BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF009D09

Length=464
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002268282.1|  PREDICTED: probable beta-1,3-galactosyltrans...  78.6    4e-14   Vitis vinifera
ref|XP_010657202.1|  PREDICTED: probable beta-1,3-galactosyltrans...  78.6    4e-14   Vitis vinifera
ref|XP_010657203.1|  PREDICTED: probable beta-1,3-galactosyltrans...  78.6    4e-14   Vitis vinifera
ref|XP_009359950.1|  PREDICTED: probable beta-1,3-galactosyltrans...  75.9    3e-13   Pyrus x bretschneideri [bai li]
ref|XP_007215470.1|  hypothetical protein PRUPE_ppa006530mg           74.7    8e-13   Prunus persica
ref|XP_007215471.1|  hypothetical protein PRUPE_ppa006530mg           74.7    8e-13   Prunus persica
ref|XP_008364090.1|  PREDICTED: probable beta-1,3-galactosyltrans...  74.7    8e-13   
ref|XP_008342011.1|  PREDICTED: probable beta-1,3-galactosyltrans...  73.9    1e-12   Malus domestica [apple tree]
ref|XP_008342010.1|  PREDICTED: probable beta-1,3-galactosyltrans...  73.9    2e-12   Malus domestica [apple tree]
emb|CDP10795.1|  unnamed protein product                              73.9    2e-12   Coffea canephora [robusta coffee]
ref|XP_008229956.1|  PREDICTED: probable beta-1,3-galactosyltrans...  73.2    3e-12   Prunus mume [ume]
ref|XP_006375532.1|  hypothetical protein POPTR_0014s15200g           72.0    7e-12   Populus trichocarpa [western balsam poplar]
ref|XP_004287949.1|  PREDICTED: probable beta-1,3-galactosyltrans...  72.0    7e-12   Fragaria vesca subsp. vesca
ref|XP_002320464.1|  galactosyltransferase family protein             72.0    7e-12   Populus trichocarpa [western balsam poplar]
ref|XP_011463344.1|  PREDICTED: probable beta-1,3-galactosyltrans...  72.0    7e-12   Fragaria vesca subsp. vesca
ref|XP_009353286.1|  PREDICTED: probable beta-1,3-galactosyltrans...  72.0    8e-12   Pyrus x bretschneideri [bai li]
ref|XP_009353285.1|  PREDICTED: probable beta-1,3-galactosyltrans...  72.0    8e-12   Pyrus x bretschneideri [bai li]
gb|KDO54670.1|  hypothetical protein CISIN_1g015407mg                 71.6    1e-11   Citrus sinensis [apfelsine]
gb|KDO54671.1|  hypothetical protein CISIN_1g015407mg                 71.6    1e-11   Citrus sinensis [apfelsine]
ref|XP_006447568.1|  hypothetical protein CICLE_v10015443mg           71.6    1e-11   Citrus clementina [clementine]
gb|KDO54672.1|  hypothetical protein CISIN_1g015407mg                 71.6    1e-11   Citrus sinensis [apfelsine]
ref|XP_006469679.1|  PREDICTED: probable beta-1,3-galactosyltrans...  71.6    1e-11   Citrus sinensis [apfelsine]
ref|XP_006469680.1|  PREDICTED: probable beta-1,3-galactosyltrans...  71.6    1e-11   Citrus sinensis [apfelsine]
gb|EYU34029.1|  hypothetical protein MIMGU_mgv1a007633mg              71.2    1e-11   Erythranthe guttata [common monkey flower]
ref|XP_007153952.1|  hypothetical protein PHAVU_003G079100g           70.5    2e-11   Phaseolus vulgaris [French bean]
ref|XP_011047261.1|  PREDICTED: probable beta-1,3-galactosyltrans...  70.5    3e-11   Populus euphratica
ref|XP_003596979.1|  hypothetical protein MTR_2g088270                70.5    3e-11   Medicago truncatula
ref|XP_011047262.1|  PREDICTED: probable beta-1,3-galactosyltrans...  70.5    3e-11   Populus euphratica
ref|XP_009770915.1|  PREDICTED: probable beta-1,3-galactosyltrans...  69.7    5e-11   Nicotiana sylvestris
ref|NP_172009.1|  putative beta-1,3-galactosyltransferase 2           69.7    5e-11   
ref|NP_001077462.1|  putative beta-1,3-galactosyltransferase 2        69.7    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008224857.1|  PREDICTED: probable beta-1,3-galactosyltrans...  69.3    6e-11   Prunus mume [ume]
ref|XP_011100272.1|  PREDICTED: probable beta-1,3-galactosyltrans...  69.3    7e-11   Sesamum indicum [beniseed]
ref|NP_001050543.1|  Os03g0577500                                     68.9    1e-10   
ref|XP_009357459.1|  PREDICTED: probable beta-1,3-galactosyltrans...  68.6    1e-10   Pyrus x bretschneideri [bai li]
gb|KDP39142.1|  hypothetical protein JCGZ_00899                       68.2    2e-10   Jatropha curcas
ref|XP_004487414.1|  PREDICTED: probable beta-1,3-galactosyltrans...  67.8    2e-10   Cicer arietinum [garbanzo]
ref|XP_009598546.1|  PREDICTED: probable beta-1,3-galactosyltrans...  67.8    2e-10   Nicotiana tomentosiformis
gb|KDO78241.1|  hypothetical protein CISIN_1g015962mg                 66.2    2e-10   Citrus sinensis [apfelsine]
ref|XP_003540300.1|  PREDICTED: probable beta-1,3-galactosyltrans...  67.8    2e-10   Glycine max [soybeans]
gb|KDO78238.1|  hypothetical protein CISIN_1g015962mg                 66.2    2e-10   Citrus sinensis [apfelsine]
ref|XP_010469587.1|  PREDICTED: probable beta-1,3-galactosyltrans...  67.4    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010469586.1|  PREDICTED: probable beta-1,3-galactosyltrans...  67.4    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_006452382.1|  hypothetical protein CICLE_v10008439mg           67.4    3e-10   Citrus clementina [clementine]
ref|XP_006475057.1|  PREDICTED: probable beta-1,3-galactosyltrans...  67.4    3e-10   Citrus sinensis [apfelsine]
ref|XP_010276120.1|  PREDICTED: probable beta-1,3-galactosyltrans...  67.4    3e-10   Nelumbo nucifera [Indian lotus]
ref|XP_006452384.1|  hypothetical protein CICLE_v10008439mg           67.4    3e-10   
ref|XP_007026089.1|  Galactosyltransferase family protein isoform 2   66.6    3e-10   
gb|KDO78237.1|  hypothetical protein CISIN_1g015962mg                 66.2    4e-10   Citrus sinensis [apfelsine]
ref|XP_002279814.2|  PREDICTED: probable beta-1,3-galactosyltrans...  67.0    4e-10   Vitis vinifera
ref|XP_006650268.1|  PREDICTED: probable beta-1,3-galactosyltrans...  67.0    4e-10   Oryza brachyantha
ref|XP_007045661.1|  Galactosyltransferase family protein             66.6    5e-10   
ref|XP_006855892.1|  hypothetical protein AMTR_s00037p00154410        66.6    6e-10   Amborella trichopoda
ref|XP_002892271.1|  galactosyltransferase family protein             66.2    6e-10   Arabidopsis lyrata subsp. lyrata
ref|XP_006346208.1|  PREDICTED: probable beta-1,3-galactosyltrans...  66.2    7e-10   Solanum tuberosum [potatoes]
ref|XP_003543389.1|  PREDICTED: probable beta-1,3-galactosyltrans...  66.2    7e-10   Glycine max [soybeans]
ref|XP_004244109.1|  PREDICTED: probable beta-1,3-galactosyltrans...  66.2    7e-10   Solanum lycopersicum
ref|XP_002518474.1|  Beta-1,3-galactosyltransferase sqv-2, putative   65.9    9e-10   Ricinus communis
ref|XP_007211967.1|  hypothetical protein PRUPE_ppa006589mg           65.9    9e-10   
ref|XP_008439989.1|  PREDICTED: probable beta-1,3-galactosyltrans...  65.9    9e-10   Cucumis melo [Oriental melon]
ref|XP_006467429.1|  PREDICTED: probable beta-1,3-galactosyltrans...  65.9    9e-10   Citrus sinensis [apfelsine]
ref|XP_006467430.1|  PREDICTED: probable beta-1,3-galactosyltrans...  65.9    9e-10   Citrus sinensis [apfelsine]
ref|XP_010413995.1|  PREDICTED: probable beta-1,3-galactosyltrans...  65.9    1e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010510018.1|  PREDICTED: probable beta-1,3-galactosyltrans...  65.9    1e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010413996.1|  PREDICTED: probable beta-1,3-galactosyltrans...  65.9    1e-09   Camelina sativa [gold-of-pleasure]
ref|XP_004507687.1|  PREDICTED: probable beta-1,3-galactosyltrans...  65.5    1e-09   Cicer arietinum [garbanzo]
ref|XP_007026088.1|  Galactosyltransferase family protein isoform 1   65.9    1e-09   
ref|XP_009624796.1|  PREDICTED: probable beta-1,3-galactosyltrans...  65.9    1e-09   Nicotiana tomentosiformis
ref|XP_009624797.1|  PREDICTED: probable beta-1,3-galactosyltrans...  65.9    1e-09   Nicotiana tomentosiformis
gb|EMT25658.1|  Putative beta-1,3-galactosyltransferase 2             65.5    1e-09   
dbj|BAJ89822.1|  predicted protein                                    65.5    1e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ89733.1|  predicted protein                                    65.5    1e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010923856.1|  PREDICTED: probable beta-1,3-galactosyltrans...  65.5    1e-09   Elaeis guineensis
ref|XP_007149975.1|  hypothetical protein PHAVU_005G115300g           65.1    2e-09   Phaseolus vulgaris [French bean]
ref|XP_004134762.1|  PREDICTED: probable beta-1,3-galactosyltrans...  65.1    2e-09   Cucumis sativus [cucumbers]
ref|XP_004243473.1|  PREDICTED: probable beta-1,3-galactosyltrans...  65.1    2e-09   Solanum lycopersicum
ref|XP_004155605.1|  PREDICTED: probable beta-1,3-galactosyltrans...  65.1    2e-09   
ref|XP_010323831.1|  PREDICTED: probable beta-1,3-galactosyltrans...  65.1    2e-09   Solanum lycopersicum
ref|XP_010278673.1|  PREDICTED: probable beta-1,3-galactosyltrans...  64.7    2e-09   Nelumbo nucifera [Indian lotus]
ref|XP_010923857.1|  PREDICTED: probable beta-1,3-galactosyltrans...  64.7    2e-09   Elaeis guineensis
ref|XP_006366586.1|  PREDICTED: probable beta-1,3-galactosyltrans...  65.1    2e-09   Solanum tuberosum [potatoes]
ref|XP_006366587.1|  PREDICTED: probable beta-1,3-galactosyltrans...  65.1    2e-09   Solanum tuberosum [potatoes]
ref|XP_010923855.1|  PREDICTED: probable beta-1,3-galactosyltrans...  65.1    2e-09   
ref|XP_010534019.1|  PREDICTED: probable beta-1,3-galactosyltrans...  64.7    3e-09   Tarenaya hassleriana [spider flower]
ref|XP_010929797.1|  PREDICTED: probable beta-1,3-galactosyltrans...  64.7    3e-09   Elaeis guineensis
ref|XP_006418057.1|  hypothetical protein EUTSA_v10007787mg           64.7    3e-09   Eutrema salsugineum [saltwater cress]
ref|XP_010278672.1|  PREDICTED: probable beta-1,3-galactosyltrans...  64.7    3e-09   Nelumbo nucifera [Indian lotus]
ref|XP_004144497.1|  PREDICTED: probable beta-1,3-galactosyltrans...  64.3    3e-09   Cucumis sativus [cucumbers]
ref|XP_008455443.1|  PREDICTED: probable beta-1,3-galactosyltrans...  64.3    3e-09   Cucumis melo [Oriental melon]
ref|XP_010104592.1|  putative beta-1,3-galactosyltransferase 2        64.3    3e-09   
emb|CDP05735.1|  unnamed protein product                              64.3    3e-09   Coffea canephora [robusta coffee]
gb|KFK42855.1|  hypothetical protein AALP_AA1G047700                  63.9    4e-09   Arabis alpina [alpine rockcress]
ref|XP_004295272.1|  PREDICTED: probable beta-1,3-galactosyltrans...  63.9    4e-09   Fragaria vesca subsp. vesca
ref|XP_004159203.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  63.9    5e-09   
gb|KEH29683.1|  beta-1,3-galactosyltransferase-like protein           63.9    5e-09   Medicago truncatula
ref|XP_009775718.1|  PREDICTED: probable beta-1,3-galactosyltrans...  63.5    5e-09   Nicotiana sylvestris
ref|XP_009775717.1|  PREDICTED: probable beta-1,3-galactosyltrans...  63.5    5e-09   Nicotiana sylvestris
ref|XP_008379640.1|  PREDICTED: probable beta-1,3-galactosyltrans...  63.5    5e-09   Malus domestica [apple tree]
ref|XP_008379639.1|  PREDICTED: probable beta-1,3-galactosyltrans...  63.5    6e-09   Malus domestica [apple tree]
ref|XP_004251520.1|  PREDICTED: probable beta-1,3-galactosyltrans...  63.5    6e-09   Solanum lycopersicum
ref|XP_010313672.1|  PREDICTED: probable beta-1,3-galactosyltrans...  63.5    6e-09   Solanum lycopersicum
ref|XP_008804298.1|  PREDICTED: probable beta-1,3-galactosyltrans...  63.5    6e-09   Phoenix dactylifera
ref|XP_010557003.1|  PREDICTED: probable beta-1,3-galactosyltrans...  63.5    7e-09   Tarenaya hassleriana [spider flower]
ref|XP_010557001.1|  PREDICTED: probable beta-1,3-galactosyltrans...  63.5    7e-09   Tarenaya hassleriana [spider flower]
ref|XP_007212259.1|  hypothetical protein PRUPE_ppa006626mg           63.2    7e-09   Prunus persica
ref|XP_006294322.1|  hypothetical protein CARUB_v10023330mg           63.2    7e-09   Capsella rubella
gb|EMS64796.1|  putative beta-1,3-galactosyltransferase 2             63.2    9e-09   Triticum urartu
ref|XP_003562342.1|  PREDICTED: probable beta-1,3-galactosyltrans...  62.8    9e-09   Brachypodium distachyon [annual false brome]
ref|XP_008455884.1|  PREDICTED: probable beta-1,3-galactosyltrans...  62.8    1e-08   Cucumis melo [Oriental melon]
gb|KJB80506.1|  hypothetical protein B456_013G101400                  62.0    1e-08   Gossypium raimondii
gb|KJB57749.1|  hypothetical protein B456_009G178900                  60.8    2e-08   Gossypium raimondii
gb|AFW68302.1|  hypothetical protein ZEAMMB73_372854                  61.2    2e-08   
ref|XP_010092200.1|  putative beta-1,3-galactosyltransferase 2        62.0    2e-08   Morus notabilis
ref|XP_002464309.1|  hypothetical protein SORBIDRAFT_01g015960        62.0    2e-08   Sorghum bicolor [broomcorn]
ref|XP_010686831.1|  PREDICTED: probable beta-1,3-galactosyltrans...  61.6    2e-08   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY49507.1|  BnaC05g03190D                                        61.6    3e-08   Brassica napus [oilseed rape]
gb|KCW88781.1|  hypothetical protein EUGRSUZ_A01123                   61.2    3e-08   Eucalyptus grandis [rose gum]
ref|XP_010433424.1|  PREDICTED: probable beta-1,3-galactosyltrans...  61.6    3e-08   Camelina sativa [gold-of-pleasure]
gb|KJB80508.1|  hypothetical protein B456_013G101400                  61.6    3e-08   Gossypium raimondii
emb|CDY46836.1|  BnaA10g03200D                                        61.6    3e-08   Brassica napus [oilseed rape]
gb|KJB57748.1|  hypothetical protein B456_009G178900                  60.8    3e-08   Gossypium raimondii
gb|KJB80507.1|  hypothetical protein B456_013G101400                  61.2    3e-08   Gossypium raimondii
gb|KJB80505.1|  hypothetical protein B456_013G101400                  61.2    3e-08   Gossypium raimondii
ref|XP_010438679.1|  PREDICTED: probable beta-1,3-galactosyltrans...  61.2    4e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006449733.1|  hypothetical protein CICLE_v10015441mg           61.2    4e-08   
ref|XP_008226885.1|  PREDICTED: probable beta-1,3-galactosyltrans...  61.2    4e-08   Prunus mume [ume]
ref|XP_008226884.1|  PREDICTED: probable beta-1,3-galactosyltrans...  61.2    4e-08   Prunus mume [ume]
ref|XP_010438680.1|  PREDICTED: probable beta-1,3-galactosyltrans...  61.2    4e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006284182.1|  hypothetical protein CARUB_v10005329mg           60.5    4e-08   
ref|XP_010448194.1|  PREDICTED: probable beta-1,3-galactosyltrans...  61.2    4e-08   Camelina sativa [gold-of-pleasure]
emb|CDY48266.1|  BnaA05g10880D                                        60.8    4e-08   Brassica napus [oilseed rape]
ref|XP_010448195.1|  PREDICTED: probable beta-1,3-galactosyltrans...  60.8    4e-08   Camelina sativa [gold-of-pleasure]
ref|XP_009143988.1|  PREDICTED: probable beta-1,3-galactosyltrans...  60.8    4e-08   Brassica rapa
emb|CDY12206.1|  BnaC04g12360D                                        60.8    4e-08   Brassica napus [oilseed rape]
ref|XP_009143989.1|  PREDICTED: probable beta-1,3-galactosyltrans...  60.8    4e-08   Brassica rapa
ref|XP_010046417.1|  PREDICTED: probable beta-1,3-galactosyltrans...  60.8    4e-08   Eucalyptus grandis [rose gum]
ref|XP_011095407.1|  PREDICTED: probable beta-1,3-galactosyltrans...  60.8    5e-08   Sesamum indicum [beniseed]
gb|KGN63249.1|  hypothetical protein Csa_2G418850                     60.8    5e-08   Cucumis sativus [cucumbers]
ref|XP_004515096.1|  PREDICTED: probable beta-1,3-galactosyltrans...  60.8    5e-08   Cicer arietinum [garbanzo]
ref|XP_008681412.1|  PREDICTED: hypothetical protein isoform X1       60.8    5e-08   Zea mays [maize]
ref|NP_849454.1|  putative beta-1,3-galactosyltransferase 4           60.1    6e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KJB13703.1|  hypothetical protein B456_002G089700                  60.5    6e-08   Gossypium raimondii
ref|XP_002879388.1|  galactosyltransferase family protein             60.5    6e-08   Arabidopsis lyrata subsp. lyrata
gb|KHG30061.1|  putative beta-1,3-galactosyltransferase 4 -like p...  60.5    6e-08   Gossypium arboreum [tree cotton]
ref|XP_006410375.1|  hypothetical protein EUTSA_v10016736mg           60.5    7e-08   Eutrema salsugineum [saltwater cress]
gb|KJB13702.1|  hypothetical protein B456_002G089700                  60.5    7e-08   Gossypium raimondii
gb|KHG03847.1|  putative beta-1,3-galactosyltransferase 2 -like p...  60.5    7e-08   Gossypium arboreum [tree cotton]
gb|KHF99242.1|  putative beta-1,3-galactosyltransferase 2 -like p...  60.5    7e-08   Gossypium arboreum [tree cotton]
ref|XP_006417321.1|  hypothetical protein EUTSA_v10007904mg           60.1    7e-08   Eutrema salsugineum [saltwater cress]
gb|KJB57747.1|  hypothetical protein B456_009G178900                  60.5    7e-08   Gossypium raimondii
ref|XP_004982530.1|  PREDICTED: probable beta-1,3-galactosyltrans...  60.1    9e-08   Setaria italica
gb|KJB57750.1|  hypothetical protein B456_009G178900                  60.1    1e-07   Gossypium raimondii
gb|KJB57751.1|  hypothetical protein B456_009G178900                  59.7    1e-07   Gossypium raimondii
ref|NP_180802.1|  putative beta-1,3-galactosyltransferase 3           60.1    1e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CAB36540.1|  Avr9 elicitor response like protein                  60.1    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567762.1|  putative beta-1,3-galactosyltransferase 4           60.1    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009419577.1|  PREDICTED: probable beta-1,3-galactosyltrans...  59.7    1e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006351966.1|  PREDICTED: probable beta-1,3-galactosyltrans...  59.3    1e-07   Solanum tuberosum [potatoes]
ref|XP_010536663.1|  PREDICTED: probable beta-1,3-galactosyltrans...  59.3    1e-07   Tarenaya hassleriana [spider flower]
ref|XP_006351967.1|  PREDICTED: probable beta-1,3-galactosyltrans...  59.3    1e-07   Solanum tuberosum [potatoes]
ref|XP_003550487.1|  PREDICTED: probable beta-1,3-galactosyltrans...  59.3    1e-07   Glycine max [soybeans]
ref|XP_010655390.1|  PREDICTED: probable beta-1,3-galactosyltrans...  59.3    1e-07   Vitis vinifera
ref|XP_007020793.1|  Galactosyltransferase family protein             59.3    1e-07   
ref|XP_003539862.1|  PREDICTED: probable beta-1,3-galactosyltrans...  59.3    2e-07   Glycine max [soybeans]
ref|XP_010536662.1|  PREDICTED: probable beta-1,3-galactosyltrans...  59.3    2e-07   
gb|KHN21228.1|  Putative beta-1,3-galactosyltransferase 2             59.3    2e-07   Glycine soja [wild soybean]
gb|KJB62838.1|  hypothetical protein B456_009G440200                  58.5    2e-07   Gossypium raimondii
ref|XP_003527496.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.9    2e-07   Glycine max [soybeans]
ref|XP_009610750.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.9    2e-07   Nicotiana tomentosiformis
ref|XP_008359264.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.9    2e-07   
ref|XP_002867534.1|  galactosyltransferase family protein             58.9    2e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_008359262.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.9    2e-07   
ref|XP_004172360.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.9    2e-07   
ref|XP_011461040.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.5    3e-07   Fragaria vesca subsp. vesca
gb|KEH28821.1|  beta-1,3-galactosyltransferase-like protein           58.5    3e-07   Medicago truncatula
ref|XP_004294404.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.5    3e-07   Fragaria vesca subsp. vesca
ref|XP_010475189.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.5    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_009361000.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.5    3e-07   Pyrus x bretschneideri [bai li]
ref|XP_010475190.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.5    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_007132543.1|  hypothetical protein PHAVU_011G103400g           58.5    3e-07   Phaseolus vulgaris [French bean]
ref|XP_008385877.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.5    3e-07   
gb|KHG10854.1|  putative beta-1,3-galactosyltransferase 2 -like p...  58.5    3e-07   Gossypium arboreum [tree cotton]
gb|KJB69211.1|  hypothetical protein B456_011G013600                  58.5    3e-07   Gossypium raimondii
gb|KJB69210.1|  hypothetical protein B456_011G013600                  58.5    3e-07   Gossypium raimondii
ref|XP_010522344.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.2    4e-07   Tarenaya hassleriana [spider flower]
ref|XP_010522341.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.2    4e-07   
gb|KJB62836.1|  hypothetical protein B456_009G440200                  58.2    4e-07   Gossypium raimondii
ref|XP_009774309.1|  PREDICTED: probable beta-1,3-galactosyltrans...  57.8    5e-07   Nicotiana sylvestris
emb|CDX97981.1|  BnaA06g07320D                                        57.4    6e-07   
emb|CDY68943.1|  BnaAnng28870D                                        57.4    6e-07   Brassica napus [oilseed rape]
ref|XP_010484744.1|  PREDICTED: probable beta-1,3-galactosyltrans...  57.4    6e-07   Camelina sativa [gold-of-pleasure]
emb|CDY49800.1|  BnaCnng18130D                                        57.4    7e-07   Brassica napus [oilseed rape]
ref|XP_010484738.1|  PREDICTED: probable beta-1,3-galactosyltrans...  57.4    7e-07   Camelina sativa [gold-of-pleasure]
ref|XP_004151891.1|  PREDICTED: probable beta-1,3-galactosyltrans...  57.4    8e-07   
ref|XP_011048788.1|  PREDICTED: probable beta-1,3-galactosyltrans...  57.0    9e-07   Populus euphratica
ref|XP_010089999.1|  putative beta-1,3-galactosyltransferase 2        57.0    9e-07   Morus notabilis
ref|XP_009399227.1|  PREDICTED: probable beta-1,3-galactosyltrans...  57.0    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011048789.1|  PREDICTED: probable beta-1,3-galactosyltrans...  57.0    1e-06   Populus euphratica
ref|XP_004172861.1|  PREDICTED: probable beta-1,3-galactosyltrans...  55.8    1e-06   
ref|XP_009119198.1|  PREDICTED: probable beta-1,3-galactosyltrans...  56.6    1e-06   Brassica rapa
ref|XP_009119197.1|  PREDICTED: probable beta-1,3-galactosyltrans...  56.6    1e-06   Brassica rapa
gb|KDP20741.1|  hypothetical protein JCGZ_21212                       56.6    1e-06   Jatropha curcas
ref|XP_006365959.1|  PREDICTED: probable beta-1,3-galactosyltrans...  56.2    1e-06   Solanum tuberosum [potatoes]
emb|CDX97371.1|  BnaC08g12360D                                        56.2    1e-06   
ref|XP_004149353.1|  PREDICTED: probable beta-1,3-galactosyltrans...  56.2    2e-06   Cucumis sativus [cucumbers]
ref|XP_008463407.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  56.2    2e-06   
gb|AFW66427.1|  hypothetical protein ZEAMMB73_715676                  53.5    3e-06   
gb|EYU27344.1|  hypothetical protein MIMGU_mgv1a007546mg              55.5    3e-06   Erythranthe guttata [common monkey flower]
ref|XP_004966215.1|  PREDICTED: probable beta-1,3-galactosyltrans...  55.5    3e-06   Setaria italica
ref|XP_009148502.1|  PREDICTED: probable beta-1,3-galactosyltrans...  55.5    3e-06   Brassica rapa
ref|XP_009148501.1|  PREDICTED: probable beta-1,3-galactosyltrans...  55.5    3e-06   Brassica rapa
emb|CDY46675.1|  BnaA03g48330D                                        55.5    3e-06   Brassica napus [oilseed rape]
ref|XP_009338706.1|  PREDICTED: probable beta-1,3-galactosyltrans...  55.5    3e-06   Pyrus x bretschneideri [bai li]
ref|XP_009408655.1|  PREDICTED: probable beta-1,3-galactosyltrans...  55.5    3e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009338707.1|  PREDICTED: probable beta-1,3-galactosyltrans...  55.5    3e-06   Pyrus x bretschneideri [bai li]
ref|XP_008808431.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  55.1    4e-06   
ref|XP_009137625.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  54.7    5e-06   Brassica rapa
ref|XP_002437448.1|  hypothetical protein SORBIDRAFT_10g027290        54.7    5e-06   Sorghum bicolor [broomcorn]
gb|EMS52307.1|  putative beta-1,3-galactosyltransferase 2             54.3    7e-06   Triticum urartu
gb|EPS64736.1|  hypothetical protein M569_10045                       52.8    7e-06   Genlisea aurea
emb|CDX92791.1|  BnaC07g40490D                                        54.3    7e-06   
ref|XP_006413124.1|  hypothetical protein EUTSA_v10025360mg           54.3    7e-06   Eutrema salsugineum [saltwater cress]
gb|ACG42389.1|  beta-1,3-galactosyltransferase sqv-2                  54.3    8e-06   Zea mays [maize]
ref|XP_002302876.1|  hypothetical protein POPTR_0002s21280g           53.9    9e-06   Populus trichocarpa [western balsam poplar]
ref|NP_001136834.1|  beta-1,3-galactosyltransferase sqv-2             53.9    1e-05   Zea mays [maize]
ref|XP_010493204.1|  PREDICTED: probable beta-1,3-galactosyltrans...  53.5    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010675728.1|  PREDICTED: probable beta-1,3-galactosyltrans...  53.5    1e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010493211.1|  PREDICTED: probable beta-1,3-galactosyltrans...  53.5    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010458580.1|  PREDICTED: probable beta-1,3-galactosyltrans...  53.5    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010493216.1|  PREDICTED: probable beta-1,3-galactosyltrans...  53.5    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_008677265.1|  PREDICTED: beta-1,3-galactosyltransferase sq...  53.1    2e-05   
gb|KGN64515.1|  hypothetical protein Csa_1G062900                     52.8    2e-05   Cucumis sativus [cucumbers]
ref|XP_002451594.1|  hypothetical protein SORBIDRAFT_04g004400        52.8    2e-05   Sorghum bicolor [broomcorn]
ref|XP_006646915.1|  PREDICTED: probable beta-1,3-galactosyltrans...  52.8    2e-05   Oryza brachyantha
gb|EAY84604.1|  hypothetical protein OsI_05972                        52.8    2e-05   Oryza sativa Indica Group [Indian rice]
dbj|BAD25162.1|  putative Avr9 elicitor response protein              52.8    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009109161.1|  PREDICTED: probable beta-1,3-galactosyltrans...  52.4    3e-05   Brassica rapa
ref|XP_010233857.1|  PREDICTED: probable beta-1,3-galactosyltrans...  52.4    3e-05   Brachypodium distachyon [annual false brome]
ref|XP_011097870.1|  PREDICTED: probable beta-1,3-galactosyltrans...  52.0    4e-05   Sesamum indicum [beniseed]
ref|XP_004951866.1|  PREDICTED: probable beta-1,3-galactosyltrans...  51.6    5e-05   Setaria italica
ref|XP_010476107.1|  PREDICTED: probable beta-1,3-galactosyltrans...  51.2    7e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010476106.1|  PREDICTED: probable beta-1,3-galactosyltrans...  51.2    7e-05   Camelina sativa [gold-of-pleasure]
gb|AAD30250.1|AC007296_11  Strong similarity to gb|AJ006228 Avr9 ...  51.2    8e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172638.1|  putative beta-1,3-galactosyltransferase 1           50.8    8e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002974972.1|  glycosyltransferase-like protein                 50.8    9e-05   Selaginella moellendorffii
ref|XP_002977391.1|  glycosyltransferase-like protein                 50.8    9e-05   Selaginella moellendorffii
ref|XP_002889892.1|  predicted protein                                50.1    2e-04   
ref|XP_010457596.1|  PREDICTED: probable beta-1,3-galactosyltrans...  50.1    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010457599.1|  PREDICTED: probable beta-1,3-galactosyltrans...  50.1    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010457597.1|  PREDICTED: probable beta-1,3-galactosyltrans...  50.1    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010457598.1|  PREDICTED: probable beta-1,3-galactosyltrans...  50.1    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010063019.1|  PREDICTED: probable beta-1,3-galactosyltrans...  50.1    2e-04   Eucalyptus grandis [rose gum]
ref|XP_009612461.1|  PREDICTED: probable beta-1,3-galactosyltrans...  49.7    2e-04   Nicotiana tomentosiformis
ref|XP_010063020.1|  PREDICTED: probable beta-1,3-galactosyltrans...  49.7    2e-04   Eucalyptus grandis [rose gum]
emb|CDY11037.1|  BnaA03g46960D                                        49.7    2e-04   Brassica napus [oilseed rape]
gb|KJB30545.1|  hypothetical protein B456_005G149400                  49.3    3e-04   Gossypium raimondii
ref|XP_009612460.1|  PREDICTED: probable beta-1,3-galactosyltrans...  49.3    3e-04   Nicotiana tomentosiformis
gb|KHN03478.1|  Putative beta-1,3-galactosyltransferase 2             48.9    4e-04   Glycine soja [wild soybean]
ref|XP_006305061.1|  hypothetical protein CARUB_v10009427mg           48.5    5e-04   Capsella rubella
ref|XP_002979099.1|  glycosyltransferase-like protein                 48.5    6e-04   
ref|XP_009398227.1|  PREDICTED: probable beta-1,3-galactosyltrans...  48.5    7e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010240796.1|  PREDICTED: probable beta-1,3-galactosyltrans...  48.1    7e-04   Brachypodium distachyon [annual false brome]
ref|XP_010245068.1|  PREDICTED: beta-1,3-galactosyltransferase 7      48.1    7e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010063329.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...  48.1    8e-04   Eucalyptus grandis [rose gum]
ref|XP_010063327.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...  48.1    8e-04   Eucalyptus grandis [rose gum]
ref|XP_010063328.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...  48.1    8e-04   Eucalyptus grandis [rose gum]
ref|XP_010063326.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...  48.1    8e-04   Eucalyptus grandis [rose gum]
dbj|BAD45480.1|  unknown protein                                      45.1    9e-04   Oryza sativa Japonica Group [Japonica rice]



>ref|XP_002268282.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Vitis vinifera]
 emb|CBI28801.3| unnamed protein product [Vitis vinifera]
Length=407

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 3/51 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS+KSRG   E+ S+S+IS+KWTLLLC+  FCAG+FFTNRMW VPESKGIT
Sbjct  1    MSLKSRG---ELPSRSVISQKWTLLLCVGCFCAGMFFTNRMWAVPESKGIT  48



>ref|XP_010657202.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Vitis vinifera]
Length=405

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 3/51 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS+KSRG   E+ S+S+IS+KWTLLLC+  FCAG+FFTNRMW VPESKGIT
Sbjct  1    MSLKSRG---ELPSRSVISQKWTLLLCVGCFCAGMFFTNRMWAVPESKGIT  48



>ref|XP_010657203.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X3 [Vitis vinifera]
Length=404

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 3/51 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS+KSRG   E+ S+S+IS+KWTLLLC+  FCAG+FFTNRMW VPESKGIT
Sbjct  1    MSLKSRG---ELPSRSVISQKWTLLLCVGCFCAGMFFTNRMWAVPESKGIT  48



>ref|XP_009359950.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 [Pyrus x 
bretschneideri]
Length=402

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            MSVKSRG GGEV+ +++IS+ W LLLC  SFCAGV FTNR+W VPES+
Sbjct  1    MSVKSRGWGGEVIVRNVISRNWALLLCFCSFCAGVLFTNRLWMVPESR  48



>ref|XP_007215470.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
 gb|EMJ16669.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
Length=404

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 3/51 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KSRG   E  S+S+ISKKWTLLLC+  FCAG+ FTNRMWTVPE+KGIT
Sbjct  1    MSWKSRG---EPSSRSVISKKWTLLLCLGCFCAGMLFTNRMWTVPENKGIT  48



>ref|XP_007215471.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
 gb|EMJ16670.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
Length=407

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 3/51 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KSRG   E  S+S+ISKKWTLLLC+  FCAG+ FTNRMWTVPE+KGIT
Sbjct  1    MSWKSRG---EPSSRSVISKKWTLLLCLGCFCAGMLFTNRMWTVPENKGIT  48



>ref|XP_008364090.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 [Malus domestica]
Length=402

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            MSVKSRG GGEV+ +++IS+ W LLLC  SFCAGV FTNR+W +PES+
Sbjct  1    MSVKSRGWGGEVIVRNVISRNWALLLCFCSFCAGVLFTNRLWMMPESR  48



>ref|XP_008342011.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Malus domestica]
Length=405

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KSRG      S+S IS+KWTL LC+  FCAG+FFTNRMWT+PESKGIT
Sbjct  1    MSWKSRGDPS--ASRSFISQKWTLFLCLSCFCAGMFFTNRMWTIPESKGIT  49



>ref|XP_008342010.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Malus domestica]
Length=408

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KSRG      S+S IS+KWTL LC+  FCAG+FFTNRMWT+PESKGIT
Sbjct  1    MSWKSRGDPS--ASRSFISQKWTLFLCLSCFCAGMFFTNRMWTIPESKGIT  49



>emb|CDP10795.1| unnamed protein product [Coffea canephora]
Length=409

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KSRGG  +  S+S+IS+KWT+ LCI SFC G+ FTNRMW VPESKGIT
Sbjct  1    MSFKSRGGEQQP-SRSVISQKWTIFLCIGSFCVGMLFTNRMWAVPESKGIT  50



>ref|XP_008229956.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Prunus 
mume]
Length=407

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 3/51 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KSRG   E   +S+ISKKWTLLLC+  FCAG+ FTNRMWTVPE+KGIT
Sbjct  1    MSWKSRG---EPSPRSVISKKWTLLLCLGCFCAGMLFTNRMWTVPENKGIT  48



>ref|XP_006375532.1| hypothetical protein POPTR_0014s15200g [Populus trichocarpa]
 gb|ERP53329.1| hypothetical protein POPTR_0014s15200g [Populus trichocarpa]
Length=408

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 38/51 (75%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KSRG   +  SK++ISKKW L  C+  FCAGVFF NRMWTVPE KGIT
Sbjct  1    MSFKSRGD--QQSSKNVISKKWALFFCLACFCAGVFFNNRMWTVPEPKGIT  49



>ref|XP_004287949.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=407

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KSRG      S+++IS+KWTLLLC+  FCAG+ FTNRMW+VPESKGIT
Sbjct  1    MSWKSRGDSSS--SRNVISQKWTLLLCLSCFCAGMLFTNRMWSVPESKGIT  49



>ref|XP_002320464.1| galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE98779.1| galactosyltransferase family protein [Populus trichocarpa]
Length=405

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 38/51 (75%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KSRG   +  SK++ISKKW L  C+  FCAGVFF NRMWTVPE KGIT
Sbjct  1    MSFKSRGD--QQSSKNVISKKWALFFCLACFCAGVFFNNRMWTVPEPKGIT  49



>ref|XP_011463344.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=404

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KSRG      S+++IS+KWTLLLC+  FCAG+ FTNRMW+VPESKGIT
Sbjct  1    MSWKSRGDSSS--SRNVISQKWTLLLCLSCFCAGMLFTNRMWSVPESKGIT  49



>ref|XP_009353286.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Pyrus x bretschneideri]
Length=405

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KSRG      S+S IS+KWTL LC+  FCAG+ FTNRMWTVPESKGIT
Sbjct  1    MSWKSRGDPSS--SRSFISQKWTLFLCLSCFCAGMLFTNRMWTVPESKGIT  49



>ref|XP_009353285.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Pyrus x bretschneideri]
Length=408

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KSRG      S+S IS+KWTL LC+  FCAG+ FTNRMWTVPESKGIT
Sbjct  1    MSWKSRGDPSS--SRSFISQKWTLFLCLSCFCAGMLFTNRMWTVPESKGIT  49



>gb|KDO54670.1| hypothetical protein CISIN_1g015407mg [Citrus sinensis]
Length=407

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 3/51 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS+KS+G   E+ S+S++S+KWT LLC+  FCAG+ FTNRMW VPESKG T
Sbjct  1    MSLKSKG---ELTSRSVVSQKWTFLLCLGCFCAGMLFTNRMWAVPESKGFT  48



>gb|KDO54671.1| hypothetical protein CISIN_1g015407mg [Citrus sinensis]
Length=405

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 3/51 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS+KS+G   E+ S+S++S+KWT LLC+  FCAG+ FTNRMW VPESKG T
Sbjct  1    MSLKSKG---ELTSRSVVSQKWTFLLCLGCFCAGMLFTNRMWAVPESKGFT  48



>ref|XP_006447568.1| hypothetical protein CICLE_v10015443mg [Citrus clementina]
 ref|XP_006469678.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Citrus sinensis]
 gb|ESR60808.1| hypothetical protein CICLE_v10015443mg [Citrus clementina]
Length=407

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 3/51 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS+KS+G   E+ S+S++S+KWT LLC+  FCAG+ FTNRMW VPESKG T
Sbjct  1    MSLKSKG---ELTSRSVVSQKWTFLLCLGCFCAGMLFTNRMWAVPESKGFT  48



>gb|KDO54672.1| hypothetical protein CISIN_1g015407mg [Citrus sinensis]
Length=404

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 3/51 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS+KS+G   E+ S+S++S+KWT LLC+  FCAG+ FTNRMW VPESKG T
Sbjct  1    MSLKSKG---ELTSRSVVSQKWTFLLCLGCFCAGMLFTNRMWAVPESKGFT  48



>ref|XP_006469679.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Citrus sinensis]
Length=405

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 3/51 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS+KS+G   E+ S+S++S+KWT LLC+  FCAG+ FTNRMW VPESKG T
Sbjct  1    MSLKSKG---ELTSRSVVSQKWTFLLCLGCFCAGMLFTNRMWAVPESKGFT  48



>ref|XP_006469680.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X3 [Citrus sinensis]
Length=404

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 3/51 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS+KS+G   E+ S+S++S+KWT LLC+  FCAG+ FTNRMW VPESKG T
Sbjct  1    MSLKSKG---ELTSRSVVSQKWTFLLCLGCFCAGMLFTNRMWAVPESKGFT  48



>gb|EYU34029.1| hypothetical protein MIMGU_mgv1a007633mg [Erythranthe guttata]
Length=401

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 44/53 (83%), Gaps = 4/53 (8%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLI--SKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS+K+RGG  E +S+S++  S KWTL LC+ SFCAG+FFTNR+W +PE+KG+T
Sbjct  1    MSMKNRGG--EQISRSVVVVSHKWTLFLCVASFCAGLFFTNRLWIMPEAKGVT  51



>ref|XP_007153952.1| hypothetical protein PHAVU_003G079100g [Phaseolus vulgaris]
 gb|ESW25946.1| hypothetical protein PHAVU_003G079100g [Phaseolus vulgaris]
Length=380

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPE  445
            MS+KS+GG  E+ +++++ +KW LLLC+ SFCAG+FFTNR+W++PE
Sbjct  1    MSMKSKGGAAELSARNVLQRKWALLLCVASFCAGMFFTNRIWSMPE  46



>ref|XP_011047261.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Populus euphratica]
Length=408

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KSRG   +  SK++ISKKW L  C+  FCAGVFF NRMW VPE KGIT
Sbjct  1    MSFKSRGD--QQSSKNVISKKWALFFCLACFCAGVFFNNRMWAVPEPKGIT  49



>ref|XP_003596979.1| hypothetical protein MTR_2g088270 [Medicago truncatula]
 gb|AES67230.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
Length=402

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 40/50 (80%), Gaps = 3/50 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            M+ KSRG   EVV +S +S+KW + LCI SFCAG+FFTNRMWT+PE KG+
Sbjct  1    MTWKSRG---EVVPRSFMSQKWMIFLCIGSFCAGMFFTNRMWTIPEPKGL  47



>ref|XP_011047262.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Populus euphratica]
Length=405

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KSRG   +  SK++ISKKW L  C+  FCAGVFF NRMW VPE KGIT
Sbjct  1    MSFKSRGD--QQSSKNVISKKWALFFCLACFCAGVFFNNRMWAVPEPKGIT  49



>ref|XP_009770915.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Nicotiana 
sylvestris]
Length=410

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKG  454
            MS K+RG   E  S+S+IS+KWTL LCI SFCAG+FFT RMWTVPE+KG
Sbjct  1    MSFKNRGLV-ETQSRSVISQKWTLFLCIGSFCAGMFFTARMWTVPETKG  48



>ref|NP_172009.1| putative beta-1,3-galactosyltransferase 2 [Arabidopsis thaliana]
 gb|AAK63859.1|AF389287_1 At1g05170/YUP8H12_22 [Arabidopsis thaliana]
 gb|AAB71461.1| Similar to Sequence 10 from patent 5477002 (gb|1253956) [Arabidopsis 
thaliana]
 gb|AAM47315.1| At1g05170/YUP8H12_22 [Arabidopsis thaliana]
 gb|AEE27797.1| putative beta-1,3-galactosyltransferase 2 [Arabidopsis thaliana]
Length=404

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  335  GEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            GE  S+S +S+KWT+LLC+ SFC G+FFTNRMW +PESKG++
Sbjct  7    GEYSSRSFVSRKWTILLCLGSFCVGMFFTNRMWNIPESKGMS  48



>ref|NP_001077462.1| putative beta-1,3-galactosyltransferase 2 [Arabidopsis thaliana]
 sp|A8MRC7.1|B3GT2_ARATH RecName: Full=Probable beta-1,3-galactosyltransferase 2 [Arabidopsis 
thaliana]
 gb|AEE27798.1| putative beta-1,3-galactosyltransferase 2 [Arabidopsis thaliana]
 gb|AHL38970.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=407

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  335  GEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            GE  S+S +S+KWT+LLC+ SFC G+FFTNRMW +PESKG++
Sbjct  7    GEYSSRSFVSRKWTILLCLGSFCVGMFFTNRMWNIPESKGMS  48



>ref|XP_008224857.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 [Prunus 
mume]
Length=402

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            MS+KS+G GGEV  ++++S+ W  LLC  SFCAGV FTNR+W VPES+
Sbjct  1    MSLKSKGWGGEVTMRNVMSRNWAFLLCFCSFCAGVLFTNRLWMVPESR  48



>ref|XP_011100272.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Sesamum 
indicum]
Length=405

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS+K+RGG  E VS+++IS+KWT+ LCI SF AG+ FT+R+WT PE+KG+T
Sbjct  1    MSMKNRGG--EQVSRTVISQKWTVFLCIASFSAGMLFTSRVWTTPEAKGVT  49



>ref|NP_001050543.1| Os03g0577500 [Oryza sativa Japonica Group]
 gb|AAT76370.1| putative glycosyltransferase [Oryza sativa Japonica Group]
 gb|ABF97265.1| Galactosyltransferase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12457.1| Os03g0577500 [Oryza sativa Japonica Group]
 gb|EAY90748.1| hypothetical protein OsI_12348 [Oryza sativa Indica Group]
 gb|EAZ27579.1| hypothetical protein OsJ_11528 [Oryza sativa Japonica Group]
Length=406

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  326  GGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            GGG E+V +  ISKKWTLLLC+ SFC G+ FTNRMWT+PE K I
Sbjct  14   GGGDELVLRGTISKKWTLLLCLASFCIGLIFTNRMWTMPEPKEI  57



>ref|XP_009357459.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Pyrus x 
bretschneideri]
Length=401

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            MSVKSRG GGEV  ++++S+ W LLLC  SFCAGV FTNR+W +PES+
Sbjct  1    MSVKSRGWGGEVTVRNVMSRNWALLLCFCSFCAGVLFTNRLW-IPESR  47



>gb|KDP39142.1| hypothetical protein JCGZ_00899 [Jatropha curcas]
Length=404

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 3/51 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            M+ KSRG   +  SKS++SKKWTLL CI  FCAG+ F++RMWTVPE KGI+
Sbjct  1    MTWKSRG---DTSSKSVVSKKWTLLFCIGCFCAGMLFSDRMWTVPEVKGIS  48



>ref|XP_004487414.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cicer 
arietinum]
Length=408

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 3/51 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KS+G   EVV +S++S KW + LCI SFCAG+FFTNRMW +PE KG+ 
Sbjct  1    MSWKSKG---EVVPRSVMSHKWMVFLCIGSFCAGMFFTNRMWNIPEPKGLA  48



>ref|XP_009598546.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Nicotiana 
tomentosiformis]
Length=410

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKG  454
            MS K RG   E  S+S+IS+KWTL LCI SFCAG+FFT RMWTVPE+KG
Sbjct  1    MSFKIRGVV-EPQSRSIISQKWTLFLCIGSFCAGMFFTARMWTVPETKG  48



>gb|KDO78241.1| hypothetical protein CISIN_1g015962mg [Citrus sinensis]
Length=253

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 2/50 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS KS   GGE  S++LI +KW L LC  SFCAG+ FTNRMW +PESKG+
Sbjct  1    MSFKS--TGGEFASRNLIPRKWALFLCACSFCAGMSFTNRMWMMPESKGV  48



>ref|XP_003540300.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoformX1 
[Glycine max]
 gb|KHN44874.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=407

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 41/51 (80%), Gaps = 3/51 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            M+ KSRG   +++ KS++S+KW + LC+ SFCAG+FFTNRMWT+PE KG+ 
Sbjct  1    MTWKSRG---DLLPKSVMSQKWMIFLCVGSFCAGMFFTNRMWTIPEPKGLA  48



>gb|KDO78238.1| hypothetical protein CISIN_1g015962mg [Citrus sinensis]
 gb|KDO78239.1| hypothetical protein CISIN_1g015962mg [Citrus sinensis]
 gb|KDO78240.1| hypothetical protein CISIN_1g015962mg [Citrus sinensis]
Length=270

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 2/50 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS KS   GGE  S++LI +KW L LC  SFCAG+ FTNRMW +PESKG+
Sbjct  1    MSFKS--TGGEFASRNLIPRKWALFLCACSFCAGMSFTNRMWMMPESKGV  48



>ref|XP_010469587.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X2 [Camelina sativa]
Length=405

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  335  GEV-VSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            GE+ +SKSL+SKKWTLLLC  SFC G+ FT+RMW +PESK IT
Sbjct  7    GEIFISKSLVSKKWTLLLCFGSFCFGILFTDRMWNIPESKDIT  49



>ref|XP_010469586.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X1 [Camelina sativa]
Length=408

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  335  GEV-VSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            GE+ +SKSL+SKKWTLLLC  SFC G+ FT+RMW +PESK IT
Sbjct  7    GEIFISKSLVSKKWTLLLCFGSFCFGILFTDRMWNIPESKDIT  49



>ref|XP_006452382.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
 ref|XP_006475056.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Citrus sinensis]
 gb|ESR65622.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
 gb|KDO62740.1| hypothetical protein CISIN_1g015419mg [Citrus sinensis]
Length=407

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            M+ KSRGG      KS +SKKWTLLLCI  FCAG+ F++RMWTVPE + ++
Sbjct  1    MTWKSRGGIESASHKSFMSKKWTLLLCIGCFCAGMLFSDRMWTVPEVRDVS  51



>ref|XP_006475057.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Citrus sinensis]
 gb|KDO62741.1| hypothetical protein CISIN_1g015419mg [Citrus sinensis]
Length=406

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            M+ KSRGG      KS +SKKWTLLLCI  FCAG+ F++RMWTVPE + ++
Sbjct  1    MTWKSRGGIESASHKSFMSKKWTLLLCIGCFCAGMLFSDRMWTVPEVRDVS  51



>ref|XP_010276120.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Nelumbo 
nucifera]
Length=404

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 3/51 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KS+G   E+ S+S++S+KWTL LCI SFC G+ FTN+MW VPE+KG T
Sbjct  1    MSWKSKG---ELPSRSVVSQKWTLFLCIGSFCVGMLFTNKMWAVPETKGFT  48



>ref|XP_006452384.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
 gb|ESR65624.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
Length=417

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            M+ KSRGG      KS +SKKWTLLLCI  FCAG+ F++RMWTVPE + ++
Sbjct  1    MTWKSRGGIESASHKSFMSKKWTLLLCIGCFCAGMLFSDRMWTVPEVRDVS  51



>ref|XP_007026089.1| Galactosyltransferase family protein isoform 2 [Theobroma cacao]
 gb|EOY28711.1| Galactosyltransferase family protein isoform 2 [Theobroma cacao]
Length=318

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 3/50 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MSVKSRG   E+ +K ++S+   LLLC  SFCAG+FFTNRMW +P+ KGI
Sbjct  1    MSVKSRG---ELAAKHVLSRNLALLLCFASFCAGMFFTNRMWMLPDGKGI  47



>gb|KDO78237.1| hypothetical protein CISIN_1g015962mg [Citrus sinensis]
Length=313

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 2/50 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS KS   GGE  S++LI +KW L LC  SFCAG+ FTNRMW +PESKG+
Sbjct  1    MSFKS--TGGEFASRNLIPRKWALFLCACSFCAGMSFTNRMWMMPESKGV  48



>ref|XP_002279814.2| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Vitis vinifera]
 emb|CBI26647.3| unnamed protein product [Vitis vinifera]
Length=405

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KSRG   E  SKS++S+KWTLL CI  FCAG+ F++RMWT+PE+KGI+
Sbjct  1    MSWKSRGI--EPSSKSVVSRKWTLLFCIGCFCAGMLFSDRMWTMPEAKGIS  49



>ref|XP_006650268.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Oryza 
brachyantha]
Length=405

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +2

Query  296  FEPEMSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            F       + GGG E+V +  ISKKWT LLC+ SFC G+ FTNRMWT+PE K I
Sbjct  3    FNKSRGAAALGGGDELVLRGTISKKWTFLLCLGSFCIGLIFTNRMWTMPEPKEI  56



>ref|XP_007045661.1| Galactosyltransferase family protein [Theobroma cacao]
 gb|EOY01493.1| Galactosyltransferase family protein [Theobroma cacao]
Length=435

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 3/50 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS KS+G   E+ +KS +SKKWT LLC+  FCAG+ FTNRM +VPESKGI
Sbjct  1    MSFKSKG---ELSTKSFVSKKWTFLLCLGCFCAGMLFTNRMGSVPESKGI  47



>ref|XP_006855892.1| hypothetical protein AMTR_s00037p00154410 [Amborella trichopoda]
 gb|ERN17359.1| hypothetical protein AMTR_s00037p00154410 [Amborella trichopoda]
Length=405

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 40/51 (78%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KSRGG  +V  +S +S++WT  LC+ SFCAG+ FTNRMW++PE+K ++
Sbjct  1    MSWKSRGG--DVSHRSSVSRRWTFFLCLASFCAGLLFTNRMWSMPEAKDVS  49



>ref|XP_002892271.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68530.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=407

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  338  EVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            E  S+S +S+KWT+LLC+ SFC G+FFT+RMW +PESKG++
Sbjct  8    EYTSRSFVSRKWTILLCLGSFCVGMFFTDRMWNIPESKGMS  48



>ref|XP_006346208.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Solanum 
tuberosum]
Length=408

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +2

Query  311  SVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            ++KSRGGG E   K + S+K T+LLCI  FC G+ FT+RMWTVPE+KGIT
Sbjct  4    TMKSRGGG-ESAGKGVFSRKLTVLLCIGCFCVGMLFTDRMWTVPEAKGIT  52



>ref|XP_003543389.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Glycine 
max]
 gb|KHN36530.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=407

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 40/51 (78%), Gaps = 3/51 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            M+ KSRG   +++ KS++S+KW + LCI  FCAG+FFTNRMWT+PE KG+ 
Sbjct  1    MTWKSRG---DLLPKSVMSQKWMIFLCIGCFCAGMFFTNRMWTIPEPKGLA  48



>ref|XP_004244109.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Solanum 
lycopersicum]
Length=408

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +2

Query  311  SVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            ++KSRGGG E   K + S+K T+LLCI  FC G+ FT+RMWTVPE+KGIT
Sbjct  4    TMKSRGGG-ESAGKGVFSRKLTVLLCIGCFCVGMLFTDRMWTVPEAKGIT  52



>ref|XP_002518474.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
 gb|EEF43861.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
Length=388

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 2/52 (4%)
 Frame = +2

Query  308  MSVKSRGG--GGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS+KSR G  GGE+ S++ + K W LLLCI SF AG FFTNRMW +PE   +
Sbjct  1    MSIKSRVGVGGGELASRNFVPKNWALLLCISSFFAGTFFTNRMWNMPEQLNV  52



>ref|XP_007211967.1| hypothetical protein PRUPE_ppa006589mg [Prunus persica]
 gb|EMJ13166.1| hypothetical protein PRUPE_ppa006589mg [Prunus persica]
Length=404

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KSRG   E  SKS +S+KWT+L CI  FCAG+ F++RMW+VPE KGI 
Sbjct  1    MSWKSRGA--ESASKSAVSRKWTILFCIGCFCAGMLFSDRMWSVPEIKGIA  49



>ref|XP_008439989.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Cucumis 
melo]
 ref|XP_008439990.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Cucumis 
melo]
 ref|XP_008439991.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Cucumis 
melo]
Length=403

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 1/45 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVP  442
            MSVK+RGG  E+ S++  S+ W LLLC+ SFCAG+FFTNRMW VP
Sbjct  1    MSVKNRGGS-ELASRNAFSRNWVLLLCLGSFCAGMFFTNRMWLVP  44



>ref|XP_006467429.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Citrus sinensis]
 gb|KDO78235.1| hypothetical protein CISIN_1g015962mg [Citrus sinensis]
Length=397

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KS GG  E  S++LI +KW L LC  SFCAG+ FTNRMW +PESKG+ 
Sbjct  1    MSFKSTGG--EFASRNLIPRKWALFLCACSFCAGMSFTNRMWMMPESKGVA  49



>ref|XP_006467430.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Citrus sinensis]
 gb|KDO78236.1| hypothetical protein CISIN_1g015962mg [Citrus sinensis]
Length=396

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KS GG  E  S++LI +KW L LC  SFCAG+ FTNRMW +PESKG+ 
Sbjct  1    MSFKSTGG--EFASRNLIPRKWALFLCACSFCAGMSFTNRMWMMPESKGVA  49



>ref|XP_010413995.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X1 [Camelina sativa]
Length=408

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  335  GEV-VSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            GE+ +SKSL+SKKWTLLLC  SFC G+ FT+RMW +PESK I
Sbjct  7    GEIFISKSLVSKKWTLLLCFGSFCFGILFTDRMWNIPESKDI  48



>ref|XP_010510018.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 [Camelina 
sativa]
Length=408

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  335  GEV-VSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            GE+ +SKSL+SKKWTLLLC  SFC G+ FT+RMW +PESK I
Sbjct  7    GEIFISKSLVSKKWTLLLCFGSFCFGILFTDRMWNIPESKDI  48



>ref|XP_010413996.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X2 [Camelina sativa]
Length=405

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  335  GEV-VSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            GE+ +SKSL+SKKWTLLLC  SFC G+ FT+RMW +PESK I
Sbjct  7    GEIFISKSLVSKKWTLLLCFGSFCFGILFTDRMWNIPESKDI  48



>ref|XP_004507687.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cicer 
arietinum]
Length=378

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS+K + GG E+ ++++I +KW LLLC+ SFCAG+FFTNRMW++ E K I+
Sbjct  1    MSLKIKVGGVELGARTVIHRKWVLLLCLASFCAGMFFTNRMWSMSEYKEIS  51



>ref|XP_007026088.1| Galactosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOY28710.1| Galactosyltransferase family protein isoform 1 [Theobroma cacao]
Length=415

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 3/50 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MSVKSRG   E+ +K ++S+   LLLC  SFCAG+FFTNRMW +P+ KGI
Sbjct  1    MSVKSRG---ELAAKHVLSRNLALLLCFASFCAGMFFTNRMWMLPDGKGI  47



>ref|XP_009624796.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Nicotiana tomentosiformis]
Length=404

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKG  454
            MS+KSRG   E  S+S++S+KW+LLLC+ SFCAG+ FT RMW +PE KG
Sbjct  1    MSLKSRGVA-ERTSRSVVSQKWSLLLCLGSFCAGMLFTTRMWIIPEIKG  48



>ref|XP_009624797.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Nicotiana tomentosiformis]
Length=402

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKG  454
            MS+KSRG   E  S+S++S+KW+LLLC+ SFCAG+ FT RMW +PE KG
Sbjct  1    MSLKSRGVA-ERTSRSVVSQKWSLLLCLGSFCAGMLFTTRMWIIPEIKG  48



>gb|EMT25658.1| Putative beta-1,3-galactosyltransferase 2 [Aegilops tauschii]
Length=400

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  326  GGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            G G E++ +  IS+KWT LLC+ SFC G+ FTNRMWTVPESK I
Sbjct  6    GAGDELLFRGTISRKWTSLLCLSSFCVGLIFTNRMWTVPESKEI  49



>dbj|BAJ89822.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89142.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=399

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  326  GGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            G G E++ +  IS+KWT LLC+ SFC G+ FTNRMWTVPESK I
Sbjct  6    GAGDELLFRGTISRKWTSLLCLSSFCVGLIFTNRMWTVPESKEI  49



>dbj|BAJ89733.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=399

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  326  GGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            G G E++ +  IS+KWT LLC+ SFC G+ FTNRMWTVPESK I
Sbjct  6    GAGDELLFRGTISRKWTSLLCLSSFCVGLIFTNRMWTVPESKEI  49



>ref|XP_010923856.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Elaeis guineensis]
Length=412

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  338  EVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            E+ SK ++SKKWT LLC+ SFC G+FFTNRMWT+PE+  I
Sbjct  16   EISSKGMVSKKWTFLLCLGSFCIGLFFTNRMWTMPEANDI  55



>ref|XP_007149975.1| hypothetical protein PHAVU_005G115300g [Phaseolus vulgaris]
 gb|ESW21969.1| hypothetical protein PHAVU_005G115300g [Phaseolus vulgaris]
Length=407

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 40/50 (80%), Gaps = 3/50 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            M+ KSRG   +++ KS++SKKW + LCI SFCAG+ FTNR+WT+PE KG+
Sbjct  1    MTWKSRG---DLLPKSVMSKKWVIFLCIGSFCAGLVFTNRIWTIPEPKGL  47



>ref|XP_004134762.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
 gb|KGN49110.1| hypothetical protein Csa_6G513740 [Cucumis sativus]
Length=403

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 35/45 (78%), Gaps = 1/45 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVP  442
            MSVK+RGG  E  S++  S+ W LLLC+ SFCAG+FFTNRMW VP
Sbjct  1    MSVKNRGGS-EFASRNAFSRNWVLLLCLGSFCAGMFFTNRMWLVP  44



>ref|XP_004243473.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Solanum lycopersicum]
Length=408

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 38/49 (78%), Gaps = 3/49 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKG  454
            M+ K+R  G    S+S+ S+KWTL LCI SFCAG+FFT RMWT+PE+KG
Sbjct  1    MTFKNRVEG---TSRSVASQKWTLFLCISSFCAGMFFTARMWTIPEAKG  46



>ref|XP_004155605.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
Length=403

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 35/45 (78%), Gaps = 1/45 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVP  442
            MSVK+RGG  E  S++  S+ W LLLC+ SFCAG+FFTNRMW VP
Sbjct  1    MSVKNRGGS-EFASRNAFSRNWVLLLCLGSFCAGMFFTNRMWLVP  44



>ref|XP_010323831.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Solanum lycopersicum]
Length=406

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 38/49 (78%), Gaps = 3/49 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKG  454
            M+ K+R  G    S+S+ S+KWTL LCI SFCAG+FFT RMWT+PE+KG
Sbjct  1    MTFKNRVEG---TSRSVASQKWTLFLCISSFCAGMFFTARMWTIPEAKG  46



>ref|XP_010278673.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Nelumbo nucifera]
Length=360

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 39/51 (76%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KS+GG  E+  +S +S+KWT+ LCI  FCAG+ FTNRM TVPE+K +T
Sbjct  1    MSWKSKGG--ELPPRSFVSRKWTIFLCIACFCAGMLFTNRMLTVPETKDLT  49



>ref|XP_010923857.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X3 [Elaeis guineensis]
Length=374

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  338  EVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            E+ SK ++SKKWT LLC+ SFC G+FFTNRMWT+PE+  I
Sbjct  16   EISSKGMVSKKWTFLLCLGSFCIGLFFTNRMWTMPEANDI  55



>ref|XP_006366586.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Solanum tuberosum]
Length=408

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 38/49 (78%), Gaps = 3/49 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKG  454
            MS K+R  G    S+S+IS+KW L LCI SFCAG+FFT RMWT+P++KG
Sbjct  1    MSFKNRVEG---TSRSVISQKWILFLCISSFCAGMFFTARMWTIPDAKG  46



>ref|XP_006366587.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Solanum tuberosum]
Length=406

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 38/49 (78%), Gaps = 3/49 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKG  454
            MS K+R  G    S+S+IS+KW L LCI SFCAG+FFT RMWT+P++KG
Sbjct  1    MSFKNRVEG---TSRSVISQKWILFLCISSFCAGMFFTARMWTIPDAKG  46



>ref|XP_010923855.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Elaeis guineensis]
Length=428

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  338  EVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            E+ SK ++SKKWT LLC+ SFC G+FFTNRMWT+PE+  I
Sbjct  16   EISSKGMVSKKWTFLLCLGSFCIGLFFTNRMWTMPEANDI  55



>ref|XP_010534019.1| PREDICTED: probable beta-1,3-galactosyltransferase 1 [Tarenaya 
hassleriana]
Length=441

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEVVS-KSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MSVKSRGGG    S +++IS+ W   LC+ SFC G+FFTNR+W VPE + I
Sbjct  1    MSVKSRGGGEYYFSPRNVISRNWAFFLCLASFCLGMFFTNRLWIVPEGRVI  51



>ref|XP_010929797.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Elaeis 
guineensis]
Length=411

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 41/54 (76%), Gaps = 4/54 (7%)
 Frame = +2

Query  308  MSVKSRGGGG----EVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS KSRGGG     EV S+ ++SK+WT LLC+ SFC G+ FTNRMWT+PE+K I
Sbjct  1    MSFKSRGGGMGGGGEVCSRGMVSKRWTFLLCLGSFCVGLLFTNRMWTMPEAKDI  54



>ref|XP_006418057.1| hypothetical protein EUTSA_v10007787mg [Eutrema salsugineum]
 gb|ESQ36410.1| hypothetical protein EUTSA_v10007787mg [Eutrema salsugineum]
Length=407

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  335  GEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            GE  S+S  S+KWT LLCI SFC G+ FT+RMW+VPESKG+
Sbjct  7    GEHSSRSFASRKWTFLLCIGSFCVGMLFTDRMWSVPESKGM  47



>ref|XP_010278672.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Nelumbo nucifera]
Length=405

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 39/51 (76%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KS+GG  E+  +S +S+KWT+ LCI  FCAG+ FTNRM TVPE+K +T
Sbjct  1    MSWKSKGG--ELPPRSFVSRKWTIFLCIACFCAGMLFTNRMLTVPETKDLT  49



>ref|XP_004144497.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
 gb|KGN43517.1| hypothetical protein Csa_7G043590 [Cucumis sativus]
Length=407

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  338  EVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            E  S+S+IS+KW + LC+ SFC G+FFTNRMW VPE KGIT
Sbjct  8    EQSSRSVISQKWAVFLCLGSFCLGMFFTNRMWNVPEPKGIT  48



>ref|XP_008455443.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Cucumis 
melo]
Length=407

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  338  EVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            E  S+S+IS+KW + LC+ SFC G+FFTNRMW VPE KGIT
Sbjct  8    EQSSRSVISQKWAVFLCLGSFCLGMFFTNRMWNVPEPKGIT  48



>ref|XP_010104592.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
 gb|EXC01255.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
Length=420

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 3/51 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KSRG   E  S +++S+KW LLLC+  FCAG+ FTNRMW VPE+K IT
Sbjct  1    MSWKSRG---EKPSGTILSQKWALLLCLGCFCAGMLFTNRMWDVPETKDIT  48



>emb|CDP05735.1| unnamed protein product [Coffea canephora]
Length=403

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 1/51 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KSRGG  E   KS++S++ T+ LCI  FCAG+ FT+RMWTVPE+KGI+
Sbjct  1    MSGKSRGGA-ESSYKSVVSRRLTVWLCIGCFCAGMLFTDRMWTVPEAKGIS  50



>gb|KFK42855.1| hypothetical protein AALP_AA1G047700 [Arabis alpina]
Length=408

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 40/51 (78%), Gaps = 3/51 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS K++G   E  S+S +S+K TL LC+ SFC G+FFT+RMW++PES+G++
Sbjct  1    MSTKNKG---EYGSRSFVSRKLTLFLCLASFCVGLFFTDRMWSIPESRGVS  48



>ref|XP_004295272.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Fragaria 
vesca subsp. vesca]
Length=372

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPE  445
            MS+KSRG GGE+ +K++IS+   +LLC+ SF AG+ FTNR+W VPE
Sbjct  1    MSIKSRGWGGEITTKNVISRNLAVLLCLCSFFAGILFTNRLWVVPE  46



>ref|XP_004159203.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-1,3-galactosyltransferase 
2-like [Cucumis sativus]
Length=407

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  338  EVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            E  S+S+IS+KW + LC+ SFC G+FFTNRMW VPE KGIT
Sbjct  8    EQSSRSVISQKWAVXLCLGSFCLGMFFTNRMWNVPEPKGIT  48



>gb|KEH29683.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
Length=407

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 3/51 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            M+ KSRG   E  S+S+IS+KW L LC+ SFCAG+ FTNR+W++PE  G+ 
Sbjct  1    MTWKSRG---EFSSRSVISQKWALFLCLGSFCAGMLFTNRIWSIPEQNGLA  48



>ref|XP_009775718.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Nicotiana sylvestris]
Length=404

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            MS+KSRG   E  S+S++S+KW+LLLC+ SFCAG+ FT RMW +PE K
Sbjct  1    MSLKSRGVA-ERTSRSVVSQKWSLLLCLGSFCAGMLFTTRMWIIPEIK  47



>ref|XP_009775717.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Nicotiana sylvestris]
Length=405

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            MS+KSRG   E  S+S++S+KW+LLLC+ SFCAG+ FT RMW +PE K
Sbjct  1    MSLKSRGVA-ERTSRSVVSQKWSLLLCLGSFCAGMLFTTRMWIIPEIK  47



>ref|XP_008379640.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Malus domestica]
Length=405

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
             IS+KWT  LC+  FCAG+ FTNRMWTVPESKGIT
Sbjct  15   FISQKWTFFLCLSCFCAGMLFTNRMWTVPESKGIT  49



>ref|XP_008379639.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Malus domestica]
Length=408

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
             IS+KWT  LC+  FCAG+ FTNRMWTVPESKGIT
Sbjct  15   FISQKWTFFLCLSCFCAGMLFTNRMWTVPESKGIT  49



>ref|XP_004251520.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Solanum lycopersicum]
Length=397

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 40/52 (77%), Gaps = 2/52 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESK-GIT  460
            M  K+RG   E  S+S++SKKW+L LC+ SFCAG+FFTNRMW V E+K GIT
Sbjct  1    MYFKNRGAT-ERPSRSVVSKKWSLFLCLGSFCAGMFFTNRMWIVSETKEGIT  51



>ref|XP_010313672.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Solanum lycopersicum]
Length=395

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 40/52 (77%), Gaps = 2/52 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESK-GIT  460
            M  K+RG   E  S+S++SKKW+L LC+ SFCAG+FFTNRMW V E+K GIT
Sbjct  1    MYFKNRGAT-ERPSRSVVSKKWSLFLCLGSFCAGMFFTNRMWIVSETKEGIT  51



>ref|XP_008804298.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Phoenix 
dactylifera]
Length=411

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  338  EVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            EV S+ + SKKWT LLC+ SFC G+ FTNRMWT+PE+K I
Sbjct  15   EVCSRGMASKKWTFLLCLGSFCVGLLFTNRMWTMPEAKDI  54



>ref|XP_010557003.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X3 [Tarenaya hassleriana]
Length=405

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +2

Query  332  GGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            G  + S S +SKKW LLLC+  FCAG+FFT+RMW VPE KG+ 
Sbjct  7    GEHLSSTSFVSKKWALLLCLGCFCAGMFFTDRMWNVPEPKGLA  49



>ref|XP_010557001.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010557002.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Tarenaya hassleriana]
Length=408

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +2

Query  332  GGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            G  + S S +SKKW LLLC+  FCAG+FFT+RMW VPE KG+ 
Sbjct  7    GEHLSSTSFVSKKWALLLCLGCFCAGMFFTDRMWNVPEPKGLA  49



>ref|XP_007212259.1| hypothetical protein PRUPE_ppa006626mg [Prunus persica]
 gb|EMJ13458.1| hypothetical protein PRUPE_ppa006626mg [Prunus persica]
Length=402

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            MS KS+G GGEV  ++++S+ W  LLC  SFCAGV FTNR+  VPES+
Sbjct  1    MSSKSKGWGGEVTMRNVMSRNWAFLLCFCSFCAGVLFTNRLSMVPESR  48



>ref|XP_006294322.1| hypothetical protein CARUB_v10023330mg [Capsella rubella]
 gb|EOA27220.1| hypothetical protein CARUB_v10023330mg [Capsella rubella]
Length=408

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  335  GEV-VSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            GE+ +S+SL+SKKWT LLC  SFC G+ FT+RMW +PESK I 
Sbjct  7    GEIFISRSLVSKKWTFLLCFGSFCFGILFTDRMWNIPESKDIA  49



>gb|EMS64796.1| putative beta-1,3-galactosyltransferase 2 [Triticum urartu]
Length=400

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  326  GGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            GGG E++ +  IS+KWT LLC+ SF  G+ FTNRMWTVPESK I
Sbjct  6    GGGDELLFRGTISRKWTSLLCLSSFFVGLIFTNRMWTVPESKEI  49



>ref|XP_003562342.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Brachypodium 
distachyon]
Length=405

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 37/53 (70%), Gaps = 6/53 (11%)
 Frame = +2

Query  317  KSRG------GGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            KSRG      GG E++ +  IS+KWT +LCI SFC G+ FTNRMWT+PE K I
Sbjct  5    KSRGAAGLGVGGDELLFRGTISRKWTFILCIGSFCIGLIFTNRMWTLPEPKEI  57



>ref|XP_008455884.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Cucumis 
melo]
Length=408

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 2/50 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS KS+       S+S+IS+KWTL LC+  FC+G+ FTNRMWT+PE KG+
Sbjct  1    MSWKSKADHHS--SRSVISQKWTLFLCLVCFCSGMLFTNRMWTIPEHKGM  48



>gb|KJB80506.1| hypothetical protein B456_013G101400 [Gossypium raimondii]
Length=319

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS KS+    E  S+S +SKKWT LLC+  FCAG+ FTNRM  VPESK I
Sbjct  1    MSFKSKT---EQSSRSFVSKKWTFLLCLSCFCAGILFTNRMVAVPESKAI  47



>gb|KJB57749.1| hypothetical protein B456_009G178900 [Gossypium raimondii]
Length=271

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            M VKSRG   E  SK ++ K   LLLC  SFCAG+FF+NR W VP++KGI
Sbjct  1    MFVKSRG---EHASKHVLPKNLALLLCFASFCAGMFFSNRTWMVPDAKGI  47



>gb|AFW68302.1| hypothetical protein ZEAMMB73_372854 [Zea mays]
Length=299

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  335  GEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
             E+V +  ISKKWT LLC  SFC G+ FTNRMWTVPE K I
Sbjct  25   DELVLRGSISKKWTFLLCFGSFCIGLLFTNRMWTVPEPKEI  65



>ref|XP_010092200.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
 gb|EXB50426.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
Length=407

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = +2

Query  308  MSVKSRGGGG-EVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MSVKS+G G      ++++S+ WTL LC   F AGVFFTNRMW VPE++ I
Sbjct  1    MSVKSKGAGDIARTRRNVLSRNWTLFLCFVCFYAGVFFTNRMWMVPEARNI  51



>ref|XP_002464309.1| hypothetical protein SORBIDRAFT_01g015960 [Sorghum bicolor]
 gb|EER91307.1| hypothetical protein SORBIDRAFT_01g015960 [Sorghum bicolor]
Length=409

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  335  GEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
             E+V +  ISKKWTLLLC+ SFC G+ FTNRMWT+PE K I
Sbjct  21   DELVLRGSISKKWTLLLCLGSFCIGLLFTNRMWTMPEPKEI  61



>ref|XP_010686831.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 [Beta vulgaris 
subsp. vulgaris]
Length=405

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 2/50 (4%)
 Frame = +2

Query  308  MSVKSRGG--GGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            MSVKSR G  G E  SK+ + +K+ +LLCI SFCAG+FFT RMW  PE K
Sbjct  1    MSVKSRAGLGGNEPSSKNFLPRKFVILLCIGSFCAGMFFTERMWIEPEGK  50



>emb|CDY49507.1| BnaC05g03190D [Brassica napus]
Length=410

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 41/53 (77%), Gaps = 2/53 (4%)
 Frame = +2

Query  308  MSVKSRGGGGE--VVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            M+ K +GGGGE    S+S  S++WTLLLC+ SFC G+FFT+RMW +PES+ I+
Sbjct  1    MTTKMKGGGGEHSSSSRSSASRRWTLLLCLGSFCVGMFFTDRMWNIPESRDIS  53



>gb|KCW88781.1| hypothetical protein EUGRSUZ_A01123 [Eucalyptus grandis]
Length=325

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 4/50 (8%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS+K RG   E+  KS +S+KWTLLLC+  FCAG+  T+R WTVPESKGI
Sbjct  1    MSMKIRG---ELAPKSAVSRKWTLLLCVGCFCAGMLITSR-WTVPESKGI  46



>ref|XP_010433424.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 [Camelina 
sativa]
Length=408

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +2

Query  308  MSVKS-RGGGGEV-VSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS+K  RGGG E+  SKS +SKKWTL LCI  FCAG+ F++RMW  PE+  ++
Sbjct  1    MSLKHHRGGGLELSASKSFVSKKWTLFLCIGFFCAGILFSDRMWPEPEANIVS  53



>gb|KJB80508.1| hypothetical protein B456_013G101400 [Gossypium raimondii]
Length=398

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS KS+    E  S+S +SKKWT LLC+  FCAG+ FTNRM  VPESK I
Sbjct  1    MSFKSKT---EQSSRSFVSKKWTFLLCLSCFCAGILFTNRMVAVPESKAI  47



>emb|CDY46836.1| BnaA10g03200D [Brassica napus]
Length=407

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 41/53 (77%), Gaps = 2/53 (4%)
 Frame = +2

Query  308  MSVKSRGGGGE--VVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            M+ K +GGGGE    S+S  S++WTLLLC+ SFC G+FFT+RMW +PES+ I+
Sbjct  1    MTTKMKGGGGEHSSSSRSSASRRWTLLLCLGSFCVGMFFTDRMWNIPESRDIS  53



>gb|KJB57748.1| hypothetical protein B456_009G178900 [Gossypium raimondii]
Length=330

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            M VKSRG   E  SK ++ K   LLLC  SFCAG+FF+NR W VP++KGI
Sbjct  1    MFVKSRG---EHASKHVLPKNLALLLCFASFCAGMFFSNRTWMVPDAKGI  47



>gb|KJB80507.1| hypothetical protein B456_013G101400 [Gossypium raimondii]
Length=405

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS KS+    E  S+S +SKKWT LLC+  FCAG+ FTNRM  VPESK I
Sbjct  1    MSFKSKT---EQSSRSFVSKKWTFLLCLSCFCAGILFTNRMVAVPESKAI  47



>gb|KJB80505.1| hypothetical protein B456_013G101400 [Gossypium raimondii]
Length=404

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS KS+    E  S+S +SKKWT LLC+  FCAG+ FTNRM  VPESK I
Sbjct  1    MSFKSKT---EQSSRSFVSKKWTFLLCLSCFCAGILFTNRMVAVPESKAI  47



>ref|XP_010438679.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X1 [Camelina sativa]
Length=409

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 3/54 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEV---VSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS+K   GGG +    SKS +SKKWTL LCI  FCAG+ F++RMW  PE+  ++
Sbjct  1    MSLKHHRGGGGLELSASKSFVSKKWTLFLCIGFFCAGILFSDRMWPEPEANLVS  54



>ref|XP_006449733.1| hypothetical protein CICLE_v10015441mg [Citrus clementina]
 gb|ESR62973.1| hypothetical protein CICLE_v10015441mg [Citrus clementina]
Length=407

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 2/50 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS KS GG  E  S++LI +KW L LC  SF AG+ FTNRMW +PESKG+
Sbjct  1    MSFKSTGG--EFASRNLIPRKWALFLCACSFWAGMSFTNRMWMMPESKGV  48



>ref|XP_008226885.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Prunus mume]
Length=403

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KSRG   E  SKS +S+K T+L CI  FCAG+ F++RMW+VPE KGI 
Sbjct  1    MSWKSRGA--ESASKSAVSRKRTILFCIGCFCAGMLFSDRMWSVPEIKGIA  49



>ref|XP_008226884.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Prunus mume]
Length=404

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KSRG   E  SKS +S+K T+L CI  FCAG+ F++RMW+VPE KGI 
Sbjct  1    MSWKSRGA--ESASKSAVSRKRTILFCIGCFCAGMLFSDRMWSVPEIKGIA  49



>ref|XP_010438680.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X2 [Camelina sativa]
Length=408

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 3/54 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEV---VSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS+K   GGG +    SKS +SKKWTL LCI  FCAG+ F++RMW  PE+  ++
Sbjct  1    MSLKHHRGGGGLELSASKSFVSKKWTLFLCIGFFCAGILFSDRMWPEPEANLVS  54



>ref|XP_006284182.1| hypothetical protein CARUB_v10005329mg [Capsella rubella]
 gb|EOA17080.1| hypothetical protein CARUB_v10005329mg [Capsella rubella]
Length=305

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEV-VSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS K   GG E+  SKS +SKKWTL LCI  FCAG+ F++RMW  PE+  ++
Sbjct  1    MSSKHHRGGLELSASKSFVSKKWTLFLCIGFFCAGILFSDRMWPEPEANLVS  52



>ref|XP_010448194.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X1 [Camelina sativa]
Length=409

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 3/54 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEV---VSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS+K   GGG +    SKS +SKKWTL LCI  FCAG+ F++RMW  PE+  ++
Sbjct  1    MSLKHHRGGGGLELSASKSFVSKKWTLFLCIGFFCAGILFSDRMWPEPEANIVS  54



>emb|CDY48266.1| BnaA05g10880D [Brassica napus]
Length=409

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  332  GGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            G  + S+S +S+KWT LLC  SFC G+FFT+RMW +PES  +
Sbjct  7    GENLYSRSFVSRKWTFLLCFASFCFGIFFTDRMWNIPESNDM  48



>ref|XP_010448195.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X2 [Camelina sativa]
Length=408

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 3/54 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEV---VSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS+K   GGG +    SKS +SKKWTL LCI  FCAG+ F++RMW  PE+  ++
Sbjct  1    MSLKHHRGGGGLELSASKSFVSKKWTLFLCIGFFCAGILFSDRMWPEPEANIVS  54



>ref|XP_009143988.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X1 [Brassica rapa]
Length=409

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  332  GGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            G  + S+S +S+KWT LLC  SFC G+FFT+RMW +PES  +
Sbjct  7    GENLYSRSFVSRKWTFLLCFASFCFGIFFTDRMWNIPESNDM  48



>emb|CDY12206.1| BnaC04g12360D [Brassica napus]
Length=409

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  332  GGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            G  + S+S +S+KWT LLC  SFC G+FFT+RMW +PES  + 
Sbjct  7    GENLYSRSFVSRKWTFLLCFASFCFGIFFTDRMWNIPESNDMA  49



>ref|XP_009143989.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X2 [Brassica rapa]
Length=406

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  332  GGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            G  + S+S +S+KWT LLC  SFC G+FFT+RMW +PES  +
Sbjct  7    GENLYSRSFVSRKWTFLLCFASFCFGIFFTDRMWNIPESNDM  48



>ref|XP_010046417.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Eucalyptus 
grandis]
 gb|KCW88779.1| hypothetical protein EUGRSUZ_A01123 [Eucalyptus grandis]
 gb|KCW88780.1| hypothetical protein EUGRSUZ_A01123 [Eucalyptus grandis]
Length=407

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 4/51 (8%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS+K RG   E+  KS +S+KWTLLLC+  FCAG+  T+R WTVPESKGI 
Sbjct  1    MSMKIRG---ELAPKSAVSRKWTLLLCVGCFCAGMLITSR-WTVPESKGIA  47



>ref|XP_011095407.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Sesamum 
indicum]
Length=405

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KSRG   E  SK+++S+K T LLCI  FCAG+ FT+RMW VPE+K I+
Sbjct  1    MSWKSRGL--ESTSKNVVSRKLTFLLCIGCFCAGMLFTDRMWAVPEAKDIS  49



>gb|KGN63249.1| hypothetical protein Csa_2G418850 [Cucumis sativus]
Length=409

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 2/50 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS KS+       S+S+IS+KWTL LC+  FC+G+ FTNRMWT+PE K +
Sbjct  1    MSWKSKADHHS--SRSVISQKWTLFLCLVCFCSGMLFTNRMWTIPEHKAM  48



>ref|XP_004515096.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cicer 
arietinum]
Length=408

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            M+ KSRG      S++ IS+KWTL LC+ SFCAG+ FTNR+W++PE  G+ 
Sbjct  1    MTWKSRGEFSS--SRNFISQKWTLFLCLGSFCAGMLFTNRIWSIPEQNGLA  49



>ref|XP_008681412.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW68303.1| hypothetical protein ZEAMMB73_372854 [Zea mays]
Length=416

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  335  GEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
             E+V +  ISKKWT LLC  SFC G+ FTNRMWTVPE K I
Sbjct  25   DELVLRGSISKKWTFLLCFGSFCIGLLFTNRMWTVPEPKEI  65



>ref|NP_849454.1| putative beta-1,3-galactosyltransferase 4 [Arabidopsis thaliana]
 gb|AEE85273.1| putative beta-1,3-galactosyltransferase 4 [Arabidopsis thaliana]
Length=306

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEV-VSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS+K    G E+  SKS +SKKWTL LCI  FCAG+ F++RMW  PES  ++
Sbjct  1    MSLKHHHRGLELSASKSFVSKKWTLFLCIGFFCAGILFSDRMWPEPESNVVS  52



>gb|KJB13703.1| hypothetical protein B456_002G089700 [Gossypium raimondii]
Length=374

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  332  GGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            G E  +KS ++KKWTLLLCI  FCAG+ F++RMWTVPE++
Sbjct  7    GLESNTKSFVTKKWTLLLCIGCFCAGMLFSDRMWTVPEAE  46



>ref|XP_002879388.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55647.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  347  SKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            S+SL+SKKWT LLC  SFC G+ FT+RMW +PESK ++
Sbjct  12   SRSLVSKKWTFLLCFGSFCFGILFTDRMWIIPESKDMS  49



>gb|KHG30061.1| putative beta-1,3-galactosyltransferase 4 -like protein [Gossypium 
arboreum]
Length=406

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  332  GGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            G E  +KS ++KKWTLLLCI  FCAG+ F++RMWTVPE++
Sbjct  7    GLESNAKSFVTKKWTLLLCIGCFCAGMLFSDRMWTVPEAE  46



>ref|XP_006410375.1| hypothetical protein EUTSA_v10016736mg [Eutrema salsugineum]
 gb|ESQ51828.1| hypothetical protein EUTSA_v10016736mg [Eutrema salsugineum]
Length=408

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  332  GGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            G  + S+S +++KWT LLC  SFC G+FFT+RMW +PES+ +
Sbjct  7    GEHLYSRSFVTRKWTFLLCFASFCFGMFFTDRMWNIPESRDM  48



>gb|KJB13702.1| hypothetical protein B456_002G089700 [Gossypium raimondii]
Length=406

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  332  GGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            G E  +KS ++KKWTLLLCI  FCAG+ F++RMWTVPE++
Sbjct  7    GLESNTKSFVTKKWTLLLCIGCFCAGMLFSDRMWTVPEAE  46



>gb|KHG03847.1| putative beta-1,3-galactosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=407

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            M VKSRG   E  SK ++ K   LLLC  SFCAG+FF+NR W VP++KGI
Sbjct  1    MFVKSRG---EHASKHVLPKNLALLLCFASFCAGMFFSNRTWMVPDAKGI  47



>gb|KHF99242.1| putative beta-1,3-galactosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=404

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS KS+    E  ++S +SKKWT LLC+  FCAG+ FTNRM  VPESK I
Sbjct  1    MSFKSKT---EQSTRSFVSKKWTFLLCLSCFCAGILFTNRMVAVPESKAI  47



>ref|XP_006417321.1| hypothetical protein EUTSA_v10007904mg [Eutrema salsugineum]
 gb|ESQ35674.1| hypothetical protein EUTSA_v10007904mg [Eutrema salsugineum]
Length=385

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS K+RGG      +S+ S+     LC+ SFC G+FFTNRMW VPE++ I+
Sbjct  1    MSFKNRGGDYYFTPRSVTSRNSVFFLCLASFCLGMFFTNRMWNVPEARSIS  51



>gb|KJB57747.1| hypothetical protein B456_009G178900 [Gossypium raimondii]
Length=406

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            M VKSRG   E  SK ++ K   LLLC  SFCAG+FF+NR W VP++KGI
Sbjct  1    MFVKSRG---EHASKHVLPKNLALLLCFASFCAGMFFSNRTWMVPDAKGI  47



>ref|XP_004982530.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Setaria 
italica]
Length=405

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  338  EVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            E+V +  ISKKWT LLC+ SFC G+ FTNRMWT+PE K I
Sbjct  18   ELVLRGSISKKWTFLLCLGSFCIGLLFTNRMWTMPEPKEI  57



>gb|KJB57750.1| hypothetical protein B456_009G178900 [Gossypium raimondii]
Length=447

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            M VKSRG   E  SK ++ K   LLLC  SFCAG+FF+NR W VP++KGI
Sbjct  1    MFVKSRG---EHASKHVLPKNLALLLCFASFCAGMFFSNRTWMVPDAKGI  47



>gb|KJB57751.1| hypothetical protein B456_009G178900 [Gossypium raimondii]
Length=330

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            M VKSRG   E  SK ++ K   LLLC  SFCAG+FF+NR W VP++KGI
Sbjct  1    MFVKSRG---EHASKHVLPKNLALLLCFASFCAGMFFSNRTWMVPDAKGI  47



>ref|NP_180802.1| putative beta-1,3-galactosyltransferase 3 [Arabidopsis thaliana]
 sp|Q9ZV71.1|B3GT3_ARATH RecName: Full=Probable beta-1,3-galactosyltransferase 3 [Arabidopsis 
thaliana]
 gb|AAC69935.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42172.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08684.1| putative beta-1,3-galactosyltransferase 3 [Arabidopsis thaliana]
 gb|AHL38822.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=409

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  347  SKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            S+SL+SKKWT LLC  SFC G+ FT+RMW +PESK +
Sbjct  12   SRSLVSKKWTFLLCFGSFCFGILFTDRMWIIPESKDM  48



>emb|CAB36540.1| Avr9 elicitor response like protein [Arabidopsis thaliana]
 emb|CAB79549.1| Avr9 elicitor response like protein [Arabidopsis thaliana]
Length=406

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEV-VSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS+K    G E+  SKS +SKKWTL LCI  FCAG+ F++RMW  PES  ++
Sbjct  1    MSLKHHHRGLELSASKSFVSKKWTLFLCIGFFCAGILFSDRMWPEPESNVVS  52



>ref|NP_567762.1| putative beta-1,3-galactosyltransferase 4 [Arabidopsis thaliana]
 sp|Q8LEJ9.1|B3GT4_ARATH RecName: Full=Probable beta-1,3-galactosyltransferase 4 [Arabidopsis 
thaliana]
 gb|AAM62612.1| Avr9 elicitor response-like protein [Arabidopsis thaliana]
 gb|AEE85272.1| putative beta-1,3-galactosyltransferase 4 [Arabidopsis thaliana]
Length=407

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEV-VSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS+K    G E+  SKS +SKKWTL LCI  FCAG+ F++RMW  PES  ++
Sbjct  1    MSLKHHHRGLELSASKSFVSKKWTLFLCIGFFCAGILFSDRMWPEPESNVVS  52



>ref|XP_009419577.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009419578.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=400

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 7/50 (14%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS KS+GG         ++++WTLLLC+ SF  G+ FTNRMWTVPE+K I
Sbjct  1    MSSKSKGG-------DTVARRWTLLLCLGSFVTGLLFTNRMWTVPEAKDI  43



>ref|XP_006351966.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Solanum tuberosum]
Length=397

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 39/52 (75%), Gaps = 2/52 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESK-GIT  460
            M  K+RG   E  S S++SKKW+L LC+ SFCAG+FFTNRMW + E++ GIT
Sbjct  1    MYFKNRGAI-ERPSTSVVSKKWSLFLCLGSFCAGMFFTNRMWIISETESGIT  51



>ref|XP_010536663.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X2 [Tarenaya hassleriana]
Length=405

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 3/51 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEV-VSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS+K RG   EV  SKS++SK+WT LLCI  FCAG+ F++RMW  PE++ +
Sbjct  1    MSLKHRGL--EVSASKSVVSKRWTFLLCIGCFCAGILFSDRMWPEPEARSV  49



>ref|XP_006351967.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Solanum tuberosum]
Length=395

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 39/52 (75%), Gaps = 2/52 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESK-GIT  460
            M  K+RG   E  S S++SKKW+L LC+ SFCAG+FFTNRMW + E++ GIT
Sbjct  1    MYFKNRGAI-ERPSTSVVSKKWSLFLCLGSFCAGMFFTNRMWIISETESGIT  51



>ref|XP_003550487.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Glycine max]
 ref|XP_006600308.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Glycine max]
Length=374

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  329  GGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            GG E+  ++++ +KW LLLC+ SFCAG+FFTNR+W++ E K I+
Sbjct  5    GGVELSGRNVLHRKWALLLCVASFCAGMFFTNRIWSMAEYKEIS  48



>ref|XP_010655390.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Vitis vinifera]
 emb|CBI23239.3| unnamed protein product [Vitis vinifera]
Length=408

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            M +K+RGG  E  SKS++S+   LLLC+ SFCAG+FFTNRMW   E+K
Sbjct  1    MYLKNRGGT-EYPSKSVVSRNLALLLCLSSFCAGMFFTNRMWAAFEAK  47



>ref|XP_007020793.1| Galactosyltransferase family protein [Theobroma cacao]
 gb|EOY12318.1| Galactosyltransferase family protein [Theobroma cacao]
Length=406

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 4/53 (8%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPES--KGIT  460
            MS KS+G   E  SKS+++KKW LLLCI  FCAG+ F++RMW VPE+  KG++
Sbjct  1    MSWKSKGL--EPNSKSVVTKKWALLLCIGCFCAGMLFSDRMWAVPEADDKGVS  51



>ref|XP_003539862.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Glycine 
max]
Length=406

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 40/52 (77%), Gaps = 4/52 (8%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPE-SKGIT  460
            M+ KSRG   E+ S+S+IS++W L LC+ SFCAG+ FT R+WT+PE +KG+ 
Sbjct  1    MTWKSRG---ELPSRSVISQRWALFLCLGSFCAGMLFTTRIWTIPENNKGLA  49



>ref|XP_010536662.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X1 [Tarenaya hassleriana]
Length=428

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 3/51 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEV-VSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS+K RG   EV  SKS++SK+WT LLCI  FCAG+ F++RMW  PE++ +
Sbjct  1    MSLKHRGL--EVSASKSVVSKRWTFLLCIGCFCAGILFSDRMWPEPEARSV  49



>gb|KHN21228.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=406

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 40/52 (77%), Gaps = 4/52 (8%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPE-SKGIT  460
            M+ KSRG   E+ S+S+IS++W L LC+ SFCAG+ FT R+WT+PE +KG+ 
Sbjct  1    MTWKSRG---ELPSRSVISQRWALFLCLGSFCAGMLFTTRIWTIPENNKGLA  49



>gb|KJB62838.1| hypothetical protein B456_009G440200 [Gossypium raimondii]
Length=280

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 38/52 (73%), Gaps = 2/52 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGITI  463
            MS KS+G       KS+++KK TLLLCI  FCAG+ F++RMWTVPE++  TI
Sbjct  1    MSWKSKGFDPN--PKSMVTKKLTLLLCIGCFCAGMLFSDRMWTVPEAEDKTI  50



>ref|XP_003527496.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Glycine 
max]
 gb|KHN41227.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=407

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 40/52 (77%), Gaps = 4/52 (8%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPE-SKGIT  460
            M+ KSRG   E+ S+S+IS++W L LC+ SFCAG+ FT R+WT+PE +KG+ 
Sbjct  1    MTWKSRG---ELPSRSVISQRWVLFLCLGSFCAGMLFTTRIWTIPENNKGLA  49



>ref|XP_009610750.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 [Nicotiana 
tomentosiformis]
Length=409

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 2/48 (4%)
 Frame = +2

Query  317  KSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            KSRG   E  +K + S K T+LLCI  FC G+ FT+RMWTVPE+KGI+
Sbjct  8    KSRGA--ESAAKGVFSPKLTILLCIGCFCVGMLFTDRMWTVPEAKGIS  53



>ref|XP_008359264.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Malus domestica]
Length=411

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 6/57 (11%)
 Frame = +2

Query  308  MSVKSRGGGGE------VVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS+KSRGGGG         SKS +S+KWTLL CI  FCAG+ F++RMW+VPE K ++
Sbjct  1    MSLKSRGGGGGGGGGEAAASKSAVSRKWTLLFCIGCFCAGMLFSDRMWSVPEIKDVS  57



>ref|XP_002867534.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43793.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=407

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEV-VSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS+K    G E+  SKS +SKKWTL LCI  FCAG+ F++RMW  PE+  ++
Sbjct  1    MSLKHHHRGLELSASKSFVSKKWTLFLCIGFFCAGILFSDRMWPEPEANVVS  52



>ref|XP_008359262.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Malus domestica]
Length=412

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 6/57 (11%)
 Frame = +2

Query  308  MSVKSRGGGGE------VVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS+KSRGGGG         SKS +S+KWTLL CI  FCAG+ F++RMW+VPE K ++
Sbjct  1    MSLKSRGGGGGGGGGEAAASKSAVSRKWTLLFCIGCFCAGMLFSDRMWSVPEIKDVS  57



>ref|XP_004172360.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
Length=408

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 2/50 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS KS+       S+S+IS+KWTL LC+  FC+G+ FTNR+WT+PE K +
Sbjct  1    MSWKSKADHHS--SRSVISQKWTLFLCLVCFCSGMLFTNRVWTIPEHKAM  48



>ref|XP_011461040.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=406

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  332  GGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            G E  S++ +S++WT+L CI  FCAG+ F++RMW+VPE KGI+
Sbjct  10   GVEPPSRNAVSRRWTILFCIACFCAGMLFSDRMWSVPEIKGIS  52



>gb|KEH28821.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
Length=378

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MSVK + G  E+ +++++  KW L LC+ SFCAG+ FTNRMW++ E + I+
Sbjct  1    MSVKIKVGDVELRARTVVHSKWALFLCLASFCAGMLFTNRMWSMSEYREIS  51



>ref|XP_004294404.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=407

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  332  GGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            G E  S++ +S++WT+L CI  FCAG+ F++RMW+VPE KGI+
Sbjct  10   GVEPPSRNAVSRRWTILFCIACFCAGMLFSDRMWSVPEIKGIS  52



>ref|XP_010475189.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Camelina sativa]
Length=409

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  347  SKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            S+S +S+K+T+LLC+ SFC G+FFT+RMW++ ESKG++
Sbjct  13   SRSFVSRKYTILLCLGSFCLGLFFTDRMWSIEESKGMS  50



>ref|XP_009361000.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Pyrus x bretschneideri]
Length=403

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS KSR G  E    + +S+KWTLL CI  FCAG+ F++RMW+VPE + I+
Sbjct  1    MSWKSREG--EASKSAFVSRKWTLLFCIGCFCAGMLFSDRMWSVPEIEDIS  49



>ref|XP_010475190.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Camelina sativa]
Length=406

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  347  SKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            S+S +S+K+T+LLC+ SFC G+FFT+RMW++ ESKG++
Sbjct  13   SRSFVSRKYTILLCLGSFCLGLFFTDRMWSIEESKGMS  50



>ref|XP_007132543.1| hypothetical protein PHAVU_011G103400g [Phaseolus vulgaris]
 gb|ESW04537.1| hypothetical protein PHAVU_011G103400g [Phaseolus vulgaris]
Length=406

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 39/52 (75%), Gaps = 4/52 (8%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPE-SKGIT  460
            M+ KSRG   E  S+S+IS++W L LC+ SFCAG+ FT R+WT+PE +KG+ 
Sbjct  1    MTWKSRG---EFPSRSVISQRWALFLCLGSFCAGMLFTTRIWTIPENNKGLA  49



>ref|XP_008385877.1| PREDICTED: probable beta-1,3-galactosyltransferase 2, partial 
[Malus domestica]
Length=407

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  347  SKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            SKS +S+KWTLL CI  FCAG+ F++RMW+VPE K ++
Sbjct  15   SKSAVSRKWTLLFCIGCFCAGMLFSDRMWSVPEIKDVS  52



>gb|KHG10854.1| putative beta-1,3-galactosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=418

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            M VK+RG   E  SK ++ KK  +LLC  SF AG+FFTNRMW VP++K I
Sbjct  1    MYVKNRG---EYASKHVLPKKLAILLCFASFFAGMFFTNRMWMVPDAKSI  47



>gb|KJB69211.1| hypothetical protein B456_011G013600 [Gossypium raimondii]
Length=417

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            M VK+RG   E  SK ++ KK  +LLC  SF AG+FFTNRMW VP++K I
Sbjct  1    MYVKNRG---EYASKHVLPKKLAILLCFASFFAGMFFTNRMWMVPDAKSI  47



>gb|KJB69210.1| hypothetical protein B456_011G013600 [Gossypium raimondii]
Length=418

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            M VK+RG   E  SK ++ KK  +LLC  SF AG+FFTNRMW VP++K I
Sbjct  1    MYVKNRG---EYASKHVLPKKLAILLCFASFFAGMFFTNRMWMVPDAKSI  47



>ref|XP_010522344.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Tarenaya hassleriana]
Length=405

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  332  GGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKG  454
            G  + S+S +SKK T LLC+  FCAG+FFT+RMW VPE KG
Sbjct  7    GEHLSSRSFVSKKLTYLLCLGCFCAGMFFTDRMWKVPELKG  47



>ref|XP_010522341.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010522342.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010522343.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Tarenaya hassleriana]
Length=408

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKG  454
            MS K +G    + S+S +SKK T LLC+  FCAG+FFT+RMW VPE KG
Sbjct  1    MSAKIKGE--HLSSRSFVSKKLTYLLCLGCFCAGMFFTDRMWKVPELKG  47



>gb|KJB62836.1| hypothetical protein B456_009G440200 [Gossypium raimondii]
 gb|KJB62837.1| hypothetical protein B456_009G440200 [Gossypium raimondii]
Length=405

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 39/52 (75%), Gaps = 2/52 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGITI  463
            MS KS+G   +   KS+++KK TLLLCI  FCAG+ F++RMWTVPE++  TI
Sbjct  1    MSWKSKGF--DPNPKSMVTKKLTLLLCIGCFCAGMLFSDRMWTVPEAEDKTI  50



>ref|XP_009774309.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Nicotiana 
sylvestris]
Length=409

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 2/48 (4%)
 Frame = +2

Query  317  KSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            KSRG   E   K + S K T+LLCI  FC G+ FT+RMWTVPE+KGI+
Sbjct  8    KSRGA--ESAVKGVFSPKLTILLCIGCFCVGMLFTDRMWTVPEAKGIS  53



>emb|CDX97981.1| BnaA06g07320D [Brassica napus]
Length=391

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 4/55 (7%)
 Frame = +2

Query  308  MSVKSRGGGG----EVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS K+RGGG         ++++S+      CI SFC G+FF+NRMW VPE +GI+
Sbjct  1    MSFKNRGGGSFGDHYFTPRNVVSRNSVFFFCIASFCLGMFFSNRMWNVPEGRGIS  55



>emb|CDY68943.1| BnaAnng28870D, partial [Brassica napus]
Length=353

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  317  KSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
              RG     VSKS +SKKWT LLCI  FCAG  F++RMW  PE+ 
Sbjct  18   HHRGVELSAVSKSFVSKKWTFLLCISFFCAGTLFSDRMWPEPEAN  62



>ref|XP_010484744.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Camelina sativa]
Length=405

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 38/51 (75%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS K +G      S+S  S+K+T+LLC+ SFC G+FFT+RMW++ ESKG++
Sbjct  1    MSTKMKGEYSS--SRSFASRKYTILLCLGSFCLGLFFTDRMWSIQESKGMS  49



>emb|CDY49800.1| BnaCnng18130D [Brassica napus]
Length=391

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 4/55 (7%)
 Frame = +2

Query  308  MSVKSRGGGG----EVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS K+RGGG         ++++S+      CI SFC G+FF+NRMW VPE +GI+
Sbjct  1    MSFKNRGGGSFGDHYFTPRNVVSRNSVFFFCIASFCLGMFFSNRMWNVPEGRGIS  55



>ref|XP_010484738.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Camelina sativa]
Length=408

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 38/51 (75%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS K +G      S+S  S+K+T+LLC+ SFC G+FFT+RMW++ ESKG++
Sbjct  1    MSTKMKGEYSS--SRSFASRKYTILLCLGSFCLGLFFTDRMWSIQESKGMS  49



>ref|XP_004151891.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
Length=408

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 2/50 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS KS+       S+S+IS+KWTL LC+  FC+G+ FTNR+W +PE K +
Sbjct  1    MSWKSKADHHS--SRSVISQKWTLFLCLVCFCSGMLFTNRLWLIPEHKAM  48



>ref|XP_011048788.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Populus euphratica]
Length=408

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 34/51 (67%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            M+ KSRG   +  SK+ IS+KWTLLLC+  FC+G+   N MW VPE  GI 
Sbjct  1    MTFKSRGD--QQSSKNAISQKWTLLLCLACFCSGMLLANWMWNVPEPIGIN  49



>ref|XP_010089999.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
 gb|EXB38730.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
Length=404

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPE  445
            MS KSRGG  E  SKS++S+KWTL LC   FCAG+ F++RM  VPE
Sbjct  1    MSWKSRGGM-ESASKSVVSRKWTLFLCFGCFCAGLLFSDRMSMVPE  45



>ref|XP_009399227.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=401

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 6/50 (12%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS KSRGG      +  +S++WTLLLC+ SF  G+ FTNRMW VP++K I
Sbjct  1    MSWKSRGG------EKTVSRRWTLLLCVGSFFTGLVFTNRMWLVPDAKDI  44



>ref|XP_011048789.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Populus euphratica]
Length=405

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 34/51 (67%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            M+ KSRG   +  SK+ IS+KWTLLLC+  FC+G+   N MW VPE  GI 
Sbjct  1    MTFKSRGD--QQSSKNAISQKWTLLLCLACFCSGMLLANWMWNVPEPIGIN  49



>ref|XP_004172861.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like, partial 
[Cucumis sativus]
Length=250

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPE  445
            MS KSRGG  E  ++  +S+KWT L CI  FCAG+ F++RMW VPE
Sbjct  1    MSWKSRGGF-EPSTRGSVSRKWTFLFCIGCFCAGMLFSDRMWAVPE  45



>ref|XP_009119198.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Brassica rapa]
Length=408

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  371  WTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            WTLLLC+ SFCAG+FFT+RMW +PES+ I+
Sbjct  26   WTLLLCLGSFCAGMFFTDRMWNIPESRDIS  55



>ref|XP_009119197.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Brassica rapa]
Length=411

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  371  WTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            WTLLLC+ SFCAG+FFT+RMW +PES+ I+
Sbjct  26   WTLLLCLGSFCAGMFFTDRMWNIPESRDIS  55



>gb|KDP20741.1| hypothetical protein JCGZ_21212 [Jatropha curcas]
Length=386

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPE  445
            MS+KSR GG E+ +++ + +     LC+ SF AG+FFTNRMWTVPE
Sbjct  1    MSMKSRVGG-EIATRNFMPRNLAFFLCLGSFLAGMFFTNRMWTVPE  45



>ref|XP_006365959.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Solanum 
tuberosum]
Length=395

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  350  KSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            KS+ S   T+LLCI  FCAG+FFT+R+WTVPE+KGI+
Sbjct  15   KSVTSPNLTILLCIGCFCAGMFFTHRVWTVPEAKGIS  51



>emb|CDX97371.1| BnaC08g12360D [Brassica napus]
Length=405

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEV-VSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS+K    G E+  SKS +SKKWT  LCI  FCAG  F++RMW  PE+  ++
Sbjct  1    MSMKHHHRGLELSASKSFVSKKWTFFLCIGFFCAGTLFSDRMWPEPEANVVS  52



>ref|XP_004149353.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
 gb|KGN56118.1| hypothetical protein Csa_3G076540 [Cucumis sativus]
Length=407

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPE  445
            MS KSRGG  E  ++  +S+KWT L CI  FCAG+ F++RMW VPE
Sbjct  1    MSWKSRGGF-EPSTRGSVSRKWTFLFCIGCFCAGMLFSDRMWAVPE  45



>ref|XP_008463407.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-1,3-galactosyltransferase 
3 [Cucumis melo]
Length=412

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPE  445
            MS KSRGG  E  ++  +S+KWT L CI  FCAG+ F++RMW VPE
Sbjct  1    MSWKSRGGF-EPSTRGSVSRKWTFLFCIGCFCAGMLFSDRMWAVPE  45



>gb|AFW66427.1| hypothetical protein ZEAMMB73_715676 [Zea mays]
Length=174

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            +S++W +LLC+ SFC G+ FTNRMWT+PE+  I
Sbjct  14   VSRRWAVLLCVGSFCLGLLFTNRMWTLPEASEI  46



>gb|EYU27344.1| hypothetical protein MIMGU_mgv1a007546mg [Erythranthe guttata]
Length=404

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS K+RG      SK+++S+K ++ LCI  FCAG+ FT+RMW VPE+K ++
Sbjct  1    MSWKNRGLDSN--SKNVVSRKLSIFLCIGCFCAGMLFTDRMWAVPEAKDVS  49



>ref|XP_004966215.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Setaria 
italica]
Length=400

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 5/47 (11%)
 Frame = +2

Query  323  RGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGITI  463
            +GGG + V++     +W LLLC+ SFC G+ FTNRMWT+PE+  + I
Sbjct  5    KGGGADGVAR-----RWVLLLCVGSFCLGLLFTNRMWTLPEASEVAI  46



>ref|XP_009148502.1| PREDICTED: probable beta-1,3-galactosyltransferase 1 isoform 
X2 [Brassica rapa]
Length=391

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 35/55 (64%), Gaps = 4/55 (7%)
 Frame = +2

Query  308  MSVKSRGGGG----EVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS K+RGGG         ++++S+      CI SFC G+FF+NR+W VPE +GI+
Sbjct  1    MSFKNRGGGSFGDHYFTPRNVVSRNSVFFFCIASFCLGMFFSNRVWNVPEGRGIS  55



>ref|XP_009148501.1| PREDICTED: probable beta-1,3-galactosyltransferase 1 isoform 
X1 [Brassica rapa]
Length=392

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 35/55 (64%), Gaps = 4/55 (7%)
 Frame = +2

Query  308  MSVKSRGGGG----EVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS K+RGGG         ++++S+      CI SFC G+FF+NR+W VPE +GI+
Sbjct  1    MSFKNRGGGSFGDHYFTPRNVVSRNSVFFFCIASFCLGMFFSNRVWNVPEGRGIS  55



>emb|CDY46675.1| BnaA03g48330D [Brassica napus]
Length=410

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 31/51 (61%), Gaps = 3/51 (6%)
 Frame = +2

Query  308  MSVKSRGGGG---EVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            MS+K     G      SKS +SKKWT LLCI  FCAG  F++RMW  PE+ 
Sbjct  1    MSLKHHHHRGVELSAASKSFVSKKWTFLLCIGFFCAGTLFSDRMWPEPEAN  51



>ref|XP_009338706.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Pyrus x bretschneideri]
Length=411

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  341  VVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
              SKS +S+KWTLL CI  FCAG+ F++R W+VPE K ++
Sbjct  17   AASKSAVSRKWTLLFCIGCFCAGMLFSDRRWSVPEIKEVS  56



>ref|XP_009408655.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=406

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +2

Query  317  KSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            +  GGGGE+ ++  + KKWT LLC+ SFCAG+ F N  W +PE+K I
Sbjct  5    RGSGGGGELWARGKVPKKWTFLLCLGSFCAGLLFANS-WKMPEAKDI  50



>ref|XP_009338707.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Pyrus x bretschneideri]
Length=410

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  341  VVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
              SKS +S+KWTLL CI  FCAG+ F++R W+VPE K ++
Sbjct  17   AASKSAVSRKWTLLFCIGCFCAGMLFSDRRWSVPEIKEVS  56



>ref|XP_008808431.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-1,3-galactosyltransferase 
2 [Phoenix dactylifera]
Length=411

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  365  KKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            +KWT LLC+ SFC G+FFTNRMWT+PE+  I
Sbjct  24   EKWTFLLCLGSFCIGLFFTNRMWTMPEANDI  54



>ref|XP_009137625.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-1,3-galactosyltransferase 
4 [Brassica rapa]
Length=411

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 31/51 (61%), Gaps = 3/51 (6%)
 Frame = +2

Query  308  MSVKSRGGGG---EVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            MS+K     G      SKS +SKKWT LLCI  FCAG  F++RMW  PE+ 
Sbjct  1    MSLKHHHHRGVELSSASKSFVSKKWTFLLCIGFFCAGTLFSDRMWPEPEAN  51



>ref|XP_002437448.1| hypothetical protein SORBIDRAFT_10g027290 [Sorghum bicolor]
 gb|EER88815.1| hypothetical protein SORBIDRAFT_10g027290 [Sorghum bicolor]
Length=400

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 5/47 (11%)
 Frame = +2

Query  323  RGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGITI  463
            RGGG + V++     +W LLLC+ SFC G+ FT+RMWT+PE+  + +
Sbjct  5    RGGGADGVAR-----RWVLLLCVGSFCLGLLFTDRMWTLPEADEVEV  46



>gb|EMS52307.1| putative beta-1,3-galactosyltransferase 2 [Triticum urartu]
 gb|EMT29217.1| Putative beta-1,3-galactosyltransferase 2 [Aegilops tauschii]
Length=400

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 6/52 (12%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGITI  463
            MS +  GG G V      SK+W +LLC+ SFC G+ FTNRMWT+PE+  + +
Sbjct  1    MSWRKAGGDGGV------SKRWAVLLCLGSFCLGLLFTNRMWTLPEATEVPL  46



>gb|EPS64736.1| hypothetical protein M569_10045, partial [Genlisea aurea]
Length=183

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGITI  463
            MS KSRG      S++ +S+K T LLCI  FCAG+ FT+R+WT+PE K + +
Sbjct  1    MSWKSRGVESSS-SRNAVSRKHTALLCICCFCAGMVFTDRIWTLPEEKDVRL  51



>emb|CDX92791.1| BnaC07g40490D [Brassica napus]
Length=402

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 0/45 (0%)
 Frame = +2

Query  317  KSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
              RG      SKS +SKKW  LLCI  FCAG  F++RMW  PES 
Sbjct  8    HHRGVELSAASKSFVSKKWAFLLCIGFFCAGTLFSDRMWPEPESN  52



>ref|XP_006413124.1| hypothetical protein EUTSA_v10025360mg [Eutrema salsugineum]
 gb|ESQ54577.1| hypothetical protein EUTSA_v10025360mg [Eutrema salsugineum]
Length=403

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  344  VSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
             SKS +SKKWT  LCI  FCAG+ F++RMW  PE+  ++
Sbjct  12   ASKSFVSKKWTFFLCIGFFCAGILFSDRMWPEPEANVVS  50



>gb|ACG42389.1| beta-1,3-galactosyltransferase sqv-2 [Zea mays]
Length=385

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 33/47 (70%), Gaps = 5/47 (11%)
 Frame = +2

Query  323  RGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGITI  463
            RGGG + V++     +W LLLC+ SFC G+ FT+RMW++PE+  + +
Sbjct  5    RGGGADGVAR-----RWVLLLCVGSFCLGLLFTDRMWSLPEADEVAV  46



>ref|XP_002302876.1| hypothetical protein POPTR_0002s21280g [Populus trichocarpa]
 gb|EEE82149.1| hypothetical protein POPTR_0002s21280g [Populus trichocarpa]
Length=405

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            M+ KSRG   +   K+ IS+KWTL LC+  FC+G+   N  W VPE KGI 
Sbjct  1    MNFKSRGD--QQSYKNAISQKWTLFLCLACFCSGMLLANWTWNVPEPKGIN  49



>ref|NP_001136834.1| beta-1,3-galactosyltransferase sqv-2 [Zea mays]
 gb|ACF82732.1| unknown [Zea mays]
 gb|AFW68972.1| beta-1,3-galactosyltransferase sqv-2 [Zea mays]
Length=401

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 33/47 (70%), Gaps = 5/47 (11%)
 Frame = +2

Query  323  RGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGITI  463
            RGGG + V++     +W LLLC+ SFC G+ FT+RMW++PE+  + +
Sbjct  5    RGGGADGVAR-----RWVLLLCVGSFCLGLLFTDRMWSLPEADEVAV  46



>ref|XP_010493204.1| PREDICTED: probable beta-1,3-galactosyltransferase 1 isoform 
X1 [Camelina sativa]
Length=386

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS K+RG       +++I +    LLC+ SFC GVFFTNRMW VP ++G+
Sbjct  1    MSFKNRGDY-YFTPRNVIYRNSVFLLCLASFCLGVFFTNRMWNVPGARGV  49



>ref|XP_010675728.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Beta vulgaris 
subsp. vulgaris]
Length=399

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 2/50 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS KSRG   +  SK+++S+K TLLLC+  FC G+ FT+RM T PE KG+
Sbjct  1    MSWKSRGF--DSASKNVVSRKLTLLLCVGCFCLGMLFTSRMLTEPEDKGL  48



>ref|XP_010493211.1| PREDICTED: probable beta-1,3-galactosyltransferase 1 isoform 
X2 [Camelina sativa]
Length=385

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS K+RG       +++I +    LLC+ SFC GVFFTNRMW VP ++G+
Sbjct  1    MSFKNRGDY-YFTPRNVIYRNSVFLLCLASFCLGVFFTNRMWNVPGARGV  49



>ref|XP_010458580.1| PREDICTED: probable beta-1,3-galactosyltransferase 1 [Camelina 
sativa]
Length=389

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS+K+RG       +++I +    LLC+ SFC G+FFTNRMW VP ++GI
Sbjct  1    MSLKNRGDY-YFTPRNVIYRNSVFLLCLASFCLGMFFTNRMWNVPGARGI  49



>ref|XP_010493216.1| PREDICTED: probable beta-1,3-galactosyltransferase 1 isoform 
X3 [Camelina sativa]
Length=384

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS K+RG       +++I +    LLC+ SFC GVFFTNRMW VP ++G+
Sbjct  1    MSFKNRGDY-YFTPRNVIYRNSVFLLCLASFCLGVFFTNRMWNVPGARGV  49



>ref|XP_008677265.1| PREDICTED: beta-1,3-galactosyltransferase sqv-2 isoform X1 [Zea 
mays]
 gb|AFW66428.1| beta-1,3-galactosyltransferase sqv-2 [Zea mays]
Length=402

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            +S++W +LLC+ SFC G+ FTNRMWT+PE+  I 
Sbjct  14   VSRRWAVLLCVGSFCLGLLFTNRMWTLPEASEIA  47



>gb|KGN64515.1| hypothetical protein Csa_1G062900 [Cucumis sativus]
Length=402

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 33/54 (61%), Gaps = 2/54 (4%)
 Frame = +2

Query  308  MSVKSRGGGG--EVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGITI  463
            MS K++ GG   +  S+ ++ +KW   LC   FCAG+ FTNRMW VP   G+ +
Sbjct  1    MSTKNKVGGFGLDFASRYVLFRKWAFFLCFVCFCAGMLFTNRMWIVPMGNGVAL  54



>ref|XP_002451594.1| hypothetical protein SORBIDRAFT_04g004400 [Sorghum bicolor]
 gb|EES04570.1| hypothetical protein SORBIDRAFT_04g004400 [Sorghum bicolor]
Length=402

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            +S++W +LLC+ SFC G+ FTNRMWT+PE+  I 
Sbjct  14   VSRRWAVLLCVGSFCLGLLFTNRMWTLPEASEIA  47



>ref|XP_006646915.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Oryza 
brachyantha]
Length=404

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            +S++W +LLC+ SFC G+ FTNRMWT+PE+  I 
Sbjct  15   VSRRWAVLLCLGSFCLGLLFTNRMWTLPEANEIA  48



>gb|EAY84604.1| hypothetical protein OsI_05972 [Oryza sativa Indica Group]
Length=400

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            +S++W +LLC+ SFC G+ FTNRMWT+PE+  I 
Sbjct  13   VSRRWAVLLCLGSFCLGLLFTNRMWTLPEANEIA  46



>dbj|BAD25162.1| putative Avr9 elicitor response protein [Oryza sativa Japonica 
Group]
 gb|EEE56368.1| hypothetical protein OsJ_05500 [Oryza sativa Japonica Group]
Length=400

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            +S++W +LLC+ SFC G+ FTNRMWT+PE+  I 
Sbjct  13   VSRRWAVLLCLGSFCLGLLFTNRMWTLPEANEIA  46



>ref|XP_009109161.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 [Brassica 
rapa]
 emb|CDY14294.1| BnaA08g14250D [Brassica napus]
Length=406

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            M    RGG     SKS +SKK T  LCI  FCAG  F++RMW  PE+  ++
Sbjct  3    MKHHHRGGLELSASKSFVSKKLTFFLCIGFFCAGTLFSDRMWPEPEANVVS  53



>ref|XP_010233857.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Brachypodium 
distachyon]
Length=408

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            +S++W +LLC+ SFC G+ FTNRMWT+PE+  I 
Sbjct  20   VSRRWAVLLCLGSFCIGLLFTNRMWTLPEATEIA  53



>ref|XP_011097870.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X2 [Sesamum indicum]
Length=403

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            MS K+RG   E  S+  +S+K T+ LC+  F AG+ FT+RMW VPE+K I+
Sbjct  1    MSWKNRGT--ESTSRHSVSRKLTIFLCVGCFFAGMLFTDRMWAVPEAKDIS  49



>ref|XP_004951866.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Setaria 
italica]
Length=403

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +2

Query  362  SKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            S++W +LLC+ SFC G+ FTNRMWT+PE+  I 
Sbjct  16   SRRWAVLLCVGSFCLGLLFTNRMWTLPEASEIA  48



>ref|XP_010476107.1| PREDICTED: probable beta-1,3-galactosyltransferase 1 isoform 
X2 [Camelina sativa]
Length=384

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS K+RG       +++I +     LC+ SFC G+FFTNRMW VP ++GI
Sbjct  1    MSFKNRGDY-YFTPRNVIYRNSVFFLCLASFCLGMFFTNRMWNVPGARGI  49



>ref|XP_010476106.1| PREDICTED: probable beta-1,3-galactosyltransferase 1 isoform 
X1 [Camelina sativa]
Length=385

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGI  457
            MS K+RG       +++I +     LC+ SFC G+FFTNRMW VP ++GI
Sbjct  1    MSFKNRGDY-YFTPRNVIYRNSVFFLCLASFCLGMFFTNRMWNVPGARGI  49



>gb|AAD30250.1|AC007296_11 Strong similarity to gb|AJ006228 Avr9 elicitor response protein 
from Nicotiana tabacum. EST gb|F15429 comes from this gene 
[Arabidopsis thaliana]
Length=401

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWT-VPESKGI  457
            MS K+RG       ++++S+     +C+ SFC G+FFTNRMW  VPE++GI
Sbjct  1    MSFKNRGDYN-FTPRNVVSRNSVFFMCLASFCLGMFFTNRMWNIVPEARGI  50



>ref|NP_172638.1| putative beta-1,3-galactosyltransferase 1 [Arabidopsis thaliana]
 sp|Q9SAA4.2|B3GT1_ARATH RecName: Full=Probable beta-1,3-galactosyltransferase 1 [Arabidopsis 
thaliana]
 gb|AEE28776.1| putative beta-1,3-galactosyltransferase 1 [Arabidopsis thaliana]
 gb|AHL38954.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=384

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWT-VPESKGI  457
            MS K+RG       ++++S+     +C+ SFC G+FFTNRMW  VPE++GI
Sbjct  1    MSFKNRGDYN-FTPRNVVSRNSVFFMCLASFCLGMFFTNRMWNIVPEARGI  50



>ref|XP_002974972.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ23757.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=402

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 26/42 (62%), Gaps = 0/42 (0%)
 Frame = +2

Query  335  GEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            G   S   +S KW L+LC+ SFC G+ FTNRMW  PE   +T
Sbjct  3    GRASSSFSVSGKWMLVLCVGSFCVGMLFTNRMWNSPEDLDVT  44



>ref|XP_002977391.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ21395.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=402

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 26/42 (62%), Gaps = 0/42 (0%)
 Frame = +2

Query  335  GEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            G   S   +S KW L+LC+ SFC G+ FTNRMW  PE   +T
Sbjct  3    GRASSSFSVSGKWMLVLCVGSFCVGMLFTNRMWNSPEDLDVT  44



>ref|XP_002889892.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66151.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=397

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 2/51 (4%)
 Frame = +2

Query  308  MSVKSRGGGGEVVSKSLISKKWTLLLCIXSFCAGVFFTNRMWT-VPESKGI  457
            MS K+RG       ++++S+     +C+ SFC G+FFTNRMW  VPE++GI
Sbjct  1    MSFKNRGEYN-FTPRNVVSRNSVFFMCLASFCLGMFFTNRMWNVVPEARGI  50



>ref|XP_010457596.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Camelina sativa]
Length=441

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  371  WTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            +T+LLC+ SFC G+FFT+RMW++ ESKG++
Sbjct  20   YTILLCLGSFCLGLFFTDRMWSIQESKGMS  49



>ref|XP_010457599.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X4 [Camelina sativa]
Length=405

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  371  WTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            +T+LLC+ SFC G+FFT+RMW++ ESKG++
Sbjct  20   YTILLCLGSFCLGLFFTDRMWSIQESKGMS  49



>ref|XP_010457597.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Camelina sativa]
Length=438

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  371  WTLLLCIXSFCAGVFFTNRMWTVPESKGIT  460
            +T+LLC+ SFC G+FFT+RMW++ ESKG++
Sbjct  20   YTILLCLGSFCLGLFFTDRMWSIQESKGMS  49



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561614547535