  128  ADGAFGFAVDIAAEF--GVALMYFDTISPCGLWSILSANRLIQAGDFPFKDDDLD-APVT  184

Query  508  KVKGMEDFLR  537
             V GME FLR
Sbjct  185  SVPGMEGFLR  194



>ref|XP_010905381.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Elaeis 
guineensis]
Length=491

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 94/184 (51%), Gaps = 7/184 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT-RFRLQ  177
            +L+FPFP Q  +N MLKLA LL  +  H+TF      H RL   +   +    + RFR  
Sbjct  11   VLVFPFPGQGMVNCMLKLAELLSKTGLHVTFLNSDYNHDRLSRSSSAYALLAQSPRFRFD  70

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNH--DSGL--PFTCFISDLLVS  345
            S   G+ D    S   L+EL  SL T      ++ +      D G   P TC I+D  ++
Sbjct  71   SISDGLADENPRSAFRLMELEESLRTRSAVQYRELLTNRGRGDDGKWPPVTCVIADGAMT  130

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  525
             A+D++EE    +P   FRTISAC+FW YF +P L + GELP         P+  V GME
Sbjct  131  FAVDIAEEL--GIPAIAFRTISACSFWAYFCIPRLLQNGELPFPDEADLDEPVRSVPGME  188

Query  526  DFLR  537
             FLR
Sbjct  189  AFLR  192



>ref|XP_002276555.2| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Vitis 
vinifera]
Length=509

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 100/185 (54%), Gaps = 10/185 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LI P P Q ++NSMLKLA LL L+   +TF      H  LL+ ++V + RF+    FR 
Sbjct  37   VLILPSPLQGNVNSMLKLAELLCLAGIQVTFLNCHYPHHCLLSYSNVQA-RFSRYPGFRF  95

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQ----YIAQNHDSGLPFTCFISDLLV  342
            ++   G+      + E  L++   + T   P   +    +     D+  P TC ++D L+
Sbjct  96   ETISDGLPMEHPRTAEQFLDIVDGVKTTTAPLFMEMMISWCRSTSDTRPPLTCIMADQLM  155

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
            S A DV+ E    LP+  F  ISAC+FW YFS P L EAGE+PI G+ +D   +  V GM
Sbjct  156  SFATDVANEV--GLPIVIFCAISACSFWAYFSFPQLIEAGEVPITGDDMDRL-VVSVPGM  212

Query  523  EDFLR  537
            E FLR
Sbjct  213  EGFLR  217



>emb|CBI31566.3| unnamed protein product [Vitis vinifera]
Length=507

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 100/185 (54%), Gaps = 10/185 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTR--FRL  174
            +LI P P Q ++NSMLKLA LL L+   +TF      H  LL+ ++V + RF+    FR 
Sbjct  10   VLILPSPLQGNVNSMLKLAELLCLAGIQVTFLNCHYPHHCLLSYSNVQA-RFSRYPGFRF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQ----YIAQNHDSGLPFTCFISDLLV  342
            ++   G+      + E  L++   + T   P   +    +     D+  P TC ++D L+
Sbjct  69   ETISDGLPMEHPRTAEQFLDIVDGVKTTTAPLFMEMMISWCRSTSDTRPPLTCIMADQLM  128

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
            S A DV+ E    LP+  F  ISAC+FW YFS P L EAGE+PI G+ +D   +  V GM
Sbjct  129  SFATDVANEV--GLPIVIFCAISACSFWAYFSFPQLIEAGEVPITGDDMDRL-VVSVPGM  185

Query  523  EDFLR  537
            E FLR
Sbjct  186  EGFLR  190



>gb|EYU19963.1| hypothetical protein MIMGU_mgv1a005336mg [Erythranthe guttata]
Length=488

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 96/186 (52%), Gaps = 12/186 (6%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRF---R  171
            +LIFP P Q  +N MLKLA L  L     TF    +IH RLL  TD  +  + TR+   R
Sbjct  12   VLIFPLPLQGPVNCMLKLAELFSLRRIRTTFLNTHHIHHRLLDCTD--NHTYFTRYPLLR  69

Query  172  LQSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNH----DSGLPFTCFISDLL  339
              + P G+ +G   + + +  L +S+  +  P  +Q +        DS  P TC I+D +
Sbjct  70   FDTVPDGLPEGNPRTGDQIPNLLNSMDAVAVPIFRQMVTSGGPYGPDSENPVTCIIADGI  129

Query  340  VSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKG  519
             + A +++ E    +P+ YF TIS C  WTY  LP L EAGE+P K + +D   I    G
Sbjct  130  FTFAAEIAAEI--GVPLLYFDTISPCGLWTYLCLPKLIEAGEVPFKDDNLDEI-IINAPG  186

Query  520  MEDFLR  537
            ME  +R
Sbjct  187  MEGIIR  192



>ref|XP_006435572.1| hypothetical protein CICLE_v10031404mg [Citrus clementina]
 ref|XP_006486449.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
 gb|ESR48812.1| hypothetical protein CICLE_v10031404mg [Citrus clementina]
Length=476

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 97/181 (54%), Gaps = 7/181 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            + I P PA  H+NSML LA LL  +   ITF    + + R++  +     R+     F+ 
Sbjct  9    VAILPLPAVGHVNSMLNLAELLGHAGIKITFLNTEHYYDRVIRHSSDAFSRYMQIPGFQF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            ++   G+      + +   EL  SL+    P LK+ ++   DS  P  C I+D  +S A+
Sbjct  69   KTLTDGLPRDHPRTPDKFPELVDSLNCATPPLLKEMVS---DSKSPVNCIITDGYMSRAI  125

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            D + E    + + YFRTISACAFW++  +PD+ +AGELPIKG       IT V GME FL
Sbjct  126  DAAREV--GVSIIYFRTISACAFWSFHCIPDIIDAGELPIKGTEDMDRLITTVPGMEGFL  183

Query  535  R  537
            R
Sbjct  184  R  184



>ref|XP_008464643.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis melo]
 ref|XP_008464644.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis melo]
Length=509

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 102/183 (56%), Gaps = 11/183 (6%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFPFPAQ H+NSMLKLA LL LS   ITF     IH +L   T+  S RF+    F+ 
Sbjct  39   VLIFPFPAQGHVNSMLKLAELLSLSGLRITFLNIHRIHHKLTLHTNFQS-RFSRFPNFQF  97

Query  175  QSFPPGIYDGALDSKE--GLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSI  348
            Q+   G+    L+++      +L +SL +I KP LKQ +        P TC I D L + 
Sbjct  98   QTITDGL---PLENRPIGNFSDLINSLKSITKPLLKQMLLSGELGPTP-TCIILDGLFNF  153

Query  349  ALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMED  528
              DV  +   ++PV+ FRTISAC+F  Y  +P L E G+LPI+G       I  V GME+
Sbjct  154  IFDV--DAHPNIPVFSFRTISACSFSAYSFVPKLIEDGQLPIEGEEDMDRIINGVVGMEN  211

Query  529  FLR  537
             LR
Sbjct  212  VLR  214



>gb|KDO69253.1| hypothetical protein CISIN_1g011848mg [Citrus sinensis]
Length=476

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 97/181 (54%), Gaps = 7/181 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            + I P PA  H+NSML LA LL  +   ITF    + + R++  +     R+     F+ 
Sbjct  9    VAILPLPAVGHVNSMLNLAELLGHAGIKITFLNTEHYYDRVIRHSSDAFSRYMQIPGFQF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            ++   G+      + +   EL  SL+    P LK+ ++   DS  P  C I+D  +S A+
Sbjct  69   KTLTDGLPRDHPRTPDKFPELVDSLNCATPPLLKEMVS---DSKSPVNCIITDGYMSRAI  125

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            D + E    + + YFRTISACAFW++  +PD+ +AGELPIKG       IT V GME FL
Sbjct  126  DAAREV--GVSIIYFRTISACAFWSFHCIPDIIDAGELPIKGTEDMDRLITTVPGMEGFL  183

Query  535  R  537
            R
Sbjct  184  R  184



>ref|XP_004239922.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Solanum 
lycopersicum]
Length=487

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 100/188 (53%), Gaps = 13/188 (7%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q  +NSM KLA LL  S  HIT  +  NIH RL+  TD+ S RF     F++
Sbjct  11   VLIFPLPLQGPVNSMFKLAELLCFSGLHITILLTENIHNRLVLHTDI-SSRFDQCPGFQI  69

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNH-----DSGL--PFTCFISD  333
            ++   G+ D         LE+  SL T  K   K  +  +      D  +    +C I+D
Sbjct  70   KTISDGLPDDHPRDGGKFLEVFDSLRTKTKTLFKDMLTSDSLCVDVDGKVRGRVSCIIAD  129

Query  334  LLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKV  513
             ++    DV++E   ++P++  RTIS+C  W +F LP+L E+GE P K + +D  PI  V
Sbjct  130  GVLGFTCDVADEV--NVPIFCVRTISSCCLWIFFCLPELIESGEYPFKDDNLD-EPIKSV  186

Query  514  KGMEDFLR  537
             G E FLR
Sbjct  187  PGTETFLR  194



>ref|XP_003517692.2| PREDICTED: UDP-glycosyltransferase 85A3-like [Glycine max]
Length=505

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 106/182 (58%), Gaps = 6/182 (3%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFT-TRFRLQ  177
            + IFP PAQ H+++MLKLA LL L  FHITF     IH RL    D+++   T    + +
Sbjct  33   VAIFPCPAQGHVSTMLKLAQLLALHGFHITFLNTDFIHHRLHRFGDLEALLQTYPSLQFK  92

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLP-FTCFISD-LLVSIA  351
            +FP G+      S +  ++L   ++   KP ++ +I  + D G P   CFI+D +  ++ 
Sbjct  93   TFPDGLPHHHPRSGQSAVDLFQYINLHAKPHIR-HILLSQDPGKPKINCFIADGVFGALT  151

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  531
            +DV+ +    +P+ +FRTISA  FWTYF +P+LF++ +LPI G+      IT + GME+ 
Sbjct  152  IDVAHQV--GIPIIHFRTISASCFWTYFCVPNLFQSNQLPITGDEDMDRVITCIPGMENM  209

Query  532  LR  537
             R
Sbjct  210  FR  211



>ref|XP_006355163.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Solanum tuberosum]
Length=471

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 97/182 (53%), Gaps = 7/182 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDL-SNFHITFFVPSNIHARLLALTDVDSGRFTT--RFR  171
            + IFP P Q  +N MLKLA LL L    H+TF     IH RLL  TDV   RF     F+
Sbjct  6    VFIFPLPLQGPVNCMLKLAELLCLHQEIHVTFINTEYIHQRLLNYTDV-LIRFAKYPNFK  64

Query  172  LQSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIA  351
              + P G+ +    + E + ++   +  +  P  ++ +     +    TC I D + + A
Sbjct  65   FVTIPDGLPEDNPRNGEQVGKIIEGVEKVSSPLFREMVMMTTTNYCAPTCLIVDGIFTFA  124

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  531
            +D++++    +P+ YF TIS CA WTY ++P L E GE+P KGN +D+  +  V GME  
Sbjct  125  VDIAKDA--KIPLLYFDTISPCAIWTYLAVPKLIEDGEIPFKGNDLDAL-VNSVSGMEGV  181

Query  532  LR  537
            +R
Sbjct  182  MR  183



>emb|CDP19644.1| unnamed protein product [Coffea canephora]
Length=493

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 98/185 (53%), Gaps = 9/185 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS--GRFTTRFRL  174
            +L+FP P Q  +N MLKLA L   S+  +TF    +I  RLL+ TDV S   R+   FR 
Sbjct  13   VLLFPLPLQGPVNCMLKLAELFCSSHLQVTFLNTDHIQRRLLSCTDVSSRFKRYAGHFRF  72

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQ----NHDSGLPFTCFISDLLV  342
            ++ P G+      + E + EL  S+  +  P  ++ +      + D+  P TC I+D   
Sbjct  73   ETVPDGLPADKTLTGEQIGELLDSMEAVSLPLFREIVRSSVLLSDDAQNPLTCIIADGAF  132

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
              A+DV+ E    + + YF TIS C  W+  S   L +AG+ P K + +D +P+T + GM
Sbjct  133  GFAVDVAAEF--GVALMYFDTISPCGLWSILSANRLIQAGDFPFKDDDLD-APVTSIPGM  189

Query  523  EDFLR  537
            E FLR
Sbjct  190  EGFLR  194



>ref|XP_007009132.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
 gb|EOY17942.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
Length=482

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 95/181 (52%), Gaps = 8/181 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            ILIFP P Q  +N+MLKLA L   +   +TF      H+RL+   ++ S RF     F  
Sbjct  13   ILIFPLPIQGPVNAMLKLAELCATAGLKVTFLNSEYNHSRLVRFANIPS-RFDKYPGFEF  71

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            ++   G+      S    +E+  +++   KP LK  + +      P  C I D ++   L
Sbjct  72   RTISDGLPGDHSRSGNRFMEIFEAMNIRTKPLLKDMLVEMIP---PVDCIIGDGILEFVL  128

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            DV+ E    +P+   RTI AC  W+ +S+PD+ EAGELPIKG+     PIT V GME FL
Sbjct  129  DVANEL--GIPIINCRTIGACFLWSNYSIPDMIEAGELPIKGSEDMDRPITAVPGMEKFL  186

Query  535  R  537
            R
Sbjct  187  R  187



>gb|KHG01935.1| UDP-glycosyltransferase 85A1 [Gossypium arboreum]
Length=948

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 104/185 (56%), Gaps = 15/185 (8%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FPFP Q H+NSM+KLA LL L+ F +TF      H RL+   ++ +  F    R Q 
Sbjct  14   VLVFPFPLQGHINSMIKLAELLALAGFKLTFLNSHYNHERLVKFNNI-AAHFE---RYQG  69

Query  181  FP-PGIYDG-ALD---SKEGLLELCH-SLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLV  342
            F    I DG  LD   S    L++   +L    KP L++ +    +   P  C I+D  +
Sbjct  70   FEFKTITDGLPLDHPRSGNWFLDMYEEALEMKMKPGLREML---ENISPPVDCIIADGFL  126

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
              A+DV++E    +P+ YFRT S C+FW Y+S+PD+ +AGELPIKG+      +T V GM
Sbjct  127  GFAIDVAKEL--EIPIIYFRTSSPCSFWVYYSIPDIIQAGELPIKGSEDMDRLLTTVPGM  184

Query  523  EDFLR  537
            E + R
Sbjct  185  ETYFR  189


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 82/166 (49%), Gaps = 11/166 (7%)
 Frame = +1

Query  52   LAHLLDLSNFHITFFVPSNIHARLLALTDVDS--GRFTTRFRLQSFPPGIYDGALDSKEG  225
            LA LL L+ F +TF    + H RL+  T + +   R+   F L++   G+      S   
Sbjct  489  LAELLALAGFKLTFLNSHHNHERLIKFTSIVAYFKRYPG-FELKTITDGLPLDHPRSGNW  547

Query  226  LLELCHS--LHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIALDVSEECFNHLPVYYF  399
             LE      L  I + F +  I  N     P  C I+D     A+DV+ E    +P+  F
Sbjct  548  FLETYEEAILMKIKQSFREMMINSNP----PVDCVIADGFSGYAIDVANEL--GIPIIGF  601

Query  400  RTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLR  537
            RT S  +FW Y+S+ D+ +AGELPI+G+      IT V GME +LR
Sbjct  602  RTSSPRSFWVYYSITDIIKAGELPIRGSEDMDRLITTVPGMETYLR  647



>gb|KHG01936.1| UDP-glycosyltransferase 85A1 [Gossypium arboreum]
Length=913

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 104/185 (56%), Gaps = 15/185 (8%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FPFP Q H+NSM+KLA LL L+ F +TF      H RL+   ++ +  F    R Q 
Sbjct  14   VLVFPFPLQGHINSMIKLAELLALAGFKLTFLNSHYNHERLVKFNNI-AAHFE---RYQG  69

Query  181  FP-PGIYDG-ALD---SKEGLLELCH-SLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLV  342
            F    I DG  LD   S    L++   +L    KP L++ +    +   P  C I+D  +
Sbjct  70   FEFKTITDGLPLDHPRSGNWFLDMYEEALEMKMKPGLREML---ENISPPVDCIIADGFL  126

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
              A+DV++E    +P+ YFRT S C+FW Y+S+PD+ +AGELPIKG+      +T V GM
Sbjct  127  GFAIDVAKEL--EIPIIYFRTSSPCSFWVYYSIPDIIQAGELPIKGSEDMDRLLTTVPGM  184

Query  523  EDFLR  537
            E + R
Sbjct  185  ETYFR  189


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 76/157 (48%), Gaps = 11/157 (7%)
 Frame = +1

Query  79   FHITFFVPSNIHARLLALTDVDS--GRFTTRFRLQSFPPGIYDGALDSKEGLLELCHS--  246
            F +TF    + H RL+  T + +   R+   F L++   G+      S    LE      
Sbjct  463  FKLTFLNSHHNHERLIKFTSIVAYFKRYPG-FELKTITDGLPLDHPRSGNWFLETYEEAI  521

Query  247  LHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIALDVSEECFNHLPVYYFRTISACAFW  426
            L  I + F +  I  N     P  C I+D     A+DV+ E    +P+  FRT S  +FW
Sbjct  522  LMKIKQSFREMMINSNP----PVDCVIADGFSGYAIDVANEL--GIPIIGFRTSSPRSFW  575

Query  427  TYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLR  537
             Y+S+ D+ +AGELPI+G+      IT V GME +LR
Sbjct  576  VYYSITDIIKAGELPIRGSEDMDRLITTVPGMETYLR  612



>ref|XP_006367216.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=474

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 97/182 (53%), Gaps = 7/182 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDL-SNFHITFFVPSNIHARLLALTDVDSGRFTT--RFR  171
            + IFP P Q  +N MLKLA LL L    HITF     IH RL+  TDV   RF     F+
Sbjct  6    VFIFPLPLQGTVNCMLKLAELLCLHQEIHITFINTEYIHQRLMNYTDVLV-RFEKYPNFK  64

Query  172  LQSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIA  351
              + P G+ +    + + + ++   +  +  P  ++ +     +    TC I D + S A
Sbjct  65   FVTVPDGLPEDNPRNGDQIGKIIEGVEKVSSPLFREMVMMTTTNYCTPTCLIVDGIFSFA  124

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  531
            +D+++E    +P+ YF TIS C+ WTY ++P L E GE+P KGN +D+  +  V GME  
Sbjct  125  VDIAKEA--KIPLLYFDTISPCSLWTYLAVPKLIEDGEIPFKGNDLDAL-VNGVAGMEGV  181

Query  532  LR  537
            +R
Sbjct  182  MR  183



>gb|AFJ53008.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=487

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 100/185 (54%), Gaps = 15/185 (8%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLS---NFHITFFVPSNIHARLLALTDVDSGRFTT--R  165
            +LIFPFP Q H+NSMLKLA LL L+      ITF      H RLL  +D +S RF+    
Sbjct  12   VLIFPFPVQGHVNSMLKLAELLSLAAGGGIRITFLNSDCTHNRLLQFSDAES-RFSVYPG  70

Query  166  FRLQSFPP-GIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLV  342
            F+ ++     I    L   + +L+L  ++ +  KP  +  +++      P TC I D L+
Sbjct  71   FQFKTIDDHRIPMEKLTKGDKVLDLVGAMESEMKPDFRDMLSRMDP---PVTCVIGDGLL  127

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
                +VS E    +PV  FRTIS C FW  + LPDL EAGELPI+        I+KV GM
Sbjct  128  GFIREVSMEL--GIPVIRFRTISPCCFWVNYCLPDLIEAGELPIQDM---DRKISKVPGM  182

Query  523  EDFLR  537
            E FLR
Sbjct  183  ESFLR  187



>gb|KJB74149.1| hypothetical protein B456_011G275600 [Gossypium raimondii]
Length=487

 Score =   109 bits (273),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 104/188 (55%), Gaps = 21/188 (11%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVD--SGRFTTRFRL  174
            +L+FPFP Q H+NSM+KLA LL ++ F +TF    + H RL+   ++   S R+   F  
Sbjct  14   VLVFPFPLQGHINSMIKLAELLAIAGFKLTFLNSHHNHERLVKFNNIAAHSERYPG-FEF  72

Query  175  QSFPPGI-------YDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISD  333
            ++   G+        +  LD+ E  +EL        K  L++ +    +S  P  C I D
Sbjct  73   KTITDGLPLDHPRSGNWFLDTLEDTMELKM------KESLREVLV---NSSPPVDCIIGD  123

Query  334  LLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKV  513
             ++S ALDV++E  + +P+ +FRT S C FW  +S+PD+ +AGELPI G       +T V
Sbjct  124  GVLSFALDVAKE--HGIPIIFFRTSSPCCFWVSYSIPDIIQAGELPINGTEDMDRLVTTV  181

Query  514  KGMEDFLR  537
             GME +LR
Sbjct  182  PGMETYLR  189



>ref|XP_010674287.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=492

 Score =   109 bits (273),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 101/186 (54%), Gaps = 12/186 (6%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFT--TRFRL  174
            +LIFP PA  HL  ML+LA LL ++NF +TF   ++ H RL   TD+++ RF   + F  
Sbjct  15   VLIFPLPALGHLTPMLQLAELLCIANFKVTFLNTTHNHQRLTQHTDIEA-RFEQYSGFEF  73

Query  175  QSFPPGIYD-----GALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLL  339
            ++ P G+ +     G  D K  ++    SL T  +P L++ +  + ++    TC I D  
Sbjct  74   KTMPDGLSEDNPRTGQGDVKGLMISAIESLSTSAEPLLREILLGSSETA-KITCLIVDGW  132

Query  340  VSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKG  519
            +S A DV+ E    +PV  FR  SA   W+Y+ +P L EAG+LPIK   +D   +    G
Sbjct  133  MSFASDVANEA--EVPVIIFRCSSASCNWSYYCIPKLIEAGDLPIKDEKMD-ELVDNAPG  189

Query  520  MEDFLR  537
            M  FLR
Sbjct  190  MSSFLR  195



>gb|KJB74138.1| hypothetical protein B456_011G275100 [Gossypium raimondii]
 gb|KJB74140.1| hypothetical protein B456_011G275100 [Gossypium raimondii]
Length=469

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 103/182 (57%), Gaps = 9/182 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS--GRFTTRFRL  174
            +L+FP P Q H+NSM+KLA LL ++ F +TF    + H RL+   ++ +   R++  F+ 
Sbjct  14   VLVFPLPIQGHINSMIKLAELLAIAGFKLTFLNSHHNHERLVKFNNIAAHFERYSG-FQF  72

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQN-HDSGLPFTCFISDLLVSIA  351
            ++   G+      S    L++        +P +K+ + +   +S  P  C I+D  +  A
Sbjct  73   KTITDGLPLDHPRSGNWFLDM---FEDTMEPKMKESLREVLVNSSPPVDCIIADGFLGFA  129

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  531
            LDV++E    +P+ +FRT S C FW Y+S+PD+ +AGELPI G+      IT V GME +
Sbjct  130  LDVAKEL--GIPIIFFRTSSPCCFWVYYSIPDIIQAGELPINGSEDMDRLITTVPGMETY  187

Query  532  LR  537
            LR
Sbjct  188  LR  189



>gb|KJB74139.1| hypothetical protein B456_011G275100 [Gossypium raimondii]
Length=477

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 103/182 (57%), Gaps = 9/182 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS--GRFTTRFRL  174
            +L+FP P Q H+NSM+KLA LL ++ F +TF    + H RL+   ++ +   R++  F+ 
Sbjct  14   VLVFPLPIQGHINSMIKLAELLAIAGFKLTFLNSHHNHERLVKFNNIAAHFERYSG-FQF  72

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQN-HDSGLPFTCFISDLLVSIA  351
            ++   G+      S    L++        +P +K+ + +   +S  P  C I+D  +  A
Sbjct  73   KTITDGLPLDHPRSGNWFLDM---FEDTMEPKMKESLREVLVNSSPPVDCIIADGFLGFA  129

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  531
            LDV++E    +P+ +FRT S C FW Y+S+PD+ +AGELPI G+      IT V GME +
Sbjct  130  LDVAKEL--GIPIIFFRTSSPCCFWVYYSIPDIIQAGELPINGSEDMDRLITTVPGMETY  187

Query  532  LR  537
            LR
Sbjct  188  LR  189



>dbj|BAK55740.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=496

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/192 (35%), Positives = 98/192 (51%), Gaps = 20/192 (10%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS--GRFTTRFRL  174
            +L+FP P Q  +N MLKLA LL  ++  +TF    ++  RLL+ TDV S   R+   FR 
Sbjct  13   VLLFPLPLQGPVNCMLKLAELLCFNHLQVTFLNTDHVQRRLLSCTDVSSRFKRYAGHFRF  72

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYI---------AQNHDSGLPFTCFI  327
            ++ P G+  G   + E + EL  S+  +  P  ++ +         AQN     P TC I
Sbjct  73   ETVPDGLPAGKTMTGEQIGELLDSMEAVSLPLFREIVRSSVHVSDGAQN-----PLTCII  127

Query  328  SDLLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGID--SSP  501
            +D     A+D++ E    + + YF TIS C  W+  S   L +AG+ P K    D   +P
Sbjct  128  ADGAFGFAVDIAAEF--GVALMYFDTISPCGLWSILSANRLIQAGDFPFKVYTDDDLDAP  185

Query  502  ITKVKGMEDFLR  537
            +T V GME FLR
Sbjct  186  VTSVPGMEGFLR  197



>ref|XP_011084983.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=524

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/198 (37%), Positives = 102/198 (52%), Gaps = 24/198 (12%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFT--TRFRL  174
            ILIFP P Q H+NSML LA LL LS  H+T  +    H RLL    + S RF+  + FR+
Sbjct  39   ILIFPVPLQGHVNSMLNLAELLCLSGLHVTILLSDYTHNRLLRHATLRS-RFSRHSGFRV  97

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLP-------FTCFISD  333
             +   G+        E ++++  SL  IG    ++ +      GL         +C I D
Sbjct  98   ATISDGLPPDHPRVGERIVDMALSLKQIGGSQFRRLMEST--DGLSEGGAMRRVSCLIMD  155

Query  334  LLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSP----  501
             ++S A+ V EE    +P  YFRTISACAFW YF + ++ +AGE+P++G   D       
Sbjct  156  GVLSFAISVVEEM--GIPYIYFRTISACAFWPYFCIQEIMDAGEVPLRGKNEDKLTYWKK  213

Query  502  ------ITKVKGMEDFLR  537
                  +T V GME FLR
Sbjct  214  KEMDMMVTSVPGMERFLR  231



>ref|XP_006367215.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=472

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 98/182 (54%), Gaps = 9/182 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDL-SNFHITFFVPSNIHARLLALTDVDSGRFTT--RFR  171
            + IFP P Q  +N MLKLA LL L    HITF     IH RL+  T+V   RF     F+
Sbjct  6    VFIFPLPLQGPVNCMLKLAELLCLHQEIHITFINTEYIHQRLMNYTNV-LVRFEKYPNFK  64

Query  172  LQSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIA  351
              + P G+ +  L + E + ++   +  +  P  ++ +  +  +    TC I D + + A
Sbjct  65   FVTVPDGLPEDNLRNGEQVEKIIEGVEKVSSPLFREMVMMS--TTCAPTCLIVDGIFTFA  122

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  531
            +D+++E    +P+ YF TIS C+ WTY ++P L E GE+P KGN +D   +  V GME  
Sbjct  123  VDIAKEA--KIPLLYFDTISPCSLWTYLAVPKLIEDGEIPFKGNDLDVL-VNGVAGMEGV  179

Query  532  LR  537
            +R
Sbjct  180  MR  181



>ref|XP_009804549.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=487

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 96/182 (53%), Gaps = 6/182 (3%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSG-RFTTRFRLQ  177
            +L+FP P QS +NSML+LA L  L+   +TF   ++    LL  T+V+S  R   RFR +
Sbjct  8    VLLFPLPIQSPINSMLQLAELFCLAGLQVTFLNTNHNQKLLLQHTNVESRFRQYPRFRFR  67

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHD--SGLPFTCFISDLLVSIA  351
            +   G+      S     EL  SL  + +PFL++ +  + D  +  P TC I D L   A
Sbjct  68   TISDGLPVENPRSSVQFGELISSLQAVAEPFLREILLSSSDGVTEPPVTCVIPDGLFYYA  127

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  531
            +DV  E    +PV  F TIS C  W Y  +P L +AGE+P KGN +D      V GM+  
Sbjct  128  VDVGNEI--GVPVIPFDTISPCCLWVYLCIPKLIQAGEVPFKGNDLDVL-FENVAGMQGL  184

Query  532  LR  537
            LR
Sbjct  185  LR  186



>ref|XP_010032069.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW51454.1| hypothetical protein EUGRSUZ_J00979 [Eucalyptus grandis]
Length=479

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 96/181 (53%), Gaps = 8/181 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            ++IFP  AQ H+NSMLKLA LL LS   ITF    +IH RLL   D+   RF     F+ 
Sbjct  11   VVIFPLAAQGHVNSMLKLAELLALSGLRITFINSEHIHHRLLQHADI-PARFAAYPDFQF  69

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            +    G         +  L     + +I K   ++ ++       P TC I+D +++  +
Sbjct  70   KIISDGFPIHHPRPSDHFLTTFDYVKSITKQLFEELVSA---PDRPVTCIIADGILTFTI  126

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            D + +    +PV  FRTISA  FWTYF +P + E+G+LPIKG+      +T V GMED L
Sbjct  127  DFAGDL--GVPVIAFRTISASCFWTYFCIPRMIESGDLPIKGDEDMDRDVTSVPGMEDIL  184

Query  535  R  537
            R
Sbjct  185  R  185



>ref|XP_004150246.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Cucumis sativus]
 gb|KGN50613.1| hypothetical protein Csa_5G196560 [Cucumis sativus]
Length=476

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 96/181 (53%), Gaps = 5/181 (3%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS--GRFTTRFRL  174
            +LIFP P Q H+NSMLKLA LL ++   +TF    +  ++L   +DV S   RF T FR 
Sbjct  10   VLIFPLPFQGHINSMLKLAELLSIAGITVTFLNTPHFQSQLTRHSDVLSRFSRFPT-FRF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
             +   G+      + E   ++  SL +I KP  + ++   H  G   TC + D  +   +
Sbjct  69   HTIIDGLPPDHPRTIEFFAQIISSLDSITKPIFRNWLVSGH-FGSNLTCVVLDGFLKNFI  127

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            D  E+     P++ FRT+SAC+ WTY   P L E G+LPI+G       IT + GME+ L
Sbjct  128  DGDEDEVKQ-PIFGFRTVSACSVWTYLCAPHLIEDGQLPIRGEEDMDRMITNLPGMENLL  186

Query  535  R  537
            R
Sbjct  187  R  187



>ref|XP_009589440.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=488

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 67/183 (37%), Positives = 96/183 (52%), Gaps = 7/183 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSG-RFTTRFRLQ  177
            +L+FP P QS +NSML LA L  L+   +TF   ++    LL  T+V+S  R   RFR +
Sbjct  8    VLLFPLPIQSPINSMLHLAELFCLAGLQVTFLNTNHNQKLLLRHTNVESRFRQYPRFRFR  67

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGL---PFTCFISDLLVSI  348
            +   G+ +    S     EL  SL  + +PFL++ +  +   G+   P TC I D L   
Sbjct  68   TISDGLPEENPRSSVQFGELISSLQAVAEPFLREILLSSSSDGVTEPPVTCVIPDGLFYY  127

Query  349  ALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMED  528
            A+D+  E    +PV  F TIS C  W Y  +P L +A E+P KGN +D+     V GM+ 
Sbjct  128  AVDIGNEI--GVPVIPFDTISPCCLWVYLCIPKLIQAEEIPFKGNDLDAL-FENVAGMQG  184

Query  529  FLR  537
             LR
Sbjct  185  LLR  187



>gb|EPS60746.1| hypothetical protein M569_14056, partial [Genlisea aurea]
Length=455

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 70/196 (36%), Positives = 106/196 (54%), Gaps = 20/196 (10%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFT--TRFRL  174
            +L+FP P Q H+NSMLKL+ LL L+  H+T  +     +RL   +DV+S RF+  + FR+
Sbjct  5    VLVFPLPLQGHVNSMLKLSELLCLAGIHVTLLLSKFSSSRLRRHSDVES-RFSRYSGFRI  63

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQN---HDSGLP--FTCFISDLL  339
              F  G+ +      E  ++L  S+  +G+  L++ +       D G     + F+ D +
Sbjct  64   AVFDDGLPEDNPRVGESTIDLLSSILRVGETELRKVLEATDSLSDGGARRRVSFFVIDGV  123

Query  340  VSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSS-------  498
            +S A+ V+EE    +PV YFRTISAC+FW YF   +L  AGELP++G             
Sbjct  124  LSFAMPVAEEL--GIPVVYFRTISACSFWCYFCSSELIAAGELPLRGEDEGKYEYWRNPN  181

Query  499  ---PITKVKGMEDFLR  537
               P+T + GME  LR
Sbjct  182  LDLPVTSIPGMEAILR  197



>ref|XP_007158359.1| hypothetical protein PHAVU_002G146200g [Phaseolus vulgaris]
 gb|ESW30353.1| hypothetical protein PHAVU_002G146200g [Phaseolus vulgaris]
Length=482

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 98/186 (53%), Gaps = 11/186 (6%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVD--SGRFTT-RFR  171
            +LIFP P  +H+ SMLKLA LL L N HITF     IH RL    D+   S  + T  F+
Sbjct  6    VLIFPLPVSAHVASMLKLAELLTLENLHITFLTTDTIHGRLTRFGDIQVLSKSYPTLHFK  65

Query  172  L--QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLP-FTCFISD-LL  339
                S+  G + G  D    + +L  S     KPFL+  I  +H   +P  +C I D + 
Sbjct  66   TLSDSYDEGDHPGFGDR---IWDLISSTTLHAKPFLRD-ILLSHTPQIPKLSCVIQDGIF  121

Query  340  VSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKG  519
             S++ DV+ E    +P+  FRT+SAC FW Y S  +L  + ELPI+G+      I  + G
Sbjct  122  GSLSADVASEFNVSIPIIQFRTVSACCFWAYISATNLLHSQELPIRGDEDMDRIIKDIPG  181

Query  520  MEDFLR  537
            ME+ LR
Sbjct  182  MENLLR  187



>ref|XP_003613025.1| UDP-glucuronosyltransferase 1-1 [Medicago truncatula]
 gb|AES95983.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=475

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 91/184 (49%), Gaps = 13/184 (7%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +LIFP PAQ H+NSMLKLA LL + N +ITF     IH RL+   D          +LQ 
Sbjct  13   VLIFPCPAQGHVNSMLKLAELLAIQNIYITFLNTKYIHNRLIQFNDDIQALLECYPKLQF  72

Query  181  FPPGIYDGALDSK-----EGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVS  345
                I D   + K     E + ++  SL   GKP LK  I     S +       DL   
Sbjct  73   --KTISDFHSEEKHPGFGERIGDVITSLSLYGKPLLKDIIVSEKISCIILDGIFGDLATD  130

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  525
            +A +        + + +FRTIS+C FW YF +P L E  ELPI+G+      IT + GME
Sbjct  131  LAAEFG------IQLIHFRTISSCCFWAYFCVPKLLECNELPIRGDEDMDRIITNIPGME  184

Query  526  DFLR  537
            + LR
Sbjct  185  NILR  188



>ref|XP_006355679.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=482

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 95/188 (51%), Gaps = 13/188 (7%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q  +NSM KLA LL  S  HIT  +  NIH RL+  TD+ S RF     F++
Sbjct  11   VLIFPLPLQGPVNSMFKLAELLCFSGLHITILLTENIHNRLVLHTDITS-RFDQCPGFQI  69

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQ-------NHDSGLPFTCFISD  333
            ++   G+ D         +E+  SL T  K   K  +         +       +C I+D
Sbjct  70   KTISDGLPDDHPRDGGKFMEVFESLRTKTKTLFKDMLTSDLLCFDLDGKERRRVSCIIAD  129

Query  334  LLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKV  513
             ++    DV++E    +P++  RTIS C  W +F LP L E+GE P K + +D  P+  V
Sbjct  130  GILGFTCDVADEI--SVPIFCVRTISPCCLWIFFCLPKLIESGEYPFKDDNLD-EPLKSV  186

Query  514  KGMEDFLR  537
             G E FLR
Sbjct  187  PGTETFLR  194



>ref|XP_006362115.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=489

 Score =   107 bits (266),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 97/181 (54%), Gaps = 8/181 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P QS +NS L+LA LL L+   +TF   ++   RL+  ++V+S RF     FR 
Sbjct  11   VLIFPLPLQSTINSNLQLAELLCLAGLRVTFLNTNHNQQRLVGNSNVES-RFKQYPGFRF  69

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
             +   G+ D    S E   ++  SL T+ +P LKQ ++       P TC I D L    +
Sbjct  70   LTLSDGLPDDHPRSVEQFGDILSSLQTMAEPLLKQMLSALVKE--PVTCVILDGLFYYGV  127

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            D+  E    +PV  F TIS   FW Y SLP L EAG LP KGN +D+  +T +  ME  L
Sbjct  128  DIGNEM--GVPVITFDTISPSCFWIYLSLPKLIEAGVLPFKGNDLDAL-VTHLPAMEGLL  184

Query  535  R  537
            R
Sbjct  185  R  185



>ref|XP_003517688.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Glycine max]
Length=481

 Score =   106 bits (265),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 68/191 (36%), Positives = 91/191 (48%), Gaps = 21/191 (11%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS-GRFTTRFRLQ  177
            +LIFP P   HL SMLKLA LL L N H+TF    NIH RL    D+            +
Sbjct  6    VLIFPLPLPGHLGSMLKLAELLALDNIHVTFVDTENIHIRLTRFGDIQELSECYPTLHFK  65

Query  178  SFP---------PGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLP-FTCFI  327
            + P         PG  D   D          S     KPFL+  +   H  G+P  +C I
Sbjct  66   TIPDCYDEEGEHPGFGDRVGD-------FITSTAQHAKPFLRDILVSQHSPGIPKVSCII  118

Query  328  SD-LLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPI  504
             D +  +++ D + E    +P+ +FRT+S+C FW YF +P L +  ELPIKG       I
Sbjct  119  QDGIFGALSSDFAAEL--RIPLIHFRTVSSCCFWAYFCVPKLLDCKELPIKGEEDMDRII  176

Query  505  TKVKGMEDFLR  537
              + GME+ LR
Sbjct  177  RNMPGMENLLR  187



>ref|XP_009800319.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=479

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 95/185 (51%), Gaps = 10/185 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q  +NS  KLA LL  S   ITF +  NIH RL++ T+++S RF     F++
Sbjct  10   VLIFPLPLQGPVNSTFKLAELLCFSGLDITFLLTENIHNRLISHTNINS-RFERFPGFQI  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSG----LPFTCFISDLLV  342
            ++   G+           +EL  SL +  KP  K  +     S        +C I+D ++
Sbjct  69   KTISDGLPQDHPRKGSKYMELFDSLKSKTKPLFKDMLTSGWLSSDGKRREVSCIIADGVL  128

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
                DV+ E    +P++  RTIS C  W +F LP L E+GE P K + +D  PI  V G 
Sbjct  129  GFTCDVANEI--GIPIFSIRTISPCCLWIFFCLPQLIESGEYPFKDDDLD-EPIKSVPGA  185

Query  523  EDFLR  537
            E FLR
Sbjct  186  ETFLR  190



>ref|XP_008359771.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
 ref|XP_008368325.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=487

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 97/190 (51%), Gaps = 16/190 (8%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+ PFPAQ H+  ML  A LL  +  H+TF    + H RLL      S RF T    +S
Sbjct  14   VLLLPFPAQGHITPMLSFAQLLCHAGIHVTFLSTEHNH-RLLTQRRALSARFPT-LHFES  71

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYI-----AQNHDSGL------PFTCFI  327
             P G+      +   L ++  SL ++ KP L+  +       N   G       P +C I
Sbjct  72   IPDGLPPDHPRTIPPLDDIVSSLRSVTKPLLRDLLITLTKKDNESXGATTTPRPPLSCVI  131

Query  328  SDLLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPIT  507
             D ++  A+D++EE    +PV+  RT+SAC+FW Y  +PDL + G+LP +   +D  PI 
Sbjct  132  IDGIMCFAIDMAEEV--GIPVFALRTVSACSFWCYSCIPDLIQQGQLPFQDQDMD-HPIR  188

Query  508  KVKGMEDFLR  537
             + GME  LR
Sbjct  189  DIPGMEALLR  198



>ref|XP_008388093.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=487

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 97/190 (51%), Gaps = 16/190 (8%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+ PFPAQ H+  ML  A LL  +  H+TF    + H RLL      S RF T    +S
Sbjct  14   VLLLPFPAQGHITPMLSFAQLLCHAGIHVTFLSTEHNH-RLLTQRRALSARFPT-LHFES  71

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYI-----AQNHDSGL------PFTCFI  327
             P G+      +   L ++  SL ++ KP L+  +       N   G       P +C I
Sbjct  72   IPDGLPPDHPRTIPPLDDIVSSLRSVTKPLLRDLLITLTKKDNESCGATTTPRPPLSCVI  131

Query  328  SDLLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPIT  507
             D ++  A+D++EE    +PV+  RT+SAC+FW Y  +PDL + G+LP +   +D  PI 
Sbjct  132  IDGIMCFAIDMAEEV--GIPVFALRTVSACSFWCYSCIPDLIQQGQLPFQDQDMD-HPIR  188

Query  508  KVKGMEDFLR  537
             + GME  LR
Sbjct  189  DIPGMEALLR  198



>ref|NP_001148991.1| cytokinin-O-glucosyltransferase 2 [Zea mays]
 gb|ACG33743.1| cytokinin-O-glucosyltransferase 2 [Zea mays]
Length=480

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 92/182 (51%), Gaps = 6/182 (3%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FP PAQ HLNS L  +  L  +  H+TF   ++ + R L     ++   + R R  S
Sbjct  9    VLVFPAPAQGHLNSFLHFSTGLLRAGLHVTFL-HTDHNLRRLGTAAAEATVASPRLRFLS  67

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGL---PFTCFISDLLVSIA  351
             P G+ D    + +GL EL  SL T      +  +A     G    P TC ++D ++   
Sbjct  68   VPDGLPDDDPRTVDGLPELMESLRTKASASYRALLASLRAGGGGFPPVTCVVADGIMPFV  127

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  531
            +DV+EE    +P   FRT+SACA   Y S+P L   GELP    G   +PI  V GME F
Sbjct  128  VDVAEEL--GVPAISFRTVSACAVLAYLSVPKLIALGELPFPKGGDLDAPIRGVPGMESF  185

Query  532  LR  537
            LR
Sbjct  186  LR  187



>gb|KHG08953.1| hypothetical protein F383_15475 [Gossypium arboreum]
Length=484

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 97/181 (54%), Gaps = 4/181 (2%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS-GRFTTRFRLQ  177
            +LI P PAQ HL  MLKLA LL  ++F ITF      H   L+  D+ +  R   +F+  
Sbjct  11   VLILPIPAQGHLRPMLKLAELLSNASFQITFLNTEYFHHTFLSSIDIHAFSRRFPKFQFV  70

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQY-IAQNHDSGLPFTCFISDLLVSIAL  354
            + P G+   +    +G+     SL    KP + +  ++    SG P TC I+D ++S A 
Sbjct  71   TIPDGLPPDSPRPGKGIAHYLISLTDAAKPAVVEVLVSLRSKSGRPPTCIIADGIMSSAA  130

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
              + E F  +PV  FRT SAC  WTYF+L +L E GELP+    +D   +T + G+E+ L
Sbjct  131  VAAGEEFG-IPVLAFRTYSACCTWTYFNLSNLVEGGELPLPDKDMDKL-VTCIPGLENVL  188

Query  535  R  537
            R
Sbjct  189  R  189



>emb|CDP19643.1| unnamed protein product [Coffea canephora]
Length=460

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 99/172 (58%), Gaps = 11/172 (6%)
 Frame = +1

Query  43   MLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS--GRFTTRFRLQSFPPGIYDGALDS  216
            ML+LA LL L+   +T+ V    H RLL  T+V S   R+   F  Q+   G+ D    +
Sbjct  1    MLRLAELLCLAGLDVTYIVSDFCHNRLLTHTNVSSHFARYPG-FSFQTISDGLPDDHPRA  59

Query  217  KEGLLELCHSLHTIGKPFLKQYIAQN---HDSGL--PFTCFISDLLVSIALDVSEECFNH  381
             EG +++  ++  +  P  K+ + +      SG   P TC I+D ++S A D +EE  N 
Sbjct  60   GEGFVDIMPAIKMVTGPLFKRMMIEKGCFASSGTRSPVTCIIADGVLSFAGDFAEE--NG  117

Query  382  LPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLR  537
            + + YFRT+SAC+FW  F +P + EAGE+P+KG+G++ + +  V GME+ LR
Sbjct  118  IALIYFRTVSACSFWACFCMPQVIEAGEIPLKGHGMELA-VKSVPGMENILR  168



>gb|ACF88457.1| unknown [Zea mays]
 tpg|DAA40852.1| TPA: cytokinin-O-glucosyltransferase 2 [Zea mays]
Length=480

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 92/182 (51%), Gaps = 6/182 (3%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FP PAQ HLNS L  +  L  +  H+TF   ++ + R L     ++   + R R  S
Sbjct  9    VLVFPAPAQGHLNSFLHFSTGLLRAGLHVTFL-HTDHNLRRLGTAAAEATVASPRLRFLS  67

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSG---LPFTCFISDLLVSIA  351
             P G+ D    + +GL EL  SL T      +  +A     G    P TC ++D ++   
Sbjct  68   VPDGLPDDDPRTVDGLPELMESLRTKASASYRALLASLRAGGGGFPPVTCVVADGIMPFV  127

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  531
            +DV+EE    +P   FRT+SACA   Y S+P L   GELP    G   +PI  V GME F
Sbjct  128  VDVAEEL--GVPAISFRTVSACAVLAYLSVPKLIALGELPFPEGGDLDAPIRGVPGMESF  185

Query  532  LR  537
            LR
Sbjct  186  LR  187



>ref|XP_007158356.1| hypothetical protein PHAVU_002G145900g [Phaseolus vulgaris]
 gb|ESW30350.1| hypothetical protein PHAVU_002G145900g [Phaseolus vulgaris]
Length=484

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 95/181 (52%), Gaps = 4/181 (2%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS-GRFTTRFRLQ  177
            +++ P P Q ++NSM+KLA LL L +FH+TF     IH RL    D+ +  +      L+
Sbjct  13   VVLLPGPLQGNVNSMMKLAQLLALHHFHVTFLTTDFIHRRLHRFADIQALSQTYPNLELK  72

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISD-LLVSIAL  354
            +   G+ D    S   L +L   L++  KP ++  +     +    TC I D  L  +  
Sbjct  73   TISDGLPDDHPRSDNALADLYSFLNSHAKPLIRDILVSQTAAKPKVTCLIGDGFLGGLTA  132

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            DV++E    +P+ +FR ISA  FW  F  P+LFE+ +LPI+G       IT + GME+ L
Sbjct  133  DVADEV--GIPLIHFRAISASCFWALFCAPNLFESNQLPIRGEEDMDRVITTLPGMENIL  190

Query  535  R  537
            R
Sbjct  191  R  191



>gb|KJB74137.1| hypothetical protein B456_011G275000 [Gossypium raimondii]
Length=469

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 99/182 (54%), Gaps = 9/182 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS--GRFTTRFRL  174
            +LIFP P Q H+NSM+KLA LL ++   +TF    + H RL+   ++ +   R+   F+ 
Sbjct  15   VLIFPLPLQGHINSMIKLAELLAIAGLKLTFLHSHHNHERLVKFNNIAAHFERYPG-FQF  73

Query  175  QSFPPGI-YDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIA  351
            ++   G+  D     +  L     ++    K  L++ +    +S  P  C I+D     A
Sbjct  74   KTITDGLPLDHPRSGRWFLAMFEDTMELKMKQSLREVLV---NSSPPVDCIIADGFSGFA  130

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  531
            LDV++E    +P+ +FRT S C FW Y+S+PD+ +AGELPI G+      IT V GME +
Sbjct  131  LDVAKEL--GIPIIFFRTSSPCCFWVYYSIPDIIQAGELPINGSEDMDRLITTVPGMETY  188

Query  532  LR  537
            LR
Sbjct  189  LR  190



>ref|XP_003613028.1| Cis-zeatin O-glucosyltransferase [Medicago truncatula]
 gb|AES95986.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=474

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 89/184 (48%), Gaps = 13/184 (7%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +LIFP PAQ H+N MLKLA LL + N +ITF     IH RL+   D          +LQ 
Sbjct  13   VLIFPCPAQGHVNPMLKLAELLAIQNIYITFLNTKYIHNRLIQFNDDIQALLECYPKLQF  72

Query  181  FPPGIYDGALDSK-----EGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVS  345
                I D   + K     E + ++  SL   GKP LK  I     S +       DL   
Sbjct  73   --KTISDFHSEEKHPGFGEKVGDVILSLSLYGKPLLKDIIVSEKISCIILDGIFGDLATD  130

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  525
            +A +        + + +FRTISAC FW Y S+P L E  ELPIKG+      I  V GME
Sbjct  131  LAAEFG------IQLIHFRTISACCFWAYLSVPKLLECNELPIKGDEDMDRIIRNVPGME  184

Query  526  DFLR  537
            + LR
Sbjct  185  NLLR  188



>gb|EAZ03904.1| hypothetical protein OsI_26038 [Oryza sativa Indica Group]
Length=498

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 95/189 (50%), Gaps = 13/189 (7%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FPFPAQ H+N M+  A  L  +  H+TF   S+   R L          + R R  S
Sbjct  10   VLVFPFPAQGHINCMMHFATGLLGAGLHVTFL-HSDRSLRRLGGAAAALAAGSPRLRFLS  68

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIG----KPFLKQYIAQNHDSGL------PFTCFIS  330
             P G+ D    +   LLE   S+ T G    +  L   + +  D G       P TC ++
Sbjct  69   IPDGLPDDHARAAGDLLEHMESIRTKGSVAYRRVLLASLVRAGDDGSTGVQFPPVTCVVA  128

Query  331  DLLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITK  510
            D ++ +A+D++EE    +P   FRT+SAC+F  Y S+P LFE GELP    G    P+  
Sbjct  129  DGIMPLAIDIAEEI--GVPALGFRTVSACSFLAYLSIPRLFELGELPFPAGGDLDEPVRG  186

Query  511  VKGMEDFLR  537
            V GME FLR
Sbjct  187  VPGMETFLR  195



>ref|XP_008785470.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Phoenix dactylifera]
Length=489

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 100/190 (53%), Gaps = 14/190 (7%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALT-DVDSGRFTTRFRLQ  177
            +L+ PFPAQ H+  MLKLA +L  +  H+TF    NIH R LA +  +       RFR +
Sbjct  9    VLVSPFPAQGHVPPMLKLAEILSHAGLHVTFVNTDNIHRRFLASSPALQRLAGLPRFRFR  68

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYI---AQNHDSGLPFTCFISDLLVSI  348
            + P G+ +         L+L  SL T  +   ++ +    ++ D   P TC ++D ++ +
Sbjct  69   TIPDGLPEDHPRPFLQFLDLEESLRTRSREHYRELLVPTGKDPDGWPPVTCAVADGILRL  128

Query  349  ALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELP-------IKGNGIDSSPIT  507
            A +V+ E    +PV + RT  ACA W Y  +PDL + GE+P        + +G+D + I 
Sbjct  129  ASEVAAEM--EIPVIFVRTSGACAVWAYLCIPDLIKGGEIPFPEEEEEKEEDGLDET-IR  185

Query  508  KVKGMEDFLR  537
             V GME FLR
Sbjct  186  GVPGMEGFLR  195



>ref|XP_010318076.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Solanum 
lycopersicum]
Length=471

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 96/182 (53%), Gaps = 10/182 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDL-SNFHITFFVPSNIHARLLALTDVDS--GRFTTRFR  171
            +LIFP P Q  +N MLKLA LL L     ITF     IH RL+  TDV+   G++   F+
Sbjct  6    VLIFPLPLQGPVNCMLKLAELLCLDKEIQITFINTEYIHQRLMNYTDVEVRFGKYPN-FK  64

Query  172  LQSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIA  351
              + P G+ +      + +  +   +  +  P  K+ +   + +    TC I D + + A
Sbjct  65   FVTVPDGLPEDNPRIGDQIRLIIEGVEEVSSPLFKEMVMTTNSAP---TCLIVDGIFTFA  121

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  531
            L +++E    +P+ YF TIS C+ WTY +LP L E GE+P KGN +D   +  + GME  
Sbjct  122  LPIAKEA--KIPLLYFDTISPCSLWTYLALPKLIEDGEIPFKGNDLDVL-VNGMPGMEGV  178

Query  532  LR  537
            +R
Sbjct  179  MR  180



>ref|XP_008353149.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=487

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 96/190 (51%), Gaps = 16/190 (8%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+ PFPAQ H+  ML LA LL  +  H+TF    + H RLL      S RF T    +S
Sbjct  14   VLLLPFPAQGHITPMLSLAQLLCHAGIHVTFLSTEHNH-RLLTQRRALSARFPT-LHFES  71

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYI---AQNHDSGL--------PFTCFI  327
             P  +      +   L ++  SL ++ KP L+  +   A+  D           P +C I
Sbjct  72   IPDALPPDQPPAIHSLHDISSSLRSVTKPLLRDLLITLAKKDDESYRSTTIRCPPLSCVI  131

Query  328  SDLLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPIT  507
             D ++  A+D +EE    +PV   RT+SAC+FW Y  +PDL + G+LP +   +D  PI 
Sbjct  132  IDGIMCFAIDXAEEV--GIPVXALRTVSACSFWCYSCIPDLIQQGQLPFQDQDMD-HPIR  188

Query  508  KVKGMEDFLR  537
             + GME  LR
Sbjct  189  DIPGMEALLR  198



>ref|XP_011084985.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=495

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 100/196 (51%), Gaps = 20/196 (10%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS--GRFTTRFRL  174
            ILIFP P Q H+NSML LA LL LS  H+T  + +  H RLL    + S   R +  FR+
Sbjct  14   ILIFPLPLQGHVNSMLNLAELLCLSGLHVTILLSNYAHNRLLRHASLRSLFSRHSG-FRV  72

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQN---HDSGLP--FTCFISDLL  339
             +F  G+      + E L++L  SL  +G    ++ +       D G     +C I D L
Sbjct  73   ATFSDGLPADHPRAGERLMDLAFSLKELGGSQFRRLMESTDGLSDGGARRGVSCLIIDGL  132

Query  340  VSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSP------  501
            +S  + V EE    +P  YFRTI AC+FW +F + ++ +AGE+P+KG   D         
Sbjct  133  LSFIISVVEEM--GIPYIYFRTIGACSFWPHFCIQEIIDAGEVPLKGKNEDKLTYWKKKE  190

Query  502  ----ITKVKGMEDFLR  537
                +T V GME  LR
Sbjct  191  MDMMVTSVPGMEKVLR  206



>gb|ACU19718.1| unknown [Glycine max]
Length=231

 Score =   102 bits (253),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 83/169 (49%), Gaps = 7/169 (4%)
 Frame = +1

Query  4    LIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSF  183
            +  P PAQ H+N MLKLA LL    FHITF      H RLL     DS    + FR ++ 
Sbjct  14   VCIPHPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPDSLNGLSSFRFETI  73

Query  184  PPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQ-NHDSGLPFTCFISDLLVSIALDV  360
            P G+ +  LD+ + +  LC +      P  K  + + N+    P +C +SD ++S  LD 
Sbjct  74   PDGLPETDLDATQDIPSLCEATRRTCSPHFKNLLTKINNSDAPPVSCIVSDGVMSFTLDA  133

Query  361  SEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPIT  507
            +EE    LP   F T SAC F  Y     L E G  P+K    DSS IT
Sbjct  134  AEEL--GLPEVLFWTTSACGFMCYVQYEQLIEKGLTPLK----DSSYIT  176



>ref|XP_008388092.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=487

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 95/190 (50%), Gaps = 16/190 (8%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+ PFPAQ H+  ML LA LL  +  H+TF      H R L      S RF T    +S
Sbjct  14   VLLLPFPAQGHITPMLSLAQLLCHAGIHVTFLSTEXNH-RXLTQRRALSARFPT-LHFES  71

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYI---AQNHDSGL--------PFTCFI  327
             P  +      +   L ++  SL ++ KP L+  +   A+  D           P +C I
Sbjct  72   IPDALPPDQPPAIHSLHDISSSLRSVTKPLLRDLLITLAKKDDESYRSTTIRCPPLSCVI  131

Query  328  SDLLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPIT  507
             D ++  A+DV+EE    +PV   RT+SAC+FW Y  +PDL + G+LP +   +D  PI 
Sbjct  132  IDGIMCFAIDVAEEV--GIPVLALRTVSACSFWCYSCIPDLIQQGQLPFQDQDMD-HPIR  188

Query  508  KVKGMEDFLR  537
             + GME  LR
Sbjct  189  DIPGMEALLR  198



>gb|KJB74141.1| hypothetical protein B456_011G2752001, partial [Gossypium raimondii]
Length=423

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 99/182 (54%), Gaps = 9/182 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS--GRFTTRFRL  174
            +LIFP P Q H+N+M+ LA LL ++ F +TF    + H RL+   ++ +   R+   F  
Sbjct  15   VLIFPLPLQGHINTMINLAELLAVAGFKLTFLNSHHNHKRLVKFNNIAAHFERYPG-FEF  73

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQN-HDSGLPFTCFISDLLVSIA  351
            ++   G+      S    L++        +P +KQ + +   +S  P  C I+D  +  A
Sbjct  74   KTITDGLPLDHPRSGNWFLDM---FEDTMEPKMKQSLREVLVNSSPPVDCIIADWFLGFA  130

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  531
            LDV++E    +P+ +F T S C FW Y+S+PD+ +AGELPI G+      IT V GME +
Sbjct  131  LDVAKEV--GIPIIFFCTSSPCCFWVYYSIPDIIQAGELPINGSEDMDRLITTVPGMETY  188

Query  532  LR  537
            LR
Sbjct  189  LR  190



>ref|XP_008785471.1| PREDICTED: UDP-glycosyltransferase 85A4-like [Phoenix dactylifera]
Length=481

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 91/185 (49%), Gaps = 9/185 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTR--FRL  174
            +L+FPFP Q  +N MLKLA LL  +   +TF    + H  L   +   + R   R  FR 
Sbjct  11   VLVFPFPGQGMVNCMLKLADLLSGAGLLVTFLNTHHNHRHLSRFSGAHT-RLAQRPKFRF  69

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIA--QNHDSGL--PFTCFISDLLV  342
             S P G+ +    S     +L  S+ T      +  +   ++ DSG   P TC I+D L+
Sbjct  70   ASIPDGLSEEETRSVFNFFDLEESMRTRAAASFRDLLIAYRDKDSGGWPPVTCVIADGLM  129

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
              A+DVSEE    +P   FRTISAC  W +  +P L E GE+P         P+  V GM
Sbjct  130  PFAVDVSEEV--GIPAIIFRTISACCVWAFLCVPKLLENGEIPFPEGADLDEPVRGVPGM  187

Query  523  EDFLR  537
            E FLR
Sbjct  188  ESFLR  192



>ref|XP_007158358.1| hypothetical protein PHAVU_002G146100g [Phaseolus vulgaris]
 gb|ESW30352.1| hypothetical protein PHAVU_002G146100g [Phaseolus vulgaris]
Length=482

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 97/190 (51%), Gaps = 19/190 (10%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +LIFP P  +H+ SMLKLA LL L N H+TF     IH RL    D+       +F  +S
Sbjct  6    VLIFPLPLPAHVVSMLKLAELLVLENLHVTFLTTDTIHGRLTRFGDI-------QFLSKS  58

Query  181  FPPGIYDGALDS-KEG--------LLELCHSLHTIGKPFLKQYIAQNHDSGLP-FTCFIS  330
            +P   +    D   EG        L +L  S     KPFL+  I  +H   +P  +C I 
Sbjct  59   YPKLHFKTISDCYDEGDHPGFGDRLWDLISSTTLHAKPFLRD-ILLSHTPQIPKLSCVIQ  117

Query  331  D-LLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPIT  507
            D +  S++ DV+ E    +P+  FRT+SAC FW Y S  +L +  ELPI+G+      I 
Sbjct  118  DGIFGSLSADVASEFNVSIPIIQFRTVSACCFWAYMSATNLLQCQELPIRGDEDMDRIIK  177

Query  508  KVKGMEDFLR  537
             + GME+ LR
Sbjct  178  DIPGMENLLR  187



>ref|XP_006355680.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=482

 Score =   103 bits (258),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 94/188 (50%), Gaps = 13/188 (7%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q  +NSM KLA LL  S  HIT  +  NIH RL+  TD+ S RF     F++
Sbjct  11   VLIFPLPLQGPVNSMFKLAELLCFSGLHITILLTENIHNRLVLHTDITS-RFDQCPGFQI  69

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNH-------DSGLPFTCFISD  333
            ++   G+ D         +E+  SL T  K   K  +  +              +C I+D
Sbjct  70   KTISDGLPDDHPRDGGKFIEVFDSLRTKTKTLFKDMLTSDMLCFDLDGKERRRVSCIIAD  129

Query  334  LLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKV  513
             +     DV++E    +P++  RTIS C  W +F LP L E+GE P + + +D  P+  V
Sbjct  130  GVWGFTCDVADEI--SVPIFCVRTISPCCLWIFFCLPKLIESGEYPFEDDNLD-EPLKSV  186

Query  514  KGMEDFLR  537
             G E FLR
Sbjct  187  PGTETFLR  194



>ref|XP_011084978.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=499

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/196 (36%), Positives = 98/196 (50%), Gaps = 20/196 (10%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFT--TRFRL  174
            +LIFP P Q H+NSML LA LL LS  H+T  +    H RLL    + S RF+  + FR+
Sbjct  14   VLIFPVPLQGHVNSMLNLAELLCLSGLHVTILLSDYTHNRLLRHASLQS-RFSRHSGFRV  72

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQN---HDSGLP--FTCFISDLL  339
             +   G+        E ++++  SL  +G    +  +       D G     +C I D +
Sbjct  73   VTISDGLPADHPRVGERIVDIVLSLKEVGGQQFRHLMESTDGLSDGGARRRVSCLIVDGV  132

Query  340  VSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSP------  501
               A+ V EE    +P  YFRTISAC+FW YF L ++ +AGE+P+KG   D         
Sbjct  133  FRFAIPVVEEM--GIPYIYFRTISACSFWPYFCLQEIIDAGEVPLKGKNEDKLTYWKKKE  190

Query  502  ----ITKVKGMEDFLR  537
                +T V GME  LR
Sbjct  191  MDLMVTSVPGMERVLR  206



>ref|XP_003542333.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Glycine max]
Length=485

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 84/169 (50%), Gaps = 7/169 (4%)
 Frame = +1

Query  4    LIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSF  183
            +  P+PAQ H+N MLKLA LL    FHITF      H RLL     DS    + FR ++ 
Sbjct  14   VCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPDSLNGLSSFRFETI  73

Query  184  PPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQ-NHDSGLPFTCFISDLLVSIALDV  360
            P G+ +  LD+ + +  LC +      P  K  + + N+    P +C +SD ++S  LD 
Sbjct  74   PDGLPETDLDATQDIPSLCEATRRTCSPHFKNLLTKINNSDAPPVSCIVSDGVMSFTLDA  133

Query  361  SEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPIT  507
            +EE    LP   F T SAC F  Y     L E G  P+K    DSS IT
Sbjct  134  AEEL--GLPEVLFWTTSACGFMCYVQYEQLIEKGLTPLK----DSSYIT  176



>gb|KJB76813.1| hypothetical protein B456_012G109200 [Gossypium raimondii]
 gb|KJB76814.1| hypothetical protein B456_012G109200 [Gossypium raimondii]
 gb|KJB76815.1| hypothetical protein B456_012G109200 [Gossypium raimondii]
 gb|KJB76816.1| hypothetical protein B456_012G109200 [Gossypium raimondii]
Length=484

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 95/181 (52%), Gaps = 4/181 (2%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS-GRFTTRFRLQ  177
            +LI P PAQ HL  MLKLA LL  ++F ITF      H   L+  D+ +  R   +F+  
Sbjct  11   VLILPIPAQGHLKPMLKLAELLSYASFQITFLNTEYFHHTFLSSIDIHAFSRRFPKFQFV  70

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQY-IAQNHDSGLPFTCFISDLLVSIAL  354
            + P GI   +    + +     SL    KP + +  ++    SG P TC I+D ++S A 
Sbjct  71   TIPDGIPPDSPRPGKSIAHSLISLTDAAKPAVVEVLVSLRSKSGRPPTCIIADGIMSSAA  130

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
              + E F  +PV  FRT SAC  WTYF L +L E GE+P+    +D   +T + G+E+ L
Sbjct  131  VAAGEEFG-IPVLAFRTYSACCTWTYFHLSNLIEGGEVPLPDKDMDKL-VTCIPGLENVL  188

Query  535  R  537
            R
Sbjct  189  R  189



>gb|KDO61155.1| hypothetical protein CISIN_1g037374mg [Citrus sinensis]
Length=463

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 95/181 (52%), Gaps = 7/181 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            ++IFP P   H+NSMLKLA LL  +   ITF      + R++  +     R+      +L
Sbjct  9    VVIFPLPGVGHVNSMLKLAELLSHAGIKITFLNTEYYYDRVIRHSSDGFSRYMQIPGLQL  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            ++   G+      + +   EL  SL+    P LK+ +    DS  P    I+D  +S A+
Sbjct  69   KTVTDGLPKDHPRTPDKFTELIDSLNLAIPPLLKEMVT---DSNSPVNYIIADGYMSHAI  125

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            DV+ E    + + YF T+SACAFW++  +P++  AGELPIKG       IT V GME FL
Sbjct  126  DVAREV--GISIIYFCTVSACAFWSFHCIPNIIIAGELPIKGTEDMDRLITNVTGMEGFL  183

Query  535  R  537
            R
Sbjct  184  R  184



>ref|XP_004512576.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cicer arietinum]
Length=473

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/191 (37%), Positives = 98/191 (51%), Gaps = 25/191 (13%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP PAQ H+NSMLKLA LL L N +ITF     IH RL+   D       T  +F+ 
Sbjct  13   VLIFPCPAQGHVNSMLKLAELLALQNMNITFLNTEYIHNRLIRFNDSIQALSLTYPKFQF  72

Query  175  QSFP--------PGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLP-FTCFI  327
            ++ P        PG         E + ++  SL   GKP+L+  I     S +P  +C I
Sbjct  73   KTIPDFHDEEKHPGF-------GEKIGDVIMSLSLNGKPYLRDMIV----SEVPKISCII  121

Query  328  SD-LLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPI  504
             D +   +  D++ E    + + +FRTISAC FW Y  +P L E+ E+PI+G+      I
Sbjct  122  LDGVFGDLVTDLASEF--GIQLIHFRTISACCFWAYLCVPKLLESNEIPIRGDEDMDRII  179

Query  505  TKVKGMEDFLR  537
                GME+ LR
Sbjct  180  RNAPGMENVLR  190



>ref|XP_008388178.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Malus domestica]
Length=190

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 91/177 (51%), Gaps = 15/177 (8%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+ PFPAQ H+  ML  A LL  +  H+TF    + H RLL      S RF T    +S
Sbjct  14   VLLLPFPAQGHITPMLSFAQLLCHAGIHVTFLSTEHNH-RLLTQRRALSARFPT-LHFES  71

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYI-----AQNHDSGL------PFTCFI  327
             P G+      +   L ++  SL ++ KP L+  +       N   G       P +C I
Sbjct  72   IPDGLPPDHPRTIPPLDDIVSSLRSVTKPLLRDLLITLTKKDNESCGATTTPRPPLSCVI  131

Query  328  SDLLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSS  498
             D ++  A+D++EE    +PV+  RT+SAC+FW Y  +PDL + G+LP +G+   SS
Sbjct  132  IDGIMCFAIDMAEEV--GIPVFALRTVSACSFWCYSCIPDLIQQGQLPFQGDHCHSS  186



>ref|XP_007141191.1| hypothetical protein PHAVU_008G174700g [Phaseolus vulgaris]
 gb|ESW13185.1| hypothetical protein PHAVU_008G174700g [Phaseolus vulgaris]
Length=491

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 88/169 (52%), Gaps = 7/169 (4%)
 Frame = +1

Query  4    LIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSF  183
            +  P P Q H+N MLKLA LL    FHITF      H RLL     DS +  + FR ++ 
Sbjct  22   VCIPHPTQGHINPMLKLAKLLHFKGFHITFVNTEYTHKRLLKSRGPDSLKGLSSFRFETI  81

Query  184  PPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGL-PFTCFISDLLVSIALDV  360
            P G+ + A+D+ + +  LC S      P L   + + + S + P TC ++D ++S  LD 
Sbjct  82   PDGLPEPAVDATQDIPSLCDSTRRTCLPHLNNLLTKINSSDVPPVTCLVADGVMSFTLDA  141

Query  361  SEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPIT  507
            +EE    +P+  F T SAC F  Y  L  L + G +P+K    DSS +T
Sbjct  142  AEEL--GVPLALFWTPSACGFMCYVQLEQLIQKGLIPLK----DSSSVT  184



>gb|KJB74136.1| hypothetical protein B456_011G274900 [Gossypium raimondii]
Length=396

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 104/185 (56%), Gaps = 16/185 (9%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FPFP Q H+N M+KL+ LL L+ F  TF      H RL+   ++ +  F    R Q 
Sbjct  14   VLVFPFPLQGHINFMIKLSELLALTGF--TFLNSHYNHERLVKFNNI-AAHFE---RCQG  67

Query  181  FP-PGIYDG-ALD---SKEGLLELCH-SLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLV  342
            F    I DG  LD   S+   L++   +L    +P L++ +   +    P  C I+D  +
Sbjct  68   FEFKTITDGLPLDYPRSRNWFLDMYEEALELKIEPGLREML--ENICCPPVDCIIADRFL  125

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
              ALDV++E    +P+ YFRT S C+ W Y+S+PD+ +AGELPIKG+   +  +T V GM
Sbjct  126  GFALDVAKEL--EIPIIYFRTSSPCSLWVYYSVPDIIQAGELPIKGSEDMNRLLTTVPGM  183

Query  523  EDFLR  537
            + +LR
Sbjct  184  KTYLR  188



>ref|XP_004231996.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X1 [Solanum lycopersicum]
Length=477

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 96/180 (53%), Gaps = 9/180 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSG-RFTTRFRLQ  177
            +L+FP P QS +NSML+LA L  L+   +TF   ++    L   TDV+S  R   +F+ +
Sbjct  5    VLLFPLPIQSPINSMLQLAELFCLAGLQVTFLNTNHNQQLLYRHTDVESRFRQYPKFQFR  64

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIALD  357
            +   G+ D    S     +L  SL  + +PFL++ + +   SG+  TC I D L   A+D
Sbjct  65   TISDGLPDDHPRSSLLFGDLITSLQAVAEPFLREIVTE---SGV--TCVIPDGLFYYAVD  119

Query  358  VSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLR  537
            +  E    + V  F TIS C  W Y   P L ++G++P KGN +D   I  V GMED LR
Sbjct  120  ICNEL--GVSVISFDTISPCCLWVYLCFPKLIQSGDIPFKGNDLDVL-IENVPGMEDLLR  176



>gb|KJB74150.1| hypothetical protein B456_011G275700 [Gossypium raimondii]
Length=486

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 102/188 (54%), Gaps = 21/188 (11%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDV--DSGRFTTRFRL  174
            +L+FPFP Q H+NSM+KLA LL ++ F +TF    + H RL+   ++   S R+   F+ 
Sbjct  14   VLVFPFPLQGHINSMIKLAELLAIAGFKLTFLNSHHNHERLVKFNNIAAHSERYPG-FQF  72

Query  175  QSFPPGI-------YDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISD  333
            ++   G+        +  LD+ E  +EL        K  L++ +    +S  P  C I D
Sbjct  73   KTITDGLPLDHPRSGNWFLDTLEDTIELKM------KESLREVLV---NSSPPVDCIIGD  123

Query  334  LLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKV  513
             ++S ALDV++E    +P+  F T S  +FW  +S+PD+ +AGELPI G       IT V
Sbjct  124  GVLSFALDVAKEL--GIPIIIFHTNSPRSFWVSYSIPDIIQAGELPINGTEDMDRLITTV  181

Query  514  KGMEDFLR  537
             GME +LR
Sbjct  182  PGMETYLR  189



>ref|XP_011085130.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=472

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 95/184 (52%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +L+FPFP QSH+N ML LA +  +S F ITF +P +I        D  S RF     F  
Sbjct  12   VLVFPFPVQSHVNVMLNLAEIFSISGFQITFLIPDHIQTG--PRFDQISLRFARYPAFYF  69

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYI---AQNHDSGLPFTCFISDLLVS  345
            Q+   G+      + + + EL  S++   KP  +  +   A + +S  P TC I+D ++S
Sbjct  70   QAISDGLPLDHPRTGDRVKELFDSINVTTKPQFRNVLKSRALSSNSRAPLTCIIADGIMS  129

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  525
              +D+++     +P   FR  SA  FWT F +P L +AGELP+K +      +  + GME
Sbjct  130  FTIDIAQNF--GIPTVLFRPFSATCFWTLFCVPKLIQAGELPLKEDSDMDRLVENIPGME  187

Query  526  DFLR  537
              LR
Sbjct  188  RVLR  191



>ref|XP_007141200.1| hypothetical protein PHAVU_008G175500g [Phaseolus vulgaris]
 gb|ESW13194.1| hypothetical protein PHAVU_008G175500g [Phaseolus vulgaris]
Length=484

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 85/169 (50%), Gaps = 7/169 (4%)
 Frame = +1

Query  4    LIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSF  183
            +  P+PAQ H+N MLKLA LL    FHITF        RLL      S    + FR ++ 
Sbjct  13   VCIPYPAQGHINPMLKLAKLLHFKGFHITFVNSEYNQKRLLKSRGSSSLHALSSFRFETI  72

Query  184  PPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQ-NHDSGLPFTCFISDLLVSIALDV  360
            P G+ D  +D+ + +  LC S      P  ++ +A+ N+  G P +C +SD +++  LD 
Sbjct  73   PDGLPDSDVDATQDIPSLCESTRRTCLPHFRKLLAKLNNSDGPPVSCIVSDGVMTFTLDA  132

Query  361  SEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPIT  507
            ++E    LP   F T SAC F  Y     LF  G  P+K    DSS +T
Sbjct  133  AQEL--GLPEVLFWTTSACGFMCYLQYEQLFRKGITPLK----DSSLVT  175



>ref|XP_011000049.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Populus 
euphratica]
Length=486

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 95/184 (52%), Gaps = 8/184 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS--GRFTTRFRL  174
            ++  PFPAQ H+  ML LA LL  + F  TF   ++I  RL   T++ +  GRF  +F+ 
Sbjct  9    VVFLPFPAQGHVKPMLMLAELLSQAGFEATFINSNHIQDRLEHSTNIATMYGRFP-KFQF  67

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYI---AQNHDSGLPFTCFISDLLVS  345
            +S P G+      S   + +L  S     +   +  +    Q +    P TC I+D ++S
Sbjct  68   RSIPDGLPSDHPRSGSSISQLLISNRDETRTEFRNLLVNLGQKNGRWEPPTCIIADGIMS  127

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  525
             A+D++EE    +PV  FRT SAC  WTYF L  L E GE P +G+      IT + G+E
Sbjct  128  FAIDIAEEL--TIPVITFRTFSACCTWTYFHLTKLIEEGEFPFQGDVDMDKTITCIPGLE  185

Query  526  DFLR  537
              LR
Sbjct  186  GTLR  189



>gb|KHN42553.1| UDP-glycosyltransferase 85A2 [Glycine soja]
Length=482

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 85/170 (50%), Gaps = 7/170 (4%)
 Frame = +1

Query  4    LIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSF  183
            +  P+PAQ H+N MLKLA LL    FHITF      H RLL     DS    + FR ++ 
Sbjct  13   VCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPDSLNGLSSFRFETI  72

Query  184  PPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGL-PFTCFISDLLVSIALDV  360
            P G+ +  LD+ + +  LC +      P  K  +A+ +DS   P +C +SD +++  LD 
Sbjct  73   PDGLPETDLDATQDIPSLCEATRRTCSPHFKNLLAKINDSDAPPVSCIVSDGVMTFTLDA  132

Query  361  SEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITK  510
            +EE    +P   F T SAC F  Y     L E    P+K    DSS IT 
Sbjct  133  AEEL--GVPEVLFWTTSACGFMCYVQYQQLIEKDLTPLK----DSSYITN  176



>ref|XP_003544800.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Glycine max]
Length=482

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 85/170 (50%), Gaps = 7/170 (4%)
 Frame = +1

Query  4    LIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSF  183
            +  P+PAQ H+N MLKLA LL    FHITF      H RLL     DS    + FR ++ 
Sbjct  13   VCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPDSLNGLSSFRFETI  72

Query  184  PPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGL-PFTCFISDLLVSIALDV  360
            P G+ +  LD+ + +  LC +      P  K  +A+ +DS   P +C +SD +++  LD 
Sbjct  73   PDGLPETDLDATQDIPSLCEATRRTCSPHFKNLLAKINDSDAPPVSCIVSDGVMTFTLDA  132

Query  361  SEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITK  510
            +EE    +P   F T SAC F  Y     L E    P+K    DSS IT 
Sbjct  133  AEEL--GVPEVLFWTTSACGFMCYVQYQQLIEKDLTPLK----DSSYITN  176



>gb|EAZ03903.1| hypothetical protein OsI_26037 [Oryza sativa Indica Group]
Length=482

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 88/184 (48%), Gaps = 7/184 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FP+P Q H+N ML  A  L  +  H+TF    +         D      + R R  S
Sbjct  6    VLVFPWPVQGHINCMLHFATGLLRAGLHVTFLHSDHTLPAASDDDDDALAAASPRLRYAS  65

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPF--LKQYIAQNHDSGL---PFTCFISDLLVS  345
             P G+ DG        + L  S+ T    +  L   +A+    G    P TC ++D L+ 
Sbjct  66   IPDGLPDGHPRHAGAAVRLMESVQTQSSAYHSLLAELARGDGDGGGFPPVTCVVADGLLP  125

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  525
             A+DV+EE    +P   FRT SAC+F  Y S+P LFE GELP    G    P+  V GME
Sbjct  126  FAVDVAEEL--GVPALSFRTASACSFLAYLSVPRLFELGELPFPAGGDLDEPVRGVPGME  183

Query  526  DFLR  537
             FLR
Sbjct  184  SFLR  187



>ref|XP_006357782.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Solanum tuberosum]
Length=484

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 98/181 (54%), Gaps = 11/181 (6%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +L+FP P QS +NSML+LA L  L++  +TF   ++    L   T+V+S RF    +F+ 
Sbjct  15   VLLFPLPIQSPINSMLQLAELFCLADLQVTFLNTNHNQQLLYRHTNVES-RFKQYPKFQF  73

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            ++   G+ D    S     +L +SL  + +PFL++ + +   SG+  TC I D L   A+
Sbjct  74   RTISDGLPDDHPRSFPMFEDLINSLQAVAEPFLRKILTE---SGV--TCVIPDGLFYYAV  128

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            D+  E    + V  F TIS C  W Y   P L + G++P KGN +D   I  V GMED L
Sbjct  129  DICNEV--GVSVISFDTISPCCLWVYLCFPKLIQTGDIPFKGNDLDML-IENVPGMEDLL  185

Query  535  R  537
            R
Sbjct  186  R  186



>ref|XP_008464907.1| PREDICTED: UDP-glycosyltransferase 85A3-like isoform X2 [Cucumis 
melo]
Length=483

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 98/188 (52%), Gaps = 18/188 (10%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FP PAQ H+N MLKLA LL LS+  +TF    + + +L   +DV       RF L  
Sbjct  11   VLLFPAPAQGHINVMLKLAELLSLSSVRVTFLTTEHSYRQLTLHSDV-----LHRFSL--  63

Query  181  FPP----GIYDGALDSKEG-----LLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISD  333
            FP      I DG   S        L E+ HS  ++ KP  +  +  +H S    +C I D
Sbjct  64   FPSFQFRTISDGLPVSHPRTFSCHLPEMLHSFVSVTKPLFRDMLVSHHFSS-DLSCLILD  122

Query  334  LLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKV  513
               S  LD+ ++ F  +P++ FRT  AC+ WT  S+P+L + G+LPIKG       +  V
Sbjct  123  GFFSYLLDIDDD-FVKVPIFCFRTFGACSTWTILSIPNLIKQGQLPIKGEEDMDRILDNV  181

Query  514  KGMEDFLR  537
             GME+ LR
Sbjct  182  PGMENLLR  189



>gb|KDO69252.1| hypothetical protein CISIN_1g011848mg [Citrus sinensis]
Length=460

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 88/162 (54%), Gaps = 7/162 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            + I P PA  H+NSML LA LL  +   ITF    + + R++  +     R+     F+ 
Sbjct  9    VAILPLPAVGHVNSMLNLAELLGHAGIKITFLNTEHYYDRVIRHSSDAFSRYMQIPGFQF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            ++   G+      + +   EL  SL+    P LK+ ++   DS  P  C I+D  +S A+
Sbjct  69   KTLTDGLPRDHPRTPDKFPELVDSLNCATPPLLKEMVS---DSKSPVNCIITDGYMSRAI  125

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG  480
            D + E    + + YFRTISACAFW++  +PD+ +AGELPIKG
Sbjct  126  DAAREV--GVSIIYFRTISACAFWSFHCIPDIIDAGELPIKG  165



>ref|XP_002530397.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF31967.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=479

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 100/183 (55%), Gaps = 8/183 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q H+NSMLKLA LL L+   ITF     IH  L   +DV + RF     F+ 
Sbjct  13   VLIFPAPGQGHVNSMLKLAELLALAGLKITFLNFEYIHENLFRCSDVQA-RFDKYPGFQF  71

Query  175  QSFPPGIYDGAL--DSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSI  348
            ++ P    +G    ++ + L EL  ++    KP  K+ + + + +  P  C I D+L+  
Sbjct  72   KTIPNCWPEGRRIGNTSDTLRELLEAMKMQSKPIFKKILVECNITA-PINCIIGDMLMGF  130

Query  349  ALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMED  528
              DV+ E    +P   F TISAC+  T+ S+PD+  A ELP+KG       ITKV GME+
Sbjct  131  VYDVASEV--GIPAIQFHTISACSVLTFLSIPDVLAAQELPVKGKEDMDRLITKVPGMEN  188

Query  529  FLR  537
            FLR
Sbjct  189  FLR  191



>emb|CDO99846.1| unnamed protein product [Coffea canephora]
Length=424

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 89/179 (50%), Gaps = 19/179 (11%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFPFP Q H+N MLKLA LL     H+TF    +IH RLL  TD+    F+    F  
Sbjct  7    VLIFPFPVQGHINCMLKLAELLCCRGLHVTFLNSHHIHERLLCCTDIHY-HFSQYPSFHF  65

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            ++   G+      + + +L         G+P L              TC I+D ++S  +
Sbjct  66   ETISDGLPADHPRTGDHILTGLQFHSPNGRPAL--------------TCIIADGIMSFTV  111

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  531
            DV++E   H+P   FRT+SA  FW +  +P L EAGELP  G       ++ V G+E F
Sbjct  112  DVAKEL--HIPTILFRTVSASCFWAFLCVPKLLEAGELPFNGENDMDKLLSSVPGLERF  168



>ref|XP_002323535.1| hypothetical protein POPTR_0016s10020g [Populus trichocarpa]
 gb|EEF05296.1| hypothetical protein POPTR_0016s10020g [Populus trichocarpa]
Length=405

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 95/184 (52%), Gaps = 8/184 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS--GRFTTRFRL  174
            ++  PFPAQ H+  ML LA LL  + F  TF   ++I  RL   TD+ +   RF  +F+ 
Sbjct  9    VVFLPFPAQGHVKPMLMLAELLSQAGFEATFINSNHIQDRLEHSTDIATMYCRFP-KFQF  67

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYI---AQNHDSGLPFTCFISDLLVS  345
            +S P G+      S   + +L  +     +   +  +    Q +    P TC I+D ++S
Sbjct  68   RSIPDGLPSDHPRSGSSISQLLIASRDETRTEFRNLLVNLGQKNGRWEPPTCIIADGIMS  127

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  525
             A+D++EE    +PV  FRT SAC  WTYF L  L E GE+P +G+      IT + G+E
Sbjct  128  FAIDIAEEL--TIPVITFRTFSACCTWTYFHLTKLIEEGEVPFQGDVDMDKTITCIPGLE  185

Query  526  DFLR  537
              LR
Sbjct  186  GTLR  189



>emb|CBI36705.3| unnamed protein product [Vitis vinifera]
Length=396

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 89/167 (53%), Gaps = 6/167 (4%)
 Frame = +1

Query  43   MLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRLQSFPPGIYDGALDS  216
            MLKLA LL L+   ITF      H RLL  T++   R+T    FR Q+   G+      +
Sbjct  1    MLKLAELLSLAGLRITFLNSDYNHHRLLRYTNI-LDRYTRYPGFRFQTISDGLPLDRPWT  59

Query  217  KEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIALDVSEECFNHLPVYY  396
              GL ++   +    KP  ++ +     S  P TC I+D L+S A+DV+ E    +P+  
Sbjct  60   GAGLRDMMDGIKATTKPLFREMVISWCQSSDPVTCIIADGLMSFAIDVANEV--GVPIIS  117

Query  397  FRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLR  537
             RT+S C F  YFS  +L EAGE+P K + +D   +T+V GME FLR
Sbjct  118  CRTVSPCCFLAYFSFAELIEAGEVPFKDDDMDRL-VTRVPGMEGFLR  163



>gb|KEH28097.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=483

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 91/185 (49%), Gaps = 10/185 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDL-SNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  177
            ++  PFPAQ H+N MLKLA LL   S+FH+TF      H RLL     +S      FR +
Sbjct  13   VVCVPFPAQGHINPMLKLAKLLHFKSDFHVTFVNTEYNHKRLLKARGPNSLNGLPSFRFE  72

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQ--NHDSGLPFTCFISDLLVSIA  351
            + P G+ +  LDS + +  LC S      P  K+ I++  N     P TC I D ++S  
Sbjct  73   TIPDGLPESDLDSTQDIPSLCESTSKTCLPHFKKLISKLNNAIDTPPVTCIIGDGVMSFT  132

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVK  516
            +D +EE   ++P   F T SAC F  Y     L E G  P+K      NG   + I  V 
Sbjct  133  IDAAEEL--NIPAVLFWTTSACGFMCYMQFRQLIEKGLTPLKDSSYLTNGYLETTIDWVP  190

Query  517  GMEDF  531
            G+++ 
Sbjct  191  GIKEI  195



>ref|XP_004150244.1| PREDICTED: UDP-glycosyltransferase 85A4-like [Cucumis sativus]
Length=388

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 95/188 (51%), Gaps = 18/188 (10%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FP PAQ H+N MLK A LL LS+  +TF    + + +L   +DV       RF L  
Sbjct  11   VLLFPVPAQGHINVMLKFAELLSLSSIRVTFLTTEHSYRQLTLHSDV-----LPRFSL--  63

Query  181  FPP----GIYDGALDS-----KEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISD  333
            FP      I DG   S        L E+ HS  ++ KP  +  +   H S    TC I D
Sbjct  64   FPSFQFRTISDGLPLSHPRIFAHHLTEMLHSFVSVTKPLFRDMLLSPHFSS-DLTCLILD  122

Query  334  LLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKV  513
               S  LD+ ++ F  +P + FRT  AC+ WT  S+P+L + G+LPIKG       +  V
Sbjct  123  GFFSYLLDIDDD-FVKVPTFCFRTSGACSTWTILSIPNLIKQGQLPIKGEEDMDRILDNV  181

Query  514  KGMEDFLR  537
             GME+ LR
Sbjct  182  PGMENLLR  189



>ref|XP_004957723.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Setaria italica]
Length=483

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 91/192 (47%), Gaps = 18/192 (9%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FP P Q H+N+ML  A  L  +  H+TF    +   R+     V S   + R R  S
Sbjct  6    VLVFPVPVQGHINAMLPFAAALLDAGAHVTFLHTDHNLRRVGRAASVAS---SPRLRFLS  62

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLP-------------FTC  321
             P G+ D +  S   L EL  SL  +G    +   A    +G P              TC
Sbjct  63   IPDGLPDDSRRSVGDLGELDRSLREVGSVRYRALFASLLSAGSPNRAGADDEHRFPPLTC  122

Query  322  FISDLLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSP  501
             ++D L+  A+D++EE    +P   FRT SAC+F  + S P LFE G+LP    G    P
Sbjct  123  VVADGLMPWAIDIAEEL--GVPALAFRTSSACSFLAFMSAPGLFELGDLPFPAGGDLDEP  180

Query  502  ITKVKGMEDFLR  537
            +  V GME FLR
Sbjct  181  VRGVPGMESFLR  192



>gb|KJB74134.1| hypothetical protein B456_011G274800 [Gossypium raimondii]
Length=486

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/183 (36%), Positives = 97/183 (53%), Gaps = 11/183 (6%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS--GRFTTRFRL  174
            ++IFP P Q H+NSM+KLA LL L+ F +TF    + H RL+  T++ +   R+   F L
Sbjct  14   VVIFPLPLQGHINSMIKLAELLALAGFKLTFLNSHHNHERLIKFTNIVAYFKRYPG-FEL  72

Query  175  QSFPPGIYDGALDSKEGLLELCHS--LHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSI  348
            ++   G+      S    LE      +  I + F +  +  N     P  C I+D     
Sbjct  73   KTITDGLPLDHPRSGNWFLETYEEAIIMKIKQSFREMLMNSNP----PVDCVIADGFSGF  128

Query  349  ALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMED  528
            A+DV+ E    +P+  FRT S  +FW Y+S+ D+ +AGELPI+G+      IT V GME 
Sbjct  129  AIDVANEL--GIPIIGFRTSSPRSFWVYYSITDIIKAGELPIRGSEDMDRLITTVPGMET  186

Query  529  FLR  537
            +LR
Sbjct  187  YLR  189



>ref|XP_006850415.1| hypothetical protein AMTR_s00165p00030470 [Amborella trichopoda]
 gb|ERN11996.1| hypothetical protein AMTR_s00165p00030470 [Amborella trichopoda]
Length=172

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 90/163 (55%), Gaps = 8/163 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHL-LDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  177
            +LIFPFPAQ  +N M+KLA L + L++FH+TF    + H RL     +     + R R +
Sbjct  9    VLIFPFPAQGPINCMIKLAELFVSLTDFHVTFLNSEHNHKRL----GIGPESGSQRVRFK  64

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLP-FTCFISDLLVSIAL  354
            S P G+ +    S     EL  S+ T  +   ++ + +    G P  +C ISD L+   +
Sbjct  65   SIPDGLPESHPRSASLFFELHDSIQTQSRSVFREMLVKKVRVGEPPVSCVISDGLMPFVV  124

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGN  483
            DV EE    +PV  FRT+S C FW +FS+P L EAG LPI GN
Sbjct  125  DVGEE--VGVPVISFRTLSGCCFWAFFSIPWLIEAGVLPILGN  165



>ref|NP_001175205.1| Os07g0489200 [Oryza sativa Japonica Group]
 dbj|BAC84378.1| putative UDP-glucose glucosyltransferase [Oryza sativa Japonica 
Group]
 gb|EAZ39845.1| hypothetical protein OsJ_24285 [Oryza sativa Japonica Group]
 dbj|BAH93933.1| Os07g0489200 [Oryza sativa Japonica Group]
Length=482

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 88/184 (48%), Gaps = 7/184 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FP+P Q H+N ML  A  L  +  H+TF    +         D      + R R  S
Sbjct  6    VLVFPWPVQGHINCMLHFATGLLRAGLHVTFLHSDHTLPAAGDDDDDALAAASPRLRYAS  65

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPF--LKQYIAQNHDSGL---PFTCFISDLLVS  345
             P G+ DG        + L  S+ T    +  L   +A+    G    P TC ++D L+ 
Sbjct  66   IPDGLPDGHPRHAGAAVRLMESVQTQSSAYRSLLAELARGDGDGGGFPPVTCVVADGLLP  125

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  525
             A+DV+EE    +P   FRT SAC+F  Y S+P LFE GELP    G    P+  V GME
Sbjct  126  FAVDVAEEL--GVPALSFRTASACSFLAYLSVPRLFELGELPFPAGGDLDEPVRGVPGME  183

Query  526  DFLR  537
             FLR
Sbjct  184  SFLR  187



>ref|XP_010316061.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Solanum 
lycopersicum]
Length=482

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 95/180 (53%), Gaps = 9/180 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSG-RFTTRFRLQ  177
            +L+FP P QS +NSML+LA L  L+   +TF   ++    L   T+V+S  R   +FR +
Sbjct  13   VLLFPLPIQSPINSMLQLAELFCLAGLQVTFLNTNHNQQLLYRHTNVESRFRQYPKFRFR  72

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIALD  357
            +   G+ D    S     +L +SL  + +P L++ + +   SG+  TC I D L   A+D
Sbjct  73   TISDGLPDDHPRSFPMFEDLINSLQAVAEPSLREIVTE---SGV--TCVIPDGLFYYAVD  127

Query  358  VSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLR  537
            +  E    + V  F TIS C  W Y   P L + G++P KGN +D   I  V GMED LR
Sbjct  128  ICNEV--GVSVISFDTISPCCLWVYLCFPKLIQTGDIPFKGNDLDML-IENVPGMEDLLR  184



>ref|XP_011076757.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=489

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 89/184 (48%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS--GRFTTRFRL  174
            +LIFP P Q  +N MLKLA LL L    +TF    +I  RL   T  +    R++  FR 
Sbjct  11   VLIFPLPLQGPVNCMLKLAELLCLGQIQVTFLNTLHIQERLRNCTGAEVYFKRYSN-FRF  69

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQN---HDSGLPFTCFISDLLVS  345
             + P G+ +    + + +  L  S+  +  P  +  +        S  P TC I+D + +
Sbjct  70   DTVPDGLPEENPRTADEIWNLLQSIDAVAVPIFRCMVTSGVYGPGSENPVTCIIADGIFT  129

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  525
             A  ++ E    +P+ YF TIS C  WTY  LP L EAGE P K + +D   I    GME
Sbjct  130  FAAGIAGEI--GVPLLYFDTISPCGLWTYLCLPKLIEAGEFPFKDDNLDEI-IRNAPGME  186

Query  526  DFLR  537
              +R
Sbjct  187  GIIR  190



>ref|XP_004162780.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
Length=485

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 95/188 (51%), Gaps = 18/188 (10%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FP PAQ H+N MLK A LL LS+  +TF    + + +L   +DV       RF L  
Sbjct  11   VLLFPVPAQGHINVMLKFAELLSLSSIRVTFLTTEHSYRQLTLHSDV-----LPRFSL--  63

Query  181  FPP----GIYDGALDS-----KEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISD  333
            FP      I DG   S        L E+ HS  ++ KP  +  +   H S    TC I D
Sbjct  64   FPSFQFRTISDGLPLSHPRIFAHHLTEMLHSFVSVTKPLFRDMLLSPHFSS-DLTCLILD  122

Query  334  LLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKV  513
               S  LD+ ++ F  +P + FRT  AC+ WT  S+P+L + G+LPIKG       +  V
Sbjct  123  GFFSYLLDIDDD-FVKVPTFCFRTSGACSTWTILSIPNLIKQGQLPIKGEDDMDRILDNV  181

Query  514  KGMEDFLR  537
             GME+ LR
Sbjct  182  PGMENLLR  189



>gb|KGN50615.1| UDP-glucosyltransferase family 1 protein [Cucumis sativus]
Length=485

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 95/188 (51%), Gaps = 18/188 (10%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FP PAQ H+N MLK A LL LS+  +TF    + + +L   +DV       RF L  
Sbjct  11   VLLFPVPAQGHINVMLKFAELLSLSSIRVTFLTTEHSYRQLTLHSDV-----LPRFSL--  63

Query  181  FPP----GIYDGALDS-----KEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISD  333
            FP      I DG   S        L E+ HS  ++ KP  +  +   H S    TC I D
Sbjct  64   FPSFQFRTISDGLPLSHPRIFAHHLTEMLHSFVSVTKPLFRDMLLSPHFSS-DLTCLILD  122

Query  334  LLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKV  513
               S  LD+ ++ F  +P + FRT  AC+ WT  S+P+L + G+LPIKG       +  V
Sbjct  123  GFFSYLLDIDDD-FVKVPTFCFRTSGACSTWTILSIPNLIKQGQLPIKGEDDMDRILDNV  181

Query  514  KGMEDFLR  537
             GME+ LR
Sbjct  182  PGMENLLR  189



>ref|XP_010666054.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=495

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 95/187 (51%), Gaps = 12/187 (6%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSN---FHITFFVPSNIHARLLALTDVDSGRFTTR--  165
            ILIFP P Q  +NSMLKLA L+ L++    HITF     +H RL+   +  S RF +   
Sbjct  10   ILIFPLPIQGPVNSMLKLAELILLASDAQIHITFLTTELVHRRLMLHANAAS-RFESYPG  68

Query  166  FRLQSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQ---NHDSGLPFTCFISDL  336
            F L++F  G+ +      +   E+  ++  + +P L++ +     N    +P TC I D 
Sbjct  69   FSLRTFSDGLPEDHPRGSDKFGEMVDAVEAVSRPLLREMLVTDRANSPQEIPITCIIPDG  128

Query  337  LVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVK  516
              + ALDV +E    +PV YF TIS    W Y  LP L E GE+P + N  +   I  V 
Sbjct  129  SYNFALDVGKEV--GIPVIYFDTISPSCLWVYLCLPKLIEDGEVPFQENW-EMEAIVGVP  185

Query  517  GMEDFLR  537
            G+   LR
Sbjct  186  GIGTLLR  192



>ref|XP_008370121.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=483

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 63/193 (33%), Positives = 96/193 (50%), Gaps = 19/193 (10%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +++ P P+Q H   ML LA LL  +  H+TF +  + H+ L    D  S RF T    +S
Sbjct  10   VVLLPLPSQGHFTPMLSLAQLLCHAGIHVTFLITKHSHS-LFTQRDALSARFPT-LHFES  67

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYI--------AQNHDSGL-----PFTC  321
             P G+          L E+  SL +  KPFL++ +          ++D        P  C
Sbjct  68   IPDGLPPDHGRKFSALHEVGASLRSTIKPFLRELLISLTKKDDETSNDGSTRRRLPPLRC  127

Query  322  FISD-LLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSS  498
             + D + +  A+DV+EE    +P++  RT SAC+FW Y  +PDL + G+LP +   +D  
Sbjct  128  MVIDGIFMCFAIDVAEEV--GIPIFALRTTSACSFWCYTCIPDLIQQGQLPFQDEDMD-Q  184

Query  499  PITKVKGMEDFLR  537
            PI  + GME  LR
Sbjct  185  PIRDIPGMESLLR  197



>ref|XP_007158357.1| hypothetical protein PHAVU_002G146000g [Phaseolus vulgaris]
 gb|ESW30351.1| hypothetical protein PHAVU_002G146000g [Phaseolus vulgaris]
Length=402

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 92/185 (50%), Gaps = 9/185 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS-GRFTTRFRLQ  177
            +LIFP P  +H+ SMLKLA LL L N H+TF     IH RL    D+    +   +   +
Sbjct  6    VLIFPLPMPAHVVSMLKLAELLVLENLHVTFLTTDTIHGRLTRFGDIQVLSKSYPKLHFK  65

Query  178  S----FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISD-LLV  342
            +    +  G + G  D    L +L  S     KPFL+  +  +       +C I D +  
Sbjct  66   TISDCYDEGDHPGFGDR---LWDLISSTTLHAKPFLRDILLSHTPQFPKISCVIQDGIFG  122

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
             +++ V+ E    +P+ +FRT SAC FW Y S  +L +  ELPI+G+      I  + GM
Sbjct  123  GLSVGVASEFNVSIPIIHFRTASACCFWAYMSATNLLQCQELPIRGDEDMDRIIKNMPGM  182

Query  523  EDFLR  537
            E+ LR
Sbjct  183  ENLLR  187



>dbj|BAJ98857.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=465

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 90/185 (49%), Gaps = 13/185 (7%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHAR-LLALTDVDSGRFTTRFRLQ  177
            +L+FP+P Q H+NSML  A  L  +  H+TF     +H    L          T R R  
Sbjct  6    VLVFPWPLQGHINSMLHFAAGLLDAGLHVTF-----VHTEHNLRRAQRAEAAATPRLRFV  60

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIG----KPFLKQYIAQNHDSGLP-FTCFISDLLV  342
            S P G+      S   L +L  SL T G    +  L   ++     G P  +C ++D L+
Sbjct  61   SLPDGLSVDHPRSVGDLKDLAKSLMTTGPAAYRALLASALSPAAIGGFPALSCVVADGLL  120

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
              A+DV+EE    +P   FRT SAC+F  Y S+P L E GE+PI        P+  V GM
Sbjct  121  PFAIDVAEEL--GVPALAFRTSSACSFLAYLSVPKLVELGEVPIPVGADLDGPVCSVPGM  178

Query  523  EDFLR  537
            EDFLR
Sbjct  179  EDFLR  183



>ref|XP_006373896.1| hypothetical protein POPTR_0016s10010g [Populus trichocarpa]
 gb|ERP51693.1| hypothetical protein POPTR_0016s10010g [Populus trichocarpa]
Length=486

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 95/184 (52%), Gaps = 8/184 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS--GRFTTRFRL  174
            ++  PFPAQ H+  ML LA LL  + F  TF   ++I  RL   TD+ +   RF  +F+ 
Sbjct  9    VVFLPFPAQGHVKPMLMLAELLSHAGFEATFINSNHIQHRLEHSTDIATMYCRFP-KFQF  67

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYI---AQNHDSGLPFTCFISDLLVS  345
            +S P G+      S   + +L  +     +   +  +    Q +    P TC I+D ++S
Sbjct  68   RSIPDGLPSDHPRSGSSISQLLIASRDETRTEFRNLLVNLGQKNGRWEPPTCIIADGIMS  127

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  525
             A+D++EE    +PV  FRT SAC  WTYF L  L E GE+P +G+      IT + G+E
Sbjct  128  FAIDIAEEL--TIPVITFRTFSACCTWTYFHLTKLIEEGEVPFQGDVDMDKTITCIPGLE  185

Query  526  DFLR  537
              LR
Sbjct  186  GTLR  189



>ref|XP_008464908.1| PREDICTED: UDP-glycosyltransferase 85A4-like [Cucumis melo]
Length=207

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 89/169 (53%), Gaps = 5/169 (3%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS--GRFTTRFRL  174
            +LIFP P Q H+NSMLKLA LL ++   +TF    + H +L+  +DV S   RF + FR 
Sbjct  10   VLIFPLPFQGHINSMLKLAELLSIAGITVTFLNTPHSHRQLIRHSDVLSRFSRFPS-FRF  68

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
             +   G+      + +   ++  S  +I KP  + ++   H  G   TC + D  +   +
Sbjct  69   DTIIDGLPPDHPRTIKFSNQIISSFDSITKPIFRNWLVSGH-FGSDLTCVVLDAFLKNFV  127

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSP  501
            D  ++     P++ FRTISAC  WTY  +P L E G+LPI+G+     P
Sbjct  128  DGDDDEVKQ-PIFGFRTISACCVWTYLCVPYLIEDGQLPIRGHKFQQGP  175



>ref|XP_010106101.1| UDP-glycosyltransferase 85A3 [Morus notabilis]
 gb|EXC07555.1| UDP-glycosyltransferase 85A3 [Morus notabilis]
Length=185

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 90/162 (56%), Gaps = 9/162 (6%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRL--  174
            +LIFPFPAQ H+ +ML LA +L L+   +TF    +IH RL    DV++ RF     L  
Sbjct  14   VLIFPFPAQGHVTAMLTLAEVLSLAGIDVTFLNTDHIHNRLFRHADVEA-RFADYPGLLF  72

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISD-LLVSIA  351
            ++ P G+ D    S E   E+ HS+    KP LK+ +       +  TC I+D      A
Sbjct  73   RTVPDGLPDDHPRSHER-TEVFHSMIATTKPVLKEMLVSGALGSV--TCIIADGSFARFA  129

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIK  477
             D++ E    +P+ +FRT+SAC  W +F + D+ +AGELP++
Sbjct  130  TDLAYE--FQIPIIHFRTVSACCIWIHFCVDDIIKAGELPLR  169



>dbj|BAG80552.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=490

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 85/181 (47%), Gaps = 9/181 (5%)
 Frame = +1

Query  4    LIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSF  183
            +  PFPAQ H+N MLKLA LL +  FHITF      H RLL      S    + FR QS 
Sbjct  15   VCIPFPAQGHINPMLKLAKLLHIRGFHITFVNTEFNHRRLLKSRGPYSLNGLSSFRFQSI  74

Query  184  PPGIYDGALDSKEGLLELCHSLHTIG-KPFLKQYIAQNHDSGL-PFTCFISDLLVSIALD  357
            P G+     D+ + +  LC +  T+   PF       N +S   P +C ISD  +S  L 
Sbjct  75   PDGLPPSNEDATQDVPSLCEACKTVCLAPFRDLVTRLNDNSSFPPISCIISDAAMSFTLQ  134

Query  358  VSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKGM  522
            VSEE    +P   F T S C+ W     P L E G  P+K      NG   + I  + GM
Sbjct  135  VSEEL--GIPYLGFWTGSGCSLWALIQYPKLVEGGYFPLKDESYLINGHLDTIIDWIPGM  192

Query  523  E  525
            E
Sbjct  193  E  193



>ref|XP_010666049.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=516

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/197 (34%), Positives = 95/197 (48%), Gaps = 21/197 (11%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLS--NFHITFFVPSNIHARLLALTDVDSGRF--TTRF  168
            ILIFP P Q  +NSMLKLA LL LS  N H TF     ++ +L+        RF    RF
Sbjct  16   ILIFPLPMQGPVNSMLKLAELLILSADNIHATFLTTDVVYHQLIVSARAKE-RFDRNPRF  74

Query  169  RLQSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQ--NHDSGLP----------  312
              ++F  G+ +      +  LE+  ++  +  P +++ ++    H S             
Sbjct  75   SFRTFSDGLPNDHPRGGDKFLEMLDAVKAVSHPIVREIVSSGDTHTSSSETNQTLEVVLS  134

Query  313  --FTCFISDLLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNG  486
               TC +SD L + ALDV  E    +PV+YF T+S    W Y  LP L EAGE+P   N 
Sbjct  135  PLVTCIVSDGLYNFALDVGNEV--GIPVFYFETMSPSCLWVYLCLPKLVEAGEVPFTENS  192

Query  487  IDSSPITKVKGMEDFLR  537
               + +  V GM+ +LR
Sbjct  193  DLDALLVNVPGMDGYLR  209



>ref|XP_003613026.1| UDP-glucuronosyltransferase 1-6 [Medicago truncatula]
 gb|AES95984.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=466

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 91/184 (49%), Gaps = 12/184 (7%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +LIFP PAQ H+N+MLKLA LL + N HITF     IH RL++L   D    +  +    
Sbjct  6    VLIFPCPAQGHVNTMLKLAELLLIQNLHITFLNTEYIHNRLISLNIDDVKSISQCYPKLQ  65

Query  181  FPPGIYDGALDSK-----EGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVS  345
            F   I D     K     E ++++  S++  GKP L+  I     S +       DL   
Sbjct  66   FKT-ISDFQNKEKHPGFGENIVDVISSINMYGKPSLRDIIVSEKISCIILDGGFGDLATD  124

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  525
            +A +        + + +FRT++A   W YF +P L +  E+PI+G+      I  V GME
Sbjct  125  LAAEFG------IQLIHFRTVAASTVWIYFCMPKLLDCNEIPIRGDEDMDRIIRNVPGME  178

Query  526  DFLR  537
            + +R
Sbjct  179  NIIR  182



>ref|XP_003560193.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Brachypodium 
distachyon]
Length=478

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 92/191 (48%), Gaps = 20/191 (10%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FP+P Q H+NSML  A  L  +  H+TF     +H     L  VD    + R R  S
Sbjct  7    VLVFPWPLQGHINSMLHFAAALVGAGLHVTF-----VHTEH-NLRRVDPAAASPRLRFTS  60

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQ------NHDSGL------PFTCF  324
             P G+ D    S   L ++  SL T G    +  +A       + D+        P +C 
Sbjct  61   VPDGLPDDHPRSVGDLKDVAKSLMTTGPAVYRALLASLLPASTHADADADGRGFPPVSCV  120

Query  325  ISDLLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPI  504
            ++D L+  A+D++EE    +P   FRT SAC+   YFS+  L E GE+P         P+
Sbjct  121  VADGLLPFAIDIAEEL--GVPALAFRTASACSVLAYFSMARLMELGEVPFPVGADLDEPV  178

Query  505  TKVKGMEDFLR  537
              V GMEDFLR
Sbjct  179  RGVPGMEDFLR  189



>ref|XP_004150245.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
Length=485

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 95/188 (51%), Gaps = 18/188 (10%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FP PAQ HLN MLK A LL LS+  +TF    + + +L   +DV       RF L  
Sbjct  11   VLLFPAPAQGHLNVMLKFAELLSLSSIRVTFLTTEHSYRQLTLHSDV-----LPRFSL--  63

Query  181  FPP----GIYDGALDS-----KEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISD  333
            FP      I DG   S        L E+ HS  ++ KP  +  +   H S    TC I D
Sbjct  64   FPSFQFRTISDGLPLSHPRTFSHHLPEMLHSFVSVTKPLFRDMLLSPHFSS-DLTCLILD  122

Query  334  LLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKV  513
               S  LD+ ++ F  +PV+ FRT  AC+ WT  S+P+L + G+L IKG       +  V
Sbjct  123  GFFSYLLDIDDD-FVKVPVFCFRTFGACSTWTILSIPNLIKQGQLTIKGEEDMDRILDNV  181

Query  514  KGMEDFLR  537
             GME+ LR
Sbjct  182  PGMENLLR  189



>ref|XP_010032067.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW51452.1| hypothetical protein EUGRSUZ_J00976 [Eucalyptus grandis]
Length=513

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/181 (34%), Positives = 94/181 (52%), Gaps = 8/181 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            ++IFP  AQ H+NSMLKL  LL +S   ITF    +IH RLL    + +  F     FR 
Sbjct  48   VIIFPLAAQGHVNSMLKLTELLAISGLRITFINSEHIHHRLLRHAHIQA-HFAAFPDFRF  106

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            +    G         +  +   + + +I K   ++ ++       P TC I+D +++  +
Sbjct  107  KIISDGFPIDHPRPPDHFMTTFNYVKSITKQLFEELVSA---PDRPVTCIIADGILTFTI  163

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            D + +    +PV  FRTISA +FW  F +P + E+G+LP+KG+      +T V GMED L
Sbjct  164  DFAGDL--GVPVIAFRTISASSFWACFCIPRMIESGDLPLKGDEDMDRDVTSVPGMEDIL  221

Query  535  R  537
            R
Sbjct  222  R  222



>ref|XP_004955353.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Setaria italica]
Length=492

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 90/182 (49%), Gaps = 10/182 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FP+P Q H+N ML LA  L  +   +TF   ++ + R LAL    +     R R+ S
Sbjct  9    VLLFPWPVQGHINPMLHLASALLDAGLRVTFL-HTDHNLRRLALAGAPAPPHHPRLRVLS  67

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGL---PFTCFISDLLVSIA  351
             P G+ D    S  GL++L  S+ T G       + +  D+     P TC ++D  +  A
Sbjct  68   VPDGLPDDHPRSVAGLMDLFESMRTAGCAAFCALLREETDASSRRPPVTCVVADGTMPFA  127

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  531
            +  +EE    +P   FRT SAC F  Y S+P L E GE P   +     P+  V GME F
Sbjct  128  IAAAEEA--GVPALAFRTESACGFLCYLSVPRLLELGETPAASD----EPVRGVPGMEGF  181

Query  532  LR  537
            LR
Sbjct  182  LR  183



>gb|ACD03242.1| UDP-glycosyltransferase UGT709A10 [Avena strigosa]
Length=470

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 92/183 (50%), Gaps = 13/183 (7%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLAL-TDVDSGRFTTRFRLQ  177
            +L+FP+P Q H+N M  LA  L  +  H+TF    + H  L  L T         R RL 
Sbjct  12   VLVFPWPLQGHINCMHHLATALLDAGLHVTFL---HTHHNLRRLATKPAPAPSQPRLRLL  68

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYI---AQNHDSGLPFTCFISDLLVSI  348
            S P G+ +    S   L +L  S+ T G    +  +   + N D   P TC I+D +++ 
Sbjct  69   SIPDGLPEDHPRSVAHLNDLMDSMRTTGSAAYRALLLASSSNKDGHPPVTCVIADGVMAF  128

Query  349  ALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMED  528
            A+DV+EE    +P   FRT SAC+F TY S+  L E GE P   +     P++ V GME 
Sbjct  129  AVDVAEEV--GVPAIAFRTASACSFLTYLSVRRLVELGEFPFPSD----QPVSGVPGMEG  182

Query  529  FLR  537
            FLR
Sbjct  183  FLR  185



>ref|XP_008464906.1| PREDICTED: UDP-glycosyltransferase 85A3-like isoform X1 [Cucumis 
melo]
Length=483

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 97/188 (52%), Gaps = 18/188 (10%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L F  PAQ ++N MLKLA LL LS+  +TF    + + +L   +DV       RF L  
Sbjct  11   VLFFSAPAQGNINVMLKLAQLLSLSSVRVTFLTTEHSYRQLTLHSDV-----LRRFSL--  63

Query  181  FPP----GIYDGALDS-----KEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISD  333
            FP      I DG   S        L E+ HS  ++ KP  +  +   H S    +C I D
Sbjct  64   FPSFQFRTISDGLPLSHPRTFSHHLPEMFHSFVSVTKPLFRDMLVSPHFSS-DLSCLILD  122

Query  334  LLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKV  513
               S  LD+ ++ F  +P++ FRT SAC+ WT FS+P+L + G+LPIKG       +  V
Sbjct  123  GFFSYLLDIDDD-FVKVPIFCFRTFSACSTWTIFSIPNLIKQGQLPIKGEEDMDRILDNV  181

Query  514  KGMEDFLR  537
             GME+ LR
Sbjct  182  PGMENLLR  189



>ref|XP_006357780.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Solanum tuberosum]
Length=489

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 94/181 (52%), Gaps = 8/181 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +L+FP P QS +NSML+LA L  L+   +TF   ++    L   T+V+S RF    +F+ 
Sbjct  17   VLLFPLPIQSPINSMLQLAELFCLAGLQVTFLNTNHNQQLLYRHTNVES-RFKQYPKFQF  75

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
            ++   G+      S     +L  SL  + +PFL++ +    +   P TC I D L   A+
Sbjct  76   RTISDGLPKDHPRSSLLFGDLITSLQAVAEPFLREILLGVTEP--PVTCVIPDGLFYYAV  133

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            D+  E    + V  F TIS C  W Y   P L ++G++P KGN +D   I  V GMED L
Sbjct  134  DICNEV--GVSVISFDTISPCCLWVYLCFPKLIQSGDIPFKGNDLDVL-IENVPGMEDLL  190

Query  535  R  537
            R
Sbjct  191  R  191



>ref|XP_009589441.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X2 [Nicotiana tomentosiformis]
Length=477

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 90/183 (49%), Gaps = 18/183 (10%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSG-RFTTRFRLQ  177
            +L+FP P QS +NSML LA L  L+   +TF   ++    LL  T+V+S  R   RFR +
Sbjct  8    VLLFPLPIQSPINSMLHLAELFCLAGLQVTFLNTNHNQKLLLRHTNVESRFRQYPRFRFR  67

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGL---PFTCFISDLLVSI  348
            +   G+ +    S     EL  SL  + +PFL++ +  +   G+   P TC I D L   
Sbjct  68   TISDGLPEENPRSSVQFGELISSLQAVAEPFLREILLSSSSDGVTEPPVTCVIPDGLFYY  127

Query  349  ALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMED  528
            A+D+  E    +PV  F TIS C  W Y  +P L +A E+P K             GM+ 
Sbjct  128  AVDIGNEI--GVPVIPFDTISPCCLWVYLCIPKLIQAEEIPFKA------------GMQG  173

Query  529  FLR  537
             LR
Sbjct  174  LLR  176



>emb|CAD27851.2| glucosyltransferase [Triticum aestivum]
 emb|CAD27852.2| glucosyltransferase [Triticum aestivum]
Length=204

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 87/183 (48%), Gaps = 7/183 (4%)
 Frame = +1

Query  4    LIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSF  183
            +I P P Q H+  MLKLA LL    FHITF      H RL+      +      FR  + 
Sbjct  14   VIVPLPTQGHVTPMLKLAKLLHCKGFHITFVNTEYNHRRLVRSRGDAAVEGLPDFRFATI  73

Query  184  PPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIALDVS  363
            P G+     D+ + +  LC+S  T   P LK+ + + +  G P TC ++D ++S ++D +
Sbjct  74   PDGLPPSDADATQDIPSLCYSTMTTCLPPLKRLLGELNRVGPPVTCVVADNVMSFSVDAA  133

Query  364  EECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIK-----GNGIDSSPITKVKGMED  528
             E    +P   F T SAC +  Y +   L + G  P+K      NG   +P+ +  GM  
Sbjct  134  AEI--RVPCVLFWTASACGYIGYRNFRFLMQEGIAPLKDEAQLSNGYLDTPVAQAPGMSR  191

Query  529  FLR  537
             +R
Sbjct  192  HMR  194



>gb|EAZ03912.1| hypothetical protein OsI_26045 [Oryza sativa Indica Group]
Length=490

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 92/189 (49%), Gaps = 14/189 (7%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FP+P Q HLN ML LA  L  +  H+TF   ++ + R L      +   +   R  S
Sbjct  10   VLVFPWPIQGHLNVMLHLAVALAGAGVHVTFL-HTDYNLRRLGAAAAAA-VASPWLRFMS  67

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHD--------SGL--PFTCFIS  330
               G+ D    +   L E+  SLHT G+   +  +A +           G   P T  ++
Sbjct  68   VTDGLPDDHPRTVANLGEISRSLHTAGRAAYRALLASSSQLVPADAAGGGAFPPVTTVVA  127

Query  331  DLLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITK  510
            D L+  A+DV+EE    +P   FRT SAC+F  Y S+P L E GELP    G    P+  
Sbjct  128  DALLPFAIDVAEEL--GVPALAFRTASACSFLAYMSVPRLVELGELPFPPGGDLDEPVRG  185

Query  511  VKGMEDFLR  537
            V GME FLR
Sbjct  186  VPGMEGFLR  194



>ref|XP_004489451.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cicer arietinum]
 gb|AGU14130.1| UDP-glycosyltransferase [Cicer arietinum]
Length=485

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 97/192 (51%), Gaps = 20/192 (10%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+ P+PAQ H+N +LKLA +L    FHITF      H RL+     +S    T F  ++
Sbjct  11   VLLIPYPAQGHINPLLKLAKILHFKGFHITFVNTEYNHKRLVESKGPNSLDGFTDFNFET  70

Query  181  FPPGI--YDGALDSKEGLLELCHSLHTIGKPFLKQY---IAQNHDSGL-----PFTCFIS  330
             P G    +G  D  + +L LC S   I K FL+ +   +A+ HDS +     P TC +S
Sbjct  71   IPDGFTPMEGDDDVSQKILSLCES---IRKNFLEPFHKLLAKLHDSAIAGFIPPLTCIVS  127

Query  331  DLLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG-----NGIDS  495
            D  +S  +  SEE    LP+  F   +AC F     LP LFE G +P+K      NG   
Sbjct  128  DYSMSFTIQASEEL--SLPIILFSPANACNFLCSLHLPTLFEKGLIPLKDKSYLTNGYLE  185

Query  496  SPITKVKGMEDF  531
            + +  + G+++F
Sbjct  186  TKVDCIPGLKNF  197



>gb|EAZ39850.1| hypothetical protein OsJ_24290 [Oryza sativa Japonica Group]
Length=473

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 92/189 (49%), Gaps = 14/189 (7%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FP+P Q HLN ML LA  L  +  H+TF   ++ + R L      +   +   R  S
Sbjct  10   VLVFPWPIQGHLNVMLHLAVALAGAGVHVTFLH-TDYNLRRLGAAAAAA-VASPWLRFMS  67

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHD--------SGL--PFTCFIS  330
               G+ D    +   L E+  SLHT G+   +  +A +           G   P T  ++
Sbjct  68   VTDGLPDDHPRTVANLGEISRSLHTAGRAAYRALLASSSQLVPADAAGGGAFPPVTTVVA  127

Query  331  DLLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITK  510
            D L+  A+DV+EE    +P   FRT SAC+F  Y S+P L E GELP    G    P+  
Sbjct  128  DALLPFAIDVAEEL--GVPALAFRTASACSFLAYMSVPRLVELGELPFPPGGDLDEPVRG  185

Query  511  VKGMEDFLR  537
            V GME FLR
Sbjct  186  VPGMEGFLR  194



>ref|XP_010674283.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=487

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 68/191 (36%), Positives = 96/191 (50%), Gaps = 22/191 (12%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q H+  ML LA LL L+N  +TF   +  H  L   T++++ RF     F  
Sbjct  10   VLIFPLPIQGHITPMLNLAELLCLANLKVTFLNTTQNHKLLTRNTNIEA-RFARYPGFVF  68

Query  175  QSFPPGIYD-----GALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGL-PFTCFISDL  336
               P G+ D     G    K+   EL   L   G+P L++ +  +  +G+   TC I D 
Sbjct  69   SIVPDGLADEHPRAGVSKFKDWSSELVEKLALSGEPLLREMLVGS--TGIDKVTCLIIDG  126

Query  337  LVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGID----SSPI  504
             +S A +V+ E    +PV  FR  S C  WTYF +P L +AG++P K   +D    SSP 
Sbjct  127  WISFANEVANEV--EVPVIAFRCSSPCYMWTYFCIPKLIQAGDIPFKDEAMDELVKSSP-  183

Query  505  TKVKGMEDFLR  537
                GM+ FLR
Sbjct  184  ----GMDSFLR  190



>ref|NP_001175206.1| Os07g0489950 [Oryza sativa Japonica Group]
 dbj|BAC80059.1| putative glucosyltransferase-2 [Oryza sativa Japonica Group]
 dbj|BAH93934.1| Os07g0489950 [Oryza sativa Japonica Group]
Length=490

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 92/189 (49%), Gaps = 14/189 (7%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FP+P Q HLN ML LA  L  +  H+TF   ++ + R L      +   +   R  S
Sbjct  10   VLVFPWPIQGHLNVMLHLAVALAGAGVHVTFL-HTDYNLRRLGAAAAAA-VASPWLRFMS  67

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHD--------SGL--PFTCFIS  330
               G+ D    +   L E+  SLHT G+   +  +A +           G   P T  ++
Sbjct  68   VTDGLPDDHPRTVANLGEISRSLHTAGRAAYRALLASSSQLVPADAAGGGAFPPVTTVVA  127

Query  331  DLLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITK  510
            D L+  A+DV+EE    +P   FRT SAC+F  Y S+P L E GELP    G    P+  
Sbjct  128  DALLPFAIDVAEEL--GVPALAFRTASACSFLAYMSVPRLVELGELPFPPGGDLDEPVRG  185

Query  511  VKGMEDFLR  537
            V GME FLR
Sbjct  186  VPGMEGFLR  194



>ref|XP_003544213.2| PREDICTED: UDP-glycosyltransferase 85A2-like [Glycine max]
Length=488

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 61/170 (36%), Positives = 84/170 (49%), Gaps = 7/170 (4%)
 Frame = +1

Query  4    LIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSF  183
            +  P P Q H+N MLKLA LL    FHITF      H RLL     DS +    FR ++ 
Sbjct  22   VCVPHPTQGHINPMLKLAKLLHFKGFHITFVNTEYTHKRLLKSRGPDSIKGLPSFRFETI  81

Query  184  PPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGL-PFTCFISDLLVSIALDV  360
            P G+ +  +D+ + +  LC S      P  +  + + +DS   P +C +SD ++S  LD 
Sbjct  82   PDGLPEPLVDATQHIPSLCDSTRRTCLPHFRNLLTKINDSDAPPVSCIVSDGVMSFTLDA  141

Query  361  SEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITK  510
            +EE    +P   F T SAC F  Y     L E G +P+K    DSS IT 
Sbjct  142  AEEL--GVPQLLFWTPSACGFMCYVQFGQLVEKGLVPLK----DSSCITN  185



>ref|XP_010674284.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=487

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 94/187 (50%), Gaps = 14/187 (7%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q H+  ML LA LL L+N  +TF   +  H  L   T++++ RF     F  
Sbjct  10   VLIFPLPIQGHITPMLNLAELLCLANLKVTFLNTTQNHKLLTRNTNIEA-RFARYPGFVF  68

Query  175  QSFPPGIYD-----GALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGL-PFTCFISDL  336
               P G+ D     G    K+   EL   L   G+P L++ +  +  +G+   TC I D 
Sbjct  69   SIVPDGLADEHPRAGVSKFKDWSSELVEKLALSGEPLLREMLVGS--TGIDKVTCLIIDG  126

Query  337  LVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVK  516
             +S A +V+ E    +PV  FR  S C  WTYF +P L +AG++P K + +D   +    
Sbjct  127  WISFANEVANEV--EVPVIAFRCSSPCYMWTYFCIPKLIQAGDIPFKDDKMDEL-VENAP  183

Query  517  GMEDFLR  537
            GM  FLR
Sbjct  184  GMSSFLR  190



>ref|XP_009600396.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like, partial 
[Nicotiana tomentosiformis]
Length=284

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 91/185 (49%), Gaps = 20/185 (11%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSG-RFTTRFRLQ  177
            +L+FP P QS +NSML+LA L  L+   +TF   ++    LL  T+V+S  R   RFR +
Sbjct  8    VLLFPLPIQSPINSMLQLAELFCLAGLQVTFLNTNHNQKLLLRHTNVESRFRQYPRFRFR  67

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHD-----SGLPFTCFISDLLV  342
            +   G+ +    S     EL  SL  + +PFL++ +  +       +  P TC I D L 
Sbjct  68   TISDGLPEENPRSSVQFGELISSLQAVAEPFLREILLSSSSNSNGVTEPPVTCVIPDGLF  127

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
              A+D+  E    +PV  F TIS C  W Y  +P L +AGE+P K             GM
Sbjct  128  YYAVDIGNEI--GVPVIPFDTISPCCLWVYLCIPKLIQAGEIPFKA------------GM  173

Query  523  EDFLR  537
            +  LR
Sbjct  174  QGLLR  178



>gb|KHN24339.1| UDP-glycosyltransferase 85A2 [Glycine soja]
Length=488

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 61/170 (36%), Positives = 84/170 (49%), Gaps = 7/170 (4%)
 Frame = +1

Query  4    LIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSF  183
            +  P P Q H+N MLKLA LL    FHITF      H RLL     DS +    FR ++ 
Sbjct  22   VCVPHPTQGHINPMLKLAKLLHFKGFHITFVNTEYTHKRLLKSRGPDSIKGLPSFRFETI  81

Query  184  PPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGL-PFTCFISDLLVSIALDV  360
            P G+ +  +D+ + +  LC S      P  +  + + +DS   P +C +SD ++S  LD 
Sbjct  82   PDGLPEPLVDATQHIPSLCDSTRRTCLPHFRNLLTKINDSDAPPVSCIVSDGVMSFTLDA  141

Query  361  SEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITK  510
            +EE    +P   F T SAC F  Y     L E G +P+K    DSS IT 
Sbjct  142  AEEL--GVPQLLFWTPSACGFMCYVQFGQLVEKGLVPLK----DSSCITN  185



>ref|XP_009759439.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=483

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 91/181 (50%), Gaps = 8/181 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT--RFRL  174
            +LIFP P Q  +N  L+LA L  LS   +TF    +   RLL  T+V S RF     FR 
Sbjct  13   VLIFPLPIQGPINCKLQLAELFCLSGLKVTFLNTIHNQERLLRHTNVQS-RFEKYPGFRF  71

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIAL  354
             + P G+ D    S E   ++  S+ T+ +PFL++ +       +  TC + D L     
Sbjct  72   LTIPDGLPDEHPRSFEQFGDIISSVQTVAEPFLREMLRSGAKELV--TCVVPDALSYYVA  129

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            D+  E    +PV  F T+S    W Y  LP L E+GELP K N +D+S +T +  +E  L
Sbjct  130  DIGNEM--GVPVIPFDTLSPSCVWVYMCLPKLIESGELPFKDNDLDAS-VTHIPALEGLL  186

Query  535  R  537
            R
Sbjct  187  R  187



>ref|XP_004237925.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=482

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 87/176 (49%), Gaps = 4/176 (2%)
 Frame = +1

Query  4    LIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSF  183
            +  PFPAQ H+N MLKLA LL + +FHITF      H RLL    ++S      FR +S 
Sbjct  14   VCIPFPAQGHINPMLKLAKLLHIQDFHITFVNTDFNHRRLLKSRGLNSLVRLPSFRFESI  73

Query  184  PPGIYDGALDSKEGLLELCHS-LHTIGKPFLKQYIAQNHDSGLP-FTCFISDLLVSIALD  357
            P G+     D+ + +  +C + + +   PF       N++S +P  +C +SD  +S    
Sbjct  74   PDGLPPSNEDATQDVPSMCEACMKSCLAPFRDLVARLNNNSNIPSISCIVSDAGMSFTQQ  133

Query  358  VSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  525
            VSEE    +P   F T S C+ W +   P L E G  P+K      + I  + GME
Sbjct  134  VSEEL--GVPNVGFWTASVCSLWAFTQYPKLVEQGYAPLKDESYLDTIIDWIPGME  187



>gb|KGN50614.1| hypothetical protein Csa_5G196570 [Cucumis sativus]
Length=485

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 95/188 (51%), Gaps = 18/188 (10%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FP PAQ HLN MLKLA LL LS+  +TF    + + +L   +DV       RF L  
Sbjct  11   VLLFPAPAQGHLNVMLKLAELLSLSSIRVTFLTTEHSYRQLTLHSDV-----LPRFSL--  63

Query  181  FPP----GIYDGALDS-----KEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISD  333
            FP      I DG   S        L E+ HS  ++ KP  +  +   H S    TC I D
Sbjct  64   FPSFQFRTISDGLPLSHPRTFSHHLPEMLHSFVSVTKPLFRDMLLSPHFSS-DLTCLILD  122

Query  334  LLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKV  513
               S  LD+ ++ F  +PV+ FRT  AC+ WT  S+P+L +  +L IKG       +  V
Sbjct  123  GFFSYLLDIDDD-FVKVPVFCFRTFGACSTWTILSIPNLIKQEQLTIKGEDDMDRILDNV  181

Query  514  KGMEDFLR  537
             GME+ LR
Sbjct  182  PGMENLLR  189



>ref|XP_004172562.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
Length=485

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 95/188 (51%), Gaps = 18/188 (10%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FP PAQ HLN MLKLA LL LS+  +TF    + + +L   +DV       RF L  
Sbjct  11   VLLFPAPAQGHLNVMLKLAELLSLSSIRVTFLTTEHSYRQLTLHSDV-----LPRFSL--  63

Query  181  FPP----GIYDGALDS-----KEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISD  333
            FP      I DG   S        L E+ HS  ++ KP  +  +   H S    TC I D
Sbjct  64   FPSFQFRTISDGLPLSHPRTFSHHLPEMLHSFVSVTKPLFRDMLLSPHFSS-DLTCLILD  122

Query  334  LLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKV  513
               S  LD+ ++ F  +PV+ FRT  AC+ WT  S+P+L +  +L IKG       +  V
Sbjct  123  GFFSYLLDIDDD-FVKVPVFCFRTFGACSTWTILSIPNLIKQEQLTIKGEEDMDRILDNV  181

Query  514  KGMEDFLR  537
             GME+ LR
Sbjct  182  PGMENLLR  189



>ref|XP_011014019.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X2 [Populus euphratica]
Length=496

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 93/183 (51%), Gaps = 6/183 (3%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSG-RFTTRFRLQ  177
            ++  PFPAQ H+  ML LA LL  + F  TF   ++I  RL    ++ +  R   +F+ +
Sbjct  19   VVFLPFPAQGHVKPMLMLAELLSQAGFEATFINSNHIQHRLEHSINIATMYRRFPKFQFR  78

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYI---AQNHDSGLPFTCFISDLLVSI  348
            S   G+      S   +++L  S     +   +  +    Q +    P TC I+D ++S 
Sbjct  79   SVTDGLPSDHPRSSSSIVQLLISARDETRTEFRNLLVNLGQKNGRWEPPTCIIADGIMSF  138

Query  349  ALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMED  528
            A+D++EE    +PV  FRT SAC  WTYF L  L E GE+P +G+      IT + G+E 
Sbjct  139  AIDIAEEL--TIPVITFRTFSACCTWTYFHLTKLIEQGEVPFQGDVDMDKTITCIPGLEG  196

Query  529  FLR  537
             LR
Sbjct  197  TLR  199



>ref|XP_010923184.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Elaeis 
guineensis]
Length=484

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 95/186 (51%), Gaps = 10/186 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALT-DVDSGRFTTRFRLQ  177
            +L+ PFPAQ H+  MLK A LL  +   +TF    NIH R LA +  +       RFR +
Sbjct  9    VLVSPFPAQGHVPPMLKFAELLAHAGLRVTFVNTDNIHRRFLASSPALQRLAGLPRFRFR  68

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIA---QNHDSGLPFTCFISDLLVSI  348
            + P G  +         L+L  SL T  +   ++ +     + D   P +C ++D ++ +
Sbjct  69   TIPDGFPEDHPRPFLEFLDLEESLRTRSREHYRELLVPTDPDPDGWPPVSCVVADGMLRL  128

Query  349  ALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPI---KGNGIDSSPITKVKG  519
            A +V+ E    +P+ +FRT  A A W Y  +PDL E G +P    + +G+D + I  V G
Sbjct  129  ASEVAAEM--EIPLIFFRTSGAGAVWAYLCVPDLIEGGVIPFPAEEEDGLDET-IRGVPG  185

Query  520  MEDFLR  537
            ME FLR
Sbjct  186  MEGFLR  191



>ref|XP_007026848.1| UDP-glucosyl transferase 85A3, putative isoform 2, partial [Theobroma 
cacao]
 gb|EOY07350.1| UDP-glucosyl transferase 85A3, putative isoform 2, partial [Theobroma 
cacao]
Length=478

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 100/187 (53%), Gaps = 11/187 (6%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS-GRFTTRFRLQ  177
            +++ PFP+  H+  +L LA LL  ++F +TF  P  IH RLL   D+ +  R    F   
Sbjct  11   VVLLPFPSLGHIKPLLSLAELLSHASFQVTFLNPQQIHDRLLLSMDMPAFHRRHPEFEFL  70

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIG---KPFLKQ-YIAQNHDSGL--PFTCFISD-L  336
            S P  +   +   + GL  L  ++ ++G   KP L +  I+ N + G   P TC I+D L
Sbjct  71   SMPDPVRRSSDRPRPGLFSLHDNILSLGSVIKPALGELLISFNRERGRRQPATCIIADGL  130

Query  337  LVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVK  516
            L S  +DV+E+    +P +  RT SAC  W YF+ P L E G++P +   +D   +T + 
Sbjct  131  LSSPVIDVAEQF--EIPFFALRTSSACCIWAYFNPPKLVEEGDVPFQDEDMDKL-VTCIP  187

Query  517  GMEDFLR  537
            G+E+ +R
Sbjct  188  GLENVVR  194



>ref|XP_007009135.1| UDP-glucosyltransferase family 1 protein, putative [Theobroma 
cacao]
 gb|EOY17945.1| UDP-glucosyltransferase family 1 protein, putative [Theobroma 
cacao]
Length=317

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 81/159 (51%), Gaps = 29/159 (18%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +LIFP PAQ H+NSMLKLA +  L+                             RF+ ++
Sbjct  13   VLIFPLPAQGHVNSMLKLAEVFALAGLQYP------------------------RFKFET  48

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIALDV  360
             P G+ +      +  +EL   +    KP L++ + + +    P  C + D ++ + LDV
Sbjct  49   IPDGLREDHPRLGDCFMELFEGMELRTKPILREMLVKINP---PVDCIVGDGVLGLVLDV  105

Query  361  SEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIK  477
            ++E    +P++ FRTISA   W YF++PD+ EAGELPI+
Sbjct  106  ADEL--GIPIFQFRTISASCIWAYFAIPDMIEAGELPIR  142



>ref|XP_007026850.1| UDP-glucosyl transferase 85A4-like protein isoform 1 [Theobroma 
cacao]
 gb|EOY07352.1| UDP-glucosyl transferase 85A4-like protein isoform 1 [Theobroma 
cacao]
Length=490

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 95/180 (53%), Gaps = 8/180 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFT-TRFRLQ  177
            ++ FPFPA  H+  M +LA LL  +NF +TF      H  LL  +D+ + R     F+L 
Sbjct  11   VVFFPFPAHGHIKPMFRLAELLSHANFQVTFLNTQRNHDLLLLSSDIPAFRSRYPNFQLL  70

Query  178  SFPPGI---YDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISD--LLV  342
            S+P  +    D    S++G ++L  S     KP L + + +      P TC I+D  ++ 
Sbjct  71   SYPDKVPLGLDPHRRSEQGFVDLLLSTKAAAKPALSELL-EKKTGRRPPTCIIADWAIMC  129

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
            S A+DV++E F ++PV+ F+T  A   W  F L  L E GE+P++G      P+T + G+
Sbjct  130  SSAMDVAKE-FGNIPVFAFQTACAHYMWMDFHLLKLIEEGEVPLRGYKDMDKPVTSISGL  188



>gb|KEH17174.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=479

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 90/185 (49%), Gaps = 10/185 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSN-FHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  177
            ++  P+PAQ H+N ML +A LL     FH+TF      H R L     DS      FR +
Sbjct  13   VVCVPYPAQGHINPMLNIAKLLHFKGGFHVTFVNTEYNHKRHLKARGPDSLNGLPTFRFE  72

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDS--GLPFTCFISDLLVSIA  351
            + P G+ +  +DS + +  LC S      P  K  +++ +D+    P TC +SD ++S  
Sbjct  73   TIPDGLPESNVDSTQDIPSLCESTRKTCLPHFKNLLSKLNDALDTPPVTCIVSDGVMSFT  132

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVK  516
            LD ++E   ++P   F T SAC F  Y     L E G  P+K      NG   +PI  V 
Sbjct  133  LDAAQEL--NIPQVLFWTTSACGFMCYAQYRQLMEKGLTPLKDWSDMTNGYLETPIDWVP  190

Query  517  GMEDF  531
            G+++ 
Sbjct  191  GIKEI  195



>gb|EMT06489.1| Cytokinin-O-glucosyltransferase 2 [Aegilops tauschii]
Length=461

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 91/181 (50%), Gaps = 14/181 (8%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FP+P Q H+N ML L   L  + F +TF    +  +RL A   +  G      RL S
Sbjct  7    VLVFPWPLQGHINCMLHLTAALLDAGFRVTFLHTEHNLSRL-ARAALPPG-----LRLLS  60

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIA--QNHDSGLPFTCFISDLLVSIAL  354
             P G+ D    S   L EL  S+ T G    +  +   ++     P TC I+D ++  A+
Sbjct  61   VPDGLPDDHPRSVRSLKELTESMFTTGSAAYRALLLSLRSDSDAPPLTCVIADGIMPFAV  120

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
            D++EE    +P   FRT SAC++  Y S+P L E GE+P   +     P+  V GME FL
Sbjct  121  DIAEEL--GVPALAFRTASACSYLAYLSVPTLVELGEVPFPAD----DPVRGVPGMEGFL  174

Query  535  R  537
            R
Sbjct  175  R  175



>gb|ACJ84649.1| unknown [Medicago truncatula]
Length=480

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 84/173 (49%), Gaps = 9/173 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSN-FHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  177
            ++  PFPAQ H+N MLKLA LL     FH+TF      H RLL     +S      FR +
Sbjct  13   VVCIPFPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKARGPNSLNGLPSFRFE  72

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQ--NHDSGLPFTCFISDLLVSIA  351
            + P G+ +  +D  + +  LC S      P  K+ +++  N     P TC +SD  +S  
Sbjct  73   TIPDGLPESDVDVTQDIPSLCESTRATCSPHFKKLLSKLNNAIDTPPVTCIVSDGCMSFT  132

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITK  510
            LD ++E   ++P   F T SAC F  Y     L E G  P+K    DSS IT 
Sbjct  133  LDAAQEL--NIPEVLFWTTSACGFMCYMQYRKLIEEGLTPLK----DSSYITN  179



>gb|AFK37311.1| unknown [Medicago truncatula]
Length=480

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 84/173 (49%), Gaps = 9/173 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSN-FHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  177
            ++  PFPAQ H+N MLKLA LL     FH+TF      H RLL     +S      FR +
Sbjct  13   VVCIPFPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKARGPNSLNGLPSFRFE  72

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQ--NHDSGLPFTCFISDLLVSIA  351
            + P G+ +  +D  + +  LC S      P  K+ +++  N     P TC +SD  +S  
Sbjct  73   TIPDGLPESDVDVTQDIPSLCESTRATCSPHFKKLLSKLNNAIDTPPVTCIVSDGCMSFT  132

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITK  510
            LD ++E   ++P   F T SAC F  Y     L E G  P+K    DSS IT 
Sbjct  133  LDAAQEL--NIPEVLFWTTSACGFMCYMQYRKLIEEGLTPLK----DSSYITN  179



>ref|XP_011014018.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X1 [Populus euphratica]
Length=498

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 95/185 (51%), Gaps = 8/185 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSG-RFTTRFRLQ  177
            ++  PFPAQ H+  ML LA LL  + F  TF   ++I  RL    ++ +  R   +F+ +
Sbjct  19   VVFLPFPAQGHVKPMLMLAELLSQAGFEATFINSNHIQHRLEHSINIATMYRRFPKFQFR  78

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYI---AQNHDSGLPFTCFISDLLVSI  348
            S   G+      S   +++L  S     +   +  +    Q +    P TC I+D ++S 
Sbjct  79   SVTDGLPSDHPRSSSSIVQLLISARDETRTEFRNLLVNLGQKNGRWEPPTCIIADGIMSF  138

Query  349  ALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNG-ID-SSPITKVKGM  522
            A+D++EE    +PV  FRT SAC  WTYF L  L E GE+P +G G +D    IT + G+
Sbjct  139  AIDIAEEL--TIPVITFRTFSACCTWTYFHLTKLIEQGEVPFQGPGDVDMDKTITCIPGL  196

Query  523  EDFLR  537
            E  LR
Sbjct  197  EGTLR  201



>ref|XP_003615138.1| Cytokinin-O-glucosyltransferase [Medicago truncatula]
 gb|AES98096.1| UDP-glucosyltransferase family protein [Medicago truncatula]
 gb|KEH28099.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=480

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 84/172 (49%), Gaps = 9/172 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSN-FHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  177
            ++  PFPAQ H+N MLKLA LL     FH+TF      H RLL     +S      FR +
Sbjct  13   VVCIPFPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKARGPNSLNGLPSFRFE  72

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQ--NHDSGLPFTCFISDLLVSIA  351
            + P G+ +  +D  + +  LC S      P  K+ +++  N     P TC +SD  +S  
Sbjct  73   TIPDGLPESDVDVTQDIPSLCESTRATCSPHFKKLLSKLNNAIDTPPVTCIVSDGCMSFT  132

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPIT  507
            LD ++E   ++P   F T SAC F  Y     L E G  P+K    DSS IT
Sbjct  133  LDAAQEL--NIPEVLFWTTSACGFMCYMQYRKLIEEGLTPLK----DSSYIT  178



>ref|XP_003576916.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Brachypodium 
distachyon]
Length=493

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 93/185 (50%), Gaps = 10/185 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FP+P Q H+N ML  A  L  +  H+TF    +  AR+  L    S   T R R  S
Sbjct  6    VLVFPWPLQGHINCMLHFAAGLVGAGLHVTFLHTEHNLARVDPLA---SAAATPRLRFVS  62

Query  181  FPPGIYDG----ALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGL-PFTCFISDLLVS  345
             P G+  G      D KE LL    + +      L+Q  +   D+G  P +C ++D L+ 
Sbjct  63   VPDGLPAGHPRTVRDLKEPLLTTVPAAYRALLASLQQQPSTTADAGFPPVSCVVADGLLP  122

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGE-LPIKGNGIDSSPITKVKGM  522
             A+D+ EE F  +P   FRT+SAC+   Y S+P L E GE +PI  +      +  V GM
Sbjct  123  FAIDIPEEEFG-VPALAFRTVSACSILAYLSVPRLVELGEAIPIPLDADLDELVLGVPGM  181

Query  523  EDFLR  537
            E FLR
Sbjct  182  EGFLR  186



>gb|AFK33787.1| unknown [Medicago truncatula]
Length=480

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 84/172 (49%), Gaps = 9/172 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSN-FHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  177
            ++  PFPAQ H+N MLKLA LL     FH+TF      H RLL     +S      FR +
Sbjct  13   VVCIPFPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKARGPNSLNGLPSFRFE  72

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQ--NHDSGLPFTCFISDLLVSIA  351
            + P G+ +  +D  + +  LC S      P  K+ +++  N     P TC +SD  +S  
Sbjct  73   TIPDGLPESDVDVTQDIPSLCESTRATCSPHFKKLLSKLNNAIDTPPVTCIVSDGCMSFT  132

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPIT  507
            LD ++E   ++P   F T SAC F  Y     L E G  P+K    DSS IT
Sbjct  133  LDAAQEL--NIPEVLFWTTSACGFMCYMQYRKLIEEGLTPLK----DSSYIT  178



>gb|EYU41802.1| hypothetical protein MIMGU_mgv1a0212491mg, partial [Erythranthe 
guttata]
Length=230

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 89/184 (48%), Gaps = 14/184 (8%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTR---FR  171
            ++I PFPAQ H+  ML LA LL  ++F +TF    + H R+    D     F  R    +
Sbjct  6    VVIIPFPAQGHIKPMLMLAELLSQASFTVTFVNNEHTHRRI----DAAEHAFRRRCPGIK  61

Query  172  LQSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIA  351
              S P G+      +   +++L  S  T  KP  K  IA    +     C ISD ++S A
Sbjct  62   FLSIPDGLPPDHPRTGPSIVDLLLSTSTSCKPIFKDTIASMSHAP---ACIISDGIMSFA  118

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGID--SSPITKVKGME  525
            +D + E    +P   FRT SA   WTYF L  L + GE+P   +G D    PI  + G+E
Sbjct  119  IDAAAEL--GIPAITFRTYSATCTWTYFHLQTLIQHGEIPAPADGSDDVDKPIPYIPGLE  176

Query  526  DFLR  537
            + +R
Sbjct  177  NIIR  180



>ref|XP_006658565.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Oryza brachyantha]
Length=505

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 67/198 (34%), Positives = 92/198 (46%), Gaps = 25/198 (13%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FP+PAQ H+N M  LA     +  H+TF    +   RL +     S     R R  S
Sbjct  9    VLVFPWPAQGHINPMAHLAVAFAGAGAHVTFLHTDHNLRRLGSAVAAAS----PRLRFLS  64

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIA---QNHDSGL--------------  309
             P G+ D    S   +LE+  SL T G+   +  +A   Q    G               
Sbjct  65   VPDGLPDEHPRSVADILEIGRSLATAGRVAYRALLASLLQPQPGGHGGADAGTGAGGGGC  124

Query  310  --PFTCFISDLLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGN  483
              P T  ++D L++ A+D++EE    +P   FRT SAC+   Y S+P LFE GELP    
Sbjct  125  FPPVTAVVADGLLTFAIDIAEEL--GVPALAFRTTSACSVLAYLSVPKLFELGELPFPPG  182

Query  484  GIDSSPITKVKGMEDFLR  537
            G    P+  V GME FLR
Sbjct  183  GDLDEPVRGVPGMEGFLR  200



>ref|XP_007026851.1| UDP-Glycosyltransferase superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY07353.1| UDP-Glycosyltransferase superfamily protein isoform 2 [Theobroma 
cacao]
Length=489

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 96/180 (53%), Gaps = 9/180 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFT-TRFRLQ  177
            ++ FPFPA  H+  M +LA LL  +NF +TF      H  LL  +D+ + R     F+L 
Sbjct  11   VVFFPFPAHGHIKPMFRLAELLSHANFQVTFLNTQRNHDLLLLSSDIPAFRSRYPNFQLL  70

Query  178  SFPPGI---YDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISD--LLV  342
            S+P  +    D    S++G ++L  S     KP L + + +      P TC I+D  ++ 
Sbjct  71   SYPDKVPLGLDPHRRSEQGFVDLLLSTKAAAKPALSELL-EKKTGRRPPTCIIADWAIMC  129

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
            S A+DV++E F ++PV+ F+T  A   W  F L  L E GE+P++   +D  P+T + G+
Sbjct  130  SSAMDVAKE-FGNIPVFAFQTACAHYMWMDFHLLKLIEEGEVPLRDKDMD-KPVTSISGL  187



>ref|XP_003544799.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Glycine max]
Length=472

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 85/170 (50%), Gaps = 7/170 (4%)
 Frame = +1

Query  4    LIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSF  183
            +  P+PAQ H+N MLKLA LL    FHITF      H R+L      S      FR ++ 
Sbjct  13   VCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRILKARGPYSLNGLPSFRFETI  72

Query  184  PPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGL-PFTCFISDLLVSIALDV  360
            P G+ +  +++ + +  LC S      P  +  +A+ ++S + P TC +SD  +S  LD 
Sbjct  73   PDGLPEPVVEATQDIPSLCDSTRRTCLPHFRNLLAKINNSDVPPVTCIVSDGGMSFTLDA  132

Query  361  SEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITK  510
            +EE    +P   F T SAC F  Y     L E G +P+    IDSS +T 
Sbjct  133  AEEL--GVPQVLFWTPSACGFMCYLQYEKLIEKGLMPL----IDSSYVTN  176



>ref|XP_006853219.1| hypothetical protein AMTR_s00038p00218410 [Amborella trichopoda]
 gb|ERN14686.1| hypothetical protein AMTR_s00038p00218410 [Amborella trichopoda]
Length=472

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 89/193 (46%), Gaps = 17/193 (9%)
 Frame = +1

Query  4    LIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSF  183
            +  P+PAQ H+N M++LA LL    FHITF      H RLL     D       F  +S 
Sbjct  12   VCVPYPAQGHINPMMQLAKLLHARGFHITFVNNEYNHKRLLKSRGPDPSMGVQGFAFESI  71

Query  184  PPGIYDGALDSKEGLLELC-HSLHTIGKPFLKQYIAQNHDSGL-PFTCFISDLLVSIALD  357
            P G+    +++ + + ELC ++ +    PF +     N    L P +C ISD  ++    
Sbjct  72   PDGLPPIEIEATQSIPELCYYTRNCCLAPFRELVARLNSTEDLPPVSCVISDGAMNFTQT  131

Query  358  VSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG-------------NGIDSS  498
            V++E    +P   F T SAC FW Y   P+L E G  P+K              N I S 
Sbjct  132  VADEL--GIPRVTFWTTSACGFWAYLHYPELVERGYTPLKDASQLTNGHLETPLNWIQSM  189

Query  499  PITKVKGMEDFLR  537
            P  +++ M  FLR
Sbjct  190  PSIRLRDMPSFLR  202



>dbj|BAB86928.1| glucosyltransferase-10 [Vigna angularis]
Length=485

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 93/183 (51%), Gaps = 9/183 (5%)
 Frame = +1

Query  4    LIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSF  183
            +  PFPAQ H+N MLKLA LL  + F+ITF      H RLL    ++S      FR ++ 
Sbjct  13   VCVPFPAQGHINPMLKLAKLLHFNGFYITFVNTHYNHKRLLKSRGLNSLNGLPSFRFETI  72

Query  184  PPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQ-NHDSGLP-FTCFISDLLVSIALD  357
            P G+ +  ++    +  LC S  T   P  +  +++ N++SG+P  +C ISD ++S  LD
Sbjct  73   PDGLPEPEVEGTHHVPSLCDSTSTTCLPHFRNLLSKLNNESGVPAVSCIISDGVMSFTLD  132

Query  358  VSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKGM  522
             S+E    LP   F T SAC F  Y     L + G +P K      NG   + I  V G+
Sbjct  133  ASQEL--GLPNVLFWTSSACGFMCYVHYHQLIQRGIVPFKDASDLTNGYLDTTIDWVAGI  190

Query  523  EDF  531
            ++ 
Sbjct  191  KEI  193



>ref|XP_003618663.1| Cytokinin-O-glucosyltransferase [Medicago truncatula]
 gb|AES74881.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=485

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 98/191 (51%), Gaps = 18/191 (9%)
 Frame = +1

Query  4    LIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSF  183
            ++ P+P Q H+N ++KLA LL L  FHITF      H RLL     ++    T F  ++ 
Sbjct  9    VLIPYPVQGHINPLIKLAKLLHLRGFHITFVNTEYNHKRLLKSRGPNAFVGFTDFTFEAI  68

Query  184  PPGI----YDGALDSKEGLLELCHSLH-TIGKPFLKQYIAQNHDSGL-----PFTCFISD  333
            P G+     DG  D  + +  LC S+     +PF ++ I++ +DS       P TC I+D
Sbjct  69   PDGLPSNEGDGDGDVSQDIYALCESIRKNFLQPF-RELISRLNDSATSGLVPPVTCIIAD  127

Query  334  LLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG-----NGIDSS  498
              +S  +   EE    +PV +F   +AC FWT F L  LF+ G +P+K      NG   +
Sbjct  128  NSMSFTIQAGEEL--SIPVVFFSPANACTFWTGFHLLTLFDKGVIPLKDESYLTNGYLDT  185

Query  499  PITKVKGMEDF  531
             +  ++G+++F
Sbjct  186  KVDCIQGLQNF  196



>ref|XP_010316060.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X2 [Solanum lycopersicum]
Length=469

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 92/180 (51%), Gaps = 17/180 (9%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSG-RFTTRFRLQ  177
            +L+FP P QS +NSML+LA L  L+   +TF   ++    L   TDV+S  R   +F+ +
Sbjct  5    VLLFPLPIQSPINSMLQLAELFCLAGLQVTFLNTNHNQQLLYRHTDVESRFRQYPKFQFR  64

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIALD  357
            +   G+ D    S     +L  SL  + +PFL++ + +   SG+  TC I D L   A+D
Sbjct  65   TISDGLPDDHPRSSLLFGDLITSLQAVAEPFLREIVTE---SGV--TCVIPDGLFYYAVD  119

Query  358  VSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLR  537
            +  E    + V  F TIS C  W Y   P L ++G++P K N         V GMED LR
Sbjct  120  ICNEL--GVSVISFDTISPCCLWVYLCFPKLIQSGDIPFKEN---------VPGMEDLLR  168



>ref|XP_007026849.1| UDP-glucosyl transferase 85A3, putative [Theobroma cacao]
 gb|EOY07351.1| UDP-glucosyl transferase 85A3, putative [Theobroma cacao]
Length=468

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 94/177 (53%), Gaps = 8/177 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+ PFPAQ H+  ML LA LL  +   +TF    + H RL  L D+ S RF T    +S
Sbjct  6    VLVLPFPAQGHIKPMLCLAELLCQAGLRVTFLNTHHSHRRLNNLQDL-STRFPT-LHFES  63

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQ-NHDSGL-PFTCFISDLLVSIAL  354
               G+ +    +    + L HS+  + KP L+  +   +  + + P +C I+D ++S A+
Sbjct  64   VSDGLPEDHPRNLVHFMHLVHSIKNVTKPLLRDLLTSLSLKTDIPPVSCIIADGILSFAI  123

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGN--GIDSSPITKVKG  519
            DV+EE    + V  FRTIS+C  W+Y  +P L + GEL    +  G   S + ++KG
Sbjct  124  DVAEEL--QIKVIIFRTISSCCLWSYLCVPKLIQQGELQFSDSDMGQKVSSVPEMKG  178



>gb|KHN04913.1| UDP-glycosyltransferase 85A2 [Glycine soja]
Length=457

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 88/182 (48%), Gaps = 18/182 (10%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVP-SNIHARLLALTDVDSGRFTTRFRLQ  177
            +LIFP P   HL SMLKLA LL L N H+TF    S  +  L   T  D       +  +
Sbjct  6    VLIFPLPLPGHLGSMLKLAELLALDNIHVTFVDELSECYPTLHFKTIPDC------YDEE  59

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLP-FTCFISD-LLVSIA  351
               PG  D   D          S     KPFL+  +   H  G+P  +C I D +  +++
Sbjct  60   GEHPGFGDRVGD-------FITSTAQHAKPFLRDILLSQHSPGIPKVSCIIQDGIFGALS  112

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  531
             D + E    +P+ +FRT+S+C FW YF +P L +  ELPIKG       I  + GME+ 
Sbjct  113  SDFAAEL--RIPLIHFRTVSSCCFWAYFCVPKLLDCKELPIKGEEDMDRIIRNMPGMENL  170

Query  532  LR  537
            LR
Sbjct  171  LR  172



>ref|XP_007018744.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOY15969.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=487

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 86/183 (47%), Gaps = 11/183 (6%)
 Frame = +1

Query  4    LIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSF  183
            +  P+PAQ H+N MLKLA +L    FHITF      H RLL     D+      FR ++ 
Sbjct  13   VCIPYPAQGHINPMLKLAKILHHRGFHITFVNTEFNHKRLLKARGPDALNGLPSFRFETI  72

Query  184  PPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGL----PFTCFISDLLVSIA  351
            P G+    +D+ + +  LC S      P  KQ + + +DS      P +C +SD ++S  
Sbjct  73   PDGLPPTDVDATQDIPSLCESTRKTCLPHFKQLLHKLNDSSSANVPPVSCIVSDGVMSFT  132

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVK  516
            LD +EE    +P   F T SAC F  Y     L E G  P+K      NG   + I  + 
Sbjct  133  LDAAEEL--GVPEVLFWTTSACGFLGYVHYRQLMEKGYTPLKDESYLTNGYLDTVIDWIP  190

Query  517  GME  525
             ME
Sbjct  191  AME  193



>ref|XP_010095928.1| UDP-glycosyltransferase 85A5 [Morus notabilis]
 ref|XP_010095929.1| UDP-glycosyltransferase 85A5 [Morus notabilis]
 gb|EXB62621.1| UDP-glycosyltransferase 85A5 [Morus notabilis]
 gb|EXB62622.1| UDP-glycosyltransferase 85A5 [Morus notabilis]
Length=180

 Score = 90.1 bits (222),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 81/169 (48%), Gaps = 19/169 (11%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +LIFP PAQ H+ SML LA LL L    +TF    ++H RL    D+++       R   
Sbjct  17   VLIFPLPAQGHVTSMLTLAELLSLCGIDVTFLNTDHVHNRLFRHADIEA-------RFAD  69

Query  181  FP----PGIYDGALD-----SKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISD  333
            +P      I DG  D     +   + E+ HS+    KP L + +       +  TC I+D
Sbjct  70   YPGLLFRTISDGLPDDHPRSNDRSITEVLHSMIATTKPVLNEMLVSGALGSV--TCIIAD  127

Query  334  LLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG  480
               +     +  C  H+P+ Y++  SAC  WT     D+ +AGELPI+G
Sbjct  128  GAFA-GFVTNSACELHVPIIYYQPASACCLWTLLCFDDIIKAGELPIRG  175



>ref|XP_007042920.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOX98751.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=519

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 89/182 (49%), Gaps = 8/182 (4%)
 Frame = +1

Query  4    LIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSF  183
            +  P+PAQ H+N MLK+A LL    FHITF      H RLL     ++      FR ++ 
Sbjct  13   VCLPYPAQGHVNPMLKVAKLLHFKGFHITFVNTEYNHKRLLKSRGPNALDGVPDFRFETI  72

Query  184  PPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGL-PFTCFISDLLVSIALDV  360
            P G+    +D+ + +  LC S         +Q +A+ + SG+ P TC +SD ++S  L  
Sbjct  73   PDGLPPPDIDATQDIPALCDSTSKNCLAPFRQLLAKLNSSGVPPVTCIVSDGVMSFTLKA  132

Query  361  SEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKGME  525
            +EE    +P   F T SAC F  Y   P L E G  P+K      NG   + I  + GM+
Sbjct  133  AEEL--GIPEVLFWTTSACGFLGYMHYPRLIERGFTPLKDETYLTNGYLDTVIDWIPGMK  190

Query  526  DF  531
            + 
Sbjct  191  NI  192



>gb|KJB74148.1| hypothetical protein B456_011G275500 [Gossypium raimondii]
Length=195

 Score = 90.1 bits (222),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 58/182 (32%), Positives = 94/182 (52%), Gaps = 19/182 (10%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS--GRFTTRFRL  174
            +LIFP P Q H+N+M+KLA LL ++ F +TF    + H RL+   ++ +   R+   F+ 
Sbjct  15   VLIFPLPLQGHINTMIKLAELLPIAGFKLTFLNSHHNHKRLVKFNNIAAHFERYPG-FKF  73

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQN-HDSGLPFTCFISDLLVSIA  351
            ++   G+      S    L++        +P +KQ + +   +S  P  C I+D  +   
Sbjct  74   KTITDGLPLDHPRSGSWFLDM---FEETMEPKMKQSLREVLVNSSPPVDCVIADGRLES-  129

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  531
                       P+++F T S+C FW  +S+PD+ +AGELPI G+      IT V GME +
Sbjct  130  -----------PLFFFHTSSSCCFWVSYSIPDIIQAGELPINGSEDMDRLITTVPGMETY  178

Query  532  LR  537
            LR
Sbjct  179  LR  180



>gb|KHN24338.1| UDP-glycosyltransferase 85A3 [Glycine soja]
Length=456

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 80/160 (50%), Gaps = 3/160 (2%)
 Frame = +1

Query  4    LIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSF  183
            +  P+PAQ H+N MLKLA LL    FHITF      H R+L      S      FR ++ 
Sbjct  5    VCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRILKARGPYSLNGLPSFRFETI  64

Query  184  PPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGL-PFTCFISDLLVSIALDV  360
            P G+ +  +++ + +  LC S      P  +  +A+ ++S + P TC +SD  +S  LD 
Sbjct  65   PDGLPEPVVEATQDIPSLCDSTRRTCLPHFRNLLAKINNSDVSPVTCIVSDGGMSFTLDA  124

Query  361  SEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG  480
            +EE    +P   F T SAC F  Y     L E G +P+ G
Sbjct  125  AEEL--GVPQVLFWTPSACGFMCYLQYEKLIEKGLMPLIG  162



>gb|EMT25167.1| Cytokinin-O-glucosyltransferase 2 [Aegilops tauschii]
Length=323

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 90/187 (48%), Gaps = 25/187 (13%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT------  162
            +L FP+P Q H+N ML LA  L  +   +TF     +H      T+ +  RFT       
Sbjct  5    VLAFPWPLQGHINPMLHLASALLDAGLRVTF-----LH------TEHNLRRFTRVPPHHP  53

Query  163  RFRLQSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGL--PFTCFISDL  336
            R RL S P G+ D    S  GL+EL  S+ T G    +  + +  DS      TC I+D 
Sbjct  54   RLRLASIPDGLPDHHPRSVGGLMELVESMRTAGSAAYRALLLRMMDSDDDDAVTCVITDG  113

Query  337  LVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVK  516
            ++  A+ V+EE    +P   FRT SAC F  Y S+P L E GE P+  + +         
Sbjct  114  VMPFAVSVAEEL--GVPALAFRTESACGFLAYLSVPRLLELGEKPVPSDELARG----AP  167

Query  517  GMEDFLR  537
            GME FLR
Sbjct  168  GMEGFLR  174



>gb|EPS61663.1| hypothetical protein M569_13131, partial [Genlisea aurea]
Length=464

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 105/196 (54%), Gaps = 20/196 (10%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFT--TRFRL  174
            +LIFP P Q  +N+MLKL+ LL L+  H+TF + +  +A L   +D++S RF+  + FR+
Sbjct  18   VLIFPLPLQGPVNAMLKLSELLCLAGIHVTFLLSNFSYALLRRHSDIES-RFSRYSGFRI  76

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIA-----QNHDSGLPFTCFISDLL  339
                 G+ +       G ++L  S+  +G+  L++ +      ++  +    +  I D +
Sbjct  77   AGIDDGLPEDRPRVGVGSIDLLSSILRVGETELRKVLEATDSLRDGSARRRVSFIIIDGI  136

Query  340  VSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG----------NGI  489
            ++  L V+EE    +PV +FRTISAC+FW  F   ++  AGELP++G          N  
Sbjct  137  LNFVLPVAEEL--GIPVVHFRTISACSFWASFCSKEVIAAGELPLRGEEEGKYEYWRNPN  194

Query  490  DSSPITKVKGMEDFLR  537
               P+T + GME  LR
Sbjct  195  LDLPVTSIPGMEAILR  210



>ref|XP_004302685.2| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=489

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 94/197 (48%), Gaps = 28/197 (14%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTT-RFRLQ  177
            +L+ PFPAQ H+  ML LA LL  +  H+TF    + H R L   +  S RF T RFR  
Sbjct  11   VLLLPFPAQGHIKPMLTLAQLLCHAGIHVTFVNTEHNH-RHLTQRESLSARFPTLRFR--  67

Query  178  SFPPGIYDG-ALDSKEGL----LELCHSLHTIGKPFLKQYIAQ-----NHDSGL------  309
                 I+DG   D    +    L++  SL +   P L Q +       N D G       
Sbjct  68   ----SIFDGLPSDHPRSISPYFLDIVTSLRSTTAPLLHQLLVSLASKTNDDIGAAAGDQL  123

Query  310  -PFTCFISDLLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNG  486
             P +C I+D L+  A+D +EE    LPV   RT SAC+ W Y  LP L E  ELP     
Sbjct  124  PPLSCVITDGLMCFAIDAAEEV--GLPVIAVRTSSACSVWCYLCLPKLIEEAELPFGDED  181

Query  487  IDSSPITKVKGMEDFLR  537
            +D + ++ V G E  LR
Sbjct  182  MDKT-VSGVPGKECLLR  197



>gb|AFK34769.1| unknown [Lotus japonicus]
Length=484

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 86/173 (50%), Gaps = 10/173 (6%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSN-FHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  177
            ++  P+PAQ H+N MLKLA LL     FH+TF      H RLL     DS      FR +
Sbjct  13   VVCIPYPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKSRGPDSLNGLPSFRFE  72

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGL---PFTCFISDLLVSI  348
            + P G+ +  +D  + +  LC S      P  K+ +++ +D      P TC +SD  +S 
Sbjct  73   TIPDGLPETDVDVTQDIPSLCISTRKTCLPHFKKLLSKLNDVSSDVPPVTCIVSDGCMSF  132

Query  349  ALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPIT  507
             LD + E   ++P   F T SAC F  Y    +L E G +P+K    DSS IT
Sbjct  133  TLDAAIEL--NIPEVLFWTTSACGFMGYVQYRELIEKGIIPLK----DSSDIT  179



>ref|XP_002285771.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=476

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 87/180 (48%), Gaps = 9/180 (5%)
 Frame = +1

Query  4    LIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSF  183
            +  P+PAQ H+N MLKLA  L    FHITF      H RLL     DS +    F+ ++ 
Sbjct  13   VCIPYPAQGHINPMLKLAKFLHFRGFHITFVNTEYNHNRLLKSRGPDSLKGIPSFQFKTI  72

Query  184  PPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQ-NHDSGLPFTCFISDLLVSIALDV  360
            P G+    +D+ + +  LC S      P  +  ++  NHD G P TC +SD  +S  LD 
Sbjct  73   PDGLLPSNVDATQDIPALCVSTRKHCLPPFRDLLSNLNHD-GPPVTCIVSDGAMSFTLDA  131

Query  361  SEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKGME  525
            ++E    +P   F T SAC F  Y    +L + G  P+K      NG   + I  + GM+
Sbjct  132  AQEL--GVPEVLFWTTSACGFMGYVQYRNLIDKGLAPLKDESYLTNGYLDTVIDWIPGMK  189



>gb|EMT13628.1| Cytokinin-O-glucosyltransferase 2 [Aegilops tauschii]
Length=857

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 57/185 (31%), Positives = 87/185 (47%), Gaps = 12/185 (6%)
 Frame = +1

Query  13   PFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSFPPG  192
            P+PAQ H   M+KLA +L    FH+TF    + H RL+      +      FR  + P G
Sbjct  368  PYPAQGHATPMMKLAKVLHSRGFHVTFVYTEHNHRRLVRSRGAGAVAGLPGFRFATIPDG  427

Query  193  IYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGL-----PFTCFISDLLVSIALD  357
            +     D+ +    +CHS  T   P LK  +   ++S       P TC ++D ++S A+D
Sbjct  428  LPPSDPDATQDQASICHSTTTTCLPHLKSLLGGLNNSAAGTGTPPVTCVVADSIMSFAVD  487

Query  358  VSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKGM  522
             + E    +P   F T SAC +  Y++   L + G  P+KG     NG   +P+T   GM
Sbjct  488  AAAEL--GVPCALFWTASACGYMGYYNFQFLVDHGLTPLKGEEQLTNGYLDTPVTNALGM  545

Query  523  EDFLR  537
               +R
Sbjct  546  TKHMR  550



>ref|XP_007026847.1| UDP-glucosyl transferase 85A3, putative isoform 1 [Theobroma 
cacao]
 gb|EOY07349.1| UDP-glucosyl transferase 85A3, putative isoform 1 [Theobroma 
cacao]
Length=496

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 99/188 (53%), Gaps = 11/188 (6%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS-GRFTTRFRLQ  177
            +++ PFP+  H+  +L LA LL  ++F +TF  P  IH RLL   D+ +  R    F   
Sbjct  11   VVLLPFPSLGHIKPLLSLAELLSHASFQVTFLNPQQIHDRLLLSMDMPAFHRRHPEFEFL  70

Query  178  SFPPGIYDGALDSKEGLLELCHSLHTIG---KPFLKQ-YIAQNHDSGL--PFTCFISD-L  336
            S P  +   +   + GL  L  ++ ++G   KP L +  I+ N + G   P TC I+D L
Sbjct  71   SMPDPVRRSSDRPRPGLFSLHDNILSLGSVIKPALGELLISFNRERGRRQPATCIIADGL  130

Query  337  LVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSP-ITKV  513
            L S  +DV+E+    +P +  RT SAC  W YF+ P L E G++P +    D    +T +
Sbjct  131  LSSPVIDVAEQF--EIPFFALRTSSACCIWAYFNPPKLVEEGDVPFQVADEDMDKLVTCI  188

Query  514  KGMEDFLR  537
             G+E+ +R
Sbjct  189  PGLENVVR  196



>ref|XP_004489447.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Cicer arietinum]
 gb|AGU14131.1| UDP-glycosyltransferase [Cicer arietinum]
Length=486

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 96/190 (51%), Gaps = 16/190 (8%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+ P+PAQ H+N +LKL  +L    FHITF      H RL      +S    T F  ++
Sbjct  11   VLLIPYPAQGHINPLLKLPKILHFKGFHITFVNTEYNHKRLNESKGPNSVDGFTDFNFET  70

Query  181  FPPGI--YDGALDSKEGLLELCHSLH-TIGKPFLKQYIAQNHDSGL-----PFTCFISDL  336
             P G+   +G  D  + ++ LC S+   + +PF ++ +A+ HDS +     P TC +SD 
Sbjct  71   IPDGLTPMEGDGDVSQDMMSLCESIRKNVLEPF-RKLLAKLHDSAIAGLIPPLTCIVSDY  129

Query  337  LVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSP  501
             +S  +  SEE    LP+  F   +AC F     L  LFE G +P+K      NG   + 
Sbjct  130  SMSFTIQASEEL--SLPIILFSPSNACNFLCGLHLSTLFEKGLIPLKDKSYLTNGYLETK  187

Query  502  ITKVKGMEDF  531
            +  + G+++F
Sbjct  188  VDCIPGLKNF  197



>ref|XP_011016624.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=505

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 88/184 (48%), Gaps = 11/184 (6%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            ++  PFPAQ H+N MLKLA +L   +FHITF      H RLL    +DS    + FR ++
Sbjct  13   VVCLPFPAQGHINPMLKLAKILHQKDFHITFVNTEFNHRRLLRSRGLDSLDGLSTFRFET  72

Query  181  FPPGIYDGALDSKEGLLELCHSL-HTIGKPFLKQYIAQNHDSGL---PFTCFISDLLVSI  348
             P G+     DS + +  LC S       PF       N+ S     P TC +SD ++S 
Sbjct  73   IPDGLPPSDADSTQHVPSLCDSTKKNCLAPFRDLLSRLNNTSSSKVPPVTCIVSDCIMSF  132

Query  349  ALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKV  513
             L  ++E    +P  +F T S C F +Y     L E G +P+K      NG   + I  +
Sbjct  133  TLKAAQEL--GIPNVFFWTASVCGFMSYLQYRPLIEKGYVPLKDESYLTNGYLDTVIDWI  190

Query  514  KGME  525
             GME
Sbjct  191  PGME  194



>gb|ADV71371.1| glycosyltransferase GT14M03 [Pueraria montana var. lobata]
Length=485

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 88/183 (48%), Gaps = 9/183 (5%)
 Frame = +1

Query  4    LIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSF  183
            +  PFPAQ H+N MLKLA LL    FHITF      H RLL     DS +  + FR ++ 
Sbjct  13   VCVPFPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKSRGPDSLKGLSSFRFETI  72

Query  184  PPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGL--PFTCFISDLLVSIALD  357
            P G+ +  ++  + +  LC        P  +  +++  DS    P +C +SD ++S  LD
Sbjct  73   PDGLPEPDVEVTQHVPSLCDYTRRTCLPHFRNVLSKLRDSPSVPPVSCIVSDGIMSFTLD  132

Query  358  VSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKGM  522
             ++E    +P   F T SAC F  Y     L E G  P+K      NG   + I  + G+
Sbjct  133  AAQEF--GVPNVLFWTTSACGFMCYVQYQQLIERGLTPLKDASYLTNGYLETAIDWIPGI  190

Query  523  EDF  531
            ++ 
Sbjct  191  KEI  193



>ref|XP_011045673.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=474

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 80/160 (50%), Gaps = 4/160 (3%)
 Frame = +1

Query  4    LIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSF  183
            +  PFPAQ H+N MLKLA +L  + FHITF      H RLL    V S      F+ ++ 
Sbjct  8    VCVPFPAQGHINPMLKLAKILHFNGFHITFVNTEYNHRRLLRSRGVSSLDGLPDFQFETI  67

Query  184  PPGIYDGALDSKEGLLELCHSL-HTIGKPFLKQYIAQNHDSGLP-FTCFISDLLVSIALD  357
            P G+     DS + +L LC+S   T   PF       N  S +P  TC +SD +++  LD
Sbjct  68   PDGLPPSDADSTQDILTLCYSTSKTCLAPFRDLISKLNSSSVIPQVTCIVSDAVMNFTLD  127

Query  358  VSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIK  477
             +EE    +P   F T SAC    Y     LFE G +P+K
Sbjct  128  AAEEF--GIPDALFWTPSACGVLGYSKCRSLFERGLIPVK  165



>ref|XP_006473006.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
Length=240

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 90/183 (49%), Gaps = 12/183 (7%)
 Frame = +1

Query  4    LIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSF  183
            +  P+PAQ H+N MLKLA +L    FHITF      H RLL     DS      FR ++ 
Sbjct  14   VCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHKRLLKSRGPDSLNGLPSFRFETI  73

Query  184  PPGIYDGALDSKEGLLELCHS-LHTIGKPFLKQYIAQNHDSGL---PFTCFISDLLVSIA  351
            P G+    +D+ + +  LC+S   T   PF K+ + + +D      P TC +SD ++S  
Sbjct  74   PDGLPPTDVDATQDIPSLCYSTTRTCLAPF-KELLHKLNDPSSNVPPVTCIVSDGVMSFT  132

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVK  516
            +D +EE    +P   F T SAC F  Y     L + G  P+K      NG  ++ I  + 
Sbjct  133  VDAAEEL--GVPEVLFWTTSACGFLAYLHFRQLIDKGYTPLKDESYFTNGYLNTVIDWIP  190

Query  517  GME  525
            GM+
Sbjct  191  GMK  193



>ref|XP_002462874.1| hypothetical protein SORBIDRAFT_02g033570 [Sorghum bicolor]
 gb|EER99395.1| hypothetical protein SORBIDRAFT_02g033570 [Sorghum bicolor]
Length=487

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 63/197 (32%), Positives = 90/197 (46%), Gaps = 24/197 (12%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FP+P Q H+N ML  A  L  +  H++F    +    L   +         R R  S
Sbjct  6    VLVFPWPMQGHINCMLHFATGLAGAGLHVSFLHTEHNLRLLGLASAA----AAPRLRFLS  61

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGK-------------PFLKQYIAQNHDSGL----  309
             P G+ D    S   L+EL  SL T G              P  +     + D+G+    
Sbjct  62   VPDGLPDDHPRSVGDLIELARSLKTEGSVAYRALLTTLLPVPPAESPGGPSSDAGVDPGF  121

Query  310  -PFTCFISDLLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNG  486
             P TC ++D L+  A+D +EE    +P   FRT SAC+F  Y S+P LF+ GE+P    G
Sbjct  122  PPVTCVVADGLLPWAIDTAEEL--GVPALAFRTASACSFLAYLSVPKLFDLGEVPFPAGG  179

Query  487  IDSSPITKVKGMEDFLR  537
                P+  V  ME +LR
Sbjct  180  SLDEPVRGVPRMESYLR  196



>ref|XP_010106102.1| UDP-glycosyltransferase 85A5 [Morus notabilis]
 gb|EXC07556.1| UDP-glycosyltransferase 85A5 [Morus notabilis]
Length=180

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 82/170 (48%), Gaps = 21/170 (12%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +LI P PAQ H+ SML LA LL L    +TF    ++H RL    D+++       R   
Sbjct  17   VLILPLPAQGHVTSMLTLAELLSLCGIDVTFLNTDHVHNRLFRHADIEA-------RFAD  69

Query  181  FP----PGIYDGALD-----SKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISD  333
            +P      I DG  D     +   + E+ HS+    KP L + +       +  TC I+D
Sbjct  70   YPGLLFRTISDGLPDDHPRSNDRSITEVLHSMIATTKPVLNEMLVSGALGSV--TCIIAD  127

Query  334  -LLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG  480
                  A +++  C  H+P+ Y++  SAC  WT     D+ +AGELPI+G
Sbjct  128  GAFAGFATNLA--CELHVPIIYYQPASACCLWTLLCFEDIIKAGELPIRG  175



>ref|XP_008808008.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Phoenix dactylifera]
Length=477

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 88/182 (48%), Gaps = 9/182 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            ++  P+PAQ H+  MLKLA LL    FHITF      H RLL      +      FR  +
Sbjct  11   VVCIPYPAQGHVTPMLKLAKLLHSKGFHITFVNTEFNHCRLLKSRGPSALDGLPDFRFAT  70

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIALDV  360
             P G+     D+ + +  LC+S  T   P  ++ ++     G P TC ISD ++S  LD 
Sbjct  71   IPDGLPPSDADATQDIPSLCYSTMTTCLPHFRRLLSML--DGPPLTCIISDGVMSFTLDA  128

Query  361  SEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKGME  525
            ++E    +P   F T SAC F +Y     L E G +P+K      NG   +P+  + G++
Sbjct  129  AKEL--GVPEVLFWTTSACGFMSYLHYRHLIEKGLVPLKDASDLTNGYLDTPLDWIPGLK  186

Query  526  DF  531
            + 
Sbjct  187  NM  188



>ref|XP_011045674.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=503

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 87/180 (48%), Gaps = 9/180 (5%)
 Frame = +1

Query  13   PFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSFPPG  192
            PFPAQ H+N MLKLA +L  + FHITF      H RLL    V S      F+ ++ P G
Sbjct  40   PFPAQGHINPMLKLAKILHFNGFHITFVNTEYNHRRLLRSRGVSSLDGLPDFQFETIPDG  99

Query  193  IYDGALDSKEGLLELCHSL-HTIGKPFLKQYIAQNHDSGLP-FTCFISDLLVSIALDVSE  366
            +     DS + +L LC+S   T   PF       N  S +P  TC +SD +++  LD +E
Sbjct  100  LPPSDADSTQDILTLCYSTSKTCLAPFRDLISKLNSSSVIPQVTCIVSDAVMNFTLDAAE  159

Query  367  ECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKGMEDF  531
            E    +P   F T SAC    Y     LFE G +P+K      N    + I  ++G E+ 
Sbjct  160  EF--GIPDALFWTPSACGVLGYSKCRSLFERGLIPVKDVSYITNEFLETAIEWIQGKENI  217



>ref|XP_002462875.1| hypothetical protein SORBIDRAFT_02g033580 [Sorghum bicolor]
 gb|EER99396.1| hypothetical protein SORBIDRAFT_02g033580 [Sorghum bicolor]
Length=509

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 91/192 (47%), Gaps = 16/192 (8%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FP PAQ HLNS L L+  L  +  H+TF   ++ + R L     ++   + R R  S
Sbjct  12   VLVFPAPAQGHLNSFLHLSTGLLRAGLHVTFL-HTDHNLRRLGAAVAEATAASPRLRFLS  70

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGL-----------PFTCFI  327
             P G+ D    + +GL  L  +L T      +  +  +                P TC +
Sbjct  71   VPDGLPDDDPRAVDGLPRLVEALCTKASASYRALMLASLSPRADGGGGAADGFPPVTCVV  130

Query  328  SDLLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGID--SSP  501
             D ++   +DV+EE    +P   +RT+SACA   Y S+P L + GELP    G D    P
Sbjct  131  GDGILPFVVDVAEEL--GVPAISYRTVSACAVLAYLSVPRLLDLGELPFPEGGDDVLDEP  188

Query  502  ITKVKGMEDFLR  537
            +  V GME FLR
Sbjct  189  VRGVPGMESFLR  200



>ref|XP_003563101.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Brachypodium 
distachyon]
Length=495

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 92/203 (45%), Gaps = 32/203 (16%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARL------LALTDVDSGRFTT  162
            +L+FP PAQ H+N ML+    L  +  H+TF    +   RL             +   + 
Sbjct  6    VLVFPCPAQGHINCMLQFTAGLLAAGLHVTFLHSDHNLRRLRHANNNNNNESTAAANSSP  65

Query  163  RFRLQSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIA---------------QNH  297
            R R  S P G+ D    S   L+E   S+      F K  +A                 +
Sbjct  66   RLRFMSVPDGLPDDHPRSAGNLVEFMESM------FAKTSVAYRALLSSLRAPAPPLDAN  119

Query  298  DSGL---PFTCFISDLLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGEL  468
            D GL   P TC ++D ++  A+ VSEE    +P   FRT SAC+F  Y S+PDL   GE+
Sbjct  120  DDGLLFPPVTCVVADGMLPFAITVSEEL--GVPALAFRTASACSFLAYLSVPDLVALGEV  177

Query  469  PIKGNGIDSSPITKVKGMEDFLR  537
            P+  +    +P+  V GME FLR
Sbjct  178  PVPESADLDAPVRGVPGMEAFLR  200



>ref|XP_006853218.1| hypothetical protein AMTR_s00038p00217680 [Amborella trichopoda]
 gb|ERN14685.1| hypothetical protein AMTR_s00038p00217680 [Amborella trichopoda]
Length=482

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 88/193 (46%), Gaps = 17/193 (9%)
 Frame = +1

Query  4    LIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSF  183
            +  PFPAQ H+  M++LA LL    FHITF      H RLL     D       F  +S 
Sbjct  12   VCVPFPAQGHITPMMQLAKLLHARGFHITFVNNEYNHKRLLKSRGSDPSMGVQGFVFESI  71

Query  184  PPGIYDGALDSKEGLLELC-HSLHTIGKPFLKQYIAQNHDSGL-PFTCFISDLLVSIALD  357
            P G+    +++ + + ELC ++  +   PF +     N    L P +C ISD +++    
Sbjct  72   PDGVPPIEIEATQSIPELCYYTRFSCLDPFRELVARLNSSEDLPPVSCVISDGVMNFTQT  131

Query  358  VSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG-------------NGIDSS  498
            +++E    +P   F T SAC  W Y   P+L E G  P+K              N I S 
Sbjct  132  LADEL--GIPRVAFWTTSACGLWAYLQYPELIERGYTPLKDASQLTNGYLETPLNWIQSM  189

Query  499  PITKVKGMEDFLR  537
            P  +++ M  FLR
Sbjct  190  PSIRLRDMPSFLR  202



>dbj|BAC57706.1| putative glucosyltransferase-2 [Oryza sativa Japonica Group]
Length=485

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 90/185 (49%), Gaps = 16/185 (9%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FP P   H+  ML  A  L  +  H+TF    +   R  A +       + R R  S
Sbjct  12   VLMFPCPVHGHITCMLHFATGLLAAGLHVTFLHSDHNLRRAAAAS-------SPRLRYVS  64

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIG----KPFLKQYIAQNHDSGLP-FTCFISDLLVS  345
             P G+          ++EL  SL T      +  L   +  +   G P  TC ++D ++S
Sbjct  65   IPDGLPVEHPRDVGRIVELMESLKTKASVAYRSLLASLLLGDATGGFPPVTCVVADGIMS  124

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIK-GNGIDSSPITKVKGM  522
             A+DV+EE    +P   FRT SAC+F  Y SLP L E GELP K G+ +D  P+  V GM
Sbjct  125  FAVDVAEEL--GIPALAFRTDSACSFLAYLSLPRLLELGELPFKDGDDLD-EPVRGVPGM  181

Query  523  EDFLR  537
            E FLR
Sbjct  182  ESFLR  186



>gb|AIL51400.1| glycosyltransferase [Actinidia deliciosa]
Length=484

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 90/183 (49%), Gaps = 11/183 (6%)
 Frame = +1

Query  4    LIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSF  183
            +  P+PAQ H+  MLKLA LL    FH+TF      H RLL     DS    + FR ++ 
Sbjct  13   VCLPYPAQGHITPMLKLAKLLHSKGFHVTFVNTEFNHKRLLKSRGPDSLTGLSSFRFETI  72

Query  184  PPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHD---SGL-PFTCFISDLLVSIA  351
            P G+ +  LD+ + +  LC S         +Q + + ++   SG+ P +C +SD ++S +
Sbjct  73   PDGLPESDLDATQFIPSLCESTRKNCLGPFRQLLGKLNNTVSSGVPPVSCVVSDGVMSFS  132

Query  352  LDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVK  516
            LD +EE    +P   F T S C F  Y    +L E G  P+K      NG   + I  + 
Sbjct  133  LDAAEEL--GIPQVLFWTTSVCGFMAYVHYRNLIEKGYTPLKDVSYVTNGYLDTVIDWIP  190

Query  517  GME  525
            GME
Sbjct  191  GME  193



>ref|XP_009387949.1| PREDICTED: UDP-glycosyltransferase 85A2-like, partial [Musa acuminata 
subsp. malaccensis]
Length=249

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 79/170 (46%), Gaps = 6/170 (4%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            ++  P+PAQ H+  M+ LA LL    FHITF      H RLL    + S      FR +S
Sbjct  11   VVCIPYPAQGHVTPMMMLAKLLHSHGFHITFVNTQYNHRRLLRSKALSSDDVLPDFRFES  70

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGLPFTCFISDLLVSIALDV  360
             P G+     D+ + +  LC S+     P     + Q ++   P +C +SD ++S  LD 
Sbjct  71   IPDGLPPSDKDATQDIPSLCESIQNNALPPFLDLLRQLNEGSPPVSCVVSDGIMSFTLDA  130

Query  361  SEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITK  510
            ++E    +P   F T SAC F  Y     L E G  P+K    D S IT 
Sbjct  131  AKEL--SIPEVMFWTPSACGFMGYLHYKHLLERGLTPLK----DESDITN  174



>ref|XP_007141201.1| hypothetical protein PHAVU_008G175600g [Phaseolus vulgaris]
 gb|ESW13195.1| hypothetical protein PHAVU_008G175600g [Phaseolus vulgaris]
Length=479

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 91/184 (49%), Gaps = 10/184 (5%)
 Frame = +1

Query  4    LIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSF  183
            +  PFPAQ H+N MLKLA LL  + FHITF      H RLL    +DS      FR Q+ 
Sbjct  13   VCVPFPAQGHINPMLKLAKLLHSNGFHITFVNTECNHKRLLKSRGLDSLNGLPSFRFQTI  72

Query  184  PPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQ-NHDS-GLP-FTCFISDLLVSIAL  354
            P G+ +   +    +  LC S      P  +  +++ N+D  G+P  +C +SD ++S  L
Sbjct  73   PDGLPEPDDEGTHQVPSLCDSTRATCLPHFRNLLSKLNNDCPGVPAVSCIVSDGVMSFTL  132

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIK-----GNGIDSSPITKVKG  519
            D S+E    +P   F T SAC F  Y     L + G +P+K      NG   + I  + G
Sbjct  133  DASQEL--GIPNVLFWTSSACGFMCYVHYNQLVQRGIVPLKDASYLKNGYLDTTIDWIAG  190

Query  520  MEDF  531
            +++ 
Sbjct  191  IKEI  194



>gb|EAZ39839.1| hypothetical protein OsJ_24280 [Oryza sativa Japonica Group]
Length=468

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 90/185 (49%), Gaps = 16/185 (9%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FP P   H+  ML  A  L  +  H+TF    +   R  A +       + R R  S
Sbjct  12   VLMFPCPVHGHITCMLHFATGLLAAGLHVTFLHSDHNLRRAAAAS-------SPRLRYVS  64

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIG----KPFLKQYIAQNHDSGLP-FTCFISDLLVS  345
             P G+          ++EL  SL T      +  L   +  +   G P  TC ++D ++S
Sbjct  65   IPDGLPVEHPRDVGRIVELMESLKTKASVAYRSLLASLLLGDATGGFPPVTCVVADGIMS  124

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIK-GNGIDSSPITKVKGM  522
             A+DV+EE    +P   FRT SAC+F  Y SLP L E GELP K G+ +D  P+  V GM
Sbjct  125  FAVDVAEEL--GIPALAFRTDSACSFLAYLSLPRLLELGELPFKDGDDLD-EPVRGVPGM  181

Query  523  EDFLR  537
            E FLR
Sbjct  182  ESFLR  186



>ref|NP_001059664.1| Os07g0486700 [Oryza sativa Japonica Group]
 dbj|BAF21578.1| Os07g0486700 [Oryza sativa Japonica Group]
Length=492

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 90/185 (49%), Gaps = 16/185 (9%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+FP P   H+  ML  A  L  +  H+TF    +   R  A +       + R R  S
Sbjct  12   VLMFPCPVHGHITCMLHFATGLLAAGLHVTFLHSDHNLRRAAAAS-------SPRLRYVS  64

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIG----KPFLKQYIAQNHDSGLP-FTCFISDLLVS  345
             P G+          ++EL  SL T      +  L   +  +   G P  TC ++D ++S
Sbjct  65   IPDGLPVEHPRDVGRIVELMESLKTKASVAYRSLLASLLLGDATGGFPPVTCVVADGIMS  124

Query  346  IALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIK-GNGIDSSPITKVKGM  522
             A+DV+EE    +P   FRT SAC+F  Y SLP L E GELP K G+ +D  P+  V GM
Sbjct  125  FAVDVAEEL--GIPALAFRTDSACSFLAYLSLPRLLELGELPFKDGDDLD-EPVRGVPGM  181

Query  523  EDFLR  537
            E FLR
Sbjct  182  ESFLR  186



>ref|XP_009598263.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like, partial 
[Nicotiana tomentosiformis]
Length=174

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 75/160 (47%), Gaps = 4/160 (3%)
 Frame = +1

Query  4    LIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSF  183
            +  PFPAQ H+N MLKLA LL L  FHI+F      H RLL      +      F  +S 
Sbjct  17   VCIPFPAQGHINPMLKLAKLLHLRGFHISFVNTEFNHRRLLKSRGPSALSGLPSFHFESI  76

Query  184  PPGIYDGALDSKEGLLELCHSLHTIG-KPFLKQYIAQNHDSGL-PFTCFISDLLVSIALD  357
            P G+     D+ + +  LC S   +   PF K     N+     P +C +SD  +S   +
Sbjct  77   PDGLPPSNEDATQDVPSLCESCKKLCLAPFRKLVTRLNNSLNFPPVSCIVSDAGMSFTHE  136

Query  358  VSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIK  477
            VS+E    +P   F T S CA W +   P L E G  P+K
Sbjct  137  VSKEL--GIPNVAFWTASGCALWAFLQYPKLVEEGYCPLK  174



>ref|XP_009346996.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Pyrus 
x bretschneideri]
Length=485

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 88/190 (46%), Gaps = 16/190 (8%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+ PFPAQ H+  ML  A LL  +  H+TF    + H RLL      S RF T    +S
Sbjct  12   VLLLPFPAQGHITPMLSFAQLLGHAGIHVTFLNTEHNH-RLLTQRHALSARFPT-LHFES  69

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYI-----------AQNHDSGLPFTCFI  327
             P G+      S   ++++  SL ++ KP L+  +                   P +C I
Sbjct  70   LPDGLPPDCPRSIPHIIDMVSSLKSVTKPLLRDLLITLTKKDEESYGSTSTRRPPLSCVI  129

Query  328  SDLLVSIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPIT  507
             D ++  A+DV+E+    +P      IS C +W+Y  +P+L + G +P     +D    +
Sbjct  130  MDEIMCFAIDVAEKV--GVPAMAITVISGCGYWSYSCIPNLIQQGHVPFTDEDMDKQS-S  186

Query  508  KVKGMEDFLR  537
             + GME  LR
Sbjct  187  DIPGMEGLLR  196



>gb|EMT24598.1| Cytokinin-O-glucosyltransferase 2 [Aegilops tauschii]
Length=472

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 92/186 (49%), Gaps = 9/186 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L+ P+PAQ H+N +L+LA  L + +FHITF    + H RLL      +      FR ++
Sbjct  13   VLLIPYPAQGHVNPLLRLAKALHMRSFHITFVHTEHNHRRLLRSRGPGAVEEVPGFRFET  72

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQ-NHDSGL-PFTCFISDLLVSIAL  354
             P G+    LD+ + +  LC +        +++ I + +H  G+ P TC I+D  +   +
Sbjct  73   IPDGLPPADLDATQDIWMLCEATRRTCPGPVRELIERLSHTEGVPPVTCVIADGAMGFVV  132

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKG  519
             V++E    LP Y F T SAC    Y +   L + G +P K      +G   +P+  + G
Sbjct  133  HVAKELV--LPAYLFFTTSACGLLAYLNFDQLVKRGYVPFKDENCFTDGYLDTPVGWITG  190

Query  520  MEDFLR  537
            M   +R
Sbjct  191  MISNVR  196



>dbj|BAJ85877.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=498

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 88/181 (49%), Gaps = 13/181 (7%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  180
            +L FP+P Q H+N ML LA  L  +   +TF    +   R + +          R RL S
Sbjct  16   VLAFPWPLQGHINPMLHLASALLDAGLRVTFLHTEHNLRRFIRVPP-----HHPRLRLLS  70

Query  181  FPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQYIAQNHDSGL--PFTCFISDLLVSIAL  354
             P G+ D    S +GL+EL  S+ T+     +  + +  +S      TC ++D ++  A+
Sbjct  71   VPDGLPDDHPRSVDGLMELVESMRTVASAAYRALLLRTMESEPDDAVTCVVADGVMPFAI  130

Query  355  DVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  534
             V+E     +P   FRT SAC F  Y S+P L E GELP+  +      +  V GME FL
Sbjct  131  SVAEGI--GVPALAFRTESACGFLAYLSVPRLLELGELPVPSD----EQVHGVAGMEGFL  184

Query  535  R  537
            R
Sbjct  185  R  185



>ref|XP_006429243.1| hypothetical protein CICLE_v10011602mg [Citrus clementina]
 gb|ESR42483.1| hypothetical protein CICLE_v10011602mg [Citrus clementina]
Length=486

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 94/185 (51%), Gaps = 10/185 (5%)
 Frame = +1

Query  1    ILIFPFPAQSHLNSMLKLAHLLDLSNFHITFFVPSNIHARLLALTDVDS--GRFTTRFRL  174
            +++ P+P Q H+  M+ LA LL  +NF +TF   ++ H  LL  TD+ S   RF   F+ 
Sbjct  13   VVLLPYPLQGHIKPMMSLAELLGSANFQVTFVNTNHNHDLLLRNTDITSFCNRFPN-FQF  71

Query  175  QSFPPGIYDGALDSKEGLLELCHSLHTIGKPFLKQY---IAQNHDSGLPFTCFISD-LLV  342
            +S P G+    + S     ++  ++  + KP  +     + +  +     TC I+D +L 
Sbjct  72   RSIPSGLPANVIRSGLTAKDVFDAMKAMSKPAFRDLLISLGEETEQRQRPTCVIADGILC  131

Query  343  SIALDVSEECFNHLPVYYFRTISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  522
             + LDVSEE    +P+   RT +A   W YF LP L E G +P     +D  P+  + G 
Sbjct  132  FLTLDVSEEL--QIPLLALRTHNASYSWIYFHLPKLIEDGHIPFLDENMD-KPVAGIPGF  188

Query  523  EDFLR  537
            E+FLR
Sbjct  189  ENFLR  193



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551443513800