BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF009C01

Length=612
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011096601.1|  PREDICTED: F-box protein At4g18380-like            140   1e-35   Sesamum indicum [beniseed]
ref|XP_009774076.1|  PREDICTED: F-box protein At4g18380-like            131   1e-32   Nicotiana sylvestris
ref|XP_009607720.1|  PREDICTED: F-box protein At4g18380-like            130   3e-32   Nicotiana tomentosiformis
ref|XP_009758227.1|  PREDICTED: F-box protein At4g18380-like            129   6e-32   Nicotiana sylvestris
gb|EYU33385.1|  hypothetical protein MIMGU_mgv1a008110mg                128   1e-31   Erythranthe guttata [common monkey flower]
ref|XP_009625759.1|  PREDICTED: F-box protein At5g46170-like            128   2e-31   Nicotiana tomentosiformis
gb|EPS70457.1|  hypothetical protein M569_04296                         127   5e-31   Genlisea aurea
ref|XP_006352970.1|  PREDICTED: F-box protein At5g46170-like            121   5e-29   Solanum tuberosum [potatoes]
gb|EYU43254.1|  hypothetical protein MIMGU_mgv1a008300mg                119   5e-28   Erythranthe guttata [common monkey flower]
ref|XP_011085237.1|  PREDICTED: F-box protein At4g18380-like            119   5e-28   Sesamum indicum [beniseed]
ref|XP_004244968.1|  PREDICTED: F-box protein At5g46170-like            118   6e-28   Solanum lycopersicum
ref|XP_006355407.1|  PREDICTED: F-box protein At5g46170-like            115   1e-26   Solanum tuberosum [potatoes]
ref|XP_004233124.1|  PREDICTED: F-box protein At5g46170-like            114   2e-26   Solanum lycopersicum
ref|XP_003546077.1|  PREDICTED: F-box protein At5g46170-like            113   4e-26   Glycine max [soybeans]
ref|XP_003542943.1|  PREDICTED: F-box protein At5g46170-like isof...    113   6e-26   Glycine max [soybeans]
ref|XP_010247412.1|  PREDICTED: F-box protein At5g46170                 109   1e-24   Nelumbo nucifera [Indian lotus]
ref|XP_007147928.1|  hypothetical protein PHAVU_006G166500g             109   1e-24   Phaseolus vulgaris [French bean]
emb|CAN73778.1|  hypothetical protein VITISV_042179                     108   2e-24   Vitis vinifera
ref|XP_002278480.1|  PREDICTED: F-box protein At5g46170                 108   2e-24   Vitis vinifera
ref|XP_006468035.1|  PREDICTED: F-box protein At5g46170-like isof...    108   3e-24   Citrus sinensis [apfelsine]
ref|XP_006449020.1|  hypothetical protein CICLE_v10015378mg             108   3e-24   Citrus clementina [clementine]
emb|CBI30928.3|  unnamed protein product                                107   6e-24   Vitis vinifera
gb|KHG20859.1|  hypothetical protein F383_03969                         103   1e-22   Gossypium arboreum [tree cotton]
gb|KJB57216.1|  hypothetical protein B456_009G154000                    102   2e-22   Gossypium raimondii
gb|KJB57218.1|  hypothetical protein B456_009G154000                    102   2e-22   Gossypium raimondii
ref|XP_010086997.1|  hypothetical protein L484_005892                   102   3e-22   Morus notabilis
ref|XP_007025034.1|  F-box family protein                               102   3e-22   
gb|KHG27594.1|  hypothetical protein F383_11279                         100   1e-21   Gossypium arboreum [tree cotton]
emb|CDP21114.1|  unnamed protein product                                100   2e-21   Coffea canephora [robusta coffee]
ref|XP_011460217.1|  PREDICTED: F-box protein At5g46170               99.8    3e-21   Fragaria vesca subsp. vesca
gb|KJB69848.1|  hypothetical protein B456_011G045900                  99.8    3e-21   Gossypium raimondii
ref|XP_008444512.1|  PREDICTED: F-box protein At5g46170-like          99.8    3e-21   Cucumis melo [Oriental melon]
ref|XP_004137366.1|  PREDICTED: F-box protein At5g46170-like          99.8    3e-21   Cucumis sativus [cucumbers]
ref|XP_009360916.1|  PREDICTED: F-box protein At5g46170-like          99.4    6e-21   Pyrus x bretschneideri [bai li]
ref|XP_010518768.1|  PREDICTED: F-box protein At5g46170               98.2    8e-21   Tarenaya hassleriana [spider flower]
ref|XP_003593894.1|  F-box family protein                             97.8    1e-20   Medicago truncatula
ref|XP_010538543.1|  PREDICTED: F-box protein At5g46170-like          97.8    1e-20   Tarenaya hassleriana [spider flower]
gb|KJB68311.1|  hypothetical protein B456_010G238100                  97.1    3e-20   Gossypium raimondii
ref|XP_002519646.1|  conserved hypothetical protein                   95.5    1e-19   Ricinus communis
ref|XP_007212265.1|  hypothetical protein PRUPE_ppa006658mg           95.1    1e-19   Prunus persica
gb|AEX97082.1|  F-box family protein                                  95.1    1e-19   Malus domestica [apple tree]
gb|KHN06964.1|  F-box protein                                         92.0    1e-19   Glycine soja [wild soybean]
ref|XP_008371620.1|  PREDICTED: F-box protein At5g46170-like          94.7    2e-19   
ref|XP_004486009.1|  PREDICTED: F-box protein At5g46170-like          94.7    2e-19   Cicer arietinum [garbanzo]
ref|XP_008225507.1|  PREDICTED: F-box protein At5g46170-like          94.7    2e-19   Prunus mume [ume]
gb|KHG06780.1|  hypothetical protein F383_00742                       94.4    2e-19   Gossypium arboreum [tree cotton]
gb|KDP37998.1|  hypothetical protein JCGZ_04641                       94.7    2e-19   Jatropha curcas
gb|KHG16115.1|  hypothetical protein F383_22310                       92.8    1e-18   Gossypium arboreum [tree cotton]
ref|XP_008371786.1|  PREDICTED: F-box protein At5g46170-like          91.7    2e-18   Malus domestica [apple tree]
ref|XP_011007418.1|  PREDICTED: F-box protein At5g46170-like          90.9    4e-18   Populus euphratica
ref|XP_006414111.1|  hypothetical protein EUTSA_v10025383mg           89.7    1e-17   Eutrema salsugineum [saltwater cress]
ref|XP_002317281.1|  F-box family protein                             88.6    3e-17   Populus trichocarpa [western balsam poplar]
gb|KJB66946.1|  hypothetical protein B456_010G167400                  87.4    7e-17   Gossypium raimondii
ref|XP_009101540.1|  PREDICTED: F-box protein At5g46170               87.0    8e-17   Brassica rapa
ref|XP_010441616.1|  PREDICTED: F-box protein At5g46170-like          86.7    1e-16   Camelina sativa [gold-of-pleasure]
emb|CDY33458.1|  BnaA06g36150D                                        86.3    1e-16   Brassica napus [oilseed rape]
ref|XP_009397406.1|  PREDICTED: F-box protein At5g46170-like          86.3    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010687117.1|  PREDICTED: F-box protein At4g18380               85.5    4e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010494785.1|  PREDICTED: F-box protein At5g46170-like          84.3    9e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010481487.1|  PREDICTED: F-box protein At5g46170               84.3    9e-16   Camelina sativa [gold-of-pleasure]
ref|XP_002863421.1|  F-box family protein                             84.0    1e-15   
ref|XP_006279647.1|  hypothetical protein CARUB_v10026571mg           84.0    1e-15   Capsella rubella
ref|XP_009398331.1|  PREDICTED: F-box protein At5g46170-like          83.6    2e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006283811.1|  hypothetical protein CARUB_v10004910mg           83.6    2e-15   
emb|CDX99890.1|  BnaC05g23120D                                        82.4    3e-15   
ref|XP_011035442.1|  PREDICTED: F-box protein At5g46170-like          82.4    5e-15   Populus euphratica
ref|XP_006398302.1|  hypothetical protein EUTSA_v10000919mg           82.0    6e-15   Eutrema salsugineum [saltwater cress]
ref|NP_199429.1|  F-box protein                                       81.6    7e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010923814.1|  PREDICTED: F-box protein At5g46170-like          81.3    1e-14   Elaeis guineensis
ref|XP_008794503.1|  PREDICTED: F-box protein At5g46170               80.9    2e-14   Phoenix dactylifera
ref|XP_010517545.1|  PREDICTED: F-box protein At4g18380               80.5    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010434544.1|  PREDICTED: F-box protein At4g18380-like          80.5    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_004163869.1|  PREDICTED: F-box protein At5g46170-like          80.9    2e-14   
ref|XP_009115183.1|  PREDICTED: F-box protein At1g30200               80.1    2e-14   Brassica rapa
ref|XP_004134599.1|  PREDICTED: F-box protein At5g46170-like          80.5    2e-14   Cucumis sativus [cucumbers]
ref|XP_008439618.1|  PREDICTED: F-box protein At5g46170-like          80.5    3e-14   Cucumis melo [Oriental melon]
ref|XP_009408533.1|  PREDICTED: F-box protein At5g46170               80.1    3e-14   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX77641.1|  BnaC07g18950D                                        79.3    4e-14   
ref|XP_010940976.1|  PREDICTED: F-box protein At5g46170-like          79.7    4e-14   Elaeis guineensis
ref|XP_002305042.1|  hypothetical protein POPTR_0004s06450g           79.0    8e-14   
ref|XP_002870048.1|  F-box family protein                             78.2    1e-13   Arabidopsis lyrata subsp. lyrata
ref|XP_010518863.1|  PREDICTED: F-box protein At5g46170-like          75.5    1e-13   Tarenaya hassleriana [spider flower]
ref|NP_193573.1|  F-box protein                                       77.4    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002992968.1|  hypothetical protein SELMODRAFT_136272           77.0    3e-13   
ref|XP_010439863.1|  PREDICTED: F-box protein At4g18380-like          77.0    4e-13   Camelina sativa [gold-of-pleasure]
ref|XP_006836365.1|  hypothetical protein AMTR_s00092p00114580        76.6    4e-13   Amborella trichopoda
ref|XP_004961549.1|  PREDICTED: F-box protein At5g46170-like          77.0    4e-13   Setaria italica
ref|XP_009407719.1|  PREDICTED: F-box protein At5g46170-like          76.3    7e-13   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX87738.1|  BnaC02g32110D                                        75.5    1e-12   
ref|XP_009388498.1|  PREDICTED: F-box protein At5g46170-like          75.5    1e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW82429.1|  F-box domain containing protein                       75.5    1e-12   
ref|XP_010538256.1|  PREDICTED: F-box protein At1g30200-like          74.7    2e-12   Tarenaya hassleriana [spider flower]
gb|ADE76154.1|  unknown                                               73.9    2e-12   Picea sitchensis
ref|XP_009131656.1|  PREDICTED: F-box protein At4g18380               73.6    5e-12   Brassica rapa
ref|XP_001770045.1|  predicted protein                                73.2    6e-12   
ref|XP_010052048.1|  PREDICTED: F-box protein At5g46170               72.8    9e-12   Eucalyptus grandis [rose gum]
emb|CDX99469.1|  BnaC01g10830D                                        70.9    9e-12   
emb|CDX78847.1|  BnaA01g09140D                                        70.9    1e-11   
ref|XP_002440052.1|  hypothetical protein SORBIDRAFT_09g025120        72.4    1e-11   
ref|XP_009399020.1|  PREDICTED: F-box protein At5g46170-like          72.4    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009381298.1|  PREDICTED: F-box protein At5g46170-like          72.0    2e-11   
ref|NP_001151246.1|  F-box domain containing protein                  71.6    2e-11   
ref|XP_010549497.1|  PREDICTED: F-box protein At1g30200               71.2    3e-11   Tarenaya hassleriana [spider flower]
dbj|BAK06381.1|  predicted protein                                    70.5    5e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003569912.1|  PREDICTED: F-box protein At4g18380-like          70.5    6e-11   Brachypodium distachyon [annual false brome]
ref|XP_008649848.1|  PREDICTED: F-box protein At5g46170-like          70.1    8e-11   Zea mays [maize]
ref|XP_002969001.1|  hypothetical protein SELMODRAFT_90428            68.9    2e-10   
ref|XP_009128847.1|  PREDICTED: F-box protein At5g46170-like          68.6    2e-10   Brassica rapa
ref|XP_006654629.1|  PREDICTED: F-box protein At5g46170-like          68.6    3e-10   
tpg|DAA41006.1|  TPA: hypothetical protein ZEAMMB73_999134            68.9    3e-10   
ref|XP_001761459.1|  predicted protein                                67.8    4e-10   
gb|EAY98656.1|  hypothetical protein OsI_20579                        68.2    4e-10   Oryza sativa Indica Group [Indian rice]
ref|NP_001056009.1|  Os05g0510400                                     68.2    4e-10   
ref|XP_006836201.1|  hypothetical protein AMTR_s00101p00078790        67.4    5e-10   Amborella trichopoda
ref|XP_003568140.1|  PREDICTED: F-box protein At5g46170-like          65.1    5e-09   Brachypodium distachyon [annual false brome]
emb|CDY43956.1|  BnaA02g24340D                                        64.3    6e-09   Brassica napus [oilseed rape]
ref|XP_009381361.1|  PREDICTED: F-box protein At4g18380-like          63.5    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393903.1|  PREDICTED: F-box protein At4g18380-like          63.5    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK24885.1|  unknown                                               63.5    1e-08   Picea sitchensis
ref|XP_008777014.1|  PREDICTED: F-box protein At4g18380-like          63.2    1e-08   Phoenix dactylifera
ref|XP_010907825.1|  PREDICTED: F-box protein At4g18380-like          63.2    2e-08   Elaeis guineensis
ref|XP_008804990.1|  PREDICTED: F-box protein At4g18380-like isof...  62.4    2e-08   Phoenix dactylifera
ref|XP_008804989.1|  PREDICTED: F-box protein At4g18380-like isof...  62.8    3e-08   Phoenix dactylifera
ref|NP_001151107.1|  F-box domain containing protein                  62.4    3e-08   Zea mays [maize]
ref|XP_009410458.1|  PREDICTED: F-box protein At5g46170-like          62.0    3e-08   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC75147.1|  hypothetical protein OsI_11347                        61.2    7e-08   Oryza sativa Indica Group [Indian rice]
ref|NP_001049959.1|  Os03g0321300                                     61.2    7e-08   
gb|EEE58967.1|  hypothetical protein OsJ_10655                        61.2    7e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006651329.1|  PREDICTED: F-box protein At5g46170-like          60.8    9e-08   
ref|XP_011043565.1|  PREDICTED: F-box protein At1g22220-like          59.7    2e-07   Populus euphratica
ref|XP_002307387.1|  F-box family protein                             59.7    2e-07   
ref|XP_008784858.1|  PREDICTED: F-box protein At5g46170-like          59.7    2e-07   Phoenix dactylifera
gb|EEC71551.1|  hypothetical protein OsI_03898                        59.7    2e-07   Oryza sativa Indica Group [Indian rice]
ref|NP_001044377.1|  Os01g0770400                                     59.7    2e-07   
gb|AFW88518.1|  hypothetical protein ZEAMMB73_307153                  59.7    2e-07   
ref|XP_009404692.1|  PREDICTED: F-box protein At4g18380-like          59.7    3e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008792446.1|  PREDICTED: F-box protein At4g18380-like          59.3    3e-07   Phoenix dactylifera
gb|AAT69637.1|  unknown protein, contains f-box domain                59.3    3e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006654574.1|  PREDICTED: F-box protein At4g18380-like          59.3    3e-07   Oryza brachyantha
ref|XP_002467943.1|  hypothetical protein SORBIDRAFT_01g036900        59.3    3e-07   Sorghum bicolor [broomcorn]
ref|XP_010922958.1|  PREDICTED: F-box protein At4g18380-like          59.3    3e-07   Elaeis guineensis
ref|XP_010052049.1|  PREDICTED: F-box protein At5g46170-like          59.3    4e-07   Eucalyptus grandis [rose gum]
ref|XP_008676229.1|  PREDICTED: F-box protein At5g46170-like          58.5    4e-07   Zea mays [maize]
ref|NP_001055899.2|  Os05g0490300                                     59.3    4e-07   
ref|XP_004984553.1|  PREDICTED: F-box protein At5g46170-like          58.5    5e-07   Setaria italica
ref|XP_010907539.1|  PREDICTED: F-box protein At4g18380-like          58.5    5e-07   Elaeis guineensis
ref|XP_002458563.1|  hypothetical protein SORBIDRAFT_03g035810        58.5    6e-07   Sorghum bicolor [broomcorn]
ref|XP_008786757.1|  PREDICTED: F-box protein At4g18380-like          58.2    8e-07   Phoenix dactylifera
ref|XP_004970106.1|  PREDICTED: F-box protein At5g46170-like          58.2    9e-07   Setaria italica
ref|NP_001132514.1|  uncharacterized protein LOC100193974             57.4    1e-06   
ref|XP_010904742.1|  PREDICTED: F-box protein At4g18380-like          57.4    1e-06   Elaeis guineensis
ref|XP_002455973.1|  hypothetical protein SORBIDRAFT_03g028320        57.4    1e-06   Sorghum bicolor [broomcorn]
gb|ACG40631.1|  F-box domain containing protein                       57.4    1e-06   Zea mays [maize]
dbj|BAJ95685.1|  predicted protein                                    57.4    1e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001146920.1|  F-box domain containing protein                  57.4    2e-06   
ref|XP_009420961.1|  PREDICTED: F-box protein At4g18380-like          57.0    2e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008672792.1|  PREDICTED: F-box domain containing protein i...  57.0    2e-06   
gb|KDP41362.1|  hypothetical protein JCGZ_15769                       56.6    2e-06   Jatropha curcas
ref|XP_006415502.1|  hypothetical protein EUTSA_v10007915mg           56.6    2e-06   Eutrema salsugineum [saltwater cress]
gb|ACG24953.1|  F-box domain containing protein                       56.6    3e-06   Zea mays [maize]
ref|XP_004150662.1|  PREDICTED: F-box protein At1g78100-like          56.6    3e-06   
ref|XP_004173053.1|  PREDICTED: F-box protein At1g78100-like          56.6    3e-06   
ref|XP_006854457.1|  hypothetical protein AMTR_s00039p00227540        56.2    4e-06   Amborella trichopoda
ref|XP_006307474.1|  hypothetical protein CARUB_v10009099mg           56.2    4e-06   
ref|XP_002456519.1|  hypothetical protein SORBIDRAFT_03g037710        55.8    5e-06   Sorghum bicolor [broomcorn]
ref|XP_002890858.1|  F-box family protein                             55.8    5e-06   
ref|XP_006434013.1|  hypothetical protein CICLE_v10001889mg           55.5    6e-06   Citrus clementina [clementine]
ref|XP_010478400.1|  PREDICTED: F-box protein At1g30200-like          55.5    7e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010460807.1|  PREDICTED: F-box protein At1g30200               55.1    7e-06   Camelina sativa [gold-of-pleasure]
gb|KDO80923.1|  hypothetical protein CISIN_1g041814mg                 55.1    7e-06   Citrus sinensis [apfelsine]
ref|XP_010499543.1|  PREDICTED: F-box protein At1g30200-like isof...  55.1    8e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010277597.1|  PREDICTED: F-box protein At4g18380-like          55.1    9e-06   Nelumbo nucifera [Indian lotus]
gb|KJB64313.1|  hypothetical protein B456_010G042500                  54.7    1e-05   Gossypium raimondii
ref|XP_009406821.1|  PREDICTED: F-box protein At5g46170-like          54.7    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003568215.1|  PREDICTED: F-box protein At5g46170-like          54.7    1e-05   Brachypodium distachyon [annual false brome]
ref|XP_002279458.1|  PREDICTED: F-box protein At5g46170-like          54.3    1e-05   Vitis vinifera
ref|XP_004961674.1|  PREDICTED: F-box protein At4g18380-like          54.7    1e-05   Setaria italica
gb|ACR36872.1|  unknown                                               54.3    1e-05   Zea mays [maize]
ref|XP_008654796.1|  PREDICTED: uncharacterized protein LOC100279...  54.3    1e-05   Zea mays [maize]
ref|XP_002313372.1|  hypothetical protein POPTR_0009s05230g           54.3    1e-05   Populus trichocarpa [western balsam poplar]
gb|ACG36557.1|  F-box domain containing protein                       54.3    1e-05   Zea mays [maize]
ref|NP_001130615.1|  uncharacterized LOC100191714                     54.3    1e-05   Zea mays [maize]
gb|ACG44263.1|  F-box domain containing protein                       54.3    2e-05   Zea mays [maize]
ref|XP_002441291.1|  hypothetical protein SORBIDRAFT_09g023970        54.3    2e-05   Sorghum bicolor [broomcorn]
ref|XP_007015207.1|  F-box family protein, putative                   54.3    2e-05   
ref|XP_008445343.1|  PREDICTED: F-box protein At1g22220               53.9    2e-05   Cucumis melo [Oriental melon]
ref|NP_001145883.1|  uncharacterized protein LOC100279399             53.5    3e-05   Zea mays [maize]
ref|XP_007227716.1|  hypothetical protein PRUPE_ppa009011mg           53.5    3e-05   
ref|XP_003558028.1|  PREDICTED: F-box protein At5g46170-like          53.5    3e-05   Brachypodium distachyon [annual false brome]
ref|XP_011016269.1|  PREDICTED: F-box protein At1g22220               53.1    4e-05   Populus euphratica
ref|XP_006386402.1|  hypothetical protein POPTR_0002s09520g           53.1    4e-05   Populus trichocarpa [western balsam poplar]
ref|NP_564350.1|  F-box protein                                       53.1    4e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002284195.1|  PREDICTED: F-box protein At1g22220               52.8    6e-05   Vitis vinifera
ref|XP_003564454.1|  PREDICTED: F-box protein At5g46170-like          52.4    7e-05   Brachypodium distachyon [annual false brome]
gb|AES87540.2|  F-box plant-like protein, putative                    50.4    7e-05   Medicago truncatula
ref|XP_007018808.1|  F-box family protein, putative                   52.4    7e-05   
ref|XP_004970320.1|  PREDICTED: F-box protein At1g30200-like          52.4    8e-05   Setaria italica
ref|XP_008219667.1|  PREDICTED: F-box protein At1g22220               52.0    9e-05   Prunus mume [ume]
ref|XP_008374968.1|  PREDICTED: F-box protein At1g22220-like          52.0    9e-05   
ref|NP_001182880.1|  hypothetical protein                             52.0    1e-04   Zea mays [maize]
ref|XP_009369664.1|  PREDICTED: F-box protein At1g22220               52.0    1e-04   Pyrus x bretschneideri [bai li]
ref|XP_002513900.1|  conserved hypothetical protein                   51.6    1e-04   Ricinus communis
dbj|BAB90386.1|  P0432B10.4                                           51.6    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009786216.1|  PREDICTED: F-box protein At1g78100               51.6    1e-04   Nicotiana sylvestris
ref|XP_009600740.1|  PREDICTED: F-box protein At1g78100               51.2    1e-04   Nicotiana tomentosiformis
ref|XP_010105899.1|  F-box protein                                    51.2    2e-04   Morus notabilis
ref|XP_004237895.1|  PREDICTED: F-box protein At1g78100               51.2    2e-04   Solanum lycopersicum
ref|XP_006353995.1|  PREDICTED: F-box protein At1g78100-like isof...  51.2    2e-04   Solanum tuberosum [potatoes]
ref|XP_010270680.1|  PREDICTED: F-box protein At4g18380-like          51.2    2e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010269221.1|  PREDICTED: F-box protein At1g22220-like          51.2    2e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010246617.1|  PREDICTED: F-box protein At4g18380-like          51.2    2e-04   
dbj|BAJ85411.1|  predicted protein                                    51.2    2e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003605343.1|  F-box protein                                    50.1    3e-04   
ref|NP_001044594.1|  Os01g0812200                                     50.4    3e-04   
ref|XP_011032098.1|  PREDICTED: F-box protein At4g18380-like          50.4    3e-04   Populus euphratica
gb|EAY76237.1|  hypothetical protein OsI_04173                        50.4    3e-04   Oryza sativa Indica Group [Indian rice]
dbj|BAJ87191.1|  predicted protein                                    50.1    4e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDM84680.1|  unnamed protein product                              50.1    5e-04   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006470730.1|  PREDICTED: F-box protein At4g18380-like          49.3    8e-04   Citrus sinensis [apfelsine]
ref|XP_010535602.1|  PREDICTED: F-box protein At1g78100-like          49.3    8e-04   Tarenaya hassleriana [spider flower]
gb|EMT09581.1|  hypothetical protein F775_20146                       49.3    8e-04   



>ref|XP_011096601.1| PREDICTED: F-box protein At4g18380-like [Sesamum indicum]
Length=392

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            MGS+R DL  R++PEP+DHFDRLPDS+ILL+FN IGDVKALGRCCVVS+RFHSLVPQVDN
Sbjct  1    MGSIRADLGSRIHPEPIDHFDRLPDSVILLIFNKIGDVKALGRCCVVSRRFHSLVPQVDN  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISAS  597
            V+VRVDCVISDED S+ SSS+AAA+AASDKSRHPISS+ R++F+GL KP QSLSQ IS S
Sbjct  61   VIVRVDCVISDEDPSATSSSSAAASAASDKSRHPISSLFRILFSGLFKPLQSLSQLISPS  120

Query  598  PRRV  609
             RR+
Sbjct  121  SRRI  124



>ref|XP_009774076.1| PREDICTED: F-box protein At4g18380-like [Nicotiana sylvestris]
Length=392

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 94/126 (75%), Gaps = 1/126 (1%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLv-pqvd  414
            M S+R DL  R+YPEPVDHFDR+PDS++LLVFN IGDVKALGRCC+VSKRF+SLV     
Sbjct  1    MESIRSDLRGRIYPEPVDHFDRIPDSVLLLVFNNIGDVKALGRCCLVSKRFNSLVPLVDS  60

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISA  594
             +V     +  D+  S  +S+A  +A  SDKSRHPISS+ RLVF+GLLKPFQS+SQFIS 
Sbjct  61   VIVRVDCVISDDDSSSPSTSNAVTSAVTSDKSRHPISSLFRLVFSGLLKPFQSISQFISV  120

Query  595  SPRRVA  612
            S R   
Sbjct  121  SSRHAG  126



>ref|XP_009607720.1| PREDICTED: F-box protein At4g18380-like [Nicotiana tomentosiformis]
Length=392

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 93/126 (74%), Gaps = 1/126 (1%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLv-pqvd  414
            M S R DL  R+YPEPVDHFDR+PDS++LLVFN IGDVKALGRCC+VSKRF+SLV     
Sbjct  1    MESFRSDLRGRIYPEPVDHFDRIPDSVLLLVFNNIGDVKALGRCCLVSKRFNSLVPLVDS  60

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISA  594
             +V     +  D+  S  +S+A  +A  SDKSRHPISS+ RLVF+GLLKPFQS+SQFIS 
Sbjct  61   VIVRVDCVISDDDSSSPSASNAVTSAVTSDKSRHPISSLFRLVFSGLLKPFQSISQFISV  120

Query  595  SPRRVA  612
            S R   
Sbjct  121  SSRHAG  126



>ref|XP_009758227.1| PREDICTED: F-box protein At4g18380-like [Nicotiana sylvestris]
Length=396

 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 107/127 (84%), Gaps = 2/127 (2%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            MGS + DL   +YPEPVDHFDRLPDS++LLVFN IGDVKALGRCCVVS+RFHSLVPQVDN
Sbjct  1    MGSSKSDLRSTIYPEPVDHFDRLPDSILLLVFNKIGDVKALGRCCVVSRRFHSLVPQVDN  60

Query  418  vvvrvdcvisdED--GsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIS  591
            V+VRVDCVISDED   SS  +++AA A +++KSRHPISS+LR +F GL+KP QSL+Q IS
Sbjct  61   VIVRVDCVISDEDGGSSSSGATSAAGAGSTNKSRHPISSLLRFLFLGLVKPIQSLTQLIS  120

Query  592  ASPRRVA  612
             S RR A
Sbjct  121  ISSRRSA  127



>gb|EYU33385.1| hypothetical protein MIMGU_mgv1a008110mg [Erythranthe guttata]
Length=384

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            MGS+R DL  +++PEP+DHFDRLPDSLILL+FN IGDVKALGRCCVVSKRFHSLVPQVDN
Sbjct  1    MGSIRADLGRKIHPEPIDHFDRLPDSLILLIFNQIGDVKALGRCCVVSKRFHSLVPQVDN  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISAS  597
            V+VRVDCVISD+D S+ SSS++A +AASDK RHPISS+ R VF+GL KP QSLSQ I  S
Sbjct  61   VIVRVDCVISDDDPSATSSSSSATSAASDKLRHPISSLFRFVFSGLFKPLQSLSQLIVPS  120

Query  598  PRRV  609
             RR+
Sbjct  121  TRRL  124



>ref|XP_009625759.1| PREDICTED: F-box protein At5g46170-like [Nicotiana tomentosiformis]
Length=385

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 106/127 (83%), Gaps = 2/127 (2%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            MGS + DL   +YPEPVDHFDRLPDS++LLVFN IGDVKALGRCCVVS+RFHSLVPQVDN
Sbjct  1    MGSSKSDLRSTIYPEPVDHFDRLPDSILLLVFNKIGDVKALGRCCVVSRRFHSLVPQVDN  60

Query  418  vvvrvdcvisdED--GsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIS  591
            V+VRVDCVISDED   SS  +++AA A ++ KSRHPISS+LR +F GL+KP QSL+Q IS
Sbjct  61   VIVRVDCVISDEDGGSSSSGATSAAGAGSTSKSRHPISSLLRFLFLGLVKPIQSLTQLIS  120

Query  592  ASPRRVA  612
             S RR A
Sbjct  121  ISSRRSA  127



>gb|EPS70457.1| hypothetical protein M569_04296 [Genlisea aurea]
Length=381

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            MGS+RPDL  R++P+ +DH DRLPDSLILL+FN IGDVKALGRCCVVS+RFHSLVPQVD+
Sbjct  1    MGSIRPDLGGRLHPDAIDHLDRLPDSLILLIFNKIGDVKALGRCCVVSRRFHSLVPQVDH  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISAS  597
            V+VRVDCVISD++ S+ SSS+A++A+A+ KSRHPISS+ R+ F+G+ KP QSLSQ I+ S
Sbjct  61   VIVRVDCVISDDEPSATSSSSASSASAAHKSRHPISSLFRIFFSGIFKPLQSLSQIIAPS  120

Query  598  PRRVA  612
             RR++
Sbjct  121  HRRLS  125



>ref|XP_006352970.1| PREDICTED: F-box protein At5g46170-like [Solanum tuberosum]
Length=367

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 99/114 (87%), Gaps = 3/114 (3%)
 Frame = +1

Query  271  VYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisd  450
            +YPEP+DHFDRLPDS++L +FN IGDVKALGRC VVS+RF+SLVP+VDNV+VRVDCVISD
Sbjct  2    IYPEPIDHFDRLPDSILLFIFNKIGDVKALGRCSVVSRRFNSLVPEVDNVLVRVDCVISD  61

Query  451  EDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISASPRRVA  612
            +     SS +++   +SDKSRHPISS+ RLVF+GLLKPFQS++QFIS SPRR A
Sbjct  62   D---ESSSPSSSTGYSSDKSRHPISSLFRLVFSGLLKPFQSITQFISISPRRAA  112



>gb|EYU43254.1| hypothetical protein MIMGU_mgv1a008300mg [Erythranthe guttata]
Length=378

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 107/124 (86%), Gaps = 4/124 (3%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            MGS+R DL  R++PEP+DHFD LPDS+ILL+FN IGDVKALGRCCVVS+RFHSLVPQVD+
Sbjct  1    MGSIRADLGSRIHPEPIDHFDHLPDSVILLIFNKIGDVKALGRCCVVSRRFHSLVPQVDD  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISAS  597
            V+VRVDCVISD     PS++++A++AASDK RHPISS+LR +F+GL KP QSL+Q I+ S
Sbjct  61   VIVRVDCVISD---DDPSAASSASSAASDKFRHPISSLLR-IFSGLFKPLQSLTQLITPS  116

Query  598  PRRV  609
             RR+
Sbjct  117  ARRL  120



>ref|XP_011085237.1| PREDICTED: F-box protein At4g18380-like [Sesamum indicum]
Length=388

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 108/124 (87%), Gaps = 2/124 (2%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            MGS+R DL CR++PE +DHFDRLPDSLILL+FN IGDVKALGRCCVVS+RFHSLVPQVD+
Sbjct  1    MGSIRVDLGCRIHPETIDHFDRLPDSLILLIFNKIGDVKALGRCCVVSRRFHSLVPQVDD  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISAS  597
            V+VRVDCVISD+   S  +S+++A+AASDKSR+PISS+ R+ F+G+ +P QSL+Q I+ S
Sbjct  61   VIVRVDCVISDD--DSSGTSSSSASAASDKSRYPISSLFRIFFSGIFRPLQSLTQLITPS  118

Query  598  PRRV  609
             RR+
Sbjct  119  SRRL  122



>ref|XP_004244968.1| PREDICTED: F-box protein At5g46170-like [Solanum lycopersicum]
Length=384

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            MGS + DL   +YPEPVDHF++LPD ++LL+FN IGDVK LGRCC V +RFHSLVPQVDN
Sbjct  1    MGSSKSDLRSTIYPEPVDHFNQLPDPVLLLIFNKIGDVKTLGRCCGVCRRFHSLVPQVDN  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISAS  597
            VVVRVDCVISD+D +S SSS+++AAA+SDKSRHPISS+ RLVF GL+KPFQSL+Q IS S
Sbjct  61   VVVRVDCVISDDDDASSSSSSSSAAASSDKSRHPISSLFRLVFLGLVKPFQSLTQLISIS  120

Query  598  PRR  606
             RR
Sbjct  121  SRR  123



>ref|XP_006355407.1| PREDICTED: F-box protein At5g46170-like [Solanum tuberosum]
Length=389

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 99/125 (79%), Gaps = 2/125 (2%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            MGS + DL   +YPEPVDHFD+LPD ++LL+FN IGDVK LGRCC V  RFHSLVPQVDN
Sbjct  1    MGSSKSDLRSTIYPEPVDHFDQLPDPVLLLIFNKIGDVKTLGRCCGVCSRFHSLVPQVDN  60

Query  418  vvvrv--dcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIS  591
            VVVRV       D+  SS SSS++++AA+SDKSRHPISS+ RLVF GL+KPFQSL+Q IS
Sbjct  61   VVVRVDCVISDDDDASSSSSSSSSSSAASSDKSRHPISSLFRLVFLGLVKPFQSLTQLIS  120

Query  592  ASPRR  606
             S RR
Sbjct  121  ISSRR  125



>ref|XP_004233124.1| PREDICTED: F-box protein At5g46170-like [Solanum lycopersicum]
Length=369

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 104/114 (91%), Gaps = 1/114 (1%)
 Frame = +1

Query  271  VYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisd  450
            +YPEP+DHFDRLPDS++L +FN IGDVKALGRC VVS+RF+SLVP+VDNV+VRVDCVISD
Sbjct  2    IYPEPMDHFDRLPDSILLFIFNKIGDVKALGRCSVVSRRFNSLVPEVDNVLVRVDCVISD  61

Query  451  EDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISASPRRVA  612
            ++ SSP SS++++  +SDKSRHPISS+ RLVF+GLLKPFQS++QFIS SPRR A
Sbjct  62   DE-SSPPSSSSSSGYSSDKSRHPISSLFRLVFSGLLKPFQSITQFISISPRRAA  114



>ref|XP_003546077.1| PREDICTED: F-box protein At5g46170-like [Glycine max]
Length=385

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 95/124 (77%), Gaps = 10/124 (8%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEP-VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvd  414
            M S R DL CR++PEP +DHFDRLPDSL+LLVFN IGDVKALGRCCVVS+RFHSLVPQV+
Sbjct  1    MSSQRADLECRIFPEPEIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVE  60

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISA  594
            NVVVRV       D       +++++AASDKSR P  ++LRLVF G++KP Q+L QF+  
Sbjct  61   NVVVRV-------DCVISDDDSSSSSAASDKSRGPFWNLLRLVFGGIVKPIQTLGQFL--  111

Query  595  SPRR  606
             P+R
Sbjct  112  GPKR  115



>ref|XP_003542943.1| PREDICTED: F-box protein At5g46170-like isoform X1 [Glycine max]
 ref|XP_006594509.1| PREDICTED: F-box protein At5g46170-like isoform X2 [Glycine max]
Length=387

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 96/127 (76%), Gaps = 13/127 (10%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEP----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvp  405
            M S R DL+CR++PEP    +DHFDRLPDSL+LLVFN IGDVKALGRCCVVS+RFHSLVP
Sbjct  1    MSSQRADLACRIFPEPDASEIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLVP  60

Query  406  qvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQF  585
            QV+NVVVRV       D       ++++AAASDKSR P  ++LRLVF G++KP Q+L QF
Sbjct  61   QVENVVVRV-------DCVISDDDSSSSAAASDKSRGPFWNLLRLVFGGIVKPIQTLGQF  113

Query  586  ISASPRR  606
            +   P+R
Sbjct  114  L--GPKR  118



>ref|XP_010247412.1| PREDICTED: F-box protein At5g46170 [Nelumbo nucifera]
Length=398

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 96/125 (77%), Gaps = 14/125 (11%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEP-------VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHS  396
            M S RPDL+ +++PEP       +DHFDRLPDSL+L+VFN IGDVKALGRCCVVS+RFH 
Sbjct  1    MASHRPDLNGKIWPEPSTAEVAEIDHFDRLPDSLLLIVFNKIGDVKALGRCCVVSRRFHG  60

Query  397  LvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSL  576
            LVPQVDNVVVRVDCVISD+D        ++  AASDK+R   S+++RLVF G++KP Q+L
Sbjct  61   LVPQVDNVVVRVDCVISDDDA-------SSGTAASDKTRGVFSNLVRLVFGGIVKPLQAL  113

Query  577  SQFIS  591
             QF+ 
Sbjct  114  GQFLG  118



>ref|XP_007147928.1| hypothetical protein PHAVU_006G166500g [Phaseolus vulgaris]
 gb|ESW19922.1| hypothetical protein PHAVU_006G166500g [Phaseolus vulgaris]
Length=379

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 96/127 (76%), Gaps = 13/127 (10%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEP----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvp  405
            M S R DL+CR++PEP    +DHFDRLPDSL+LLVFN IGDVKALGRCCVVS+RFHSLVP
Sbjct  1    MSSQRADLACRIFPEPDAYQIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLVP  60

Query  406  qvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQF  585
            QV+NVVVRV       D       +++++A+SDKSR P  ++LRLVF G++KP Q+L QF
Sbjct  61   QVENVVVRV-------DCVISDDDSSSSSASSDKSRGPFWNLLRLVFGGIVKPIQTLGQF  113

Query  586  ISASPRR  606
            +   P+R
Sbjct  114  L--GPKR  118



>emb|CAN73778.1| hypothetical protein VITISV_042179 [Vitis vinifera]
Length=399

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 93/136 (68%), Gaps = 22/136 (16%)
 Frame = +1

Query  244  SVRPDLSCRVYPEP-------------VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSK  384
            S+RPD S R++PEP             +DHFDRLPDSL+LLVFN IGDVKALGRCCVVS+
Sbjct  4    SMRPDPSTRIWPEPQNSPPPVMMMAEAIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSR  63

Query  385  RFHSLvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKP  564
            RFH+LVPQV+NVVVRV       D       +++AA + +KSR P S + RLVF G++KP
Sbjct  64   RFHTLVPQVENVVVRV-------DCVISDDESSSAAGSLEKSRGPFSHLFRLVFGGIVKP  116

Query  565  FQSLSQFISASPRRVA  612
             Q+L QF+   P+R A
Sbjct  117  LQALGQFL--GPKRSA  130



>ref|XP_002278480.1| PREDICTED: F-box protein At5g46170 [Vitis vinifera]
Length=399

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 93/136 (68%), Gaps = 22/136 (16%)
 Frame = +1

Query  244  SVRPDLSCRVYPEP-------------VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSK  384
            S+RPD S R++PEP             +DHFDRLPDSL+LLVFN IGDVKALGRCCVVS+
Sbjct  4    SMRPDPSTRIWPEPQNSPPPVMMMAEAIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSR  63

Query  385  RFHSLvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKP  564
            RFH+LVPQV+NVVVRV       D       +++AA + +KSR P S + RLVF G++KP
Sbjct  64   RFHTLVPQVENVVVRV-------DCVISDDESSSAAGSLEKSRGPFSHLFRLVFGGIVKP  116

Query  565  FQSLSQFISASPRRVA  612
             Q+L QF+   P+R A
Sbjct  117  LQALGQFL--GPKRSA  130



>ref|XP_006468035.1| PREDICTED: F-box protein At5g46170-like isoform X1 [Citrus sinensis]
 ref|XP_006468036.1| PREDICTED: F-box protein At5g46170-like isoform X2 [Citrus sinensis]
 gb|KDO75441.1| hypothetical protein CISIN_1g014846mg [Citrus sinensis]
 gb|KDO75442.1| hypothetical protein CISIN_1g014846mg [Citrus sinensis]
 gb|KDO75443.1| hypothetical protein CISIN_1g014846mg [Citrus sinensis]
Length=417

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 94/118 (80%), Gaps = 9/118 (8%)
 Frame = +1

Query  241  GSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnv  420
            G VR D   RV+PEP+DHFDRLPDS++LLVFN IGDVKALGRCCVVS+RFHSLVPQVDNV
Sbjct  3    GVVRVDPPSRVFPEPIDHFDRLPDSVLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVDNV  62

Query  421  vvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISA  594
            VVRVDCVISD+          +++++S+KSR P S++ R VF G++KPFQ+L Q + A
Sbjct  63   VVRVDCVISDD---------DSSSSSSEKSRSPFSNLFRYVFGGIVKPFQALGQLLGA  111



>ref|XP_006449020.1| hypothetical protein CICLE_v10015378mg [Citrus clementina]
 ref|XP_006449021.1| hypothetical protein CICLE_v10015378mg [Citrus clementina]
 gb|ESR62260.1| hypothetical protein CICLE_v10015378mg [Citrus clementina]
 gb|ESR62261.1| hypothetical protein CICLE_v10015378mg [Citrus clementina]
Length=418

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 94/118 (80%), Gaps = 9/118 (8%)
 Frame = +1

Query  241  GSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnv  420
            G VR D   RV+PEP+DHFDRLPDS++LLVFN IGDVKALGRCCVVS+RFHSLVPQVDNV
Sbjct  3    GVVRVDPPSRVFPEPIDHFDRLPDSVLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVDNV  62

Query  421  vvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISA  594
            VVRVDCVISD+          +++++S+KSR P S++ R VF G++KPFQ+L Q + A
Sbjct  63   VVRVDCVISDD---------DSSSSSSEKSRSPFSNLFRYVFGGIVKPFQALGQLLGA  111



>emb|CBI30928.3| unnamed protein product [Vitis vinifera]
Length=398

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 89/130 (68%), Gaps = 20/130 (15%)
 Frame = +1

Query  244  SVRPDLSCRVYPEP-------------VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSK  384
            S+RPD S R++PEP             +DHFDRLPDSL+LLVFN IGDVKALGRCCVVS+
Sbjct  36   SMRPDPSTRIWPEPQNSPPPVMMMAEAIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSR  95

Query  385  RFHSLvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKP  564
            RFH+LVPQV+NVVVRV       D       +++AA + +KSR P S + RLVF G++KP
Sbjct  96   RFHTLVPQVENVVVRV-------DCVISDDESSSAAGSLEKSRGPFSHLFRLVFGGIVKP  148

Query  565  FQSLSQFISA  594
             Q+L QF+  
Sbjct  149  LQALGQFLDG  158



>gb|KHG20859.1| hypothetical protein F383_03969 [Gossypium arboreum]
Length=391

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 83/118 (70%), Gaps = 7/118 (6%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            M SV  D     +PEP+DHFDRLPDSL+LLVFNMIGDVKALGRCCVVS+RFHSLVPQV+N
Sbjct  1    MSSVYSDPIHGTHPEPIDHFDRLPDSLLLLVFNMIGDVKALGRCCVVSRRFHSLVPQVEN  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIS  591
            VVVRV       D        + +++   ++  P S++ RLVF G++KP Q+L QF+ 
Sbjct  61   VVVRV-------DCVISDDDCSPSSSVKSRADGPFSTLFRLVFGGIVKPLQALGQFLG  111



>gb|KJB57216.1| hypothetical protein B456_009G154000 [Gossypium raimondii]
 gb|KJB57217.1| hypothetical protein B456_009G154000 [Gossypium raimondii]
Length=391

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 83/118 (70%), Gaps = 7/118 (6%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            M SV  D     +PEP+DHFDRLPDSL+LLVFNMIGDVKALGRCCVVS+RFH+LVPQV+N
Sbjct  1    MSSVYSDPIHGTHPEPIDHFDRLPDSLLLLVFNMIGDVKALGRCCVVSRRFHALVPQVEN  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIS  591
            VVVRV       D        + +++   ++  P S++ RLVF G++KP Q+L QF+ 
Sbjct  61   VVVRV-------DCVISDDDCSPSSSVKSRAAGPFSTLFRLVFGGIVKPLQALGQFLG  111



>gb|KJB57218.1| hypothetical protein B456_009G154000 [Gossypium raimondii]
Length=369

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 83/118 (70%), Gaps = 7/118 (6%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            M SV  D     +PEP+DHFDRLPDSL+LLVFNMIGDVKALGRCCVVS+RFH+LVPQV+N
Sbjct  1    MSSVYSDPIHGTHPEPIDHFDRLPDSLLLLVFNMIGDVKALGRCCVVSRRFHALVPQVEN  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIS  591
            VVVRV       D        + +++   ++  P S++ RLVF G++KP Q+L QF+ 
Sbjct  61   VVVRV-------DCVISDDDCSPSSSVKSRAAGPFSTLFRLVFGGIVKPLQALGQFLG  111



>ref|XP_010086997.1| hypothetical protein L484_005892 [Morus notabilis]
 gb|EXB25437.1| hypothetical protein L484_005892 [Morus notabilis]
Length=410

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 95/127 (75%), Gaps = 13/127 (10%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEP----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvp  405
            M S+R DL+ RVYPEP    +DHFDRLPDSL+LLVFN IGDVKALGRCCVVS+RFH+LVP
Sbjct  1    MSSMRVDLTSRVYPEPDAMEIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHALVP  60

Query  406  qvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQF  585
            QV+NVVVRV       D       +A+++++SDKSR   S++ RLV  G++KP Q+L QF
Sbjct  61   QVENVVVRV-------DCVISDDDSASSSSSSDKSRGSFSNLFRLVVGGIVKPLQALGQF  113

Query  586  ISASPRR  606
            +  +P+R
Sbjct  114  L--TPKR  118



>ref|XP_007025034.1| F-box family protein [Theobroma cacao]
 gb|EOY27656.1| F-box family protein [Theobroma cacao]
Length=397

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 96/123 (78%), Gaps = 7/123 (6%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            M SVR D   R++PEP+DH DRLPDSL+LLVFN IGDVKALGRCCVVS+RFHSLVPQV+N
Sbjct  1    MSSVRSDPIHRIHPEPIDHVDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVEN  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISAS  597
            VVVRVDCVISD+       S++++++   ++  P S++ RLVF G++KP Q+L QF+   
Sbjct  61   VVVRVDCVISDD-----DCSSSSSSSDKSRATGPFSNLFRLVFGGIVKPLQALGQFL--G  113

Query  598  PRR  606
            P+R
Sbjct  114  PKR  116



>gb|KHG27594.1| hypothetical protein F383_11279 [Gossypium arboreum]
Length=411

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 91/125 (73%), Gaps = 11/125 (9%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            M S+R D   R++PEP+DHFDRLPDSL+ LVFN IGDVKALGRCCVVS+RF SLVPQV+N
Sbjct  1    MSSLRSDPVYRIHPEPIDHFDRLPDSLLPLVFNKIGDVKALGRCCVVSRRFRSLVPQVEN  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRH--PISSILRLVFTGLLKPFQSLSQFIS  591
            VVVRV       D        + ++++ DKSR   PIS++LR++  G++KPFQ+L QF+ 
Sbjct  61   VVVRV-------DCVISDDDCSPSSSSYDKSRAAGPISNLLRILLGGIVKPFQALVQFL-  112

Query  592  ASPRR  606
              P+R
Sbjct  113  -GPKR  116



>emb|CDP21114.1| unnamed protein product [Coffea canephora]
Length=420

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            MGS+R DLS +++PEPVDHFDRLPDSL+LLVFN IGDVKALGRCC+VS+RFH+L
Sbjct  1    MGSIRADLSTKIFPEPVDHFDRLPDSLLLLVFNKIGDVKALGRCCLVSRRFHTL  54



>ref|XP_011460217.1| PREDICTED: F-box protein At5g46170 [Fragaria vesca subsp. vesca]
Length=402

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 100/127 (79%), Gaps = 10/127 (8%)
 Frame = +1

Query  244  SVRPDLSC------RVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvp  405
            S  PDL+       RVYPEP DHFDRLPDSL+LLVFN I DVKALGRCCVVS+RFHSLVP
Sbjct  14   SFYPDLTSSSSSSSRVYPEPSDHFDRLPDSLLLLVFNKIADVKALGRCCVVSRRFHSLVP  73

Query  406  qvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQF  585
            QVD V+VRVDCVISD+   S SSS++++ ++SDKSR P SS++RLV  G++KP Q+L QF
Sbjct  74   QVDTVLVRVDCVISDD--DSTSSSSSSSPSSSDKSRAPFSSLVRLVLGGIVKPLQALGQF  131

Query  586  ISASPRR  606
            +   PRR
Sbjct  132  L--GPRR  136



>gb|KJB69848.1| hypothetical protein B456_011G045900 [Gossypium raimondii]
 gb|KJB69849.1| hypothetical protein B456_011G045900 [Gossypium raimondii]
Length=399

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 90/125 (72%), Gaps = 11/125 (9%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            M S+R D   R++PEP+DHFDRLPDSL+ LVFN IGDVKALGRCCVVS+RF SLVPQV+N
Sbjct  1    MSSLRSDPVHRIHPEPIDHFDRLPDSLLPLVFNKIGDVKALGRCCVVSRRFRSLVPQVEN  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRH--PISSILRLVFTGLLKPFQSLSQFIS  591
            VVVRV       D        + ++++ DKSR   PIS++LR++  G+ KPFQ+L QF+ 
Sbjct  61   VVVRV-------DCVISDDDCSPSSSSYDKSRAAGPISNLLRILLGGIAKPFQALVQFL-  112

Query  592  ASPRR  606
              P+R
Sbjct  113  -GPKR  116



>ref|XP_008444512.1| PREDICTED: F-box protein At5g46170-like [Cucumis melo]
 ref|XP_008444520.1| PREDICTED: F-box protein At5g46170-like [Cucumis melo]
Length=406

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 90/137 (66%), Gaps = 24/137 (18%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEP-----------------VDHFDRLPDSLILLVFNMIGDVKALGR  366
            M S+R DL+ ++YPEP                 +DHFDRLPDSL+LL+FN IGDVKALGR
Sbjct  1    MSSLRLDLTSKIYPEPDSLFSFNSASISTTSCCIDHFDRLPDSLLLLIFNKIGDVKALGR  60

Query  367  CCVVSKRFHSLvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVF  546
            CCVVS+RFH LVPQV+NVVVRV       D       +++++++S KSR P  +I R VF
Sbjct  61   CCVVSRRFHCLVPQVENVVVRV-------DCVISDDESSSSSSSSGKSRGPFFNIFRFVF  113

Query  547  TGLLKPFQSLSQFISAS  597
             G++KP Q+L QF+  +
Sbjct  114  GGIVKPLQALGQFLGQT  130



>ref|XP_004137366.1| PREDICTED: F-box protein At5g46170-like [Cucumis sativus]
 ref|XP_004167064.1| PREDICTED: F-box protein At5g46170-like [Cucumis sativus]
 gb|KGN63909.1| hypothetical protein Csa_1G025900 [Cucumis sativus]
Length=406

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 90/137 (66%), Gaps = 24/137 (18%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEP-----------------VDHFDRLPDSLILLVFNMIGDVKALGR  366
            M S+R DL+ ++YPEP                 +DHFDRLPDSL+LL+FN IGDVKALGR
Sbjct  1    MSSLRLDLTSKIYPEPDSLFSFNSSSISSTSCCIDHFDRLPDSLLLLIFNKIGDVKALGR  60

Query  367  CCVVSKRFHSLvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVF  546
            CCVVS+RFH LVPQV+NVVVRV       D       +++++++S KSR P  +I R VF
Sbjct  61   CCVVSRRFHCLVPQVENVVVRV-------DCVISDDESSSSSSSSGKSRGPFFNIFRFVF  113

Query  547  TGLLKPFQSLSQFISAS  597
             G++KP Q+L QF+  +
Sbjct  114  GGIVKPLQALGQFLGQT  130



>ref|XP_009360916.1| PREDICTED: F-box protein At5g46170-like [Pyrus x bretschneideri]
 ref|XP_009360917.1| PREDICTED: F-box protein At5g46170-like [Pyrus x bretschneideri]
Length=436

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 10/129 (8%)
 Frame = +1

Query  238  MGSVRPDL--SCRVYPEPV-----DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHS  396
            M SVR DL  S RVYPEP      DHFDRLPDSL+LLVFN IGDVKALGRCCVVS+RFHS
Sbjct  34   MSSVRSDLTFSSRVYPEPYSSVDDDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHS  93

Query  397  LvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSL  576
            LVPQVDNVVVRVDCVISD+     S S+A+++++SDKSR P S++ RLV  G++KP Q+L
Sbjct  94   LVPQVDNVVVRVDCVISDD---DSSPSSASSSSSSDKSRAPFSALFRLVLGGIVKPLQAL  150

Query  577  SQFISASPR  603
             QF+  + R
Sbjct  151  GQFLGPNRR  159



>ref|XP_010518768.1| PREDICTED: F-box protein At5g46170 [Tarenaya hassleriana]
Length=385

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 94/120 (78%), Gaps = 6/120 (5%)
 Frame = +1

Query  247  VRPDLSCRVYPEP----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvd  414
            +RPD   R++PEP    +DHFDRLPDS+ LLVFN IGDVKALGRCCVVSKRFHSLVPQVD
Sbjct  5    LRPDPPSRIHPEPQTLDIDHFDRLPDSIFLLVFNKIGDVKALGRCCVVSKRFHSLVPQVD  64

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISA  594
            NVVVRVDCVISD+D SSPSS    +AAA   S  P S+I RLVF G++KP Q+L QF+  
Sbjct  65   NVVVRVDCVISDDDSSSPSSDKPRSAAAV--SAGPFSAIFRLVFGGIVKPLQALGQFLGT  122



>ref|XP_003593894.1| F-box family protein [Medicago truncatula]
 gb|AES64145.1| F-box plant-like protein [Medicago truncatula]
Length=389

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 90/129 (70%), Gaps = 15/129 (12%)
 Frame = +1

Query  238  MGSVRPDLS-CRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            M S+R D    R+YPEP     +DHFDR+PDSL+LLVFN IGDVKALGRCCVVS+RFHSL
Sbjct  1    MCSIRADQQPNRIYPEPSYFPQIDHFDRIPDSLLLLVFNKIGDVKALGRCCVVSRRFHSL  60

Query  400  vpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLS  579
            VPQV+NVVVRV       D       + ++  +SDKSR P  ++LRLVF G+ KP Q+L 
Sbjct  61   VPQVENVVVRV-------DCVISDDDSNSSVNSSDKSRGPFWNLLRLVFGGIAKPIQTLG  113

Query  580  QFISASPRR  606
            QF+   P+R
Sbjct  114  QFL--GPKR  120



>ref|XP_010538543.1| PREDICTED: F-box protein At5g46170-like [Tarenaya hassleriana]
Length=378

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 93/120 (78%), Gaps = 6/120 (5%)
 Frame = +1

Query  247  VRPDLSCRVYPEP----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvd  414
            +R D   R+YPEP    +DHFDRLPD+++LLVFN IGDVKALGRCCVVSKRFHSLVPQVD
Sbjct  5    LRSDPPSRIYPEPETLEIDHFDRLPDAILLLVFNKIGDVKALGRCCVVSKRFHSLVPQVD  64

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISA  594
            NVVVRVDCVISD+D SSPSS    +  A   +  P+S+I RLVF G++KP Q+L QF+  
Sbjct  65   NVVVRVDCVISDDDSSSPSSDKRRSVTAV--AAGPVSAIFRLVFGGIVKPIQALGQFLGT  122



>gb|KJB68311.1| hypothetical protein B456_010G238100 [Gossypium raimondii]
Length=378

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 95/123 (77%), Gaps = 9/123 (7%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            M SV PD   R  PEPVDHFDRLPDS++LLVFN IGDVKALGRCCVVS+RFHSLVPQV+N
Sbjct  1    MSSVYPD---RDQPEPVDHFDRLPDSVLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVEN  57

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISAS  597
            VVVRVDCVISD+D SS SSS+  + A       P S++ RLVF G++KP Q+L QF+   
Sbjct  58   VVVRVDCVISDDDCSSSSSSSDKSRALVG----PFSNLFRLVFGGIVKPLQALGQFL--G  111

Query  598  PRR  606
            P+R
Sbjct  112  PKR  114



>ref|XP_002519646.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42619.1| conserved hypothetical protein [Ricinus communis]
Length=414

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 91/131 (69%), Gaps = 9/131 (7%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLv  402
            M S R D + R+YPEP     +DHFDRLPDSL+LLVFN IGDVKALGRCCVVS+RFHSLV
Sbjct  1    MTSFRSDPASRIYPEPQSLSAIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLV  60

Query  403  pqvdnvvv----rvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQ  570
            PQVDNVVV     +    +    SS  S ++ ++++S  S    SSI RLVF G++KPFQ
Sbjct  61   PQVDNVVVRVDCVISDDDTSPSSSSDKSRSSGSSSSSSSSSAGFSSIFRLVFGGIVKPFQ  120

Query  571  SLSQFISASPR  603
            +L QF+  + R
Sbjct  121  ALGQFLGPTRR  131



>ref|XP_007212265.1| hypothetical protein PRUPE_ppa006658mg [Prunus persica]
 gb|EMJ13464.1| hypothetical protein PRUPE_ppa006658mg [Prunus persica]
Length=401

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 100/127 (79%), Gaps = 8/127 (6%)
 Frame = +1

Query  238  MGSVRPDL-SCRVYPEPV----DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLv  402
            M S+R DL S RVYPEP     D FDRLPDSL+LLVFN IGDVKALGRCCVVS+RFHSLV
Sbjct  1    MSSLRSDLTSSRVYPEPSYMDDDLFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLV  60

Query  403  pqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQ  582
            PQV+NVVVRVDCVISD+     S S+A+++++SDKSR P S++ RLV  G++KP Q+L Q
Sbjct  61   PQVENVVVRVDCVISDD---ESSPSSASSSSSSDKSRTPFSALFRLVIGGIVKPLQALGQ  117

Query  583  FISASPR  603
            F+  + R
Sbjct  118  FLGPTRR  124



>gb|AEX97082.1| F-box family protein [Malus domestica]
Length=403

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 99/129 (77%), Gaps = 10/129 (8%)
 Frame = +1

Query  238  MGSVRPDL--SCRVYPEPV-----DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHS  396
            M SVR DL  S  VYPEP      DHFDRLPDSL+LLVFN IGDVKALGRCCVVS+RFHS
Sbjct  1    MSSVRSDLTFSSTVYPEPYSSVDDDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHS  60

Query  397  LvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSL  576
            LVPQVDNVVVRVDCVISD+     S S+A+++++SDKSR P S++ RLV  G++KP Q+L
Sbjct  61   LVPQVDNVVVRVDCVISDD---DSSPSSASSSSSSDKSRAPFSALFRLVLGGIVKPLQAL  117

Query  577  SQFISASPR  603
             Q +  + R
Sbjct  118  GQLLGPNRR  126



>gb|KHN06964.1| F-box protein [Glycine soja]
Length=166

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEP-VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            M S R DL+CR++PEP +DHFDRLPDSL+LLVFN IGDVKALGRCCVVS  FHSL
Sbjct  1    MSSQRADLACRIFPEPEIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSCHFHSL  55



>ref|XP_008371620.1| PREDICTED: F-box protein At5g46170-like [Malus domestica]
Length=403

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 99/129 (77%), Gaps = 10/129 (8%)
 Frame = +1

Query  238  MGSVRPDL--SCRVYPEPV-----DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHS  396
            M SVR DL  S  VYPEP      DHFDRLPDSL+LLVFN IGDVKALGRCCVVS+RFHS
Sbjct  1    MSSVRSDLTFSSTVYPEPYSSVDDDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHS  60

Query  397  LvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSL  576
            LVPQVDNVVVRVDCVISD+     S S+A+++++SDKSR P S++ RLV  G++KP Q+L
Sbjct  61   LVPQVDNVVVRVDCVISDD---DSSPSSASSSSSSDKSRAPFSALFRLVLGGIVKPLQAL  117

Query  577  SQFISASPR  603
             Q +  + R
Sbjct  118  GQLLGPNRR  126



>ref|XP_004486009.1| PREDICTED: F-box protein At5g46170-like [Cicer arietinum]
Length=402

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 92/132 (70%), Gaps = 18/132 (14%)
 Frame = +1

Query  238  MGSVRPDLSC-----RVYPEP----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRF  390
            M S+R D S      R+YPEP    +DHFDR+PDSL+LLVFN I DVKALGRCCVVS+RF
Sbjct  1    MCSLRSDQSLLSPTNRIYPEPYFPQIDHFDRIPDSLLLLVFNKIADVKALGRCCVVSRRF  60

Query  391  HSLvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQ  570
            HSLVPQV+NV+VRV       D       ++++ A+SDKSR P  ++LRLVF G+ KP Q
Sbjct  61   HSLVPQVENVLVRV-------DCVISDEDSSSSTASSDKSRGPFWNLLRLVFGGIAKPIQ  113

Query  571  SLSQFISASPRR  606
            +L QF+   P+R
Sbjct  114  TLGQFL--GPKR  123



>ref|XP_008225507.1| PREDICTED: F-box protein At5g46170-like [Prunus mume]
Length=402

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 100/128 (78%), Gaps = 9/128 (7%)
 Frame = +1

Query  238  MGSVRPDL--SCRVYPEPV----DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            M S+R DL  S RVYPEP     D FDRLPDSL+LLVFN IGDVKALGRCCVVS+RFHSL
Sbjct  1    MSSLRSDLTTSSRVYPEPSYMDDDLFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSL  60

Query  400  vpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLS  579
            VPQV+NVVVRVDCVISD+     S S+A+++++SDKSR P S++ RLV  G++KP Q+L 
Sbjct  61   VPQVENVVVRVDCVISDD---ESSPSSASSSSSSDKSRTPFSALFRLVLGGIVKPLQALG  117

Query  580  QFISASPR  603
            QF+  + R
Sbjct  118  QFLGPTRR  125



>gb|KHG06780.1| hypothetical protein F383_00742 [Gossypium arboreum]
Length=378

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 94/123 (76%), Gaps = 9/123 (7%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            M SV PD      PEPVDHFDRLPDS++LLVFN IGDVKALGRCCVVS+RFHSLVPQV+N
Sbjct  1    MSSVYPDPD---QPEPVDHFDRLPDSVLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVEN  57

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISAS  597
            VVVRVDCVISD+D SS SSS+  + A       P S++ RLVF G++KP Q+L QF+   
Sbjct  58   VVVRVDCVISDDDCSSSSSSSDKSRALVG----PFSNLFRLVFGGIVKPLQALGQFL--G  111

Query  598  PRR  606
            P+R
Sbjct  112  PKR  114



>gb|KDP37998.1| hypothetical protein JCGZ_04641 [Jatropha curcas]
Length=429

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 94/127 (74%), Gaps = 9/127 (7%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEP----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvp  405
            M S R D + R+YPEP    +DHFDRLPDSL+LLVFN IGDVKALGRCCVVS+RFHSLVP
Sbjct  1    MTSFRSDPTSRIYPEPESLSIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLVP  60

Query  406  qvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQF  585
            QVDNVVVRVDCVISD      S S+++  + S  S    SS+ RLVF G++KPFQ+L Q 
Sbjct  61   QVDNVVVRVDCVISD---DDSSPSSSSEKSRSSGSSSGFSSLFRLVFGGIVKPFQALGQL  117

Query  586  ISASPRR  606
            +   PRR
Sbjct  118  L--GPRR  122



>gb|KHG16115.1| hypothetical protein F383_22310 [Gossypium arboreum]
Length=432

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 94/123 (76%), Gaps = 7/123 (6%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            M  VR D   R +P P+DHFDRLPDSL+LL+FN IGDVKALGRCC+VS+RFHSLVPQV+N
Sbjct  1    MCPVRSDPIHRFHPLPLDHFDRLPDSLLLLIFNKIGDVKALGRCCLVSRRFHSLVPQVEN  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISAS  597
            V+VRVDCVISD+D S  SSS+  +  A      P S++LRLVF G++KP Q+L QF+   
Sbjct  61   VLVRVDCVISDDDSSPSSSSSDKSCPAG-----PFSNLLRLVFGGIVKPLQALGQFL--G  113

Query  598  PRR  606
            P+R
Sbjct  114  PKR  116



>ref|XP_008371786.1| PREDICTED: F-box protein At5g46170-like [Malus domestica]
Length=402

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 100/129 (78%), Gaps = 11/129 (9%)
 Frame = +1

Query  238  MGSVRPDL--SCRVYPEPV-----DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHS  396
            M S+R DL  S RVYPEP      D FD +PDSL+LLVFN IGDVKALGRCCVVS+RFHS
Sbjct  1    MSSLRSDLTFSSRVYPEPYSSVDDDLFDLIPDSLLLLVFNKIGDVKALGRCCVVSRRFHS  60

Query  397  LvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSL  576
            LVPQV+NVVVRVDCVISD+     SS +A+++++SDKSR P S++ RLV +G++KP Q+L
Sbjct  61   LVPQVENVVVRVDCVISDD----DSSPSASSSSSSDKSRTPFSALFRLVLSGIVKPLQAL  116

Query  577  SQFISASPR  603
             QF+  + R
Sbjct  117  GQFLGPNRR  125



>ref|XP_011007418.1| PREDICTED: F-box protein At5g46170-like [Populus euphratica]
Length=405

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 93/127 (73%), Gaps = 13/127 (10%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEP----------VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKR  387
            M S+RPD + R++PEP          +DHFDRLPDSL+LLVFN IGDVKALGRCCVV  R
Sbjct  1    MSSLRPDPTSRIHPEPEPTTTTSSLSIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVCHR  60

Query  388  FHSLvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPF  567
            FHSLVPQVDNVVVRVDCVISD+     SSS+++  + S  S    SSI RLVF G++KPF
Sbjct  61   FHSLVPQVDNVVVRVDCVISDD---DTSSSSSSTKSHSPSSSSGFSSIFRLVFGGIVKPF  117

Query  568  QSLSQFI  588
            Q+L Q +
Sbjct  118  QALGQLL  124



>ref|XP_006414111.1| hypothetical protein EUTSA_v10025383mg [Eutrema salsugineum]
 gb|ESQ55564.1| hypothetical protein EUTSA_v10025383mg [Eutrema salsugineum]
Length=397

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 81/122 (66%), Gaps = 13/122 (11%)
 Frame = +1

Query  247  VRPDLSCRVYPEP----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvd  414
            +R D   R++PEP    +DHFD LPDS++LLVFN IGDVKALGRCCVVSKRFHSLVPQV+
Sbjct  5    LRSDPLSRIHPEPQTLEIDHFDHLPDSILLLVFNKIGDVKALGRCCVVSKRFHSLVPQVE  64

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKS--RHPISSILRLVFTGLLKPFQSLSQFI  588
            NVVVRV       D       +++ +    +S    P S+I RLVF G+ KP Q+L Q +
Sbjct  65   NVVVRV-------DCVISDDDSSSLSPDKPRSAVSGPFSAIFRLVFGGIFKPLQALGQLL  117

Query  589  SA  594
             +
Sbjct  118  GS  119



>ref|XP_002317281.1| F-box family protein [Populus trichocarpa]
 gb|EEE97893.1| F-box family protein [Populus trichocarpa]
Length=405

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 92/127 (72%), Gaps = 13/127 (10%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEP----------VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKR  387
            M S+RPD + R++PEP          +DHFDRLPDSL+LLVFN IGDVKALGRCCVV  R
Sbjct  1    MSSLRPDPTSRIHPEPEPTTTTSSPSIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVCLR  60

Query  388  FHSLvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPF  567
            FHSLVPQVDNVVVRVDCVISD+     SSS+++  + S  S    SSI RLVF G++KPF
Sbjct  61   FHSLVPQVDNVVVRVDCVISDD---DTSSSSSSTKSHSPSSSSGFSSIFRLVFGGIVKPF  117

Query  568  QSLSQFI  588
            Q L Q +
Sbjct  118  QVLGQLL  124



>gb|KJB66946.1| hypothetical protein B456_010G167400 [Gossypium raimondii]
 gb|KJB66947.1| hypothetical protein B456_010G167400 [Gossypium raimondii]
Length=392

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 92/123 (75%), Gaps = 7/123 (6%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            M  VR D   R +  P+DHFDRLPDSL+LL+FN IGDVKALGRCC+VS+RFHSLVPQVDN
Sbjct  1    MCPVRSDPIHRFHSLPLDHFDRLPDSLLLLIFNKIGDVKALGRCCLVSRRFHSLVPQVDN  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISAS  597
            V+VRVDCVISD+      SS +++++   +   P S++LRLVF  ++KP Q+L QF+   
Sbjct  61   VLVRVDCVISDD-----DSSPSSSSSDKSRPAGPFSNLLRLVFGCIVKPLQALGQFL--G  113

Query  598  PRR  606
            P+R
Sbjct  114  PKR  116



>ref|XP_009101540.1| PREDICTED: F-box protein At5g46170 [Brassica rapa]
Length=374

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 84/118 (71%), Gaps = 7/118 (6%)
 Frame = +1

Query  247  VRPDLSCRVYPEP--VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnv  420
             R D   R++PEP  +DHFD LPDS++LLVFN I DVK+LGRCCVVS+RFHSLV QV+NV
Sbjct  2    ARSDPPSRIHPEPQRIDHFDHLPDSILLLVFNKISDVKSLGRCCVVSRRFHSLVTQVENV  61

Query  421  vvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISA  594
            ++RVDCVI     S   +S+ ++  +   +  P S++ RLV  G++KP Q+L QF+ A
Sbjct  62   LIRVDCVI-----SDDDNSSLSSIKSRSAASGPFSNLFRLVVGGIVKPLQALGQFLGA  114



>ref|XP_010441616.1| PREDICTED: F-box protein At5g46170-like [Camelina sativa]
Length=389

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 86/120 (72%), Gaps = 9/120 (8%)
 Frame = +1

Query  250  RPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvd  414
            R D   R++PEP     +DHFDRLPDS++LLVFN IGDVKALGRCCVVS+RFHSLVPQVD
Sbjct  7    RSDPPSRIHPEPPQTLEIDHFDRLPDSILLLVFNKIGDVKALGRCCVVSRRFHSLVPQVD  66

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISA  594
            NVVVRVDCVIS       SSS  +  + S  S    S+I RLVF G++KP Q+L QF+  
Sbjct  67   NVVVRVDCVIS----DDDSSSLLSIKSRSAASSGSFSAIFRLVFGGIVKPLQALGQFLGT  122



>emb|CDY33458.1| BnaA06g36150D [Brassica napus]
Length=360

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 83/118 (70%), Gaps = 7/118 (6%)
 Frame = +1

Query  247  VRPDLSCRVYPEP--VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnv  420
             R D   R++PEP   DHFD LPDS++LLVFN I DVK+LGRCCVVS+RFHSLV QV+NV
Sbjct  2    ARSDPPSRIHPEPRQTDHFDHLPDSILLLVFNKISDVKSLGRCCVVSRRFHSLVTQVENV  61

Query  421  vvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISA  594
            ++RVDCVI     S   +S+ ++  +   +  P S++ RLV  G++KP Q+L QF+ A
Sbjct  62   LIRVDCVI-----SDDDNSSLSSIKSRSAASAPFSNLFRLVVGGIVKPLQALGQFLGA  114



>ref|XP_009397406.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=408

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 69/106 (65%), Gaps = 3/106 (3%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDG  459
            E +DHFDRLPDS++L++FN IGDVK LGRCC VS+RFH+L   V    V V       DG
Sbjct  32   EGIDHFDRLPDSVLLVIFNRIGDVKVLGRCCGVSRRFHAL--AVLVDDVVVRVDCVISDG  89

Query  460  sspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISAS  597
               SS  AA  A SDK R   S + RLV  GL+KP Q+LSQ +SAS
Sbjct  90   -PSSSPGAAGGAVSDKPRGVFSHLARLVLGGLVKPLQALSQILSAS  134



>ref|XP_010687117.1| PREDICTED: F-box protein At4g18380 [Beta vulgaris subsp. vulgaris]
 ref|XP_010687118.1| PREDICTED: F-box protein At4g18380 [Beta vulgaris subsp. vulgaris]
Length=408

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 92/144 (64%), Gaps = 30/144 (21%)
 Frame = +1

Query  238  MGSVRPDLS--CRVYPEP-------------------VDHFDRLPDSLILLVFNMIGDVK  354
            M S R DL+   R+YPEP                   VDHFDRLPDS++LLVFN IGDVK
Sbjct  1    MSSFRADLTTTARIYPEPFLDYSSSSSSNNNNSVIDGVDHFDRLPDSVLLLVFNKIGDVK  60

Query  355  ALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSIL  534
            ALGRCCVVS+RF +LVPQV+NVVVRV       D       +++AA+++DKSR P ++++
Sbjct  61   ALGRCCVVSRRFQTLVPQVENVVVRV-------DCVISDDDSSSAASSADKSRSPFANLV  113

Query  535  RLVFTGLLKPFQSLSQFISASPRR  606
            RL+F  + KP Q+L  F+   P+R
Sbjct  114  RLIFGNIFKPLQALGHFL--GPKR  135



>ref|XP_010494785.1| PREDICTED: F-box protein At5g46170-like [Camelina sativa]
Length=389

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 86/120 (72%), Gaps = 9/120 (8%)
 Frame = +1

Query  250  RPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvd  414
            R D   R++PEP     +DHFDRLPDS++LLVFN IGDVKALGRCCVVS+RFHSLVPQVD
Sbjct  7    RSDPPSRIHPEPPQTLEIDHFDRLPDSILLLVFNKIGDVKALGRCCVVSRRFHSLVPQVD  66

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISA  594
            NVVVRVDCVIS       SSS ++  + S  S    S+I RLV  G++KP Q+L QF+  
Sbjct  67   NVVVRVDCVIS----DDDSSSLSSIKSRSAASSGSFSAIFRLVVGGIVKPLQALGQFLGT  122



>ref|XP_010481487.1| PREDICTED: F-box protein At5g46170 [Camelina sativa]
Length=388

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 87/122 (71%), Gaps = 9/122 (7%)
 Frame = +1

Query  244  SVRPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpq  408
            S R D   R++PEP     +DHFDRLPDS++LLVFN IGDVKALGRCCVVS+RFHSLVPQ
Sbjct  5    SHRSDPPSRIHPEPPQTLEIDHFDRLPDSILLLVFNKIGDVKALGRCCVVSRRFHSLVPQ  64

Query  409  vdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFI  588
            VDNVVVRVDCVIS       SSS ++  + S  S    S+I RLV  G++KP Q+L QF+
Sbjct  65   VDNVVVRVDCVIS----DDDSSSLSSIKSRSAASSGSFSAIFRLVVGGIVKPLQALGQFL  120

Query  589  SA  594
              
Sbjct  121  GT  122



>ref|XP_002863421.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39680.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
Length=392

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 86/120 (72%), Gaps = 9/120 (8%)
 Frame = +1

Query  250  RPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvd  414
            R D   R++PEP     +DHFDRLPDS++LLVFN IGDVKALGRCCVVS+RFHSLVPQVD
Sbjct  7    RSDPPSRIHPEPPQTLEIDHFDRLPDSILLLVFNKIGDVKALGRCCVVSRRFHSLVPQVD  66

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISA  594
            NVVVRVDCVIS       SSS ++  + S  S    S+I RLV  G++KP Q+L QF+  
Sbjct  67   NVVVRVDCVIS----DDDSSSLSSIKSRSGSSAGSFSAIFRLVVGGIVKPLQALGQFLGT  122



>ref|XP_006279647.1| hypothetical protein CARUB_v10026571mg [Capsella rubella]
 gb|EOA12545.1| hypothetical protein CARUB_v10026571mg [Capsella rubella]
Length=388

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 86/120 (72%), Gaps = 9/120 (8%)
 Frame = +1

Query  250  RPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvd  414
            R D   R++PEP     +DHFDRLPDS++LLVFN IGDVKALGRCCVVS+RFHSLVPQVD
Sbjct  7    RSDPPSRIHPEPPQTLEIDHFDRLPDSILLLVFNKIGDVKALGRCCVVSRRFHSLVPQVD  66

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISA  594
            NVVVRVDCVIS       SSS ++  + S  S    S+I RLV  G++KP Q+L QF+  
Sbjct  67   NVVVRVDCVIS----DDDSSSLSSIKSRSAASAGSFSAIFRLVVGGIVKPLQALGQFLGT  122



>ref|XP_009398331.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009398332.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=399

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 77/118 (65%), Gaps = 2/118 (2%)
 Frame = +1

Query  238  MGSVRPDLSCRVYP-EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvd  414
            M  +RPD    V   E +DHFDRLPDS++L++FN++GDVKALGRCCVVS+RFH+L  ++ 
Sbjct  1    MDGLRPDHWDPVEEDEGIDHFDRLPDSVLLVIFNLVGDVKALGRCCVVSRRFHAL-VRLV  59

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFI  588
            + VV     +  +D S    + A  AAASDK R   S + R+V  GL+KP  +L Q +
Sbjct  60   DEVVVRVDCVISDDPSLSRVAEAGGAAASDKPRGVFSHLARIVLGGLVKPLVALGQIL  117



>ref|XP_006283811.1| hypothetical protein CARUB_v10004910mg, partial [Capsella rubella]
 gb|EOA16709.1| hypothetical protein CARUB_v10004910mg, partial [Capsella rubella]
Length=418

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 85/113 (75%), Gaps = 12/113 (11%)
 Frame = +1

Query  268  RVYPEP------VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvr  429
            R++PEP      +DHFD LPDS++LL+FN IGDVK+LGRCCVVSKRFHSL+PQV+NVVVR
Sbjct  34   RIHPEPEPLKQQIDHFDHLPDSILLLIFNNIGDVKSLGRCCVVSKRFHSLIPQVENVVVR  93

Query  430  vdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFI  588
            VDCVISD+DGSS  S    + A+   +  P S++ RL    ++KP Q+L QF+
Sbjct  94   VDCVISDDDGSSIVSDKPRSVASVAAT--PFSALYRL----MIKPLQALGQFL  140



>emb|CDX99890.1| BnaC05g23120D [Brassica napus]
Length=367

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 88/125 (70%), Gaps = 9/125 (7%)
 Frame = +1

Query  247  VRPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqv  411
            +R +   R++PEP     +DHFD LPDSL+LL+F+ + DVK LGRCC+VS+RFHSLVP V
Sbjct  5    LRSEPVSRIHPEPQPLDDIDHFDHLPDSLLLLIFDKVADVKDLGRCCIVSRRFHSLVPFV  64

Query  412  dnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIS  591
            +NV+VRVDCVISD+D    S + A+ + A   +    S++ RLVF  + KPFQ+L QF+ 
Sbjct  65   ENVLVRVDCVISDDDDRRFSLNTASISDA--SAGGSFSALFRLVFAPIFKPFQALGQFL-  121

Query  592  ASPRR  606
              PRR
Sbjct  122  -GPRR  125



>ref|XP_011035442.1| PREDICTED: F-box protein At5g46170-like [Populus euphratica]
 ref|XP_011035443.1| PREDICTED: F-box protein At5g46170-like [Populus euphratica]
Length=394

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 82/108 (76%), Gaps = 3/108 (3%)
 Frame = +1

Query  262  SCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcv  441
            SC      +DHFDRLPDSL+LLVFN IGDVKALGRCCVVS+RFHSLVPQVDNVVVRVDCV
Sbjct  22   SCFCSSSKIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVDNVVVRVDCV  81

Query  442  isdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQF  585
            ISD+      SS+++  + S  S    SSI RLVF G+ KPFQ+LSQ 
Sbjct  82   ISDD---DTPSSSSSIKSHSSSSSSGFSSIFRLVFGGISKPFQALSQM  126



>ref|XP_006398302.1| hypothetical protein EUTSA_v10000919mg [Eutrema salsugineum]
 gb|ESQ39755.1| hypothetical protein EUTSA_v10000919mg [Eutrema salsugineum]
Length=387

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 86/120 (72%), Gaps = 8/120 (7%)
 Frame = +1

Query  247  VRPDLSCRVYPEP----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvd  414
             R D   R++PEP    +DHFDRLPDS++LLVFN IGDVK+LGRCCVVS+RFHSLVPQV+
Sbjct  5    TRSDPPSRIHPEPQILEIDHFDRLPDSILLLVFNKIGDVKSLGRCCVVSRRFHSLVPQVE  64

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISA  594
            N+VVRVDCVIS       SSS ++  + S  S    S++ RLV  G++KP Q+L QF+  
Sbjct  65   NIVVRVDCVIS----DDDSSSLSSIKSRSAASAGSFSAMFRLVVGGIVKPLQALGQFLGT  120



>ref|NP_199429.1| F-box protein [Arabidopsis thaliana]
 sp|Q9FNK5.1|FB285_ARATH RecName: Full=F-box protein At5g46170 [Arabidopsis thaliana]
 dbj|BAB08262.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL49842.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13195.1| unknown protein [Arabidopsis thaliana]
 gb|AED95349.1| F-box protein [Arabidopsis thaliana]
Length=395

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 85/120 (71%), Gaps = 9/120 (8%)
 Frame = +1

Query  250  RPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvd  414
            R D   R++PEP     +DHFD LPDS++LLVFN IGDVKALGRCCVVS+RFHSLVPQVD
Sbjct  7    RSDPPSRIHPEPPQTLEIDHFDHLPDSILLLVFNKIGDVKALGRCCVVSRRFHSLVPQVD  66

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISA  594
            NVVVRVDCVIS       SSS ++  + S  S    S+I RLV  G++KP Q+L QF+  
Sbjct  67   NVVVRVDCVIS----DDDSSSLSSIKSRSGSSAGSFSAIFRLVVGGIVKPLQALGQFLGT  122



>ref|XP_010923814.1| PREDICTED: F-box protein At5g46170-like [Elaeis guineensis]
Length=401

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 67/101 (66%), Gaps = 1/101 (1%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGss  465
            +DHFDRLPDS++LLVFN IGDVK LGRCCVV +RF +L   V + VV     +  +D + 
Sbjct  38   IDHFDRLPDSVLLLVFNRIGDVKVLGRCCVVCRRFQAL-VPVVDDVVVRVDCVISDDATP  96

Query  466  psssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFI  588
             S++AAA     DK R  +S + RLV  GL+KP Q+L Q +
Sbjct  97   SSAAAAAGGCGPDKGRGVLSHLARLVLDGLVKPLQALGQML  137



>ref|XP_008794503.1| PREDICTED: F-box protein At5g46170 [Phoenix dactylifera]
Length=396

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGss  465
            +DHFDRLPDS++L+VFN IGDVK LGRCCVV +RF +LVP VD+VVVRVDCVISD+   S
Sbjct  39   IDHFDRLPDSVLLVVFNRIGDVKGLGRCCVVCRRFQALVPLVDDVVVRVDCVISDDATPS  98

Query  466  psssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFI  588
              ++AA++    DK R  +S + RLV  GL+KP Q+L Q +
Sbjct  99   SVAAAASSGCGLDKGRGVLSHLARLVLDGLVKPLQALGQML  139



>ref|XP_010517545.1| PREDICTED: F-box protein At4g18380 [Camelina sativa]
Length=391

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 85/113 (75%), Gaps = 9/113 (8%)
 Frame = +1

Query  268  RVYPEP---VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdc  438
            R++PEP   +DHFD LPDS++LL+FN IGDVK+LGRCCVVSKRFHSL+PQV+NVVVRVDC
Sbjct  13   RIHPEPEQQIDHFDHLPDSILLLIFNNIGDVKSLGRCCVVSKRFHSLIPQVENVVVRVDC  72

Query  439  visdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISAS  597
            VISD+D SS  S    + A+   +  P S+I RLV    +KP Q+L QF+  S
Sbjct  73   VISDDDSSSLVSDKPRSVASVAAT--PFSAIFRLV----IKPLQALGQFLKRS  119



>ref|XP_010434544.1| PREDICTED: F-box protein At4g18380-like [Camelina sativa]
Length=393

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 85/113 (75%), Gaps = 9/113 (8%)
 Frame = +1

Query  268  RVYPEP---VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdc  438
            R++PEP   +DHFD LPDS++LL+FN IGDVK+LGRCCVVSKRFHSL+PQV+NVVVRVDC
Sbjct  13   RIHPEPEQQIDHFDHLPDSILLLIFNNIGDVKSLGRCCVVSKRFHSLIPQVENVVVRVDC  72

Query  439  visdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISAS  597
            VISD+D SS  S    + A+   +  P S+I RLV    +KP Q+L QF+  S
Sbjct  73   VISDDDSSSLVSDKPRSVASVAAT--PFSAIFRLV----IKPLQALGQFLKRS  119



>ref|XP_004163869.1| PREDICTED: F-box protein At5g46170-like, partial [Cucumis sativus]
Length=421

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 78/107 (73%), Gaps = 9/107 (8%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGssp  468
            DHFDRLPDSL+LL+FN IGDVKALGRCC VS+RFHS+V QVDNVVVRV       D    
Sbjct  48   DHFDRLPDSLLLLIFNRIGDVKALGRCCAVSRRFHSIVSQVDNVVVRV-------DCVIS  100

Query  469  sssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISASPRRV  609
                ++A+++SDKSR   S++ R+V  G++KP Q+L QF+   P+RV
Sbjct  101  DDDFSSASSSSDKSRSGFSNLFRMVLGGIVKPLQALGQFL--GPKRV  145



>ref|XP_009115183.1| PREDICTED: F-box protein At1g30200 [Brassica rapa]
 emb|CDY26286.1| BnaA09g26370D [Brassica napus]
Length=374

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 78/130 (60%), Gaps = 12/130 (9%)
 Frame = +1

Query  247  VRPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqv  411
            +RPD   R++PEP      DHFD LPDSL+LL+F+ + DVK LGRCC+VS+RFHSLVP V
Sbjct  5    LRPDPVSRIHPEPQPSDDTDHFDHLPDSLLLLIFDKVADVKDLGRCCIVSRRFHSLVPFV  64

Query  412  dnvv-----vrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSL  576
            +NV+     V  D   S         S   A+ +   +    S++ RLVF  + KPFQ+L
Sbjct  65   ENVLVRVDCVISDDDSSASGDDDRRFSLNTASISDASAGGSFSALFRLVFAPIFKPFQAL  124

Query  577  SQFISASPRR  606
             QF+   PRR
Sbjct  125  GQFL--GPRR  132



>ref|XP_004134599.1| PREDICTED: F-box protein At5g46170-like [Cucumis sativus]
 gb|KGN49409.1| hypothetical protein Csa_6G523990 [Cucumis sativus]
Length=407

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 78/107 (73%), Gaps = 9/107 (8%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGssp  468
            DHFDRLPDSL+LL+FN IGDVKALGRCC VS+RFHS+V QVDNVVVRV       D    
Sbjct  34   DHFDRLPDSLLLLIFNRIGDVKALGRCCAVSRRFHSIVSQVDNVVVRV-------DCVIS  86

Query  469  sssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISASPRRV  609
                ++A+++SDKSR   S++ R+V  G++KP Q+L QF+   P+RV
Sbjct  87   DDDFSSASSSSDKSRSGFSNLFRMVLGGIVKPLQALGQFL--GPKRV  131



>ref|XP_008439618.1| PREDICTED: F-box protein At5g46170-like [Cucumis melo]
Length=407

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 78/107 (73%), Gaps = 9/107 (8%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGssp  468
            DHFDRLPDSL+LL+FN IGDVKALGRCC VS+RFHS+V QVDNVVVRV       D    
Sbjct  34   DHFDRLPDSLLLLIFNRIGDVKALGRCCAVSRRFHSIVSQVDNVVVRV-------DCVIS  86

Query  469  sssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISASPRRV  609
                ++A++ASDKSR   S++ R+V  G++KP Q+L QF+   P+RV
Sbjct  87   DDDFSSASSASDKSRSGFSNLFRMVLGGIVKPLQALGQFL--GPKRV  131



>ref|XP_009408533.1| PREDICTED: F-box protein At5g46170 [Musa acuminata subsp. malaccensis]
Length=402

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDG  459
            E +DHFDRLPDS++L+VFN +GD+KALGRCC+VS+RFH+LV  VD++VVRVDCV+SDE  
Sbjct  26   EGIDHFDRLPDSVLLVVFNRVGDIKALGRCCIVSRRFHALVRLVDDIVVRVDCVVSDEPS  85

Query  460  sspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQF  585
              P + A +AAA  DK R     + R+V  GL+KP  +L Q 
Sbjct  86   LFPDTEADSAAAGPDKPRGVFFHLARVVLGGLVKPLHALGQL  127



>emb|CDX77641.1| BnaC07g18950D [Brassica napus]
Length=362

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 79/112 (71%), Gaps = 9/112 (8%)
 Frame = +1

Query  250  RPDLSCRVYPEP----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            R D   R++PEP    +DHFD LPDS++LLVFN I DVK+LGRCCVVS+RFHSLV QV+N
Sbjct  6    RSDPPSRIHPEPQTLGIDHFDHLPDSILLLVFNKISDVKSLGRCCVVSRRFHSLVTQVEN  65

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQS  573
            V++RVDCVI     S   +S+ ++  +   +  P SSI RLV  G++KP Q+
Sbjct  66   VLIRVDCVI-----SDDDNSSLSSIKSRSSASGPFSSIFRLVVGGIVKPLQA  112



>ref|XP_010940976.1| PREDICTED: F-box protein At5g46170-like [Elaeis guineensis]
Length=412

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 68/108 (63%), Gaps = 2/108 (2%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrv--dcvisdE  453
            E +DHFDRLPD+L+L VFN IGDVKALGRCCVV +RFHSLVP VD VVV V         
Sbjct  29   EGIDHFDRLPDALLLDVFNRIGDVKALGRCCVVCRRFHSLVPLVDYVVVHVDCVISDDPG  88

Query  454  DGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISAS  597
              SS +       A  DK R   S + RLVF  L+KP Q+L Q +S +
Sbjct  89   PSSSSAPGCGGGGAGPDKGRGVFSHLARLVFGSLVKPLQALGQILSPA  136



>ref|XP_002305042.1| hypothetical protein POPTR_0004s06450g [Populus trichocarpa]
 ref|XP_006384083.1| F-box family protein [Populus trichocarpa]
 gb|EEE85553.1| hypothetical protein POPTR_0004s06450g [Populus trichocarpa]
 gb|ERP61880.1| F-box family protein [Populus trichocarpa]
Length=398

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 80/108 (74%), Gaps = 4/108 (4%)
 Frame = +1

Query  262  SCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcv  441
            SC      +DHFDRLPDSL+L VFN IGDVKALGRCCVVS+RFHSLVPQVDNVVVRVDCV
Sbjct  24   SCFCSSSKIDHFDRLPDSLLLFVFNKIGDVKALGRCCVVSRRFHSLVPQVDNVVVRVDCV  83

Query  442  isdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQF  585
            IS       +SS++++  +   S    SSI RLVF G+ KPFQ+LSQ 
Sbjct  84   IS----DDDTSSSSSSIKSHSSSSSGFSSIFRLVFGGISKPFQALSQM  127



>ref|XP_002870048.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46307.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
Length=386

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 82/112 (73%), Gaps = 10/112 (9%)
 Frame = +1

Query  259  LSCRVYPEP--VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrv  432
            L  R++P+P  +DHFD LPDS++LL+FN IGDVKALGRC VVSKRFHSL+PQV+NVVVRV
Sbjct  11   LLSRIHPQPQHIDHFDHLPDSILLLIFNNIGDVKALGRCSVVSKRFHSLIPQVENVVVRV  70

Query  433  dcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFI  588
            DCVISD+D SS  S    +      +  P S+I RLVF    KP Q+L QF+
Sbjct  71   DCVISDDDSSSLISDKPRSV----AAATPFSAIFRLVF----KPLQALGQFL  114



>ref|XP_010518863.1| PREDICTED: F-box protein At5g46170-like [Tarenaya hassleriana]
Length=166

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 67/118 (57%), Gaps = 19/118 (16%)
 Frame = +1

Query  247  VRPDLSCRVYPEP--VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnv  420
            +R D   R++ EP  +DHFDRLPDS+++ VFN IG VKALGRC VVSKRFHSLV QVD V
Sbjct  5    LRSDPPSRIHSEPQGIDHFDRLPDSVVIFVFNKIGHVKALGRCRVVSKRFHSLVSQVDYV  64

Query  421  vvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISA  594
            V    C  S                    +  P SSI R V   ++KP Q++ QF+  
Sbjct  65   VWAAHCDCSAA-----------------AAARPFSSIFRRVVGDIVKPLQAVGQFLGT  105



>ref|NP_193573.1| F-box protein [Arabidopsis thaliana]
 ref|NP_001190761.1| F-box protein [Arabidopsis thaliana]
 sp|O49508.1|FB237_ARATH RecName: Full=F-box protein At4g18380 [Arabidopsis thaliana]
 emb|CAA16718.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78840.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABL66803.1| At4g18380 [Arabidopsis thaliana]
 gb|AEE84037.1| F-box protein [Arabidopsis thaliana]
 gb|AEE84038.1| F-box protein [Arabidopsis thaliana]
Length=380

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 2/49 (4%)
 Frame = +1

Query  259  LSCRVYPEP--VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            L  R++PEP  +DHFD LPDS++LL+FN IGDVKALGRC VVSKRFHSL
Sbjct  11   LLSRIHPEPQEIDHFDNLPDSILLLIFNNIGDVKALGRCSVVSKRFHSL  59



>ref|XP_002992968.1| hypothetical protein SELMODRAFT_136272 [Selaginella moellendorffii]
 gb|EFJ05914.1| hypothetical protein SELMODRAFT_136272 [Selaginella moellendorffii]
Length=373

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 73/103 (71%), Gaps = 10/103 (10%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGssp  468
            DHF+RLPDSL+L +FN I ++KALG+CC VSKRF+S+  QVDNVVVRVDCV+S ED    
Sbjct  32   DHFERLPDSLLLTIFNKIAEIKALGKCCAVSKRFNSVASQVDNVVVRVDCVLSGED----  87

Query  469  sssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISAS  597
                     +S  S+  +SS+++LV+  LL+PFQ L Q +S S
Sbjct  88   ------TNCSSKASKGLVSSLVKLVYGSLLRPFQVLQQMLSFS  124



>ref|XP_010439863.1| PREDICTED: F-box protein At4g18380-like [Camelina sativa]
Length=419

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 3/47 (6%)
 Frame = +1

Query  268  RVYPEP---VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            R++PEP   +DHFD LPDS++LL+ N IGDVK+LGRCCVVSKRFHSL
Sbjct  35   RIHPEPKQQIDHFDHLPDSILLLILNNIGDVKSLGRCCVVSKRFHSL  81



>ref|XP_006836365.1| hypothetical protein AMTR_s00092p00114580 [Amborella trichopoda]
 gb|ERM99218.1| hypothetical protein AMTR_s00092p00114580 [Amborella trichopoda]
Length=393

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +DHFDRLPDSL+LLVFN IGDVKALGRCCVVSKRFH+L
Sbjct  55   LDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSKRFHAL  92



>ref|XP_004961549.1| PREDICTED: F-box protein At5g46170-like [Setaria italica]
Length=410

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGssp  468
            DHFDRLPD+L+L++FN IGDVKALGRC +VS+RFH L+P VD+V+VRVDCVI DE  SS 
Sbjct  29   DHFDRLPDALLLVIFNRIGDVKALGRCSIVSRRFHELIPLVDSVLVRVDCVIPDEPPSSS  88

Query  469  sssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISAS  597
            S SA ++  AS ++R   S I R+V  G++KP Q+L Q +S +
Sbjct  89   SPSAPSSPTASVRARGVFSQIARIVLGGIVKPIQALGQILSPA  131



>ref|XP_009407719.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=406

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 81/121 (67%), Gaps = 5/121 (4%)
 Frame = +1

Query  235  DMGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvd  414
            D+   R D       E +DH DRLPDS++L+VFN IGDVKALGRCCVV +RFH LVP VD
Sbjct  12   DLRQWRGDAQEEEDEEGIDHLDRLPDSVLLVVFNRIGDVKALGRCCVVCRRFHDLVPLVD  71

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISA  594
            +V+VRVDCVISD+      S + A  A +D+SR   S + R+V  G++KP Q+L   ++ 
Sbjct  72   SVLVRVDCVISDD-----PSPSPAGGAGADRSRGVFSHLARIVIGGIVKPLQALGHILAP  126

Query  595  S  597
            S
Sbjct  127  S  127



>emb|CDX87738.1| BnaC02g32110D [Brassica napus]
Length=373

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 42/53 (79%), Gaps = 5/53 (9%)
 Frame = +1

Query  256  DLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            D + R++PEP     +DHFDRLPDS++LLV N I DVK+LGRCC VS+RFHSL
Sbjct  8    DPTSRIHPEPQPLEQIDHFDRLPDSILLLVLNRIADVKSLGRCCAVSRRFHSL  60



>ref|XP_009388498.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=404

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 61/104 (59%), Gaps = 8/104 (8%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGss  465
            +D FD+LPDSL+L VFN+IGDVK LGRCCVV++RFH L        V V       DG  
Sbjct  37   IDFFDQLPDSLVLTVFNLIGDVKDLGRCCVVTRRFHDL--VPLVDSVLVRVDCVISDG--  92

Query  466  psssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISAS  597
                 + ++   DK+R   S + R+V  GL+KP Q+L Q +  S
Sbjct  93   ----PSPSSPGGDKARGVFSHLARVVLGGLVKPLQALGQILGPS  132



>gb|AFW82429.1| F-box domain containing protein [Zea mays]
Length=412

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = +1

Query  277  PEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdED  456
            P   DHFDRLPD+L+L++FN IGDVKALGRC +VS RFH LVP VD+V+VRVDCVI DE 
Sbjct  25   PAGDDHFDRLPDALLLVIFNRIGDVKALGRCSLVSLRFHELVPLVDSVLVRVDCVIPDEP  84

Query  457  GsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIS  591
             SS S S   +  AS ++R   S I R+V  G++KP Q+L Q +S
Sbjct  85   PSSSSPSTPFSPTASVRARGVFSQIARIVLGGIVKPIQALGQILS  129



>ref|XP_010538256.1| PREDICTED: F-box protein At1g30200-like [Tarenaya hassleriana]
Length=384

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 76/132 (58%), Gaps = 23/132 (17%)
 Frame = +1

Query  253  PDLSCRVYPE--------PVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpq  408
            PD   R++PE         VDHFDRLPDSLILLV   I DVK LGRCC+VS+RFHSLVP 
Sbjct  7    PDHISRLHPESVQALDSAAVDHFDRLPDSLILLVLEKIADVKVLGRCCLVSRRFHSLVPL  66

Query  409  vdnv------vvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQ  570
             +NV      V+  D   S ED  S +   A    +       +S++ R+VF  + KPFQ
Sbjct  67   AENVLVCVDCVISDDDSSSAEDPGSSAFGDAVVGGS-------LSALFRVVFGPIFKPFQ  119

Query  571  SLSQFISASPRR  606
            +L QF+   P+R
Sbjct  120  ALGQFL--GPKR  129



>gb|ADE76154.1| unknown [Picea sitchensis]
Length=348

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 72/108 (67%), Gaps = 13/108 (12%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGss  465
            +DH DR+PDSL+LL+FN + D+KALGRCC VSKRF+ LVPQV+NVVV+VDCVIS EDG  
Sbjct  4    IDHLDRIPDSLLLLIFNKVADIKALGRCCAVSKRFNFLVPQVENVVVKVDCVISGEDGGL  63

Query  466  psssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISASPRRV  609
             +           K +  I  ++R +   ++KP Q+L  FI   PR+ 
Sbjct  64   NA-----------KGKGIIGHLVRFMIGSIVKPLQALQHFI--GPRKA  98



>ref|XP_009131656.1| PREDICTED: F-box protein At4g18380 [Brassica rapa]
Length=377

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 80/118 (68%), Gaps = 12/118 (10%)
 Frame = +1

Query  250  RPDLSCRVYPEPVD---HFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnv  420
            R D   R++PEP+D    FD LPDS++LLVFN IGDVKALGRC VVSKRFHSLVPQV+NV
Sbjct  6    RSDPLSRIHPEPLDPPDFFDHLPDSILLLVFNRIGDVKALGRCGVVSKRFHSLVPQVENV  65

Query  421  vvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISA  594
            VVRVDCVISD+        ++ +      S  P S+I RL+F    KP  +L+Q +S 
Sbjct  66   VVRVDCVISDD-----DDPSSLSPDKPRSSASPFSAIFRLIF----KPLHALTQLLST  114



>ref|XP_001770045.1| predicted protein [Physcomitrella patens]
 gb|EDQ65221.1| predicted protein [Physcomitrella patens]
Length=348

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 66/101 (65%), Gaps = 11/101 (11%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGss  465
             DHFDRLPDSL+L++FN + D+K LGRCC VSKRFHSL P VDNVVV+VDCVIS E+   
Sbjct  4    TDHFDRLPDSLLLVIFNKVADIKVLGRCCAVSKRFHSLAPLVDNVVVKVDCVISGEENGL  63

Query  466  psssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFI  588
             +           + R  IS  +R V   L+KP Q+L+  +
Sbjct  64   NA-----------RGRGIISHFVRFVVGTLVKPLQALTHLL  93



>ref|XP_010052048.1| PREDICTED: F-box protein At5g46170 [Eucalyptus grandis]
 gb|KCW75903.1| hypothetical protein EUGRSUZ_D00284 [Eucalyptus grandis]
 gb|KCW75904.1| hypothetical protein EUGRSUZ_D00284 [Eucalyptus grandis]
Length=407

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 75/108 (69%), Gaps = 8/108 (7%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGssp  468
            DHFDRLPDSL+LL+FN + DVKALGRC  VS+RF  LVPQVD V+VRVDCVISD++    
Sbjct  44   DHFDRLPDSLLLLIFNRVADVKALGRCGAVSRRFRQLVPQVDAVLVRVDCVISDDE----  99

Query  469  sssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISASPRRVA  612
                +A+ A SDK R P++S +R V   ++KP Q+L  F   + R  A
Sbjct  100  ----SASPALSDKGRGPLASFVRAVLGNIVKPLQALGLFSGGARRAQA  143



>emb|CDX99469.1| BnaC01g10830D [Brassica napus]
Length=227

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 42/53 (79%), Gaps = 3/53 (6%)
 Frame = +1

Query  250  RPDLSCRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            R D   R++PEP+   D FD LPDS++LLVFN IGDVKALGRC VVSKRFHSL
Sbjct  6    RSDPLSRIHPEPLHQPDFFDHLPDSILLLVFNRIGDVKALGRCGVVSKRFHSL  58



>emb|CDX78847.1| BnaA01g09140D [Brassica napus]
Length=238

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 80/118 (68%), Gaps = 12/118 (10%)
 Frame = +1

Query  250  RPDLSCRVYPEPVD---HFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnv  420
            R D   R++PEP+D    FD LPDS++LLVFN IGDVKALGRC VVSKRFHSLVPQV+NV
Sbjct  6    RSDPLSRIHPEPLDPPDFFDHLPDSILLLVFNRIGDVKALGRCGVVSKRFHSLVPQVENV  65

Query  421  vvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISA  594
            VVRVDCVISD+D  S  S           S  P S+I RL+F    KP  +L+Q +S 
Sbjct  66   VVRVDCVISDDDDPSSLSPDKPR-----SSASPFSAIFRLIF----KPLHALTQLLST  114



>ref|XP_002440052.1| hypothetical protein SORBIDRAFT_09g025120 [Sorghum bicolor]
 gb|EES18482.1| hypothetical protein SORBIDRAFT_09g025120 [Sorghum bicolor]
Length=398

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 79/104 (76%), Gaps = 1/104 (1%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGssp  468
            DHFDRLPD+L+L++FN IGDVKALGRC +VS+RFH LVP VD+VVVRVDCVI DE  SS 
Sbjct  29   DHFDRLPDALLLVIFNRIGDVKALGRCSLVSRRFHELVPLVDSVVVRVDCVIPDEPPSSS  88

Query  469  sssaaaaaaasD-KSRHPISSILRLVFTGLLKPFQSLSQFISAS  597
            SS +A ++  +  ++R   S I R+V  G++KP Q+L Q +S +
Sbjct  89   SSPSAPSSPTASVRARGVFSQIARIVLGGIVKPIQALGQILSPA  132



>ref|XP_009399020.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=397

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 70/107 (65%), Gaps = 6/107 (6%)
 Frame = +1

Query  271  VYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisd  450
            V  E +DHFDRLPDS++L++FN IGDVK LGRCC V +RFH L P VD+VVVRVDCVISD
Sbjct  23   VEEEGIDHFDRLPDSVLLVIFNRIGDVKTLGRCCAVYRRFHDLAPLVDDVVVRVDCVISD  82

Query  451  EDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIS  591
            +       S +A     DK     S   R V  GL+KP ++L Q +S
Sbjct  83   D------PSPSAPGGGFDKPHSVFSHFARFVLGGLVKPLEALCQMLS  123



>ref|XP_009381298.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381299.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381300.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=406

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 72/104 (69%), Gaps = 5/104 (5%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGss  465
            +DHFDRLPDS++LLVFN +GDVK LGRCCVV  RFHSLV  VD+V+VRVDCVISD+    
Sbjct  31   IDHFDRLPDSVLLLVFNRVGDVKDLGRCCVVCSRFHSLVRLVDSVLVRVDCVISDD----  86

Query  466  psssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISAS  597
              S + A  A  D +R   S + R+V   + +PFQ+L   ++ S
Sbjct  87   -PSPSPAGVAGGDSARGVFSHLARIVLGSIARPFQALGHILAPS  129



>ref|NP_001151246.1| F-box domain containing protein [Zea mays]
 gb|ACG42117.1| F-box domain containing protein [Zea mays]
Length=411

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = +1

Query  277  PEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdED  456
            P   DHFDRLPD+L+L++FN IGDVKALGRC +VS RFH LVP VD+V VRVDCVI DE 
Sbjct  25   PAGDDHFDRLPDALLLVIFNRIGDVKALGRCSLVSLRFHELVPLVDSVFVRVDCVIPDEP  84

Query  457  GsspsssaaaaaaasD-KSRHPISSILRLVFTGLLKPFQSLSQFIS  591
             SS SS +   +  +  ++R   S I R+V  G++KP Q+L Q +S
Sbjct  85   PSSSSSPSTPFSPTASVRARGVFSQIARIVLGGIVKPIQALGQILS  130



>ref|XP_010549497.1| PREDICTED: F-box protein At1g30200 [Tarenaya hassleriana]
Length=398

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  247  VRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            ++P ++       VDHFDRLPDSL+LLVF+ I D+KALGRCC+VS+RFHSL
Sbjct  13   IQPVMAQSFESAAVDHFDRLPDSLLLLVFDRISDIKALGRCCLVSRRFHSL  63



>dbj|BAK06381.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99725.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97479.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=397

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 76/103 (74%), Gaps = 2/103 (2%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGssp  468
            D FDRLPD+++L VFN IGDVKALGRC +VS+RFH+LVP VD+V VRVDCVI DE    P
Sbjct  22   DQFDRLPDAVLLDVFNRIGDVKALGRCALVSRRFHALVPLVDSVFVRVDCVIPDEPA--P  79

Query  469  sssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISAS  597
            SS+ +  AAA  + R  ++ I RLV  G+++P Q+L Q +S +
Sbjct  80   SSAGSPQAAAPSRGRGALAHIARLVLGGIVRPIQALGQILSPT  122



>ref|XP_003569912.1| PREDICTED: F-box protein At4g18380-like [Brachypodium distachyon]
 ref|XP_003569913.1| PREDICTED: F-box protein At4g18380-like [Brachypodium distachyon]
Length=396

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGssp  468
            D FDRLPD ++L VFN IGDVKALGRC +VS+RFH LVP VD+V VRVDCVI DE  SS 
Sbjct  22   DQFDRLPDEVLLDVFNRIGDVKALGRCALVSRRFHELVPLVDSVFVRVDCVIPDEPPSSS  81

Query  469  sssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISAS  597
            +SS  AAAAA  + R  ++ + RLV  G+++P Q+L Q +S +
Sbjct  82   ASSPQAAAAAPGRGRGALAHLARLVLGGIVRPIQALGQILSPT  124



>ref|XP_008649848.1| PREDICTED: F-box protein At5g46170-like [Zea mays]
 gb|AFW78643.1| hypothetical protein ZEAMMB73_212566 [Zea mays]
Length=412

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGssp  468
            D FDRLPD+L+L++FN IGDVKALGRC +VS+RFH LVP VD+V+VRVDCVI DE  SS 
Sbjct  29   DQFDRLPDALLLVIFNRIGDVKALGRCSLVSRRFHELVPLVDSVLVRVDCVIPDEPPSSS  88

Query  469  sssaaaaaaasD-KSRHPISSILRLVFTGLLKPFQSLSQFISAS  597
            SSS+  ++  +  ++R   S I R+V  G++KP Q+L Q +S +
Sbjct  89   SSSSTPSSPTASVRARGVFSQIARIVLGGIVKPIQALGQILSPA  132



>ref|XP_002969001.1| hypothetical protein SELMODRAFT_90428 [Selaginella moellendorffii]
 ref|XP_002990664.1| hypothetical protein SELMODRAFT_132039 [Selaginella moellendorffii]
 gb|EFJ08296.1| hypothetical protein SELMODRAFT_132039 [Selaginella moellendorffii]
 gb|EFJ30117.1| hypothetical protein SELMODRAFT_90428 [Selaginella moellendorffii]
Length=364

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 67/109 (61%), Gaps = 13/109 (12%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGss  465
             D FD+LPDSL++L+ N +GD+K LGRCC VSKRF +L   V++V V+VDCVIS ED   
Sbjct  30   TDCFDQLPDSLLVLILNKVGDIKVLGRCCAVSKRFQALAAHVEDVTVKVDCVISGED---  86

Query  466  psssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISASPRRVA  612
                       S KS+  +  ++RLVF   ++P Q L  F+   PR+ A
Sbjct  87   --------CNLSGKSKGFLGQLMRLVFGSFVRPLQLLQHFL--GPRKSA  125



>ref|XP_009128847.1| PREDICTED: F-box protein At5g46170-like [Brassica rapa]
Length=371

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 5/55 (9%)
 Frame = +1

Query  250  RPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            R D   R++P+P      DHFDRLPDS++LLV N I DVK+LGRC  VS+RFHSL
Sbjct  6    RSDPPSRIHPQPQPLEQTDHFDRLPDSILLLVLNRIADVKSLGRCRAVSRRFHSL  60



>ref|XP_006654629.1| PREDICTED: F-box protein At5g46170-like [Oryza brachyantha]
Length=420

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 77/108 (71%), Gaps = 5/108 (5%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdE-----  453
            DHFDRLPD L+L++FN IGDVKALGRC +VS+RFH LVP VD+V+VRVDCVI D+     
Sbjct  28   DHFDRLPDPLLLVIFNRIGDVKALGRCSLVSRRFHDLVPLVDSVLVRVDCVIPDDPASSA  87

Query  454  DGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISAS  597
              +S S SA  +  AS ++R   S I R+V  G++KP Q+L Q +S +
Sbjct  88   AAASSSPSAPCSPTASARARTVFSQIARIVLGGIVKPIQALGQILSPA  135



>tpg|DAA41006.1| TPA: hypothetical protein ZEAMMB73_999134 [Zea mays]
Length=490

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 77/102 (75%), Gaps = 1/102 (1%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGssp  468
            D FDRLPD+L+L++FN IG+VKALGRC +VS+RFH LVP VD+V+VRVDCVI DE  SS 
Sbjct  29   DQFDRLPDALLLVIFNRIGNVKALGRCSLVSRRFHELVPLVDSVLVRVDCVIPDEPPSSS  88

Query  469  sssaaaaaaasD-KSRHPISSILRLVFTGLLKPFQSLSQFIS  591
            SSS+  ++  +  ++R   S I R+V  G++KP Q+L Q +S
Sbjct  89   SSSSTPSSPTASVRARGVFSQIARIVLGGIVKPIQALGQILS  130



>ref|XP_001761459.1| predicted protein [Physcomitrella patens]
 gb|EDQ73848.1| predicted protein [Physcomitrella patens]
Length=346

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +DHFDRLPDS++L++FN + D+KALGRCC VS RFHSL
Sbjct  1    MDHFDRLPDSVLLVIFNKVSDIKALGRCCAVSSRFHSL  38



>gb|EAY98656.1| hypothetical protein OsI_20579 [Oryza sativa Indica Group]
Length=412

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 77/106 (73%), Gaps = 5/106 (5%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdE-----  453
            DHFDRLPD L+L++FN IGDVKALGRC +VS+RFH LVP VD+V+VRVDCVI D+     
Sbjct  33   DHFDRLPDPLLLVIFNRIGDVKALGRCSLVSRRFHDLVPLVDSVLVRVDCVIPDDPASSS  92

Query  454  DGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIS  591
              SS  S+A ++  AS ++R   S I R+V  G++KP Q+L Q +S
Sbjct  93   SSSSSPSAAPSSPTASARARTVFSQIARIVLGGIVKPIQALGQILS  138



>ref|NP_001056009.1| Os05g0510400 [Oryza sativa Japonica Group]
 gb|AAT44135.1| putative F-box protein family [Oryza sativa Japonica Group]
 dbj|BAF17923.1| Os05g0510400 [Oryza sativa Japonica Group]
 dbj|BAG91029.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64319.1| hypothetical protein OsJ_19156 [Oryza sativa Japonica Group]
Length=412

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 77/106 (73%), Gaps = 5/106 (5%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdE-----  453
            DHFDRLPD L+L++FN IGDVKALGRC +VS+RFH LVP VD+V+VRVDCVI D+     
Sbjct  33   DHFDRLPDPLLLVIFNRIGDVKALGRCSLVSRRFHDLVPLVDSVLVRVDCVIPDDPASSS  92

Query  454  DGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIS  591
              SS  S+A ++  AS ++R   S I R+V  G++KP Q+L Q +S
Sbjct  93   SSSSSPSAAPSSPTASARARTVFSQIARIVLGGIVKPIQALGQILS  138



>ref|XP_006836201.1| hypothetical protein AMTR_s00101p00078790 [Amborella trichopoda]
 gb|ERM99054.1| hypothetical protein AMTR_s00101p00078790 [Amborella trichopoda]
Length=348

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  274  YPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            YP P DHFDRLPDSL+L++FN + DVK+LGRC  VSKRF+SL
Sbjct  11   YPIPEDHFDRLPDSLLLIIFNKLEDVKSLGRCFAVSKRFNSL  52



>ref|XP_003568140.1| PREDICTED: F-box protein At5g46170-like [Brachypodium distachyon]
Length=420

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 68/109 (62%), Gaps = 8/109 (7%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvv--------vrvdcvi  444
            D FD LPD L+L++FN IGDVKALGRC +VS+RFH+LVP VD+V+               
Sbjct  31   DRFDGLPDPLLLVIFNRIGDVKALGRCSLVSRRFHALVPLVDSVLVRVDCVIPDDASSAG  90

Query  445  sdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIS  591
            +       S SA ++  AS ++R+ +S I R+V  G++KP Q+L Q +S
Sbjct  91   AAAAAGDFSLSAPSSPTASARARNVVSQIARMVIGGIVKPIQALGQILS  139



>emb|CDY43956.1| BnaA02g24340D [Brassica napus]
Length=373

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E  DHFDRLPDS++LLV N I DVK+LGRC  VS+RFHSL
Sbjct  23   EQTDHFDRLPDSVLLLVLNRIADVKSLGRCRAVSRRFHSL  62



>ref|XP_009381361.1| PREDICTED: F-box protein At4g18380-like [Musa acuminata subsp. 
malaccensis]
Length=354

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 38/48 (79%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEP---VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             RVY +P   +D F+RLPDS++LL+FN + DV++LGRC  VSKRF+SL
Sbjct  5    ARVYADPSRDLDEFERLPDSIVLLIFNKVADVRSLGRCSAVSKRFNSL  52



>ref|XP_009393903.1| PREDICTED: F-box protein At4g18380-like [Musa acuminata subsp. 
malaccensis]
Length=363

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 39/53 (74%), Gaps = 3/53 (6%)
 Frame = +1

Query  250  RPDLSCRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            R     R++ +P    DHFDR+PDSL+LL+FN + DV++LGRC  VSKRF++L
Sbjct  9    RTQTKSRIHADPSLHQDHFDRIPDSLVLLIFNKLADVRSLGRCSAVSKRFNAL  61



>gb|ABK24885.1| unknown [Picea sitchensis]
 gb|ABR16398.1| unknown [Picea sitchensis]
Length=361

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             DHFDRLP+SL+L++FN +GD+KALGRC  VSKRF+ L
Sbjct  22   TDHFDRLPNSLVLVIFNKLGDIKALGRCSAVSKRFNCL  59



>ref|XP_008777014.1| PREDICTED: F-box protein At4g18380-like [Phoenix dactylifera]
Length=354

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 39/49 (80%), Gaps = 3/49 (6%)
 Frame = +1

Query  262  SCRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            + R++ +P    DHFD++PDSL+LL+FN + DV++LGRC  VSKRF+SL
Sbjct  4    NTRIHSDPYLSEDHFDQIPDSLVLLIFNKLADVRSLGRCSAVSKRFNSL  52



>ref|XP_010907825.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
Length=354

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 38/49 (78%), Gaps = 3/49 (6%)
 Frame = +1

Query  262  SCRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            + R++ +P    DHFDR+PD L+LL+FN + DV++LGRC  VSKRF+SL
Sbjct  4    NTRIHSDPYLSEDHFDRIPDPLVLLIFNKLADVRSLGRCSAVSKRFNSL  52



>ref|XP_008804990.1| PREDICTED: F-box protein At4g18380-like isoform X2 [Phoenix dactylifera]
Length=354

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +P    D+FDR+PDSL+LL+FN + DV++LGRC  VSKRF+SL
Sbjct  5    TRIHADPSLNEDYFDRIPDSLVLLIFNNLADVQSLGRCSAVSKRFNSL  52



>ref|XP_008804989.1| PREDICTED: F-box protein At4g18380-like isoform X1 [Phoenix dactylifera]
Length=421

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = +1

Query  235  DMGSVRPDLSCRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            ++G  +     R++ +P    D+FDR+PDSL+LL+FN + DV++LGRC  VSKRF+SL
Sbjct  62   ELGPEKMQSKTRIHADPSLNEDYFDRIPDSLVLLIFNNLADVQSLGRCSAVSKRFNSL  119



>ref|NP_001151107.1| F-box domain containing protein [Zea mays]
 gb|ACG41645.1| F-box domain containing protein [Zea mays]
Length=406

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  277  PEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            PE  DHF+RL D+++L V N IGDVKALGRC +VS+RFH+L
Sbjct  20   PEAADHFERLHDAVLLDVLNRIGDVKALGRCALVSRRFHAL  60



>ref|XP_009410458.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009410459.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=353

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 37/48 (77%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEP---VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             RVY +P   +D FDRLPDS++LL+ N + DV++LGRC  VSKRF+SL
Sbjct  5    ARVYADPSHDLDQFDRLPDSIVLLILNKLADVRSLGRCSAVSKRFNSL  52



>gb|EEC75147.1| hypothetical protein OsI_11347 [Oryza sativa Indica Group]
Length=384

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E  DHFDR+PDSL+LL+FN + D ++LGRC  VSKRF+SL
Sbjct  19   EGEDHFDRVPDSLVLLIFNRLADARSLGRCSAVSKRFNSL  58



>ref|NP_001049959.1| Os03g0321300 [Oryza sativa Japonica Group]
 gb|ABF95667.1| F-box domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11873.1| Os03g0321300 [Oryza sativa Japonica Group]
 dbj|BAG92352.1| unnamed protein product [Oryza sativa Japonica Group]
Length=384

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E  DHFDR+PDSL+LL+FN + D ++LGRC  VSKRF+SL
Sbjct  19   EGEDHFDRVPDSLVLLIFNRLADARSLGRCSAVSKRFNSL  58



>gb|EEE58967.1| hypothetical protein OsJ_10655 [Oryza sativa Japonica Group]
Length=370

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E  DHFDR+PDSL+LL+FN + D ++LGRC  VSKRF+SL
Sbjct  19   EGEDHFDRVPDSLVLLIFNRLADARSLGRCSAVSKRFNSL  58



>ref|XP_006651329.1| PREDICTED: F-box protein At5g46170-like [Oryza brachyantha]
Length=324

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E  DHFDR+PDSL+LL+FN + D ++LGRC  VSKRF++L
Sbjct  18   EGEDHFDRVPDSLVLLIFNRLADARSLGRCSAVSKRFNAL  57



>ref|XP_011043565.1| PREDICTED: F-box protein At1g22220-like [Populus euphratica]
Length=321

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E +D FDRLPDSLILL+FN I D+KAL RC  VSKRF+SL
Sbjct  12   EEMDGFDRLPDSLILLIFNSISDIKALIRCRSVSKRFNSL  51



>ref|XP_002307387.1| F-box family protein [Populus trichocarpa]
 gb|EEE94383.1| F-box family protein [Populus trichocarpa]
Length=312

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E +D FDRLPDSLILL+FN I D+KAL RC  VSKRF+SL
Sbjct  3    EAMDGFDRLPDSLILLIFNSISDIKALIRCRSVSKRFNSL  42



>ref|XP_008784858.1| PREDICTED: F-box protein At5g46170-like [Phoenix dactylifera]
 ref|XP_008784859.1| PREDICTED: F-box protein At5g46170-like [Phoenix dactylifera]
Length=410

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 71/118 (60%), Gaps = 4/118 (3%)
 Frame = +1

Query  250  RPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvv-  426
            R D +     E +D+FDRLPD L+L VFN IGDVKALGRCCVVS RFHSLVP VD VVV 
Sbjct  19   RGDRAEEEEAEGIDYFDRLPDLLLLDVFNRIGDVKALGRCCVVSHRFHSLVPLVDYVVVH  78

Query  427  ---rvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIS  591
                +    +    S+ ++      A  DK R   S + RLVF  L+KP Q+L Q ++
Sbjct  79   VDCVISDDPAPSSSSTTAAGCGGGGAGPDKGRGVFSHLTRLVFGSLVKPLQALGQILA  136



>gb|EEC71551.1| hypothetical protein OsI_03898 [Oryza sativa Indica Group]
Length=396

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 78/113 (69%), Gaps = 5/113 (4%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdE-----  453
            D F+RLPD ++L VF  IGDVKALGRC +VS+RFH+LVP VD+V VRVDCVISD+     
Sbjct  14   DQFERLPDEVLLDVFGRIGDVKALGRCALVSRRFHALVPLVDSVFVRVDCVISDDPPPSS  73

Query  454  DGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISASPRRVA  612
             GS+ +++AA     + + R  ++ + RLV  G+++P Q+L Q +S +   V+
Sbjct  74   AGSAQAAAAAEGGPPAARGRGALAHLARLVLGGIVRPIQALGQILSPAAATVS  126



>ref|NP_001044377.1| Os01g0770400 [Oryza sativa Japonica Group]
 dbj|BAB56069.1| F-box family protein-like [Oryza sativa Japonica Group]
 dbj|BAF06291.1| Os01g0770400 [Oryza sativa Japonica Group]
 dbj|BAG88022.1| unnamed protein product [Oryza sativa Japonica Group]
Length=396

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 78/113 (69%), Gaps = 5/113 (4%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdE-----  453
            D F+RLPD ++L VF  IGDVKALGRC +VS+RFH+LVP VD+V VRVDCVISD+     
Sbjct  14   DQFERLPDEVLLDVFGRIGDVKALGRCALVSRRFHALVPLVDSVFVRVDCVISDDPPPSS  73

Query  454  DGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISASPRRVA  612
             GS+ +++AA     + + R  ++ + RLV  G+++P Q+L Q +S +   V+
Sbjct  74   AGSAQAAAAAEGGPPAARGRGALAHLARLVLGGIVRPIQALGQILSPAAATVS  126



>gb|AFW88518.1| hypothetical protein ZEAMMB73_307153 [Zea mays]
Length=435

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E  DHFDR+PDSL+LL+FN + D ++LGRC  VS+RF++L
Sbjct  74   EGEDHFDRVPDSLVLLIFNKVADARSLGRCSAVSRRFNAL  113



>ref|XP_009404692.1| PREDICTED: F-box protein At4g18380-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009404693.1| PREDICTED: F-box protein At4g18380-like [Musa acuminata subsp. 
malaccensis]
Length=384

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 37/47 (79%), Gaps = 3/47 (6%)
 Frame = +1

Query  268  RVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            R++ +P    DHFD++PDSL+LL+FN + D+++LGRC  VSKRF+ L
Sbjct  36   RIHADPSLYQDHFDQIPDSLVLLIFNKVADIRSLGRCLAVSKRFNIL  82



>ref|XP_008792446.1| PREDICTED: F-box protein At4g18380-like [Phoenix dactylifera]
 ref|XP_008792447.1| PREDICTED: F-box protein At4g18380-like [Phoenix dactylifera]
Length=354

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++  P    D FDR+PDSL+LL+ N I DV++LGRC  VSKRF+SL
Sbjct  5    TRIHAHPSLDQDQFDRIPDSLVLLILNKIADVRSLGRCSAVSKRFNSL  52



>gb|AAT69637.1| unknown protein, contains f-box domain [Oryza sativa Japonica 
Group]
 gb|EAY98512.1| hypothetical protein OsI_20423 [Oryza sativa Indica Group]
 dbj|BAG92711.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64186.1| hypothetical protein OsJ_19018 [Oryza sativa Japonica Group]
Length=351

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +PV   D FDRLPDSL+L++ N + DV++LGRC  VSKRF+ L
Sbjct  2    ARIHADPVLEADQFDRLPDSLVLVILNNVEDVRSLGRCSAVSKRFYGL  49



>ref|XP_006654574.1| PREDICTED: F-box protein At4g18380-like [Oryza brachyantha]
Length=352

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEP---VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +P   VD FDRLPDSL+L++ N + DV++LGRC  VSKRF+ L
Sbjct  5    ARIHADPLLEVDQFDRLPDSLVLVILNNVEDVRSLGRCSAVSKRFYGL  52



>ref|XP_002467943.1| hypothetical protein SORBIDRAFT_01g036900 [Sorghum bicolor]
 gb|EER94941.1| hypothetical protein SORBIDRAFT_01g036900 [Sorghum bicolor]
Length=380

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E  DHFDR+PDSL+LL+FN + D ++LGRC  VS+RF++L
Sbjct  17   EGEDHFDRVPDSLVLLIFNKLADARSLGRCSAVSRRFNAL  56



>ref|XP_010922958.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
 ref|XP_010922959.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
 ref|XP_010922960.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
 ref|XP_010922961.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
 ref|XP_010922962.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
Length=354

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++  P    D FDR+PDSL+LL+ N I DV++LGRC  VSKRF+SL
Sbjct  5    TRIHAHPSLEQDQFDRIPDSLVLLILNKIADVRSLGRCSAVSKRFNSL  52



>ref|XP_010052049.1| PREDICTED: F-box protein At5g46170-like [Eucalyptus grandis]
 gb|KCW75905.1| hypothetical protein EUGRSUZ_D00286 [Eucalyptus grandis]
Length=384

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 78/122 (64%), Gaps = 10/122 (8%)
 Frame = +1

Query  238  MGSVRPD-LSCRVYPEP--VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpq  408
            M S+R D  S RV+P P  VDHFDRLPD L+LL+FN I DVKALGRC VVS+RF  LVPQ
Sbjct  1    MSSLRADPSSSRVHPAPLLVDHFDRLPDPLLLLIFNRIADVKALGRCGVVSRRFRQLVPQ  60

Query  409  vdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFI  588
            VD V+VRV       D       +A+ AA SDK+R+P +S  +     ++KP Q+L  F 
Sbjct  61   VDAVLVRV-------DCVISDDESASPAALSDKARNPFASFFQAFLGNIVKPLQALGLFS  113

Query  589  SA  594
             A
Sbjct  114  GA  115



>ref|XP_008676229.1| PREDICTED: F-box protein At5g46170-like [Zea mays]
Length=267

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E  DHFDR+PDSL+LL+FN + D ++LGRC  VS+RF +L
Sbjct  9    EGEDHFDRVPDSLVLLIFNKLADARSLGRCSAVSRRFSAL  48



>ref|NP_001055899.2| Os05g0490300 [Oryza sativa Japonica Group]
 dbj|BAF17813.2| Os05g0490300, partial [Oryza sativa Japonica Group]
Length=450

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +PV   D FDRLPDSL+L++ N + DV++LGRC  VSKRF+ L
Sbjct  101  ARIHADPVLEADQFDRLPDSLVLVILNNVEDVRSLGRCSAVSKRFYGL  148



>ref|XP_004984553.1| PREDICTED: F-box protein At5g46170-like [Setaria italica]
Length=371

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E  DHFDR+PDSL+L++FN + D ++LGRC  VS+RF++L
Sbjct  17   EGEDHFDRVPDSLVLIIFNKLADARSLGRCSAVSRRFNAL  56



>ref|XP_010907539.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
 ref|XP_010907541.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
Length=354

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 71/114 (62%), Gaps = 8/114 (7%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvd  435
             R++ +P    DHFD +PD L+LL+FN + DV++LGR   VSKRF+SLVP V +V V++D
Sbjct  5    TRIHADPSLNEDHFDWIPDPLVLLIFNKLADVRSLGRASAVSKRFNSLVPLVHDVYVKID  64

Query  436  cvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISAS  597
             V++  DG    +   ++     K R+ +S +L+L+F  +LKPF  L    S +
Sbjct  65   RVVTV-DGDLDEALNLSSP----KPRNLLSHLLKLMFLTVLKPFHHLQNTSSGN  113



>ref|XP_002458563.1| hypothetical protein SORBIDRAFT_03g035810 [Sorghum bicolor]
 gb|EES03683.1| hypothetical protein SORBIDRAFT_03g035810 [Sorghum bicolor]
Length=418

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +1

Query  262  SCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +C    E  D F+RL D+++L V N IGDVKALGRC +VS+RFH+L
Sbjct  24   TCGGGAEAADQFERLHDAVLLDVLNRIGDVKALGRCALVSRRFHAL  69



>ref|XP_008786757.1| PREDICTED: F-box protein At4g18380-like [Phoenix dactylifera]
 ref|XP_008786758.1| PREDICTED: F-box protein At4g18380-like [Phoenix dactylifera]
Length=354

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            D FDR+PDSL+LL+ N I DV++LGRC  VSKRF++L
Sbjct  16   DQFDRIPDSLVLLILNKIADVRSLGRCSAVSKRFNAL  52



>ref|XP_004970106.1| PREDICTED: F-box protein At5g46170-like [Setaria italica]
Length=411

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E  D FDRL D+++L V N IGDVKALGRC +VS+RFH+L
Sbjct  23   EAGDQFDRLHDAVLLDVLNRIGDVKALGRCALVSRRFHAL  62



>ref|NP_001132514.1| uncharacterized protein LOC100193974 [Zea mays]
 gb|ACF81382.1| unknown [Zea mays]
Length=359

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            DHFDR+PDSL+LL+FN + D ++LGRC  VS+RF +L
Sbjct  22   DHFDRVPDSLVLLIFNKLADARSLGRCSAVSRRFSAL  58



>ref|XP_010904742.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
Length=354

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +P    D FDR+PDSL+LL+ N I DV++LGRC  VSKRF+ L
Sbjct  5    TRIHADPSLDQDQFDRIPDSLVLLILNKIADVRSLGRCSAVSKRFNFL  52



>ref|XP_002455973.1| hypothetical protein SORBIDRAFT_03g028320 [Sorghum bicolor]
 gb|EES01093.1| hypothetical protein SORBIDRAFT_03g028320 [Sorghum bicolor]
Length=418

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  265  CRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            C    E  D F+RL D+++L V N IGDVKALGRC +VS+RFH+L
Sbjct  25   CGGGSEAADQFERLHDAVLLDVLNRIGDVKALGRCALVSRRFHAL  69



>gb|ACG40631.1| F-box domain containing protein [Zea mays]
Length=358

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            DHFDR+PDSL+LL+FN + D ++LGRC  VS+RF +L
Sbjct  22   DHFDRVPDSLVLLIFNKLADARSLGRCSAVSRRFSAL  58



>dbj|BAJ95685.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 59/93 (63%), Gaps = 11/93 (12%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGssp  468
            DHFD +PDSL+LL+FN + D ++LGRC  VS+RF++LVP VD+  +R+D VI+ +D  + 
Sbjct  19   DHFDSVPDSLVLLIFNKLADARSLGRCSAVSRRFNALVPLVDDACLRIDRVIAADDAPAG  78

Query  469  sssaaaaaaasDKSRHPISSILRLVFTGLLKPF  567
                        + R  IS +L+ V   +LKPF
Sbjct  79   P-----------RQRGVISGLLKTVLLAVLKPF  100



>ref|NP_001146920.1| F-box domain containing protein [Zea mays]
 gb|ACG24418.1| F-box domain containing protein [Zea mays]
Length=406

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E  D F+RL D+++L V N IGDVKALGRC +VS+RFH+L
Sbjct  17   EAADQFERLHDAVLLDVLNRIGDVKALGRCALVSRRFHAL  56



>ref|XP_009420961.1| PREDICTED: F-box protein At4g18380-like [Musa acuminata subsp. 
malaccensis]
Length=348

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            DHFDR+PDSL+L++FN + D+++LGR   VSKRF++L
Sbjct  10   DHFDRIPDSLVLVIFNKLADIQSLGRSSTVSKRFNAL  46



>ref|XP_008672792.1| PREDICTED: F-box domain containing protein isoform X1 [Zea mays]
 tpg|DAA57445.1| TPA: F-box domain containing protein [Zea mays]
Length=401

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E  D F+RL D+++L V N IGDVKALGRC +VS+RFH+L
Sbjct  17   EAADQFERLHDAVLLDVLNRIGDVKALGRCALVSRRFHAL  56



>gb|KDP41362.1| hypothetical protein JCGZ_15769 [Jatropha curcas]
Length=324

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +D FDRLPDSLILL+FN + D+K L RC  VSKRF+SL
Sbjct  1    MDGFDRLPDSLILLIFNSVSDIKTLIRCLSVSKRFNSL  38



>ref|XP_006415502.1| hypothetical protein EUTSA_v10007915mg [Eutrema salsugineum]
 gb|ESQ33855.1| hypothetical protein EUTSA_v10007915mg [Eutrema salsugineum]
Length=382

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 83/120 (69%), Gaps = 9/120 (8%)
 Frame = +1

Query  268  RVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrv  432
            R++PEP      DHFD LPDSL+LL+F+ + DVK LGRC +VS+RFHSLVP V+NV+VRV
Sbjct  12   RIHPEPQSLENSDHFDLLPDSLLLLIFDKVADVKDLGRCSIVSRRFHSLVPFVENVLVRV  71

Query  433  dcvisdEDGsspss--saaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISASPRR  606
            DCVISD+D S+     S  +A+     +    S++ RLVF  + KPFQ+L QF+   P+R
Sbjct  72   DCVISDDDSSAADRRFSLNSASITDATAGGSFSALFRLVFAPIFKPFQALGQFL--GPKR  129



>gb|ACG24953.1| F-box domain containing protein [Zea mays]
Length=354

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 34/48 (71%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R+Y +PV   DHFD LPDSL+LL+ N + DV++LGRC  VSKR   L
Sbjct  5    ARIYADPVREVDHFDCLPDSLVLLILNKVEDVRSLGRCYAVSKRLCGL  52



>ref|XP_004150662.1| PREDICTED: F-box protein At1g78100-like [Cucumis sativus]
Length=349

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  271  VYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +Y    D F+ LPDSLILL+FN + DVK L RC  VSKRF+SL
Sbjct  23   IYTNDADAFESLPDSLILLIFNSVSDVKTLIRCRAVSKRFNSL  65



>ref|XP_004173053.1| PREDICTED: F-box protein At1g78100-like [Cucumis sativus]
 gb|KGN62167.1| hypothetical protein Csa_2G307320 [Cucumis sativus]
Length=350

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  271  VYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +Y    D F+ LPDSLILL+FN + DVK L RC  VSKRF+SL
Sbjct  24   IYTNDADAFESLPDSLILLIFNSVSDVKTLIRCRAVSKRFNSL  66



>ref|XP_006854457.1| hypothetical protein AMTR_s00039p00227540 [Amborella trichopoda]
 gb|ERN15924.1| hypothetical protein AMTR_s00039p00227540 [Amborella trichopoda]
Length=354

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  277  PEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            P   DHF+RLPDS++LL+FN + D+K+LG C  VSKRF SL
Sbjct  13   PLLADHFERLPDSVLLLIFNKVQDIKSLGLCLSVSKRFFSL  53



>ref|XP_006307474.1| hypothetical protein CARUB_v10009099mg [Capsella rubella]
 gb|EOA40372.1| hypothetical protein CARUB_v10009099mg [Capsella rubella]
Length=453

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 87/130 (67%), Gaps = 12/130 (9%)
 Frame = +1

Query  247  VRPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqv  411
            +R D   R++PEP      DHFD LPDSL+LL+F+ + DVK LGRCC+VS+RFHSLVP V
Sbjct  69   LRSDPVSRIHPEPQSLTSFDHFDLLPDSLLLLIFDKVADVKDLGRCCIVSRRFHSLVPFV  128

Query  412  dnvvvrvdcvisdEDGsspsssaaaaaaasDKSRH-----PISSILRLVFTGLLKPFQSL  576
            +NV+VRVDCVISD+D SS   +   +  AS  S         S++ RLVF  + KPFQ+L
Sbjct  129  ENVLVRVDCVISDDDSSSSDDNRRFSLNASSISDAVGAGGSFSALFRLVFAPIFKPFQAL  188

Query  577  SQFISASPRR  606
             QF+   P+R
Sbjct  189  GQFL--GPKR  196



>ref|XP_002456519.1| hypothetical protein SORBIDRAFT_03g037710 [Sorghum bicolor]
 gb|EES01639.1| hypothetical protein SORBIDRAFT_03g037710 [Sorghum bicolor]
Length=354

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +PV   D FD LPDSL+LL+ N + DV++LGRC  VSKRF  L
Sbjct  5    ARIHADPVLEFDQFDGLPDSLVLLILNKLEDVRSLGRCSAVSKRFSGL  52



>ref|XP_002890858.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67117.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
Length=381

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 78/124 (63%), Gaps = 10/124 (8%)
 Frame = +1

Query  247  VRPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqv  411
            +R D   R++PEP      DHFD LPDSL+LL+F+ + DVK LGRCC+VS+RFHSLVP V
Sbjct  5    LRSDPVSRIHPEPQSLTSFDHFDLLPDSLLLLIFDKVADVKDLGRCCIVSRRFHSLVPFV  64

Query  412  dnvv-----vrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSL  576
            +NV+     V  D   S  D +   S  AA+ + +  +    S++ RLVF  + KPFQ+L
Sbjct  65   ENVLVRVDCVISDDDSSSSDENRRFSLNAASISDAAGAGGSFSALFRLVFAPIFKPFQAL  124

Query  577  SQFI  588
             QF+
Sbjct  125  GQFL  128



>ref|XP_006434013.1| hypothetical protein CICLE_v10001889mg [Citrus clementina]
 gb|ESR47253.1| hypothetical protein CICLE_v10001889mg [Citrus clementina]
Length=316

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +DHFD+LPD+LILL+F+ + DVK L RC  VSKRF+SL
Sbjct  1    MDHFDQLPDALILLIFSSVSDVKTLIRCRSVSKRFNSL  38



>ref|XP_010478400.1| PREDICTED: F-box protein At1g30200-like [Camelina sativa]
 ref|XP_010478401.1| PREDICTED: F-box protein At1g30200-like [Camelina sativa]
Length=383

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 86/133 (65%), Gaps = 15/133 (11%)
 Frame = +1

Query  247  VRPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqv  411
            +R D   R++PEP      DHFD LPDSL+LL+F+ + DVK LGRCC+VS+RFHSLVP V
Sbjct  5    LRSDPVSRIHPEPQSLTSFDHFDLLPDSLLLLIFDKVADVKDLGRCCIVSRRFHSLVPFV  64

Query  412  dnvvvrvdcvisdEDGsspsssaaaaaaasDKSR--------HPISSILRLVFTGLLKPF  567
            +NV+VRVDCVISD+D SS   +      + + +            S++ RLVF  + KPF
Sbjct  65   ENVLVRVDCVISDDDSSSSDDNNNNRRFSLNAASISDAVAVGGSFSALFRLVFAPIFKPF  124

Query  568  QSLSQFISASPRR  606
            Q+L QF+   P+R
Sbjct  125  QALGQFL--GPKR  135



>ref|XP_010460807.1| PREDICTED: F-box protein At1g30200 [Camelina sativa]
Length=384

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 86/133 (65%), Gaps = 15/133 (11%)
 Frame = +1

Query  247  VRPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqv  411
            +R D   R++PEP      DHFD LPDSL+LL+F+ + DVK LGRCC+VS+RFHSLVP V
Sbjct  5    LRTDPVSRIHPEPQSPTSFDHFDLLPDSLLLLIFDKVADVKDLGRCCIVSRRFHSLVPFV  64

Query  412  dnvvvrvdcvisdEDGsspsssaaaaaaasDKSR--------HPISSILRLVFTGLLKPF  567
            +NV+VRVDCVISD+D SS   +      + + +            S++ RLVF  + KPF
Sbjct  65   ENVLVRVDCVISDDDSSSSDDNNNNRRFSLNAASISDAVAVGGSFSALFRLVFAPIFKPF  124

Query  568  QSLSQFISASPRR  606
            Q+L QF+   P+R
Sbjct  125  QALGQFL--GPKR  135



>gb|KDO80923.1| hypothetical protein CISIN_1g041814mg [Citrus sinensis]
Length=316

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +DHFD+LPD+LILL+F+ + DVK L RC  VSKRF+SL
Sbjct  1    MDHFDQLPDALILLIFSSVSDVKTLIRCRSVSKRFNSL  38



>ref|XP_010499543.1| PREDICTED: F-box protein At1g30200-like isoform X1 [Camelina 
sativa]
 ref|XP_010499544.1| PREDICTED: F-box protein At1g30200-like isoform X2 [Camelina 
sativa]
Length=383

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 85/133 (64%), Gaps = 15/133 (11%)
 Frame = +1

Query  247  VRPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqv  411
            +R D   R++PEP      DHFD LPDSL+LL+F+ + DVK LGRCC+VS+RFHSLVP V
Sbjct  5    LRSDPVSRIHPEPQSLTSFDHFDLLPDSLLLLIFDKVADVKDLGRCCIVSRRFHSLVPFV  64

Query  412  dnvvvrvdcvisdEDGsspsssaaaaaaasDKSR--------HPISSILRLVFTGLLKPF  567
            +NV+VRVDCVISD+D SS          + + +            S++ RLVF  + KPF
Sbjct  65   ENVLVRVDCVISDDDSSSDDDDNNNRRFSLNAASISDAVADGGSFSALFRLVFAPIFKPF  124

Query  568  QSLSQFISASPRR  606
            Q+L QF+   P+R
Sbjct  125  QALGQFL--GPKR  135



>ref|XP_010277597.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
Length=372

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E  DHFDRL DSL+ L+FN I D K LGRC  V KRF SL
Sbjct  8    EADDHFDRLHDSLLCLIFNKIQDAKTLGRCLAVCKRFSSL  47



>gb|KJB64313.1| hypothetical protein B456_010G042500 [Gossypium raimondii]
Length=302

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +D FD+LPDSLILL+FN + DVK+L RC  VSKRF+SL
Sbjct  1    MDGFDQLPDSLILLIFNSVSDVKSLIRCRSVSKRFNSL  38



>ref|XP_009406821.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009406822.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=353

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            D FDR+PD LIL++FN + D ++LGRC  VS+RF SL
Sbjct  16   DQFDRIPDPLILVIFNKLADARSLGRCAAVSRRFRSL  52



>ref|XP_003568215.1| PREDICTED: F-box protein At5g46170-like [Brachypodium distachyon]
Length=356

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 5/50 (10%)
 Frame = +1

Query  265  CRVYPEPV-----DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +PV     D FD LPDSL+LL+ N + DV++LGRC   SKRF+ L
Sbjct  5    ARIHADPVLEFEVDQFDCLPDSLVLLILNKVEDVRSLGRCSAASKRFYGL  54



>ref|XP_002279458.1| PREDICTED: F-box protein At5g46170-like [Vitis vinifera]
Length=341

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +1

Query  283  PVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            P DHFDRL D L+ L+FN + D K+L RC VVSKRF SL
Sbjct  7    PDDHFDRLSDELVTLIFNKVLDAKSLCRCSVVSKRFASL  45



>ref|XP_004961674.1| PREDICTED: F-box protein At4g18380-like [Setaria italica]
Length=354

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +PV   D FD LPDSL+LL+ N + DV++LGRC  VSKRF  L
Sbjct  5    ARIHADPVLEVDQFDCLPDSLVLLILNKVEDVRSLGRCSAVSKRFCGL  52



>gb|ACR36872.1| unknown [Zea mays]
Length=354

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +PV   DHFD LPDSL+LL+ N + DV++LGRC  VSKR   L
Sbjct  5    ARIHADPVREVDHFDCLPDSLVLLILNKVEDVRSLGRCYAVSKRLCGL  52



>ref|XP_008654796.1| PREDICTED: uncharacterized protein LOC100279399 isoform X1 [Zea 
mays]
 gb|ACF85349.1| unknown [Zea mays]
 gb|AFW82355.1| F-box domain containing protein isoform 1 [Zea mays]
 gb|AFW82356.1| F-box domain containing protein isoform 2 [Zea mays]
Length=354

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +PV   DHFD LPDSL+LL+ N + DV++LGRC  VSKR   L
Sbjct  5    ARIHADPVREVDHFDCLPDSLVLLILNKVEDVRSLGRCYAVSKRLCGL  52



>ref|XP_002313372.1| hypothetical protein POPTR_0009s05230g [Populus trichocarpa]
 gb|EEE87327.1| hypothetical protein POPTR_0009s05230g [Populus trichocarpa]
Length=361

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            D FDRLPD+L+L++FN +GD K+L RC  VSKRF SL
Sbjct  26   DCFDRLPDALLLVIFNKVGDAKSLTRCISVSKRFASL  62



>gb|ACG36557.1| F-box domain containing protein [Zea mays]
Length=354

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +PV   DHFD LPDSL+LL+ N + DV++LGRC  VSKR   L
Sbjct  5    ARIHADPVREVDHFDCLPDSLVLLILNKVEDVRSLGRCYAVSKRLCGL  52



>ref|NP_001130615.1| uncharacterized LOC100191714 [Zea mays]
 gb|ACF78905.1| unknown [Zea mays]
 gb|ACF81071.1| unknown [Zea mays]
 gb|ACL52912.1| unknown [Zea mays]
 gb|ACR35595.1| unknown [Zea mays]
 gb|AFW78474.1| F-box domain containing protein isoform 1 [Zea mays]
 gb|AFW78475.1| F-box domain containing protein isoform 2 [Zea mays]
Length=354

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +PV   DHFD LPDSL+LL+ N + DV++LGRC  VSKR   L
Sbjct  5    ARIHADPVREVDHFDCLPDSLVLLILNKVEDVRSLGRCYAVSKRLCGL  52



>gb|ACG44263.1| F-box domain containing protein [Zea mays]
Length=354

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +PV   DHFD LPDSL+LL+ N + DV++LGRC  VSKR   L
Sbjct  5    ARIHADPVREVDHFDCLPDSLVLLILNKVEDVRSLGRCYAVSKRLCGL  52



>ref|XP_002441291.1| hypothetical protein SORBIDRAFT_09g023970 [Sorghum bicolor]
 gb|EES19721.1| hypothetical protein SORBIDRAFT_09g023970 [Sorghum bicolor]
Length=354

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +PV   DHFD LPDSL+LL+ N + DV++LGRC  VSKR   L
Sbjct  5    ARIHADPVREVDHFDCLPDSLVLLILNKVEDVRSLGRCYAVSKRLCGL  52



>ref|XP_007015207.1| F-box family protein, putative [Theobroma cacao]
 gb|EOY32826.1| F-box family protein, putative [Theobroma cacao]
Length=354

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            D+FDRLPD+L+L +FN + D K+LG C +VSKRF SL
Sbjct  12   DNFDRLPDALLLFIFNKLQDAKSLGNCLLVSKRFFSL  48



>ref|XP_008445343.1| PREDICTED: F-box protein At1g22220 [Cucumis melo]
Length=348

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  271  VYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            ++    D FD LPDSLILL+FN + DVK L RC  VSKRF+SL
Sbjct  20   IHTNDHDGFDSLPDSLILLIFNSVSDVKTLIRCRAVSKRFNSL  62



>ref|NP_001145883.1| uncharacterized protein LOC100279399 [Zea mays]
 gb|ACL52786.1| unknown [Zea mays]
Length=354

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +PV   DHFD LPDSL+LL+ N + DV++LGRC  VSKR   L
Sbjct  5    ARIHVDPVREVDHFDCLPDSLVLLILNKVEDVRSLGRCYAVSKRLCGL  52



>ref|XP_007227716.1| hypothetical protein PRUPE_ppa009011mg [Prunus persica]
 gb|EMJ28915.1| hypothetical protein PRUPE_ppa009011mg [Prunus persica]
Length=310

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +D FDRLPDSLIL +F+++ DVK L RC  VSKRF+SL
Sbjct  1    MDGFDRLPDSLILQIFDLVSDVKTLIRCRAVSKRFNSL  38



>ref|XP_003558028.1| PREDICTED: F-box protein At5g46170-like [Brachypodium distachyon]
Length=372

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  292  HFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            HFD +PDSL+LL+FN + D ++LGRC  VS+RF++L
Sbjct  23   HFDSVPDSLVLLIFNKLADARSLGRCSAVSRRFNAL  58



>ref|XP_011016269.1| PREDICTED: F-box protein At1g22220 [Populus euphratica]
Length=323

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E ++ FDRLPDSLILL+FN I D+K L  C  VSKRF+SL
Sbjct  10   EAMNGFDRLPDSLILLIFNSISDIKTLICCRSVSKRFNSL  49



>ref|XP_006386402.1| hypothetical protein POPTR_0002s09520g [Populus trichocarpa]
 gb|ERP64199.1| hypothetical protein POPTR_0002s09520g [Populus trichocarpa]
Length=323

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E ++ FDRLPDSLILL+FN I D+K L  C  VSKRF+SL
Sbjct  10   EAMNGFDRLPDSLILLIFNSISDIKTLICCRSVSKRFNSL  49



>ref|NP_564350.1| F-box protein [Arabidopsis thaliana]
 ref|NP_973940.1| F-box protein [Arabidopsis thaliana]
 sp|Q9C534.1|FB19_ARATH RecName: Full=F-box protein At1g30200 [Arabidopsis thaliana]
 gb|AAG50568.1|AC073506_10 hypothetical protein [Arabidopsis thaliana]
 gb|AAG50853.1|AC074176_2 hypothetical protein [Arabidopsis thaliana]
 gb|AAK59838.1| At1g30200/F12P21_1 [Arabidopsis thaliana]
 gb|AAL24254.1| At1g30200/F12P21_1 [Arabidopsis thaliana]
 gb|AAN18072.1| At1g30200/F12P21_1 [Arabidopsis thaliana]
 gb|AEE31190.1| F-box protein [Arabidopsis thaliana]
 gb|AEE31191.1| F-box protein [Arabidopsis thaliana]
Length=379

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 78/130 (60%), Gaps = 12/130 (9%)
 Frame = +1

Query  247  VRPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqv  411
            +R D   R++PEP      DHFD LPDSL+LL+F+ + DVK LGRCC+VS+RFHSLVP V
Sbjct  5    LRSDPVSRIHPEPQSLTSFDHFDLLPDSLLLLIFDKVADVKDLGRCCIVSRRFHSLVPFV  64

Query  412  dnvv-----vrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSL  576
            +NV+     V  D   S  D +   S   A+ + +  +    S++ RLVF  + KPFQ L
Sbjct  65   ENVLVRVDCVISDDDSSSSDENHRFSLNTASISDAGGAGGSFSALFRLVFAPIFKPFQML  124

Query  577  SQFISASPRR  606
             Q +   P+R
Sbjct  125  GQIL--GPKR  132



>ref|XP_002284195.1| PREDICTED: F-box protein At1g22220 [Vitis vinifera]
Length=320

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            D FDRLPD LIL++FN + D+K L RC  VSKRF+SL
Sbjct  7    DSFDRLPDPLILVIFNSVADIKTLIRCRAVSKRFNSL  43



>ref|XP_003564454.1| PREDICTED: F-box protein At5g46170-like [Brachypodium distachyon]
Length=354

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 68/107 (64%), Gaps = 8/107 (7%)
 Frame = +1

Query  265  CRVYPEP---VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvd  435
             R++ +P   +D  D LPD+L+LL+ N + DV++LGRC  VSKRF+ LVP V +V V++D
Sbjct  5    ARIHADPALQLDQIDCLPDALVLLILNKLEDVRSLGRCSAVSKRFNELVPLVHDVYVKID  64

Query  436  cvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSL  576
             V++  DG +  +   ++     K+RH  S  ++L+   ++KPF S+
Sbjct  65   RVVTA-DGDADDAFNLSSP----KARHIFSHFIKLMLFTIVKPFHSM  106



>gb|AES87540.2| F-box plant-like protein, putative [Medicago truncatula]
Length=153

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 55/84 (65%), Gaps = 7/84 (8%)
 Frame = +1

Query  331  FNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKS  510
             N IGD KALGRCCVVS+ FHSLVPQV NVVVRV       D       + ++  +SDKS
Sbjct  17   LNKIGDFKALGRCCVVSRHFHSLVPQVANVVVRV-------DCVISDDDSNSSENSSDKS  69

Query  511  RHPISSILRLVFTGLLKPFQSLSQ  582
            R P  ++LRLVF G+ KP Q+L +
Sbjct  70   RGPFWNLLRLVFGGIAKPIQNLGE  93



>ref|XP_007018808.1| F-box family protein, putative [Theobroma cacao]
 gb|EOY16033.1| F-box family protein, putative [Theobroma cacao]
Length=304

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +D  D+LPDSLILL+FN + DVK L RC  VSKRF+SL
Sbjct  1    MDGLDQLPDSLILLIFNSVSDVKTLIRCRSVSKRFNSL  38



>ref|XP_004970320.1| PREDICTED: F-box protein At1g30200-like [Setaria italica]
Length=354

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = +1

Query  268  RVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            R++ +PV   D FD LPDSL+LL+ N + DV++LGRC  VS+RF  L
Sbjct  6    RIHADPVLEFDRFDCLPDSLVLLILNKLEDVRSLGRCSAVSRRFSCL  52



>ref|XP_008219667.1| PREDICTED: F-box protein At1g22220 [Prunus mume]
Length=324

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +D FDRLPDSLIL +F+ + DVK L RC  VSKRF+SL
Sbjct  1    MDGFDRLPDSLILQIFDSVSDVKTLIRCRAVSKRFNSL  38



>ref|XP_008374968.1| PREDICTED: F-box protein At1g22220-like [Malus domestica]
Length=320

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +D FDRLPDSLIL +F+ + D+K L RC  VSKRF+SL
Sbjct  1    MDGFDRLPDSLILQIFDSVSDIKTLIRCRAVSKRFNSL  38



>ref|NP_001182880.1| hypothetical protein [Zea mays]
 gb|ACR35006.1| unknown [Zea mays]
 tpg|DAA57163.1| TPA: hypothetical protein ZEAMMB73_107043 [Zea mays]
Length=350

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 67/114 (59%), Gaps = 8/114 (7%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvd  435
             R++ +PV   D FD L DSL+LL+ N + DV++LGRC  VSKRF  LV  V +V V++D
Sbjct  5    ARIHADPVHEFDQFDCLHDSLVLLILNKLEDVRSLGRCSAVSKRFSGLVLLVHDVRVKID  64

Query  436  cvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFISAS  597
             V++ + G+  + + ++      K  + IS + +++   + KPF  +   ISA 
Sbjct  65   HVVTVDGGADDALNLSSP-----KPHNIISHLFKMMLFAIAKPFHDMRSPISAG  113



>ref|XP_009369664.1| PREDICTED: F-box protein At1g22220 [Pyrus x bretschneideri]
Length=323

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +D FDRLPDSLIL +F+ + D+K L RC  VSKRF+SL
Sbjct  1    MDGFDRLPDSLILQIFDSVSDIKTLIRCRAVSKRFNSL  38



>ref|XP_002513900.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48483.1| conserved hypothetical protein [Ricinus communis]
Length=303

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +D FDRLPDSLI+L+FN +  +K L RC  VSKRF+SL
Sbjct  1    MDGFDRLPDSLIVLIFNSVSHIKTLIRCRSVSKRFNSL  38



>dbj|BAB90386.1| P0432B10.4 [Oryza sativa Japonica Group]
Length=451

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 3/50 (6%)
 Frame = +1

Query  259  LSCRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            L  R++ +P    D FD LPD ++LL+ N + DV++LGRC  VSKRF  L
Sbjct  95   LRARIHADPAPEFDQFDCLPDPVVLLILNKLEDVRSLGRCAAVSKRFSGL  144



>ref|XP_009786216.1| PREDICTED: F-box protein At1g78100 [Nicotiana sylvestris]
Length=345

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            D FDR+PD LI L+FN I D+K L RC  VSKRF+SL
Sbjct  9    DGFDRIPDPLINLIFNQISDIKTLIRCRSVSKRFNSL  45



>ref|XP_009600740.1| PREDICTED: F-box protein At1g78100 [Nicotiana tomentosiformis]
Length=344

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            D FDR+PD LI L+FN I D+K L RC  VSKRF+SL
Sbjct  9    DGFDRIPDPLINLIFNQISDIKTLIRCRSVSKRFNSL  45



>ref|XP_010105899.1| F-box protein [Morus notabilis]
 gb|EXC06718.1| F-box protein [Morus notabilis]
Length=348

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +D FD+LPDSLILL+FN + D+K L RC  V +RF+SL
Sbjct  1    MDGFDQLPDSLILLIFNSVSDIKTLLRCRAVCQRFNSL  38



>ref|XP_004237895.1| PREDICTED: F-box protein At1g78100 [Solanum lycopersicum]
 ref|XP_010320162.1| PREDICTED: F-box protein At1g78100 [Solanum lycopersicum]
 ref|XP_010320163.1| PREDICTED: F-box protein At1g78100 [Solanum lycopersicum]
 ref|XP_010320164.1| PREDICTED: F-box protein At1g78100 [Solanum lycopersicum]
Length=340

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            D FDRLPD LI L+FN I D+K L RC  VSKRF+SL
Sbjct  9    DGFDRLPDPLIHLMFNQISDIKTLIRCRSVSKRFNSL  45



>ref|XP_006353995.1| PREDICTED: F-box protein At1g78100-like isoform X1 [Solanum tuberosum]
 ref|XP_006353996.1| PREDICTED: F-box protein At1g78100-like isoform X2 [Solanum tuberosum]
 ref|XP_006353997.1| PREDICTED: F-box protein At1g78100-like isoform X3 [Solanum tuberosum]
 ref|XP_006353998.1| PREDICTED: F-box protein At1g78100-like isoform X4 [Solanum tuberosum]
Length=340

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            D FDRLPD LI L+FN I D+K L RC  VSKRF+SL
Sbjct  9    DGFDRLPDPLIHLMFNQISDIKTLIRCRSVSKRFNSL  45



>ref|XP_010270680.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
 ref|XP_010270681.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
Length=351

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 63/95 (66%), Gaps = 5/95 (5%)
 Frame = +1

Query  292  HFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGssps  471
             FD++PDS++L++ N + D+++LGRC  V KRF+SLVP V +V +++D V++        
Sbjct  19   EFDKIPDSVVLIILNKLADIRSLGRCTAVCKRFNSLVPYVHDVYIKIDEVVTING-----  73

Query  472  ssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSL  576
             S  ++ ++S K R+  S++L+ +F  LLKPF  L
Sbjct  74   DSDESSYSSSHKPRNFFSNLLKYMFLNLLKPFHHL  108



>ref|XP_010269221.1| PREDICTED: F-box protein At1g22220-like [Nelumbo nucifera]
Length=346

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             D FDR+PD ++LL+FN + D+K+L RC  VSKRF+SL
Sbjct  8    TDVFDRIPDPIVLLIFNHLSDIKSLIRCRAVSKRFNSL  45



>ref|XP_010246617.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
 ref|XP_010246618.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
 ref|XP_010246619.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
 ref|XP_010246620.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
 ref|XP_010246621.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
Length=351

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 35/52 (67%), Gaps = 6/52 (12%)
 Frame = +1

Query  262  SCRVYPEPVD------HFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            S R+Y   +D       FD++PDS++L++ N + D+++LGRC  V KRF+SL
Sbjct  3    SNRIYYADLDDDVDQGEFDKIPDSVVLIILNKLADIRSLGRCTAVCKRFNSL  54



>dbj|BAJ85411.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=353

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = +1

Query  265  CRVYPEPV-----DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +P      D FD LPDS++LL+ N + DV++LGRC   SKRF+ L
Sbjct  5    ARIHADPALELEDDRFDCLPDSIVLLILNKVEDVRSLGRCSAASKRFNGL  54



>ref|XP_003605343.1| F-box protein [Medicago truncatula]
Length=227

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 55/84 (65%), Gaps = 7/84 (8%)
 Frame = +1

Query  331  FNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKS  510
             N IGD KALGRCCVVS+ FHSLVPQV NVVVRV       D       + ++  +SDKS
Sbjct  91   LNKIGDFKALGRCCVVSRHFHSLVPQVANVVVRV-------DCVISDDDSNSSENSSDKS  143

Query  511  RHPISSILRLVFTGLLKPFQSLSQ  582
            R P  ++LRLVF G+ KP Q+L +
Sbjct  144  RGPFWNLLRLVFGGIAKPIQNLGE  167



>ref|NP_001044594.1| Os01g0812200 [Oryza sativa Japonica Group]
 dbj|BAD68209.1| F-box protein family-like [Oryza sativa Japonica Group]
 dbj|BAF06508.1| Os01g0812200 [Oryza sativa Japonica Group]
 gb|EAZ13910.1| hypothetical protein OsJ_03835 [Oryza sativa Japonica Group]
 dbj|BAG93081.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96606.1| unnamed protein product [Oryza sativa Japonica Group]
Length=353

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +P    D FD LPD ++LL+ N + DV++LGRC  VSKRF  L
Sbjct  5    ARIHADPAPEFDQFDCLPDPVVLLILNKLEDVRSLGRCAAVSKRFSGL  52



>ref|XP_011032098.1| PREDICTED: F-box protein At4g18380-like [Populus euphratica]
Length=342

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            D FDRLPD+L+L++FN + D K+L RC  VSKRF SL
Sbjct  7    DCFDRLPDALLLVIFNKVVDAKSLTRCISVSKRFASL  43



>gb|EAY76237.1| hypothetical protein OsI_04173 [Oryza sativa Indica Group]
Length=353

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +P    D FD LPD ++LL+ N + DV++LGRC  VSKRF  L
Sbjct  5    ARIHADPAPEFDQFDCLPDPVVLLILNKLEDVRSLGRCAAVSKRFSGL  52



>dbj|BAJ87191.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=354

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +1

Query  277  PEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            PEP D  D LPDSL+LL+ N + DV +LGRC  VS+RF+ L
Sbjct  14   PEP-DRMDCLPDSLVLLILNKLEDVHSLGRCSAVSRRFNEL  53



>emb|CDM84680.1| unnamed protein product [Triticum aestivum]
Length=354

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 33/49 (67%), Gaps = 4/49 (8%)
 Frame = +1

Query  265  CRVYPEP----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +P    +D  D LPDSL+LL+ N + DV +LGRC  VSKRF+ L
Sbjct  5    ARIHADPAAPELDRIDCLPDSLVLLILNKLEDVHSLGRCAAVSKRFNDL  53



>ref|XP_006470730.1| PREDICTED: F-box protein At4g18380-like [Citrus sinensis]
Length=345

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +P D+FD LPD+++L +FN + D K+L RC VV KRF SL
Sbjct  10   KPDDYFDSLPDAILLDIFNKLLDAKSLTRCLVVCKRFSSL  49



>ref|XP_010535602.1| PREDICTED: F-box protein At1g78100-like [Tarenaya hassleriana]
Length=323

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +D FDRLPD+L+L + N +GDVK L RC  VSKR +SL
Sbjct  1    MDLFDRLPDTLVLDILNRVGDVKTLIRCRSVSKRLNSL  38



>gb|EMT09581.1| hypothetical protein F775_20146 [Aegilops tauschii]
Length=356

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = +1

Query  265  CRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +P     +D FD LPDSL+LL+ N + DV++LGRC   SKR + L
Sbjct  5    ARIHADPALDFELDLFDCLPDSLVLLILNKVEDVRSLGRCSAASKRLNGL  54



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660