BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF008P23

Length=505
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002276757.1|  PREDICTED: glycerophosphodiester phosphodies...    149   3e-38   Vitis vinifera
ref|XP_010324292.1|  PREDICTED: glycerophosphodiester phosphodies...    147   1e-37   Solanum lycopersicum
ref|XP_009787408.1|  PREDICTED: probable glycerophosphoryl dieste...    144   8e-37   Nicotiana sylvestris
ref|XP_009625976.1|  PREDICTED: probable glycerophosphoryl dieste...    142   7e-36   Nicotiana tomentosiformis
ref|XP_010270134.1|  PREDICTED: glycerophosphodiester phosphodies...    140   4e-35   Nelumbo nucifera [Indian lotus]
emb|CAN61355.1|  hypothetical protein VITISV_027762                     138   6e-35   Vitis vinifera
ref|XP_006346174.1|  PREDICTED: probable glycerophosphoryl dieste...    137   3e-34   Solanum tuberosum [potatoes]
ref|XP_011097815.1|  PREDICTED: glycerophosphodiester phosphodies...    135   2e-33   Sesamum indicum [beniseed]
gb|EYU33686.1|  hypothetical protein MIMGU_mgv1a001772mg                135   3e-33   Erythranthe guttata [common monkey flower]
gb|KJB62955.1|  hypothetical protein B456_009G445400                    134   4e-33   Gossypium raimondii
ref|XP_006344880.1|  PREDICTED: probable glycerophosphoryl dieste...    134   4e-33   Solanum tuberosum [potatoes]
gb|KHG12016.1|  putative glycerophosphoryl diester phosphodiester...    134   6e-33   Gossypium arboreum [tree cotton]
ref|XP_009798152.1|  PREDICTED: probable glycerophosphoryl dieste...    130   2e-32   Nicotiana sylvestris
gb|KDO62177.1|  hypothetical protein CISIN_1g003550mg                   130   3e-32   Citrus sinensis [apfelsine]
gb|KDO62176.1|  hypothetical protein CISIN_1g003550mg                   131   4e-32   Citrus sinensis [apfelsine]
gb|KHG08046.1|  putative glycerophosphoryl diester phosphodiester...    131   5e-32   Gossypium arboreum [tree cotton]
ref|XP_006452490.1|  hypothetical protein CICLE_v10007536mg             131   5e-32   Citrus clementina [clementine]
ref|XP_006474966.1|  PREDICTED: probable glycerophosphoryl dieste...    131   6e-32   Citrus sinensis [apfelsine]
gb|KDO62175.1|  hypothetical protein CISIN_1g003550mg                   131   6e-32   Citrus sinensis [apfelsine]
gb|KDO62174.1|  hypothetical protein CISIN_1g003550mg                   131   7e-32   Citrus sinensis [apfelsine]
ref|XP_011095489.1|  PREDICTED: glycerophosphodiester phosphodies...    130   1e-31   Sesamum indicum [beniseed]
ref|XP_009108190.1|  PREDICTED: probable glycerophosphoryl dieste...    129   2e-31   Brassica rapa
ref|XP_008447692.1|  PREDICTED: probable glycerophosphoryl dieste...    129   2e-31   Cucumis melo [Oriental melon]
gb|KJB13801.1|  hypothetical protein B456_002G094900                    129   3e-31   Gossypium raimondii
gb|KJB13800.1|  hypothetical protein B456_002G094900                    129   3e-31   Gossypium raimondii
ref|XP_009105134.1|  PREDICTED: probable glycerophosphoryl dieste...    129   3e-31   Brassica rapa
gb|KJB13799.1|  hypothetical protein B456_002G094900                    129   3e-31   Gossypium raimondii
emb|CDY60410.1|  BnaC02g45300D                                          119   2e-30   Brassica napus [oilseed rape]
ref|XP_002888565.1|  glycerophosphoryl diester phosphodiesterase ...    127   2e-30   
ref|XP_010470590.1|  PREDICTED: glycerophosphodiester phosphodies...    118   3e-30   
ref|XP_003530777.1|  PREDICTED: probable glycerophosphoryl dieste...    126   4e-30   Glycine max [soybeans]
gb|KHM99500.1|  Putative glycerophosphoryl diester phosphodiester...    126   4e-30   Glycine soja [wild soybean]
ref|XP_010422831.1|  PREDICTED: glycerophosphodiester phosphodies...    117   1e-29   
ref|XP_006300798.1|  hypothetical protein CARUB_v10019878mg             124   1e-29   
gb|AAF98210.1|AC007152_6  Unknown protein                               125   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004251903.1|  PREDICTED: glycerophosphodiester phosphodies...    124   1e-29   Solanum lycopersicum
ref|XP_006300799.1|  hypothetical protein CARUB_v10019878mg             124   2e-29   
ref|XP_006300797.1|  hypothetical protein CARUB_v10019878mg             124   2e-29   
ref|XP_010511612.1|  PREDICTED: glycerophosphodiester phosphodies...    124   2e-29   Camelina sativa [gold-of-pleasure]
emb|CDP13760.1|  unnamed protein product                                124   3e-29   Coffea canephora [robusta coffee]
emb|CDY61647.1|  BnaCnng38120D                                          124   3e-29   Brassica napus [oilseed rape]
ref|XP_010536709.1|  PREDICTED: glycerophosphodiester phosphodies...    124   3e-29   Tarenaya hassleriana [spider flower]
ref|XP_010545263.1|  PREDICTED: glycerophosphodiester phosphodies...    124   3e-29   Tarenaya hassleriana [spider flower]
ref|NP_176870.2|  suppressor of npr1-1 constitutive 4                   124   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009127510.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    123   3e-29   Brassica rapa
ref|XP_006401453.1|  hypothetical protein EUTSA_v10012748mg             122   7e-29   Eutrema salsugineum [saltwater cress]
ref|XP_006279181.1|  hypothetical protein CARUB_v10007932mg             122   9e-29   
ref|XP_004150252.1|  PREDICTED: probable glycerophosphoryl dieste...    122   9e-29   Cucumis sativus [cucumbers]
ref|XP_010511610.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    122   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010099974.1|  putative glycerophosphoryl diester phosphodi...    122   1e-28   
ref|XP_006279182.1|  hypothetical protein CARUB_v10007932mg             122   1e-28   Capsella rubella
ref|XP_009127509.1|  PREDICTED: probable glycerophosphoryl dieste...    114   1e-28   Brassica rapa
emb|CDY12601.1|  BnaA02g12690D                                          114   1e-28   Brassica napus [oilseed rape]
ref|XP_007020654.1|  PLC-like phosphodiesterase family protein, p...    119   1e-28   
ref|XP_006300773.1|  hypothetical protein CARUB_v10019847mg             121   2e-28   
gb|KDP39221.1|  hypothetical protein JCGZ_00978                         121   2e-28   Jatropha curcas
emb|CDY14478.1|  BnaC03g21170D                                          122   2e-28   Brassica napus [oilseed rape]
ref|XP_010438711.1|  PREDICTED: glycerophosphodiester phosphodies...    121   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_007020652.1|  PLC-like phosphodiesterase family protein, p...    121   2e-28   
ref|XP_007020653.1|  PLC-like phosphodiesterase family protein, p...    121   2e-28   
ref|XP_006391459.1|  hypothetical protein EUTSA_v10018170mg             120   3e-28   Eutrema salsugineum [saltwater cress]
ref|XP_010253010.1|  PREDICTED: glycerophosphodiester phosphodies...    120   3e-28   Nelumbo nucifera [Indian lotus]
gb|AAP40466.1|  unknown protein                                         120   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010470589.1|  PREDICTED: glycerophosphodiester phosphodies...    120   3e-28   Camelina sativa [gold-of-pleasure]
ref|XP_002529027.1|  glycerophosphoryl diester phosphodiesterase,...    120   3e-28   Ricinus communis
ref|NP_176869.2|  putative glycerophosphoryl diester phosphodiest...    120   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010448228.1|  PREDICTED: glycerophosphodiester phosphodies...    120   3e-28   Camelina sativa [gold-of-pleasure]
emb|CDY13237.1|  BnaC09g24190D                                          120   3e-28   Brassica napus [oilseed rape]
ref|XP_002888566.1|  kinase family protein                              121   4e-28   
gb|KFK27133.1|  hypothetical protein AALP_AA8G339300                    120   6e-28   Arabis alpina [alpine rockcress]
ref|XP_010433460.1|  PREDICTED: glycerophosphodiester phosphodies...    119   7e-28   
ref|XP_008227060.1|  PREDICTED: probable glycerophosphoryl dieste...    119   1e-27   Prunus mume [ume]
ref|XP_006280048.1|  hypothetical protein CARUB_v10025925mg             119   1e-27   Capsella rubella
ref|XP_010449676.1|  PREDICTED: glycerophosphodiester phosphodies...    119   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_002867546.1|  MRH5/SHV3                                          118   2e-27   
gb|KFK29182.1|  hypothetical protein AALP_AA7G100300                    118   3e-27   Arabis alpina [alpine rockcress]
ref|XP_009132384.1|  PREDICTED: probable glycerophosphoryl dieste...    117   3e-27   Brassica rapa
ref|XP_007214645.1|  hypothetical protein PRUPE_ppa001847mg             117   3e-27   Prunus persica
ref|XP_010511611.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    118   4e-27   
ref|XP_002300353.2|  glycerophosphoryl diester phosphodiesterase ...    115   4e-27   
ref|NP_200359.1|  putative glycerophosphoryl diester phosphodiest...    117   5e-27   Arabidopsis thaliana [mouse-ear cress]
emb|CDY36746.1|  BnaA03g11400D                                          117   5e-27   Brassica napus [oilseed rape]
ref|XP_011013351.1|  PREDICTED: glycerophosphodiester phosphodies...    117   7e-27   Populus euphratica
ref|XP_010443178.1|  PREDICTED: glycerophosphodiester phosphodies...    116   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010482994.1|  PREDICTED: glycerophosphodiester phosphodies...    116   1e-26   Camelina sativa [gold-of-pleasure]
emb|CDY11996.1|  BnaC03g14220D                                          116   1e-26   Brassica napus [oilseed rape]
ref|XP_011014930.1|  PREDICTED: glycerophosphodiester phosphodies...    116   1e-26   Populus euphratica
ref|XP_011014752.1|  PREDICTED: glycerophosphodiester phosphodies...    116   1e-26   Populus euphratica
gb|AAL07129.1|  unknown protein                                         116   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567755.1|  glycerophosphoryl diester phosphodiesterase-like 3    116   1e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CAB36515.1|  putative protein                                       115   2e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CDY71959.1|  BnaCnng75290D                                          112   2e-26   Brassica napus [oilseed rape]
emb|CDX94294.1|  BnaC01g18900D                                          115   2e-26   
ref|XP_007146559.1|  hypothetical protein PHAVU_006G050800g             115   2e-26   Phaseolus vulgaris [French bean]
ref|XP_010496109.1|  PREDICTED: glycerophosphodiester phosphodies...    115   3e-26   
ref|XP_009137635.1|  PREDICTED: probable glycerophosphoryl dieste...    115   3e-26   Brassica rapa
ref|XP_010675854.1|  PREDICTED: glycerophosphodiester phosphodies...    115   4e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010252664.1|  PREDICTED: glycerophosphodiester phosphodies...    114   4e-26   Nelumbo nucifera [Indian lotus]
ref|XP_009142640.1|  PREDICTED: probable glycerophosphoryl dieste...    114   5e-26   Brassica rapa
emb|CDX89312.1|  BnaA01g15810D                                          114   5e-26   
ref|XP_010913178.1|  PREDICTED: glycerophosphodiester phosphodies...    114   5e-26   
ref|XP_006283180.1|  hypothetical protein CARUB_v10004210mg             114   6e-26   Capsella rubella
ref|XP_010913177.1|  PREDICTED: glycerophosphodiester phosphodies...    114   7e-26   Elaeis guineensis
emb|CDY46687.1|  BnaA03g48210D                                          113   9e-26   Brassica napus [oilseed rape]
ref|XP_009137609.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    114   9e-26   Brassica rapa
ref|XP_009361078.1|  PREDICTED: probable glycerophosphoryl dieste...    113   1e-25   Pyrus x bretschneideri [bai li]
ref|XP_010496108.1|  PREDICTED: glycerophosphodiester phosphodies...    113   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_002864395.1|  glycerophosphoryl diester phosphodiesterase ...    113   1e-25   
ref|XP_002300351.2|  hypothetical protein POPTR_0001s37160g             113   1e-25   Populus trichocarpa [western balsam poplar]
ref|XP_007146552.1|  hypothetical protein PHAVU_006G050300g             113   1e-25   Phaseolus vulgaris [French bean]
ref|XP_009588257.1|  PREDICTED: probable glycerophosphoryl dieste...    113   1e-25   
ref|XP_009120058.1|  PREDICTED: probable glycerophosphoryl dieste...    113   1e-25   Brassica rapa
emb|CDY58867.1|  BnaC09g52640D                                          112   2e-25   Brassica napus [oilseed rape]
emb|CDY17323.1|  BnaA10g09570D                                          112   2e-25   Brassica napus [oilseed rape]
emb|CDX86765.1|  BnaA09g21550D                                          106   2e-25   
ref|XP_010252665.1|  PREDICTED: glycerophosphodiester phosphodies...    112   2e-25   Nelumbo nucifera [Indian lotus]
ref|XP_006297062.1|  hypothetical protein CARUB_v10013062mg             112   2e-25   Capsella rubella
emb|CDX92806.1|  BnaC07g40640D                                          112   3e-25   
ref|XP_006413151.1|  hypothetical protein EUTSA_v10024494mg             112   4e-25   Eutrema salsugineum [saltwater cress]
emb|CDY12600.1|  BnaA02g12680D                                          112   4e-25   Brassica napus [oilseed rape]
ref|XP_009127505.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    112   6e-25   
ref|XP_004294052.1|  PREDICTED: glycerophosphodiester phosphodies...    111   6e-25   Fragaria vesca subsp. vesca
ref|XP_009396661.1|  PREDICTED: probable glycerophosphoryl dieste...    111   7e-25   
emb|CDX86766.1|  BnaA09g21560D                                          110   7e-25   
ref|XP_010419030.1|  PREDICTED: glycerophosphodiester phosphodies...    110   9e-25   
emb|CDY60415.1|  BnaC02g45340D                                          111   9e-25   Brassica napus [oilseed rape]
emb|CDX92782.1|  BnaC07g40400D                                          111   1e-24   
ref|XP_010415240.1|  PREDICTED: glycerophosphodiester phosphodies...    110   1e-24   Camelina sativa [gold-of-pleasure]
gb|EYU27402.1|  hypothetical protein MIMGU_mgv1a001806mg                110   1e-24   Erythranthe guttata [common monkey flower]
gb|AAO42211.1|  unknown protein                                         110   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188688.1|  glycerophosphodiester phosphodiesterase-like pr...    110   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007020655.1|  SHV3-like 2, putative isoform 4                    108   2e-24   
ref|XP_006406374.1|  hypothetical protein EUTSA_v10020151mg             108   4e-24   
emb|CDY19634.1|  BnaA05g20420D                                          108   5e-24   Brassica napus [oilseed rape]
ref|XP_009145621.1|  PREDICTED: probable glycerophosphoryl dieste...    108   5e-24   Brassica rapa
ref|XP_002883252.1|  glycerophosphoryl diester phosphodiesterase ...    108   7e-24   
ref|XP_004500131.1|  PREDICTED: probable glycerophosphoryl dieste...    108   7e-24   Cicer arietinum [garbanzo]
ref|XP_008806340.1|  PREDICTED: probable glycerophosphoryl dieste...    108   7e-24   Phoenix dactylifera
gb|KCW78936.1|  hypothetical protein EUGRSUZ_C00368                     108   9e-24   Eucalyptus grandis [rose gum]
ref|NP_001185333.1|  putative glycerophosphoryl diester phosphodi...    107   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003579951.1|  PREDICTED: glycerophosphodiester phosphodies...    107   1e-23   Brachypodium distachyon [annual false brome]
dbj|BAD17454.1|  glycerophosphoryl diester phosphodiesterase 2 pr...    101   1e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010474169.1|  PREDICTED: glycerophosphodiester phosphodies...    105   1e-23   
gb|KHN28414.1|  Putative glycerophosphoryl diester phosphodiester...    107   2e-23   Glycine soja [wild soybean]
emb|CDY46667.1|  BnaA03g48410D                                          108   2e-23   Brassica napus [oilseed rape]
ref|XP_003553031.1|  PREDICTED: probable glycerophosphoryl dieste...    107   2e-23   
ref|XP_004293798.1|  PREDICTED: glycerophosphodiester phosphodies...    107   2e-23   Fragaria vesca subsp. vesca
ref|XP_003530776.1|  PREDICTED: probable glycerophosphoryl dieste...    106   2e-23   Glycine max [soybeans]
gb|KHM99502.1|  Putative glycerophosphoryl diester phosphodiester...    106   2e-23   Glycine soja [wild soybean]
ref|XP_007142367.1|  hypothetical protein PHAVU_008G274300g             106   3e-23   Phaseolus vulgaris [French bean]
ref|XP_009415406.1|  PREDICTED: probable glycerophosphoryl dieste...    106   3e-23   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI18678.3|  unnamed protein product                                106   3e-23   Vitis vinifera
ref|XP_007146553.1|  hypothetical protein PHAVU_006G0504001g            105   4e-23   Phaseolus vulgaris [French bean]
ref|XP_010656583.1|  PREDICTED: glycerophosphodiester phosphodies...    106   4e-23   Vitis vinifera
ref|XP_002862842.1|  glycerophosphoryl diester phosphodiesterase ...    106   4e-23   
gb|AES70468.2|  glycerophosphoryl diester phosphodiesterase famil...    105   5e-23   Medicago truncatula
ref|XP_003600217.1|  Glycerophosphodiesterase-like protein              105   6e-23   
ref|XP_007146557.1|  hypothetical protein PHAVU_006G050600g             105   7e-23   Phaseolus vulgaris [French bean]
gb|KHN28413.1|  Putative glycerophosphoryl diester phosphodiester...    105   9e-23   Glycine soja [wild soybean]
ref|XP_007146558.1|  hypothetical protein PHAVU_006G050600g             105   1e-22   Phaseolus vulgaris [French bean]
ref|XP_009364631.1|  PREDICTED: probable glycerophosphoryl dieste...    102   1e-22   Pyrus x bretschneideri [bai li]
ref|XP_009348463.1|  PREDICTED: probable glycerophosphoryl dieste...    104   1e-22   Pyrus x bretschneideri [bai li]
ref|XP_009335427.1|  PREDICTED: probable glycerophosphoryl dieste...    104   2e-22   Pyrus x bretschneideri [bai li]
ref|XP_010675853.1|  PREDICTED: glycerophosphodiester phosphodies...    103   3e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001142429.1|  uncharacterized protein LOC100274608               101   3e-22   
gb|AFW58563.1|  hypothetical protein ZEAMMB73_741781                  98.6    3e-22   
gb|EMT15515.1|  Putative glycerophosphoryl diester phosphodiester...    103   3e-22   
gb|EMT29224.1|  Putative glycerophosphoryl diester phosphodiester...    103   4e-22   
ref|XP_008349893.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    101   4e-22   
ref|XP_006652401.1|  PREDICTED: probable glycerophosphoryl dieste...    103   5e-22   Oryza brachyantha
ref|XP_010943202.1|  PREDICTED: glycerophosphodiester phosphodies...    102   6e-22   Elaeis guineensis
ref|XP_008364336.1|  PREDICTED: probable glycerophosphoryl dieste...    102   6e-22   
ref|XP_010488033.1|  PREDICTED: glycerophosphodiester phosphodies...  99.4    6e-22   
ref|NP_001047275.1|  Os02g0588500                                       102   7e-22   
ref|NP_001053060.1|  Os04g0472300                                       102   7e-22   
emb|CAH67272.1|  B0806H07.1                                             102   7e-22   Oryza sativa [red rice]
ref|XP_008366428.1|  PREDICTED: probable glycerophosphoryl dieste...    102   8e-22   
ref|XP_006856834.1|  hypothetical protein AMTR_s00055p00174750          102   8e-22   Amborella trichopoda
gb|EMS58329.1|  putative glycerophosphoryl diester phosphodiester...    102   8e-22   Triticum urartu
ref|XP_004973845.1|  PREDICTED: probable glycerophosphoryl dieste...    102   9e-22   Setaria italica
ref|XP_008811210.1|  PREDICTED: probable glycerophosphoryl dieste...    101   1e-21   
ref|XP_004973844.1|  PREDICTED: probable glycerophosphoryl dieste...    102   1e-21   Setaria italica
ref|XP_006586115.1|  PREDICTED: probable glycerophosphoryl dieste...    101   1e-21   Glycine max [soybeans]
gb|EAY86479.1|  hypothetical protein OsI_07859                          101   1e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_004975931.1|  PREDICTED: probable glycerophosphoryl dieste...    102   1e-21   Setaria italica
ref|XP_008811209.1|  PREDICTED: probable glycerophosphoryl dieste...    101   2e-21   Phoenix dactylifera
gb|EMS62136.1|  putative glycerophosphoryl diester phosphodiester...    101   2e-21   Triticum urartu
ref|XP_003530778.1|  PREDICTED: probable glycerophosphoryl dieste...    101   2e-21   Glycine max [soybeans]
dbj|BAJ85772.1|  predicted protein                                      101   2e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87963.1|  predicted protein                                      101   2e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004979884.1|  PREDICTED: probable glycerophosphoryl dieste...    102   2e-21   Setaria italica
ref|XP_010687738.1|  PREDICTED: glycerophosphodiester phosphodies...    101   2e-21   Beta vulgaris subsp. vulgaris [field beet]
tpg|DAA63616.1|  TPA: hypothetical protein ZEAMMB73_629479            98.6    3e-21   
gb|AAV64200.1|  unknown                                               98.6    3e-21   Zea mays [maize]
emb|CDY36036.1|  BnaC03g41620D                                          100   4e-21   Brassica napus [oilseed rape]
ref|NP_001169682.1|  hypothetical protein precursor                     100   5e-21   Zea mays [maize]
ref|XP_010109457.1|  putative glycerophosphoryl diester phosphodi...    100   6e-21   Morus notabilis
gb|AAV64238.1|  unknown                                               97.4    7e-21   Zea mays [maize]
ref|XP_006344951.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...  97.4    7e-21   
ref|XP_010545539.1|  PREDICTED: glycerophosphodiester phosphodies...  99.8    8e-21   Tarenaya hassleriana [spider flower]
ref|NP_001168748.1|  uncharacterized protein LOC100382543 precursor   99.4    1e-20   Zea mays [maize]
gb|EMT33222.1|  Putative glycerophosphoryl diester phosphodiester...  99.4    1e-20   
ref|XP_009390640.1|  PREDICTED: probable glycerophosphoryl dieste...  99.4    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011033465.1|  PREDICTED: glycerophosphodiester phosphodies...  99.0    1e-20   Populus euphratica
ref|XP_002446646.1|  hypothetical protein SORBIDRAFT_06g019730        99.0    2e-20   Sorghum bicolor [broomcorn]
ref|XP_002308389.2|  hypothetical protein POPTR_0006s20170g           98.6    2e-20   
ref|XP_004491451.1|  PREDICTED: probable glycerophosphoryl dieste...  98.6    2e-20   Cicer arietinum [garbanzo]
gb|KFK39359.1|  hypothetical protein AALP_AA3G234500                  98.2    2e-20   Arabis alpina [alpine rockcress]
ref|XP_008799657.1|  PREDICTED: probable glycerophosphoryl dieste...  98.2    3e-20   Phoenix dactylifera
emb|CDY11831.1|  BnaC03g12570D                                        97.4    3e-20   Brassica napus [oilseed rape]
ref|XP_010064948.1|  PREDICTED: probable glycerophosphoryl dieste...  97.8    3e-20   
ref|XP_002452366.1|  hypothetical protein SORBIDRAFT_04g024440        97.8    4e-20   Sorghum bicolor [broomcorn]
ref|XP_004491450.1|  PREDICTED: probable glycerophosphoryl dieste...  97.4    5e-20   Cicer arietinum [garbanzo]
ref|XP_002445920.1|  hypothetical protein SORBIDRAFT_07g028050        97.4    5e-20   
ref|XP_006829998.1|  hypothetical protein AMTR_s00252p00015420        97.1    6e-20   Amborella trichopoda
ref|XP_002866252.1|  glycerophosphoryl diester phosphodiesterase ...  97.1    6e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_003544723.1|  PREDICTED: probable glycerophosphoryl dieste...  97.1    7e-20   Glycine max [soybeans]
gb|KHN23877.1|  Putative glycerophosphoryl diester phosphodiester...  97.1    7e-20   Glycine soja [wild soybean]
gb|AFW72078.1|  hypothetical protein ZEAMMB73_869244                  94.0    8e-20   
emb|CDX82243.1|  BnaA03g35780D                                        93.6    9e-20   
gb|KHN43860.1|  Putative glycerophosphoryl diester phosphodiester...  96.7    1e-19   Glycine soja [wild soybean]
ref|XP_003519608.1|  PREDICTED: probable glycerophosphoryl dieste...  96.7    1e-19   Glycine max [soybeans]
tpg|DAA47913.1|  TPA: hypothetical protein ZEAMMB73_887943            95.9    1e-19   
ref|XP_010241663.1|  PREDICTED: glycerophosphodiester phosphodies...  96.3    1e-19   Nelumbo nucifera [Indian lotus]
ref|NP_001170117.1|  hypothetical protein                             96.3    1e-19   Zea mays [maize]
ref|XP_008645839.1|  PREDICTED: uncharacterized protein LOC100384...  95.9    1e-19   
ref|XP_009132086.1|  PREDICTED: probable glycerophosphoryl dieste...  95.9    2e-19   Brassica rapa
emb|CDX88656.1|  BnaA03g09930D                                        95.5    2e-19   
emb|CDX71386.1|  BnaC04g16210D                                        90.9    2e-19   
ref|XP_007142366.1|  hypothetical protein PHAVU_008G274200g           95.5    3e-19   Phaseolus vulgaris [French bean]
ref|XP_003575252.1|  PREDICTED: glycerophosphodiester phosphodies...  95.1    3e-19   
ref|XP_008782908.1|  PREDICTED: probable glycerophosphoryl dieste...  95.1    3e-19   Phoenix dactylifera
ref|XP_010050300.1|  PREDICTED: probable glycerophosphoryl dieste...  95.1    3e-19   
ref|XP_008645878.1|  PREDICTED: probable glycerophosphoryl dieste...  95.1    3e-19   Zea mays [maize]
ref|XP_010913956.1|  PREDICTED: glycerophosphodiester phosphodies...  95.1    3e-19   Elaeis guineensis
ref|XP_009417318.1|  PREDICTED: probable glycerophosphoryl dieste...  94.7    4e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010928867.1|  PREDICTED: glycerophosphodiester phosphodies...  94.7    4e-19   Elaeis guineensis
ref|XP_011017989.1|  PREDICTED: glycerophosphodiester phosphodies...  94.4    6e-19   Populus euphratica
ref|XP_010483370.1|  PREDICTED: glycerophosphodiester phosphodies...  94.4    6e-19   Camelina sativa [gold-of-pleasure]
ref|XP_007011972.1|  SHV3-like 5                                      94.0    7e-19   
ref|XP_008798763.1|  PREDICTED: probable glycerophosphoryl dieste...  93.6    9e-19   Phoenix dactylifera
ref|NP_001062173.1|  Os08g0503200                                     93.2    1e-18   
ref|XP_004952935.1|  PREDICTED: probable glycerophosphoryl dieste...  92.4    2e-18   
gb|KEH28442.1|  glycerophosphoryl diester phosphodiesterase famil...  92.4    2e-18   Medicago truncatula
ref|XP_003617676.1|  Glycerophosphodiesterase-like protein            92.4    2e-18   Medicago truncatula
emb|CDY02800.1|  BnaC02g10890D                                        92.0    3e-18   
ref|XP_002325146.2|  hypothetical protein POPTR_0018s11890g           92.0    3e-18   Populus trichocarpa [western balsam poplar]
emb|CDY02788.1|  BnaC02g11010D                                        92.0    3e-18   
emb|CDY32730.1|  BnaA02g07920D                                        92.0    4e-18   Brassica napus [oilseed rape]
ref|XP_008679540.1|  PREDICTED: probable glycerophosphoryl dieste...  91.7    4e-18   Zea mays [maize]
ref|XP_009126795.1|  PREDICTED: probable glycerophosphoryl dieste...  91.7    5e-18   Brassica rapa
ref|XP_003572357.1|  PREDICTED: glycerophosphodiester phosphodies...  91.3    6e-18   
ref|XP_004506009.1|  PREDICTED: uncharacterized protein LOC101491157  89.4    7e-18   
ref|XP_010536984.1|  PREDICTED: glycerophosphodiester phosphodies...  91.3    7e-18   Tarenaya hassleriana [spider flower]
ref|XP_006660255.1|  PREDICTED: probable glycerophosphoryl dieste...  91.3    7e-18   
ref|XP_006282081.1|  hypothetical protein CARUB_v10028327mg           90.9    7e-18   Capsella rubella
ref|XP_006401135.1|  hypothetical protein EUTSA_v10012762mg           90.9    8e-18   
ref|NP_001046128.1|  Os02g0187400                                     90.5    1e-17   
dbj|BAD15424.1|  glycerophosphoryl diester phosphodiesterase 2 pr...  90.5    1e-17   Oryza sativa Japonica Group [Japonica rice]
gb|AFW66254.1|  hypothetical protein ZEAMMB73_246886                  90.1    2e-17   
ref|XP_004951679.1|  PREDICTED: probable glycerophosphoryl dieste...  90.1    2e-17   
gb|EEE56466.1|  hypothetical protein OsJ_05675                        90.1    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008677441.1|  PREDICTED: uncharacterized protein LOC100304...  90.1    2e-17   
ref|XP_008677440.1|  PREDICTED: uncharacterized protein LOC100304...  90.1    2e-17   
ref|XP_008677439.1|  PREDICTED: uncharacterized protein LOC100304...  90.1    2e-17   
gb|EEC72640.1|  hypothetical protein OsI_06154                        89.7    2e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_010443532.1|  PREDICTED: glycerophosphodiester phosphodies...  89.0    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_004499801.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...  89.4    3e-17   
ref|XP_010453288.1|  PREDICTED: glycerophosphodiester phosphodies...  89.4    3e-17   Camelina sativa [gold-of-pleasure]
gb|AFW70515.1|  hypothetical protein ZEAMMB73_076757                  87.0    3e-17   
ref|XP_010928375.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...  89.4    3e-17   Elaeis guineensis
gb|EPS69135.1|  glycerophosphodiesterase-like protein                 89.0    3e-17   Genlisea aurea
ref|XP_010485211.1|  PREDICTED: glycerophosphodiester phosphodies...  87.4    5e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006647435.1|  PREDICTED: probable glycerophosphoryl dieste...  88.6    5e-17   Oryza brachyantha
gb|EEE53168.1|  hypothetical protein OsJ_36008                        89.0    5e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002866246.1|  glycerophosphoryl diester phosphodiesterase ...  88.2    7e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_010453117.1|  PREDICTED: glycerophosphodiester phosphodies...  88.2    7e-17   Camelina sativa [gold-of-pleasure]
dbj|BAJ92515.1|  predicted protein                                    84.7    7e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY32720.1|  BnaA02g07820D                                        88.2    7e-17   Brassica napus [oilseed rape]
ref|XP_008645346.1|  PREDICTED: probable glycerophosphoryl dieste...  87.4    1e-16   
ref|NP_200625.1|  glycerophosphodiester phosphodiesterase like 7      87.0    2e-16   
ref|XP_009399679.1|  PREDICTED: probable glycerophosphoryl dieste...  87.0    2e-16   
ref|NP_200613.2|  glycerophosphodiester phosphodiesterase like 6      86.7    2e-16   
ref|XP_004160165.1|  PREDICTED: probable glycerophosphoryl dieste...  86.7    2e-16   
ref|XP_004143578.1|  PREDICTED: probable glycerophosphoryl dieste...  86.7    2e-16   
ref|XP_004965786.1|  PREDICTED: probable glycerophosphoryl dieste...  86.7    3e-16   
ref|XP_009358473.1|  PREDICTED: probable glycerophosphoryl dieste...  86.7    3e-16   
ref|XP_008440682.1|  PREDICTED: probable glycerophosphoryl dieste...  86.3    3e-16   
gb|EMT22700.1|  Putative glycerophosphoryl diester phosphodiester...  86.3    4e-16   
ref|XP_009366150.1|  PREDICTED: probable glycerophosphoryl dieste...  85.9    4e-16   
gb|EMS66577.1|  putative glycerophosphoryl diester phosphodiester...  86.3    5e-16   
dbj|BAK08209.1|  predicted protein                                    85.5    6e-16   
gb|EMS54688.1|  putative glycerophosphoryl diester phosphodiester...  85.1    7e-16   
ref|XP_002523503.1|  glycerophosphoryl diester phosphodiesterase,...  85.1    8e-16   
ref|XP_003570935.1|  PREDICTED: glycerophosphodiester phosphodies...  85.1    9e-16   
ref|XP_010913957.1|  PREDICTED: glycerophosphodiester phosphodies...  84.3    1e-15   
emb|CDP10204.1|  unnamed protein product                              84.3    1e-15   
dbj|BAJ93663.1|  predicted protein                                    84.0    2e-15   
ref|XP_007201937.1|  hypothetical protein PRUPE_ppa001673mg           84.0    2e-15   
ref|XP_008384576.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...  84.0    2e-15   
ref|XP_008242952.1|  PREDICTED: probable glycerophosphoryl dieste...  83.6    2e-15   
ref|XP_006586114.1|  PREDICTED: probable glycerophosphoryl dieste...  78.6    3e-15   
ref|XP_008343908.1|  PREDICTED: probable glycerophosphoryl dieste...  82.4    7e-15   
ref|XP_003566003.1|  PREDICTED: glycerophosphodiester phosphodies...  82.4    7e-15   
ref|XP_009126782.1|  PREDICTED: probable glycerophosphoryl dieste...  82.4    7e-15   
ref|XP_010231119.1|  PREDICTED: glycerophosphodiester phosphodies...  82.0    9e-15   
ref|XP_008361197.1|  PREDICTED: probable glycerophosphoryl dieste...  81.3    2e-14   
gb|EEE69509.1|  hypothetical protein OsJ_28963                        80.1    2e-14   
ref|XP_006474608.1|  PREDICTED: probable glycerophosphoryl dieste...  80.9    2e-14   
ref|NP_001062919.2|  Os09g0339800                                     80.5    2e-14   
dbj|BAD28342.1|  glycerophosphoryl diester phosphodiesterase 2 pr...  80.5    3e-14   
ref|XP_009120321.1|  PREDICTED: probable glycerophosphoryl dieste...  80.5    3e-14   
gb|EMT03737.1|  Putative glycerophosphoryl diester phosphodiester...  80.5    4e-14   
emb|CDY43885.1|  BnaC09g33580D                                        80.1    5e-14   
gb|EYU25341.1|  hypothetical protein MIMGU_mgv1a001922mg              79.0    1e-13   
gb|KJB54927.1|  hypothetical protein B456_009G054700                  77.8    2e-13   
ref|XP_011460616.1|  PREDICTED: glycerophosphodiester phosphodies...  77.4    3e-13   
gb|KDP38642.1|  hypothetical protein JCGZ_03995                       77.0    5e-13   
ref|XP_009126781.1|  PREDICTED: probable glycerophosphoryl dieste...  75.1    2e-12   
ref|XP_011084009.1|  PREDICTED: glycerophosphodiester phosphodies...  75.1    2e-12   
ref|XP_002437331.1|  hypothetical protein SORBIDRAFT_10g025000        73.2    9e-12   
gb|EPS68532.1|  hypothetical protein M569_06231                       71.6    2e-11   
emb|CDY12605.1|  BnaA02g12730D                                        71.6    3e-11   
gb|KEH37864.1|  glycerophosphoryl diester phosphodiesterase famil...  69.7    1e-10   
ref|XP_001756508.1|  predicted protein                                67.8    5e-10   
ref|XP_007154910.1|  hypothetical protein PHAVU_003G158000g           67.8    5e-10   
ref|XP_006600556.1|  PREDICTED: probable glycerophosphoryl dieste...  66.6    1e-09   
ref|XP_009594117.1|  PREDICTED: probable glycerophosphoryl dieste...  66.2    2e-09   
ref|XP_003610370.1|  GPI-anchored protein                             65.5    3e-09   
gb|AES92567.2|  glycerophosphoryl diester phosphodiesterase famil...  65.5    3e-09   
ref|XP_010315575.1|  PREDICTED: glycerophosphodiester phosphodies...  65.1    4e-09   
ref|XP_006340538.1|  PREDICTED: probable glycerophosphoryl dieste...  65.1    4e-09   
ref|XP_009803613.1|  PREDICTED: probable glycerophosphoryl dieste...  63.5    1e-08   
ref|XP_003541467.2|  PREDICTED: probable glycerophosphoryl dieste...  63.5    1e-08   
gb|KHN18329.1|  Putative glycerophosphoryl diester phosphodiester...  63.5    1e-08   
ref|XP_009803612.1|  PREDICTED: probable glycerophosphoryl dieste...  63.2    2e-08   
ref|XP_006340583.1|  PREDICTED: probable glycerophosphoryl dieste...  61.6    5e-08   
gb|KHN22089.1|  Putative glycerophosphoryl diester phosphodiester...  60.8    1e-07   
ref|XP_010315562.1|  PREDICTED: glycerophosphodiester phosphodies...  59.3    3e-07   
ref|XP_001756342.1|  predicted protein                                57.0    2e-06   
ref|WP_042464421.1|  hypothetical protein                             53.1    8e-06   
ref|WP_026880196.1|  glycerophosphodiester phosphodiesterase          54.3    9e-06   
ref|WP_008906374.1|  glycerophosphoryl diester phosphodiesterase      54.3    9e-06   
ref|WP_035783325.1|  glycerophosphodiester phosphodiesterase          53.9    1e-05   
ref|XP_002983605.1|  hypothetical protein SELMODRAFT_118548           54.3    1e-05   
ref|WP_017352539.1|  glycerophosphodiester phosphodiesterase          53.9    1e-05   
ref|WP_003372241.1|  glycerophosphodiester phosphodiesterase          53.9    1e-05   
ref|WP_012425650.1|  glycerophosphodiester phosphodiesterase          53.9    1e-05   
gb|EJL83967.1|  glycerophosphoryl diester phosphodiesterase           53.1    2e-05   
ref|WP_027846981.1|  hypothetical protein                             53.1    2e-05   
ref|WP_036838616.1|  glycerophosphodiester phosphodiesterase          53.1    2e-05   
ref|XP_001766682.1|  predicted protein                                52.8    3e-05   
gb|KFI26028.1|  glycerophosphodiester phosphodiesterase               52.4    4e-05   
ref|XP_002973791.1|  hypothetical protein SELMODRAFT_100702           52.0    6e-05   
ref|WP_011647402.1|  MULTISPECIES: glycerophosphoryl diester phos...  51.2    9e-05   
ref|WP_019960329.1|  hypothetical protein                             50.8    1e-04   
gb|KDB51915.1|  glycerophosphoryl diester phosphodiesterase           50.8    1e-04   
ref|WP_039222483.1|  glycerophosphodiester phosphodiesterase          49.3    1e-04   
ref|WP_037482455.1|  glycerophosphodiester phosphodiesterase          50.8    1e-04   
ref|WP_029169778.1|  glycerophosphodiester phosphodiesterase          50.4    1e-04   
ref|WP_029169609.1|  glycerophosphodiester phosphodiesterase          50.4    2e-04   
gb|AEB77601.1|  glycerophosphodiester phosphodiesterase               50.4    2e-04   
ref|WP_012745495.1|  glycerophosphoryl diester phosphodiesterase      50.1    2e-04   
gb|ABI67153.1|  glycerophosphoryl diester phosphodiesterase           50.1    2e-04   
ref|WP_036269588.1|  glycerophosphodiester phosphodiesterase          49.7    3e-04   
gb|ERT04513.1|  glycerophosphoryl diester phosphodiesterase famil...  49.7    4e-04   
ref|WP_012775934.1|  glycerophosphodiester phosphodiesterase          49.3    4e-04   
ref|WP_039233339.1|  glycerophosphodiester phosphodiesterase          48.9    5e-04   
ref|WP_039230396.1|  glycerophosphodiester phosphodiesterase          48.9    5e-04   
ref|WP_007835428.1|  glycerophosphoryl diester phosphodiesterase      48.9    6e-04   
ref|XP_976827.1|  Glycerophosphoryl diester phosphodiesterase fam...  48.9    6e-04   
ref|WP_035601663.1|  hypothetical protein                             48.5    6e-04   
gb|KCZ97003.1|  glycerophosphoryl diester phosphodiesterase           48.5    6e-04   
ref|WP_039260348.1|  glycerophosphodiester phosphodiesterase          48.5    6e-04   
ref|WP_008178488.1|  glycerophosphoryl diester phosphodiesterase      48.5    8e-04   
ref|WP_036483116.1|  glycerophosphodiester phosphodiesterase          48.5    0.001   
ref|WP_036478771.1|  glycerophosphodiester phosphodiesterase          48.5    0.001   



>ref|XP_002276757.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Vitis 
vinifera]
 emb|CBI26719.3| unnamed protein product [Vitis vinifera]
Length=757

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 86/104 (83%), Gaps = 1/104 (1%)
 Frame = +2

Query  194  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  373
            M KLR +  LL L  +V LV+AQGSTN TS WQTL+G+APLVIARGGFSGLFPDSS  AY
Sbjct  1    MSKLRQVI-LLFLLHSVALVSAQGSTNGTSSWQTLNGNAPLVIARGGFSGLFPDSSSAAY  59

Query  374  SFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
            S A  TSL+ V++WCDVQLTKDG GICFPD+KL+NAS+++ +FK
Sbjct  60   SLALMTSLSNVVLWCDVQLTKDGAGICFPDMKLENASDISIVFK  103



>ref|XP_010324292.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Solanum 
lycopersicum]
Length=753

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +2

Query  194  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  373
            M K+RS+  LL+LC +V  VAAQ S N TSKW+TLSGDAP VIARGGFSGL PDSSFNAY
Sbjct  1    MRKMRSVLCLLVLCCSVAFVAAQRSNNVTSKWKTLSGDAPKVIARGGFSGLLPDSSFNAY  60

Query  374  SFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
              A   S    + WCDVQLTKDGVGICFPDIKL+NAS++ TL+
Sbjct  61   MLAQAISSADWVAWCDVQLTKDGVGICFPDIKLNNASDIDTLY  103



>ref|XP_009787408.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana sylvestris]
Length=752

 Score =   144 bits (364),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = +2

Query  194  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  373
            MW LRSI  LLLLC +   V+AQ S N+TSKW TLSGDAP VIARGGFSGL PDSSFNAY
Sbjct  1    MWNLRSISCLLLLCCSAAFVSAQRSNNATSKWFTLSGDAPKVIARGGFSGLMPDSSFNAY  60

Query  374  SFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
            + A   S+   + WCDVQLTKDGVGIC  DI+LDN+S+V  LFK
Sbjct  61   TLASTISVADWVAWCDVQLTKDGVGICLSDIRLDNSSDVDVLFK  104



>ref|XP_009625976.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Nicotiana tomentosiformis]
 dbj|BAE53680.1| putative glycerophosphoryl diester phosphodiesterase family protein 
[Nicotiana tabacum]
 dbj|BAF34116.1| glycerophosphodiesterase-like protein [Nicotiana tabacum]
Length=752

 Score =   142 bits (358),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = +2

Query  194  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  373
            MW LRSI  LLLLC +   V+AQ S N+TSKW TL+GDAP VIARGGFSGL PDSSFNAY
Sbjct  1    MWNLRSISCLLLLCCSAAFVSAQRSDNATSKWLTLTGDAPKVIARGGFSGLMPDSSFNAY  60

Query  374  SFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
              A   S+   + WCDVQLTKDGVGIC  DI+LDN+S+V  LFK
Sbjct  61   ILAKAISVADWVAWCDVQLTKDGVGICLSDIRLDNSSDVNVLFK  104



>ref|XP_010270134.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Nelumbo 
nucifera]
Length=751

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 83/101 (82%), Gaps = 1/101 (1%)
 Frame = +2

Query  206  RSIFNLLLLCSAVTLVAAQGSTN-STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFA  382
            R +F LL+L SAV + + + STN STS W TL+G APLVIA+GGFSGLFPDSS+ AYS A
Sbjct  5    RPLFLLLVLHSAVLITSQRSSTNNSTSPWLTLNGKAPLVIAKGGFSGLFPDSSYAAYSLA  64

Query  383  GXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
              TSL+ VI+WCDVQLTKD VGICFPD+KLDN+S++A +FK
Sbjct  65   NMTSLSNVILWCDVQLTKDAVGICFPDLKLDNSSDIANVFK  105



>emb|CAN61355.1| hypothetical protein VITISV_027762 [Vitis vinifera]
Length=642

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  AVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWC  418
            +V LV+AQGSTN TS WQTL+G+APLVIARGGFSGLFPDSS  AYS A  TSL+ V++WC
Sbjct  15   SVALVSAQGSTNGTSSWQTLNGNAPLVIARGGFSGLFPDSSSAAYSLALMTSLSNVVLWC  74

Query  419  DVQLTKDGVGICFPDIKLDNASNVATLFK  505
            DVQL+KDG GICFPD+KL+NAS+++ +FK
Sbjct  75   DVQLSKDGAGICFPDMKLENASDISIVFK  103



>ref|XP_006346174.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Solanum tuberosum]
Length=753

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +2

Query  194  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  373
            M K+RS+  LLLLC +   VAAQ S+N TSKW+TLSGDAP VIARGGFSGL PDSS+NAY
Sbjct  1    MRKMRSVLCLLLLCCSAAFVAAQRSSNVTSKWKTLSGDAPKVIARGGFSGLLPDSSYNAY  60

Query  374  SFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
              A   SL   + WCDVQLTKDGVGICFPDIKL+NAS++ TL+
Sbjct  61   LLAQAISLADWVAWCDVQLTKDGVGICFPDIKLNNASDIDTLY  103



>ref|XP_011097815.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
Length=760

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 82/107 (77%), Gaps = 3/107 (3%)
 Frame = +2

Query  194  MWKLRSIFNLLLLCSAVTL---VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  364
            MWK+RS+  LL L          AAQGS   +SKWQTLSGDAPLVIARGGFSG+FPDSSF
Sbjct  1    MWKVRSVLGLLSLLLLSASVGLAAAQGSRGRSSKWQTLSGDAPLVIARGGFSGIFPDSSF  60

Query  365  NAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
             AYS A  TSLT V +WCDVQLTKDG GICFPDI+L+N+S++  ++K
Sbjct  61   YAYSLAVQTSLTNVHVWCDVQLTKDGAGICFPDIRLENSSDIDNVYK  107



>gb|EYU33686.1| hypothetical protein MIMGU_mgv1a001772mg [Erythranthe guttata]
Length=761

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 79/107 (74%), Gaps = 3/107 (3%)
 Frame = +2

Query  194  MWKLRSIF---NLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  364
            M K R +F   + LLLCS+  LV+AQ S    S WQTLSG+APLVIARGGFSG+FPDSS 
Sbjct  1    MLKFRPVFCLFSFLLLCSSSVLVSAQRSRTRGSPWQTLSGNAPLVIARGGFSGIFPDSSL  60

Query  365  NAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
             AYS A  T L  +  WCDVQLTKDG GICFPD++L+NAS++  ++K
Sbjct  61   YAYSLAVQTGLPNLHAWCDVQLTKDGAGICFPDLRLENASDIDNIYK  107



>gb|KJB62955.1| hypothetical protein B456_009G445400 [Gossypium raimondii]
Length=760

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 83/108 (77%), Gaps = 5/108 (5%)
 Frame = +2

Query  194  MWKLR----SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  361
            M  LR    +IF +  L ++VTLV+AQGSTN  S+WQTLSG AP VIA GGFSG+F DSS
Sbjct  1    MGSLRGISVAIFVVQALLASVTLVSAQGSTNG-SRWQTLSGKAPSVIAHGGFSGIFADSS  59

Query  362  FNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
            F AYS A  TSL  VI+WCDVQLT+DG GICFPD+KLDN S+VA ++K
Sbjct  60   FGAYSLALLTSLPDVILWCDVQLTRDGAGICFPDLKLDNNSDVAVVYK  107



>ref|XP_006344880.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Solanum tuberosum]
Length=753

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = +2

Query  194  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  373
            MW LR +  L +L S  + V  Q   N+T+KW TL GDAPLVIARGGFSGL PDSS++AY
Sbjct  1    MWNLRRLSYLFVLLSCFS-VTTQALNNATTKWLTLHGDAPLVIARGGFSGLLPDSSYDAY  59

Query  374  SFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
              A  TSL   I+WCDVQLTKDGVGICFPD+KLDNAS++   FK
Sbjct  60   IMALETSLPNAIIWCDVQLTKDGVGICFPDLKLDNASDIDFYFK  103



>gb|KHG12016.1| putative glycerophosphoryl diester phosphodiesterase 1 -like 
protein [Gossypium arboreum]
Length=762

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 80/98 (82%), Gaps = 1/98 (1%)
 Frame = +2

Query  209  SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGX  388
            +IF +  L ++V LV+AQGS  + S+WQTLSG+AP+VIARGGFSG+F DSSF AYS A  
Sbjct  10   AIFVVQALLASVALVSAQGSA-TPSRWQTLSGEAPVVIARGGFSGIFSDSSFGAYSLALE  68

Query  389  TSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            T  + VI+WCDVQLTKDG GICFPD+KLDN SN+AT+F
Sbjct  69   TGPSDVILWCDVQLTKDGAGICFPDLKLDNNSNIATIF  106



>ref|XP_009798152.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana sylvestris]
Length=391

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +2

Query  194  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  373
            MW LRS+  LLLLC +VT VAAQ + + T+KW TL+GDAPLVIA GGFSGLFPDSS++AY
Sbjct  14   MWNLRSLSCLLLLCFSVTTVAAQRTNSETTKWLTLNGDAPLVIALGGFSGLFPDSSYDAY  73

Query  374  SFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
              A  TSL  VI WCDVQLTKDGVGIC PD+KLDNAS++   FK
Sbjct  74   MVAMETSLANVIAWCDVQLTKDGVGICLPDLKLDNASDIDVYFK  117



>gb|KDO62177.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
 gb|KDO62178.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=504

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 72/91 (79%), Gaps = 1/91 (1%)
 Frame = +2

Query  233  CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIM  412
            C  +  V+AQGS N+TS+WQTL+GD P V+ARGGFSG+FPDSS  AYS    TS   VI+
Sbjct  67   CGVIAQVSAQGS-NATSRWQTLTGDPPFVVARGGFSGIFPDSSSIAYSLTLITSAPSVIL  125

Query  413  WCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
            WCDVQLTKD  GICFPD+KLDNASN+A +FK
Sbjct  126  WCDVQLTKDEAGICFPDLKLDNASNIAQIFK  156



>gb|KDO62176.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=667

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 72/91 (79%), Gaps = 1/91 (1%)
 Frame = +2

Query  233  CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIM  412
            C  +  V+AQGS N+TS+WQTL+GD P V+ARGGFSG+FPDSS  AYS    TS   VI+
Sbjct  67   CGVIAQVSAQGS-NATSRWQTLTGDPPFVVARGGFSGIFPDSSSIAYSLTLITSAPSVIL  125

Query  413  WCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
            WCDVQLTKD  GICFPD+KLDNASN+A +FK
Sbjct  126  WCDVQLTKDEAGICFPDLKLDNASNIAQIFK  156



>gb|KHG08046.1| putative glycerophosphoryl diester phosphodiesterase 2 -like 
protein [Gossypium arboreum]
Length=775

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +2

Query  209  SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGX  388
            +IF +  L ++VTLV+AQGSTN  S+WQTLSG AP VIA GGFSG+F DSSF AYS A  
Sbjct  10   AIFVVQALLASVTLVSAQGSTNG-SRWQTLSGKAPSVIAHGGFSGIFADSSFGAYSLALL  68

Query  389  TSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
            TS   VI+WCDVQLT+DG GICFPD+KLDN S+VA ++K
Sbjct  69   TSPPDVILWCDVQLTRDGAGICFPDLKLDNNSDVAIVYK  107



>ref|XP_006452490.1| hypothetical protein CICLE_v10007536mg [Citrus clementina]
 gb|ESR65730.1| hypothetical protein CICLE_v10007536mg [Citrus clementina]
Length=764

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 72/91 (79%), Gaps = 1/91 (1%)
 Frame = +2

Query  233  CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIM  412
            C  +  V+AQGS N+TS+WQTL+GD P V+ARGGFSG+FPDSS  AYS    TS   VI+
Sbjct  20   CGVIAQVSAQGS-NATSRWQTLTGDPPFVVARGGFSGIFPDSSSIAYSLTLITSAPSVIL  78

Query  413  WCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
            WCDVQLTKD  GICFPD+KLDNASN+A +FK
Sbjct  79   WCDVQLTKDEAGICFPDLKLDNASNIAQIFK  109



>ref|XP_006474966.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Citrus sinensis]
Length=764

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 72/91 (79%), Gaps = 1/91 (1%)
 Frame = +2

Query  233  CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIM  412
            C  +  V+AQGS N+TS+WQTL+GD P V+ARGGFSG+FPDSS  AYS    TS   VI+
Sbjct  20   CGVIAQVSAQGS-NATSRWQTLTGDPPFVVARGGFSGIFPDSSSIAYSLTLITSAPSVIL  78

Query  413  WCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
            WCDVQLTKD  GICFPD+KLDNASN+A +FK
Sbjct  79   WCDVQLTKDEAGICFPDLKLDNASNIAQIFK  109



>gb|KDO62175.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=733

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 72/91 (79%), Gaps = 1/91 (1%)
 Frame = +2

Query  233  CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIM  412
            C  +  V+AQGS N+TS+WQTL+GD P V+ARGGFSG+FPDSS  AYS    TS   VI+
Sbjct  67   CGVIAQVSAQGS-NATSRWQTLTGDPPFVVARGGFSGIFPDSSSIAYSLTLITSAPSVIL  125

Query  413  WCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
            WCDVQLTKD  GICFPD+KLDNASN+A +FK
Sbjct  126  WCDVQLTKDEAGICFPDLKLDNASNIAQIFK  156



>gb|KDO62174.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=811

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 72/91 (79%), Gaps = 1/91 (1%)
 Frame = +2

Query  233  CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIM  412
            C  +  V+AQGS N+TS+WQTL+GD P V+ARGGFSG+FPDSS  AYS    TS   VI+
Sbjct  67   CGVIAQVSAQGS-NATSRWQTLTGDPPFVVARGGFSGIFPDSSSIAYSLTLITSAPSVIL  125

Query  413  WCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
            WCDVQLTKD  GICFPD+KLDNASN+A +FK
Sbjct  126  WCDVQLTKDEAGICFPDLKLDNASNIAQIFK  156



>ref|XP_011095489.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
 ref|XP_011095490.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
Length=767

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = +2

Query  194  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  373
            MW+ R +F L++LC     VAAQG+     +WQTLSG+APLVIARGGFSG+FP SS  AY
Sbjct  1    MWRFRDVFLLIMLCLLAVSVAAQGTRRGGRQWQTLSGNAPLVIARGGFSGVFPYSSGYAY  60

Query  374  SFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
              A  T L  + +WCDVQLTKDG GICFPDI+L NAS++  ++
Sbjct  61   ELALLTGLPNLHIWCDVQLTKDGAGICFPDIRLQNASDIKYVY  103



>ref|XP_009108190.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=758

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 72/95 (76%), Gaps = 2/95 (2%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSL  397
            +LLC  V   L A Q    S+S WQTLSGDAPLVIARGGFSGLFPDSS NAYSFA  TS+
Sbjct  6    VLLCCVVLIQLFAGQTDARSSSPWQTLSGDAPLVIARGGFSGLFPDSSLNAYSFAVQTSV  65

Query  398  TXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
                +WCDVQLTKDG GICFPD+KL+NAS V  ++
Sbjct  66   PGSALWCDVQLTKDGAGICFPDLKLNNASTVEYVY  100



>ref|XP_008447692.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Cucumis melo]
 ref|XP_008447693.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Cucumis melo]
Length=764

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 76/95 (80%), Gaps = 1/95 (1%)
 Frame = +2

Query  212  IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXT  391
            IF  L L S + LV+AQGS NST+ WQTLSGDAP V+ARGGFSGLFPDSS  AY+FA   
Sbjct  10   IFFSLFLHSFLALVSAQGS-NSTALWQTLSGDAPFVVARGGFSGLFPDSSGVAYNFAVMV  68

Query  392  SLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVAT  496
            S+  VI+WCDVQLTKDGVGIC PD++LDNA++  T
Sbjct  69   SVPDVILWCDVQLTKDGVGICLPDLRLDNATDAPT  103



>gb|KJB13801.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=686

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = +2

Query  209  SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGX  388
            +IF +  L ++V LV+AQGS  + S+WQTLSG+AP+VIARGGFSG+F DSSF AYS A  
Sbjct  10   AIFVVQALLASVALVSAQGSA-TPSRWQTLSGEAPVVIARGGFSGIFSDSSFGAYSLALE  68

Query  389  TSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            T  + VI+WCDVQLT DG GICFPD+KLDN S +AT+F
Sbjct  69   TGPSDVILWCDVQLTNDGAGICFPDLKLDNNSKIATVF  106



>gb|KJB13800.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=691

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = +2

Query  209  SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGX  388
            +IF +  L ++V LV+AQGS  + S+WQTLSG+AP+VIARGGFSG+F DSSF AYS A  
Sbjct  10   AIFVVQALLASVALVSAQGSA-TPSRWQTLSGEAPVVIARGGFSGIFSDSSFGAYSLALE  68

Query  389  TSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            T  + VI+WCDVQLT DG GICFPD+KLDN S +AT+F
Sbjct  69   TGPSDVILWCDVQLTNDGAGICFPDLKLDNNSKIATVF  106



>ref|XP_009105134.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=756

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 73/96 (76%), Gaps = 3/96 (3%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQG-STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTS  394
            +LLC  V   L A Q  +  S+S WQTLSGDAPLVIARGGFSGLFPDSSFNAY FA  TS
Sbjct  6    VLLCCVVLIQLFAGQADAQRSSSPWQTLSGDAPLVIARGGFSGLFPDSSFNAYDFAKQTS  65

Query  395  LTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            +    +WCDVQLTKDG GICFPD+KL+NAS V  ++
Sbjct  66   VAGAALWCDVQLTKDGAGICFPDLKLNNASTVEDVY  101



>gb|KJB13799.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=762

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = +2

Query  209  SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGX  388
            +IF +  L ++V LV+AQGS  + S+WQTLSG+AP+VIARGGFSG+F DSSF AYS A  
Sbjct  10   AIFVVQALLASVALVSAQGSA-TPSRWQTLSGEAPVVIARGGFSGIFSDSSFGAYSLALE  68

Query  389  TSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            T  + VI+WCDVQLT DG GICFPD+KLDN S +AT+F
Sbjct  69   TGPSDVILWCDVQLTNDGAGICFPDLKLDNNSKIATVF  106



>emb|CDY60410.1| BnaC02g45300D [Brassica napus]
Length=136

 Score =   119 bits (297),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = +2

Query  242  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWC  418
            + L AAQ  +  S S WQTLSGDAPLVIARGGFSGLFPDSS +AY+ A  TS+   ++WC
Sbjct  14   IQLFAAQIDAKRSKSPWQTLSGDAPLVIARGGFSGLFPDSSIDAYNNAMQTSVAGAVLWC  73

Query  419  DVQLTKDGVGICFPDIKLDNASNVATLF  502
            DVQLTKDG GICFPD+KL+NAS++  ++
Sbjct  74   DVQLTKDGHGICFPDLKLNNASSIGYVY  101



>ref|XP_002888565.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH64824.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=708

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 71/96 (74%), Gaps = 3/96 (3%)
 Frame = +2

Query  224  LLLCSAVTL---VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTS  394
            LL C  V +   VA   +  STS+WQTL+GDAPLVIARGGFSGLFPDSS  AY FA   S
Sbjct  18   LLFCGVVLIQLFVAQIDAQRSTSRWQTLNGDAPLVIARGGFSGLFPDSSLAAYQFAMQAS  77

Query  395  LTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            L  VI+WCDVQLTKD VGICFPD+ L NASN+  ++
Sbjct  78   LADVILWCDVQLTKDEVGICFPDLNLANASNIQDVY  113



>ref|XP_010470590.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=136

 Score =   118 bits (295),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 72/97 (74%), Gaps = 3/97 (3%)
 Frame = +2

Query  221  LLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXT  391
            ++L C  V   L AAQ  +  STS+WQTLSGDAP VIARGGFSGL PDSS +AY+ A  T
Sbjct  1    MILFCGVVMIQLFAAQIDAERSTSRWQTLSGDAPRVIARGGFSGLLPDSSIDAYNLAIQT  60

Query  392  SLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            S+  V++WCDVQLTKDG GICFPD+ L NAS V  ++
Sbjct  61   SVADVVLWCDVQLTKDGFGICFPDLNLANASTVQFVY  97



>ref|XP_003530777.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Glycine max]
Length=761

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 81/109 (74%), Gaps = 7/109 (6%)
 Frame = +2

Query  194  MWKLRSI---FNLL--LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDS  358
            MWK R++   F+LL  L  S + LV+AQGS  +T  W TL+G  PLVIARGGFSG+FPDS
Sbjct  1    MWKPRAVPRAFSLLHLLFHSVLVLVSAQGSNRTT--WNTLTGSPPLVIARGGFSGIFPDS  58

Query  359  SFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
            S  AY+ A  TSL  +I+WCDVQLTKDG GIC P+IKL+NA+N+  +F+
Sbjct  59   SEFAYNLAAVTSLKNLIVWCDVQLTKDGEGICIPNIKLENATNIDNVFQ  107



>gb|KHM99500.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Glycine 
soja]
Length=761

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 81/109 (74%), Gaps = 7/109 (6%)
 Frame = +2

Query  194  MWKLRSI---FNLL--LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDS  358
            MWK R++   F+LL  L  S + LV+AQGS  +T  W TL+G  PLVIARGGFSG+FPDS
Sbjct  1    MWKPRAVPRAFSLLHLLFHSVLVLVSAQGSNRTT--WNTLTGSPPLVIARGGFSGIFPDS  58

Query  359  SFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
            S  AY+ A  TSL  +I+WCDVQLTKDG GIC P+IKL+NA+N+  +F+
Sbjct  59   SEFAYNLAAVTSLKNLIVWCDVQLTKDGEGICIPNIKLENATNIDNVFQ  107



>ref|XP_010422831.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=146

 Score =   117 bits (292),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 69/96 (72%), Gaps = 3/96 (3%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTS  394
             L C  V   L AAQ  +  S S+WQTLSGDAP VIARGGFSGL PDSS +AY+ A  TS
Sbjct  16   FLFCGVVLINLFAAQIDAQRSRSRWQTLSGDAPRVIARGGFSGLLPDSSVDAYNLATQTS  75

Query  395  LTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            +  V++WCDVQLTKDGVGICFPD+ L NAS V   +
Sbjct  76   VAEVVLWCDVQLTKDGVGICFPDLNLANASTVQYAY  111



>ref|XP_006300798.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33696.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=678

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 78/106 (74%), Gaps = 6/106 (6%)
 Frame = +2

Query  203  LRSI---FNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  364
            LR +   ++ +LLC  V   L +AQ  +  S S+WQTLSGDAPLVIARGGFSGL PDSS 
Sbjct  9    LREVVMRYSTVLLCGVVLIQLFSAQIDAQRSRSRWQTLSGDAPLVIARGGFSGLLPDSSL  68

Query  365  NAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            +AYS A  TS+  V++WCDVQLTKDGVGICFPD+ L NAS +  ++
Sbjct  69   DAYSLATQTSVADVVLWCDVQLTKDGVGICFPDLNLANASTIDLVY  114



>gb|AAF98210.1|AC007152_6 Unknown protein [Arabidopsis thaliana]
Length=1111

 Score =   125 bits (314),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 63/95 (66%), Positives = 70/95 (74%), Gaps = 3/95 (3%)
 Frame = +2

Query  227  LLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSL  397
            LLC  V   L AAQ  +  STS WQTLSGDAPLVIARGGFSGLFPDSS  AY FA   S+
Sbjct  9    LLCGVVLLQLFAAQVDAQRSTSPWQTLSGDAPLVIARGGFSGLFPDSSLAAYQFAMVVSV  68

Query  398  TXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
              V++WCDVQLTKDG GICFPD+ L NASN   ++
Sbjct  69   ADVVLWCDVQLTKDGHGICFPDLNLANASNSEEVY  103



>ref|XP_004251903.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Solanum lycopersicum]
Length=751

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 80/107 (75%), Gaps = 9/107 (8%)
 Frame = +2

Query  194  MWKLRSI---FNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  364
            MW LRS+   F +LL C +V   AAQG   + +KW TL+G+APLVIARGGFSGL PDSS+
Sbjct  1    MWNLRSLSWSF-VLLTCFSV---AAQGV--NRTKWLTLNGNAPLVIARGGFSGLLPDSSY  54

Query  365  NAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
            +AY     TSL   I+WCDVQLTKDGVGICFPD+KLDNAS++   FK
Sbjct  55   DAYIMGLETSLPNAIIWCDVQLTKDGVGICFPDLKLDNASDIDFYFK  101



>ref|XP_006300799.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33697.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=701

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 78/106 (74%), Gaps = 6/106 (6%)
 Frame = +2

Query  203  LRSI---FNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  364
            LR +   ++ +LLC  V   L +AQ  +  S S+WQTLSGDAPLVIARGGFSGL PDSS 
Sbjct  9    LREVVMRYSTVLLCGVVLIQLFSAQIDAQRSRSRWQTLSGDAPLVIARGGFSGLLPDSSL  68

Query  365  NAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            +AYS A  TS+  V++WCDVQLTKDGVGICFPD+ L NAS +  ++
Sbjct  69   DAYSLATQTSVADVVLWCDVQLTKDGVGICFPDLNLANASTIDLVY  114



>ref|XP_006300797.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33695.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=704

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 78/106 (74%), Gaps = 6/106 (6%)
 Frame = +2

Query  203  LRSI---FNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  364
            LR +   ++ +LLC  V   L +AQ  +  S S+WQTLSGDAPLVIARGGFSGL PDSS 
Sbjct  9    LREVVMRYSTVLLCGVVLIQLFSAQIDAQRSRSRWQTLSGDAPLVIARGGFSGLLPDSSL  68

Query  365  NAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            +AYS A  TS+  V++WCDVQLTKDGVGICFPD+ L NAS +  ++
Sbjct  69   DAYSLATQTSVADVVLWCDVQLTKDGVGICFPDLNLANASTIDLVY  114



>ref|XP_010511612.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=761

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 73/99 (74%), Gaps = 9/99 (9%)
 Frame = +2

Query  224  LLLCSAV------TLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  385
            LL C  V      T + A+GST   S+WQTLSGDAPLVIARGGFSGL PDSS  AY+ A 
Sbjct  18   LLFCGVVMIQLFATQIDAEGST---SRWQTLSGDAPLVIARGGFSGLLPDSSLVAYNLAT  74

Query  386  XTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
             TS+T V++WCDVQLTKDG GICFPD+ + NASN+  ++
Sbjct  75   LTSVTSVVLWCDVQLTKDGAGICFPDLNMANASNIDVVY  113



>emb|CDP13760.1| unnamed protein product [Coffea canephora]
Length=745

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +2

Query  275  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGIC  454
            ST KWQTLSG APL IARGGFSGLFPDSS+NAY  A  TSL+ +++WCDVQLTKD  GIC
Sbjct  26   STRKWQTLSGSAPLAIARGGFSGLFPDSSYNAYVLAVGTSLSDLVLWCDVQLTKDAAGIC  85

Query  455  FPDIKLDNASNVATLF  502
            FPD+KLDNAS+V  +F
Sbjct  86   FPDLKLDNASDVNVVF  101



>emb|CDY61647.1| BnaCnng38120D [Brassica napus]
Length=755

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 72/96 (75%), Gaps = 3/96 (3%)
 Frame = +2

Query  224  LLLCSAVTLVAAQGSTN---STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTS  394
            +LLC  V +    G T+   S+S+WQTLSGDAPLVIARGGFSGLFPDSS  AY FA  TS
Sbjct  6    VLLCCVVLIQLFAGQTDAQRSSSRWQTLSGDAPLVIARGGFSGLFPDSSSIAYGFAKQTS  65

Query  395  LTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            +    +WCDVQLTKDG GICFPD+KL+NAS V  ++
Sbjct  66   VAGAALWCDVQLTKDGAGICFPDLKLNNASTVEDVY  101



>ref|XP_010536709.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Tarenaya hassleriana]
Length=752

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 73/96 (76%), Gaps = 3/96 (3%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTS  394
            LLLC  V   L+AAQ  +  S S WQTL+GDAPLVIARGGFSG+ PDSS +AY  A   S
Sbjct  9    LLLCGVVLIQLLAAQVDAQRSRSPWQTLAGDAPLVIARGGFSGVLPDSSVDAYGLAVQVS  68

Query  395  LTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            +T V++WCDVQLTKDG+GICFPD+ L NASN+  ++
Sbjct  69   VTDVVLWCDVQLTKDGIGICFPDVNLGNASNIGDVY  104



>ref|XP_010545263.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Tarenaya hassleriana]
Length=764

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 73/97 (75%), Gaps = 4/97 (4%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQ--GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXT  391
            LLLC  V   L+AAQ     +  S WQTL+GDAPLVIARGGFSGL PDSS +AY  A  T
Sbjct  18   LLLCGVVLMQLLAAQVDAQRSGRSPWQTLTGDAPLVIARGGFSGLLPDSSIDAYGLALQT  77

Query  392  SLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            S++ V++WCDVQLTKDGVGICFPD+ L NASN+  ++
Sbjct  78   SVSDVVLWCDVQLTKDGVGICFPDVNLRNASNIDVVY  114



>ref|NP_176870.2| suppressor of npr1-1 constitutive 4 [Arabidopsis thaliana]
 sp|D7SFH9.1|GPDL2_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase protein 
kinase domain-containing GDPDL2; AltName: Full=Glycerophosphodiester 
phosphodiesterase-like 2; Short=ATGDPDL2; AltName: 
Full=Protein SUPPRESSOR OF NPR1-1 CONSTITUTIVE 4; Flags: Precursor 
[Arabidopsis thaliana]
 gb|ADI71282.1| SNC4 [Arabidopsis thaliana]
 gb|AEE34581.1| suppressor of npr1-1 constitutive 4 [Arabidopsis thaliana]
Length=1118

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 70/95 (74%), Gaps = 3/95 (3%)
 Frame = +2

Query  227  LLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSL  397
            LLC  V   L AAQ  +  STS WQTLSGDAPLVIARGGFSGLFPDSS  AY FA   S+
Sbjct  20   LLCGVVLLQLFAAQVDAQRSTSPWQTLSGDAPLVIARGGFSGLFPDSSLAAYQFAMVVSV  79

Query  398  TXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
              V++WCDVQLTKDG GICFPD+ L NASN   ++
Sbjct  80   ADVVLWCDVQLTKDGHGICFPDLNLANASNSEEVY  114



>ref|XP_009127510.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=749

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 75/98 (77%), Gaps = 5/98 (5%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTS  394
            +LL S V   L AAQ  + +S S WQTLSGDAPLVIARGGFSGLFPDSS  AY FA  TS
Sbjct  6    VLLSSVVLIQLFAAQIDAKSSRSPWQTLSGDAPLVIARGGFSGLFPDSSSVAYKFAKQTS  65

Query  395  L--TXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            +  T  ++WCDVQLTKDG GICFPD+KL+NASN+  LF
Sbjct  66   VAGTSSVLWCDVQLTKDGHGICFPDLKLNNASNIGDLF  103



>ref|XP_006401453.1| hypothetical protein EUTSA_v10012748mg [Eutrema salsugineum]
 gb|ESQ42906.1| hypothetical protein EUTSA_v10012748mg [Eutrema salsugineum]
Length=768

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 67/86 (78%), Gaps = 3/86 (3%)
 Frame = +2

Query  245  TLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDV  424
            T +AAQ    S S WQTLSGDAPL+IARGGFSGL PDSS +AYSF   TS+   ++WCDV
Sbjct  31   TQLAAQ---RSKSPWQTLSGDAPLIIARGGFSGLLPDSSLDAYSFVSMTSVPDAVLWCDV  87

Query  425  QLTKDGVGICFPDIKLDNASNVATLF  502
            QLTKDGVGICFPD+K+ NASN+   +
Sbjct  88   QLTKDGVGICFPDVKMMNASNIQVAY  113



>ref|XP_006279181.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
 gb|EOA12079.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
Length=677

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 74/99 (75%), Gaps = 3/99 (3%)
 Frame = +2

Query  215  FNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  385
            ++ +LLC  V   L +AQ  +  S S+WQTLSGD PLVIARGGFSGL PDSS +AY FA 
Sbjct  16   YSTVLLCGVVLIQLFSAQIDAQRSRSRWQTLSGDPPLVIARGGFSGLLPDSSIDAYGFAI  75

Query  386  XTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
             TS+  V++WCDVQLTKDGVGICFPD+ L NAS +  ++
Sbjct  76   QTSVDDVVLWCDVQLTKDGVGICFPDLNLANASTIDLVY  114



>ref|XP_004150252.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cucumis sativus]
 ref|XP_004163282.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cucumis sativus]
 gb|KGN59083.1| Glycerophosphoryl diester phosphodiesterase [Cucumis sativus]
Length=764

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = +2

Query  248  LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQ  427
            LV+AQGS N+   WQTLSGDAP V+ARGGFSGLFPDSS  AY+FA   S+  VI+WCDVQ
Sbjct  22   LVSAQGS-NTPPLWQTLSGDAPFVVARGGFSGLFPDSSGVAYNFAAIVSVPDVILWCDVQ  80

Query  428  LTKDGVGICFPDIKLDNASNVATL  499
            LTKDGVGIC PD++LDNA++ + +
Sbjct  81   LTKDGVGICLPDLRLDNATDASVI  104



>ref|XP_010511610.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
GDPDL1-like [Camelina sativa]
Length=764

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 71/92 (77%), Gaps = 3/92 (3%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTS  394
            LL CS V   L AAQ  +  S S+WQTLSGDAPLVIARGGFSGL PDSS +AY+ A  TS
Sbjct  16   LLFCSVVLIQLFAAQIDAQRSRSRWQTLSGDAPLVIARGGFSGLLPDSSLDAYNLAIQTS  75

Query  395  LTXVIMWCDVQLTKDGVGICFPDIKLDNASNV  490
            +  V++WCDVQLTKDG GICFP++ + NASN+
Sbjct  76   VAEVVLWCDVQLTKDGAGICFPELNMANASNI  107



>ref|XP_010099974.1| putative glycerophosphoryl diester phosphodiesterase 2 [Morus 
notabilis]
 gb|EXB81079.1| putative glycerophosphoryl diester phosphodiesterase 2 [Morus 
notabilis]
Length=748

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = +2

Query  254  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLT  433
            +AQGS  S + WQTLSG APL IARGGFSGLFPDSS+ AYSFA  TSL  V++WCDVQLT
Sbjct  21   SAQGS-GSKTPWQTLSGGAPLAIARGGFSGLFPDSSYAAYSFAIMTSLPEVVLWCDVQLT  79

Query  434  KDGVGICFPDIKLDNASNVATLF  502
            KD  GIC PDIKLDN++++A +F
Sbjct  80   KDSKGICLPDIKLDNSTDIADVF  102



>ref|XP_006279182.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
 gb|EOA12080.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
Length=760

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 74/99 (75%), Gaps = 3/99 (3%)
 Frame = +2

Query  215  FNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  385
            ++ +LLC  V   L +AQ  +  S S+WQTLSGD PLVIARGGFSGL PDSS +AY FA 
Sbjct  16   YSTVLLCGVVLIQLFSAQIDAQRSRSRWQTLSGDPPLVIARGGFSGLLPDSSIDAYGFAI  75

Query  386  XTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
             TS+  V++WCDVQLTKDGVGICFPD+ L NAS +  ++
Sbjct  76   QTSVDDVVLWCDVQLTKDGVGICFPDLNLANASTIDLVY  114



>ref|XP_009127509.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=136

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = +2

Query  242  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWC  418
            + L AAQ  +  S S WQT SGDAPLVIARGGFSGLFPDSS +AY+FA  TS+   ++ C
Sbjct  14   IQLFAAQIDAKGSKSPWQTFSGDAPLVIARGGFSGLFPDSSIDAYNFAMQTSVAGAVLCC  73

Query  419  DVQLTKDGVGICFPDIKLDNASNVATLF  502
            DVQLTKDG G+ FPD+KL+NASN+  ++
Sbjct  74   DVQLTKDGHGVSFPDLKLNNASNIGDIY  101



>emb|CDY12601.1| BnaA02g12690D [Brassica napus]
Length=136

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = +2

Query  242  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWC  418
            + L AAQ  +  S S WQT SGDAPLVIARGGFSGLFPDSS +AY+FA  TS+   ++ C
Sbjct  14   IQLFAAQIDAKGSKSPWQTFSGDAPLVIARGGFSGLFPDSSIDAYNFAMQTSVAGAVLCC  73

Query  419  DVQLTKDGVGICFPDIKLDNASNVATLF  502
            DVQLTKDG G+ FPD+KL+NASN+  ++
Sbjct  74   DVQLTKDGHGVSFPDLKLNNASNIGDIY  101



>ref|XP_007020654.1| PLC-like phosphodiesterase family protein, putative isoform 3 
[Theobroma cacao]
 gb|EOY12179.1| PLC-like phosphodiesterase family protein, putative isoform 3 
[Theobroma cacao]
Length=514

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 71/91 (78%), Gaps = 1/91 (1%)
 Frame = +2

Query  230  LCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVI  409
            L ++V LV+AQGS+N  S+WQTL+GD P VIARGGFSG+F DSS  AY  A  T  T VI
Sbjct  17   LLASVALVSAQGSSNR-SRWQTLNGDVPFVIARGGFSGMFSDSSPAAYRLALLTGPTNVI  75

Query  410  MWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            +WCDVQL+KD  GICFPD+KLDN S++ T+F
Sbjct  76   LWCDVQLSKDAAGICFPDLKLDNNSDITTVF  106



>ref|XP_006300773.1| hypothetical protein CARUB_v10019847mg [Capsella rubella]
 gb|EOA33671.1| hypothetical protein CARUB_v10019847mg [Capsella rubella]
Length=766

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +2

Query  275  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGIC  454
            STS WQTLSGDAPLVIARGGFSGLFPDSS +AY+FA  TS+  V++WCDVQLTKDGVGIC
Sbjct  43   STSPWQTLSGDAPLVIARGGFSGLFPDSSSDAYNFAILTSVADVVLWCDVQLTKDGVGIC  102

Query  455  FPDIKLDNASNVATLF  502
            FPD+ L NAS +  ++
Sbjct  103  FPDLNLANASIIKYIY  118



>gb|KDP39221.1| hypothetical protein JCGZ_00978 [Jatropha curcas]
Length=767

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 81/107 (76%), Gaps = 6/107 (6%)
 Frame = +2

Query  194  MWKLRSIFNLL---LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  364
            M + R+  +LL   +L   ++ V+A+GSTN   +WQTLSG+ PLV+ARGGFSG+FPDSS 
Sbjct  1    MCRPRAFASLLAGFILLHLLSFVSAKGSTN---RWQTLSGNPPLVVARGGFSGIFPDSSS  57

Query  365  NAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
             AY  A  TS+  V++WCDVQLTKDGVGIC PD++L+N+++++  FK
Sbjct  58   YAYQLALATSVPDVVLWCDVQLTKDGVGICAPDVRLENSTDISLFFK  104



>emb|CDY14478.1| BnaC03g21170D [Brassica napus]
Length=1314

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 69/97 (71%), Gaps = 3/97 (3%)
 Frame = +2

Query  221  LLLLCSAVTLVAAQGSTN---STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXT  391
            + LLC  V +    G T+   S   WQTLSGDAPLVIARGGFSGLFPDSS  AYSF   T
Sbjct  44   MFLLCGVVLIQLFAGQTDAQRSRGPWQTLSGDAPLVIARGGFSGLFPDSSLKAYSFVKQT  103

Query  392  SLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            S+    +WCDVQLTKDG GICFPD+KL+NAS +  ++
Sbjct  104  SVAGAALWCDVQLTKDGAGICFPDLKLNNASTIDFVY  140



>ref|XP_010438711.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Camelina sativa]
Length=757

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 73/97 (75%), Gaps = 3/97 (3%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTS  394
            LLLC  V   L+A+Q  +  S S W TL+G+APLVIARGGFSGLFPDSS++AY+FA  TS
Sbjct  9    LLLCGVVLIQLLASQIHAQRSKSPWPTLTGEAPLVIARGGFSGLFPDSSYDAYNFAMLTS  68

Query  395  LTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
            +   ++WCDVQLTKD  GICFPD+ + NASN+  + K
Sbjct  69   VPDAVLWCDVQLTKDAFGICFPDLTMSNASNIEAVHK  105



>ref|XP_007020652.1| PLC-like phosphodiesterase family protein, putative isoform 1 
[Theobroma cacao]
 gb|EOY12177.1| PLC-like phosphodiesterase family protein, putative isoform 1 
[Theobroma cacao]
Length=760

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 76/107 (71%), Gaps = 5/107 (5%)
 Frame = +2

Query  194  MWKLRSIFNLLLLCSA----VTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  361
            M  LR I   +L+  A    V LV+AQGS+N  S+WQTL+GD P VIARGGFSG+F DSS
Sbjct  1    MGSLRGITVAVLVVQALLASVALVSAQGSSNR-SRWQTLNGDVPFVIARGGFSGMFSDSS  59

Query  362  FNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
              AY  A  T  T VI+WCDVQL+KD  GICFPD+KLDN S++ T+F
Sbjct  60   PAAYRLALLTGPTNVILWCDVQLSKDAAGICFPDLKLDNNSDITTVF  106



>ref|XP_007020653.1| PLC-like phosphodiesterase family protein, putative isoform 2 
[Theobroma cacao]
 gb|EOY12178.1| PLC-like phosphodiesterase family protein, putative isoform 2 
[Theobroma cacao]
Length=758

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 76/107 (71%), Gaps = 5/107 (5%)
 Frame = +2

Query  194  MWKLRSIFNLLLLCSA----VTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  361
            M  LR I   +L+  A    V LV+AQGS+N  S+WQTL+GD P VIARGGFSG+F DSS
Sbjct  1    MGSLRGITVAVLVVQALLASVALVSAQGSSNR-SRWQTLNGDVPFVIARGGFSGMFSDSS  59

Query  362  FNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
              AY  A  T  T VI+WCDVQL+KD  GICFPD+KLDN S++ T+F
Sbjct  60   PAAYRLALLTGPTNVILWCDVQLSKDAAGICFPDLKLDNNSDITTVF  106



>ref|XP_006391459.1| hypothetical protein EUTSA_v10018170mg [Eutrema salsugineum]
 gb|ESQ28745.1| hypothetical protein EUTSA_v10018170mg [Eutrema salsugineum]
Length=763

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 71/96 (74%), Gaps = 3/96 (3%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTS  394
            +LLC  V   L AAQ     S S WQTLSGDAPLVIARGGFSGLFPDSS  AYSFA  TS
Sbjct  15   VLLCGIVLAHLFAAQIDGQRSRSPWQTLSGDAPLVIARGGFSGLFPDSSLAAYSFAMQTS  74

Query  395  LTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            +    +WCDVQLTKDG+GICFPD+ L+NAS +  ++
Sbjct  75   VAGSALWCDVQLTKDGLGICFPDLTLNNASTIEFVY  110



>ref|XP_010253010.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
[Nelumbo nucifera]
Length=734

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 77/95 (81%), Gaps = 3/95 (3%)
 Frame = +2

Query  221  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLT  400
            LL +  +V LV A  S NS+S W TL+G+APLVIARGGF G+FPDSSF +Y  A  TSL+
Sbjct  9    LLFVLHSVGLVVA--SRNSSS-WLTLTGNAPLVIARGGFPGIFPDSSFASYQLALNTSLS  65

Query  401  XVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
             VI+WCDVQLTKDG GICFP+IKL+N+S+++++F+
Sbjct  66   NVILWCDVQLTKDGAGICFPNIKLENSSDISSVFR  100



>gb|AAP40466.1| unknown protein [Arabidopsis thaliana]
Length=763

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 72/96 (75%), Gaps = 3/96 (3%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTS  394
            LL C  V   L AAQ  +  STS+WQTL+GDAPLVIARGGFSGL+PDSS  AY  A  TS
Sbjct  18   LLFCGVVLIHLFAAQIDAQRSTSRWQTLNGDAPLVIARGGFSGLYPDSSIAAYQLATLTS  77

Query  395  LTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            +  V++WCD+QLTKDG+GICFPD+ L NAS +  ++
Sbjct  78   VADVVLWCDLQLTKDGLGICFPDLNLANASTIDRVY  113



>ref|XP_010470589.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=765

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 77/106 (73%), Gaps = 5/106 (5%)
 Frame = +2

Query  194  MWKLRSIFNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  364
            M  LRS  + +LLCS V   L A Q  +  S S+WQTLSGDAPLVIARGGFSGL PDSS 
Sbjct  14   MLLLRS--STILLCSVVLIQLFAPQIDAQRSRSRWQTLSGDAPLVIARGGFSGLLPDSSL  71

Query  365  NAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            +AY+ A  TS+  VI+WCDV LTKDG+GICFP++ L NAS +  ++
Sbjct  72   DAYNLAIQTSVADVILWCDVHLTKDGIGICFPNLNLANASTIQYVY  117



>ref|XP_002529027.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
 gb|EEF33338.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
Length=768

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 79/108 (73%), Gaps = 7/108 (6%)
 Frame = +2

Query  194  MWKLRSI----FNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  361
            MW  RS+       +LL S  +LV+AQGS  S   W+TLSG+ PLVIARGGFSG+FPDSS
Sbjct  11   MWSRRSVSCVVAAFVLLNSLASLVSAQGSGTS---WKTLSGNPPLVIARGGFSGIFPDSS  67

Query  362  FNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
              AY  A  T +  +I+WCDVQLTKDGVGIC PD++LDN+++++ +FK
Sbjct  68   SAAYQLALITGVPDLILWCDVQLTKDGVGICAPDLRLDNSTDISLVFK  115



>ref|NP_176869.2| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
 sp|Q7Y208.2|GPDL1_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL1; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
1; Short=ATGDPDL1; AltName: Full=Glycerophosphodiesterase-like 
3; AltName: Full=Protein SHV3-LIKE 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF98209.1|AC007152_5 Unknown protein [Arabidopsis thaliana]
 gb|AEE34579.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
Length=763

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 72/96 (75%), Gaps = 3/96 (3%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTS  394
            LL C  V   L AAQ  +  STS+WQTL+GDAPLVIARGGFSGL+PDSS  AY  A  TS
Sbjct  18   LLFCGVVLIHLFAAQIDAQRSTSRWQTLNGDAPLVIARGGFSGLYPDSSIAAYQLATLTS  77

Query  395  LTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            +  V++WCD+QLTKDG+GICFPD+ L NAS +  ++
Sbjct  78   VADVVLWCDLQLTKDGLGICFPDLNLANASTIDRVY  113



>ref|XP_010448228.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Camelina sativa]
Length=757

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 74/97 (76%), Gaps = 3/97 (3%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTS  394
            LLLC  V   L+++Q  +  S S W TL+G+APLVIARGGFSGLFPDSS++AY+FA  TS
Sbjct  9    LLLCGVVLIQLLSSQIHAQRSKSPWPTLTGEAPLVIARGGFSGLFPDSSYDAYNFAMLTS  68

Query  395  LTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
            +   ++WCDVQLTKD +GICFPD+ + NASN+  + K
Sbjct  69   VPDAVLWCDVQLTKDALGICFPDLTMSNASNIEVVHK  105



>emb|CDY13237.1| BnaC09g24190D [Brassica napus]
Length=759

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 68/95 (72%), Gaps = 2/95 (2%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSL  397
            +LLC  V   L A Q    S+S WQTLSG APLVIARGGFSGLFPDSS  AY FA  TS+
Sbjct  6    VLLCCVVLIQLFAGQTDARSSSPWQTLSGGAPLVIARGGFSGLFPDSSSAAYGFAVQTSV  65

Query  398  TXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
               ++WCDVQLTKDG  ICFPD+KL+NAS V   +
Sbjct  66   PGAVLWCDVQLTKDGAAICFPDLKLNNASTVEYFY  100



>ref|XP_002888566.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64825.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=1089

 Score =   121 bits (303),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 58/88 (66%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = +2

Query  242  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWC  418
            + L AAQ  +  STS WQTLSG+APLVIARGGFSGLFPDSS  A+ FA   S+  VI+WC
Sbjct  8    LQLFAAQINAQRSTSTWQTLSGEAPLVIARGGFSGLFPDSSLAAFQFAMQASVDEVILWC  67

Query  419  DVQLTKDGVGICFPDIKLDNASNVATLF  502
            DVQLTKD VGICFPD+ L NASN+  ++
Sbjct  68   DVQLTKDEVGICFPDLNLANASNIQDVY  95



>gb|KFK27133.1| hypothetical protein AALP_AA8G339300 [Arabis alpina]
Length=764

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 3/93 (3%)
 Frame = +2

Query  212  IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXT  391
            +F L+L+    T + AQ    S S WQTL+GDAPLVIARGGFSGL PDSS +AYSF   T
Sbjct  17   LFALILIHLLPTQLFAQ---RSKSPWQTLTGDAPLVIARGGFSGLLPDSSLDAYSFVSQT  73

Query  392  SLTXVIMWCDVQLTKDGVGICFPDIKLDNASNV  490
            S++  ++WCDVQLTKDG+GICFPD+ + NASN+
Sbjct  74   SVSDAVLWCDVQLTKDGIGICFPDLTMMNASNI  106



>ref|XP_010433460.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 [Camelina 
sativa]
Length=661

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 73/97 (75%), Gaps = 3/97 (3%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTS  394
            LLLC  V   L+A+Q  +  S S W TL+G+ PLVIARGGFSGLFPDSS++AY+FA  TS
Sbjct  9    LLLCGVVLIQLLASQIHAQRSKSPWPTLTGNPPLVIARGGFSGLFPDSSYDAYNFAMLTS  68

Query  395  LTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
            +   ++WCDVQLTKD +GICFPD+ + NASN+  + K
Sbjct  69   VPDAVLWCDVQLTKDALGICFPDLTMSNASNIEAVLK  105



>ref|XP_008227060.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Prunus mume]
Length=755

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = +2

Query  236  SAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMW  415
            S V LV+A+GS NSTS+WQTLSGDAPLVIARGGFSGLFP  S  A++ A  TS+  V++W
Sbjct  16   SVVALVSAKGS-NSTSQWQTLSGDAPLVIARGGFSGLFPGFSTAAFNLALVTSVPDVVLW  74

Query  416  CDVQLTKDGVGICFPDIKLDNASNVATLF  502
            CDVQLT+DG GICFPD+ L+N S++  +F
Sbjct  75   CDVQLTRDGAGICFPDLLLNNNSDIEAVF  103



>ref|XP_006280048.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
 gb|EOA12946.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
Length=767

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = +2

Query  275  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGIC  454
            S S WQTL+GDAPL++ARGGFSGLFPDSS ++YSF   TS+   ++WCD+QLTKD +GIC
Sbjct  39   SKSPWQTLTGDAPLIVARGGFSGLFPDSSLDSYSFVAQTSVQGTVLWCDLQLTKDAIGIC  98

Query  455  FPDIKLDNASNVATLF  502
            FPD+K+ NASN+  +F
Sbjct  99   FPDVKMMNASNIQVVF  114



>ref|XP_010449676.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X1 [Camelina sativa]
 ref|XP_010449685.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X2 [Camelina sativa]
Length=767

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +2

Query  275  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGIC  454
            S S WQTLSGDAP +IARGGFSGL PDSS +AYSF G TS+   ++WCD+QLTKD +GIC
Sbjct  39   SKSPWQTLSGDAPRIIARGGFSGLLPDSSLDAYSFVGQTSVPDAVLWCDLQLTKDAIGIC  98

Query  455  FPDIKLDNASNVATLF  502
            FPD+K+ NASN+  ++
Sbjct  99   FPDVKMMNASNIQVVY  114



>ref|XP_002867546.1| MRH5/SHV3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43805.1| MRH5/SHV3 [Arabidopsis lyrata subsp. lyrata]
Length=756

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 72/96 (75%), Gaps = 3/96 (3%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTS  394
            LLLC  V   L AAQ  +    S W TL+GD P VIARGGFSGLFPDSS++AY+FA  TS
Sbjct  9    LLLCGVVLIQLFAAQINAQKPKSPWPTLTGDPPFVIARGGFSGLFPDSSYDAYNFAMLTS  68

Query  395  LTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            ++ V++WCDVQLTKD +GICFPD+ + NAS++  ++
Sbjct  69   VSDVVLWCDVQLTKDALGICFPDLTMSNASSIEVVY  104



>gb|KFK29182.1| hypothetical protein AALP_AA7G100300 [Arabis alpina]
Length=758

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 74/102 (73%), Gaps = 5/102 (5%)
 Frame = +2

Query  194  MWKLRSIFNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  364
            M  LRS  + L+LC  V   L ++Q  +  S S WQTL GDAPLVIARGGFSGLFPDSS 
Sbjct  1    MRGLRS--SSLILCGFVLIQLFSSQIDAQRSKSPWQTLLGDAPLVIARGGFSGLFPDSSL  58

Query  365  NAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNV  490
            +AYSFA  TS+   ++WCDVQLTKDG GICFPD+ + NAS +
Sbjct  59   DAYSFAMQTSVAGAVLWCDVQLTKDGAGICFPDLTMSNASTI  100



>ref|XP_009132384.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Brassica rapa]
Length=766

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +2

Query  275  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGIC  454
            S S WQTL+G+APLVIARGGFSGLFPDSSFNAYSF   TS    ++WCDVQLTKDGVGIC
Sbjct  40   SKSPWQTLTGEAPLVIARGGFSGLFPDSSFNAYSFVASTSAPDAVLWCDVQLTKDGVGIC  99

Query  455  FPDIKLDNASNVATLF  502
            FP + + N SNV   +
Sbjct  100  FPYVTMYNDSNVQEAY  115



>ref|XP_007214645.1| hypothetical protein PRUPE_ppa001847mg [Prunus persica]
 gb|EMJ15844.1| hypothetical protein PRUPE_ppa001847mg [Prunus persica]
Length=756

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 71/89 (80%), Gaps = 1/89 (1%)
 Frame = +2

Query  236  SAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMW  415
            S V LV+A+GS NSTS+W+TLSGDAPLVIARGGFSGLFP  S  A+S A  TS+  V++W
Sbjct  16   SVVALVSAKGS-NSTSQWKTLSGDAPLVIARGGFSGLFPGFSSAAFSLALITSVPDVVLW  74

Query  416  CDVQLTKDGVGICFPDIKLDNASNVATLF  502
            CDVQLTKD  GICFPDI L+N S+V  +F
Sbjct  75   CDVQLTKDEAGICFPDILLNNNSDVQDVF  103



>ref|XP_010511611.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
protein kinase domain-containing GDPDL2-like [Camelina 
sativa]
Length=1150

 Score =   118 bits (296),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 55/88 (63%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = +2

Query  242  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWC  418
            + L A Q  +  S S+WQTLSG+APLVI RGGFSGL PDSS +AY+ A  TS+  V++WC
Sbjct  49   IQLFAPQIDAQRSRSRWQTLSGEAPLVIDRGGFSGLLPDSSLDAYNLAIQTSVADVVLWC  108

Query  419  DVQLTKDGVGICFPDIKLDNASNVATLF  502
            DVQLTKDGVGICFPD+ L NASN+  ++
Sbjct  109  DVQLTKDGVGICFPDLNLFNASNIEDVY  136



>ref|XP_002300353.2| glycerophosphoryl diester phosphodiesterase family protein, partial 
[Populus trichocarpa]
 gb|EEE85158.2| glycerophosphoryl diester phosphodiesterase family protein, partial 
[Populus trichocarpa]
Length=495

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 3/84 (4%)
 Frame = +2

Query  254  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLT  433
            +AQGS    S WQTL+G+ PLVIARGGFSGLFPDSS  A+ FA  TSL  V++WCDVQLT
Sbjct  25   SAQGSA---STWQTLTGNRPLVIARGGFSGLFPDSSSVAFQFATLTSLPDVVLWCDVQLT  81

Query  434  KDGVGICFPDIKLDNASNVATLFK  505
            KDGVGIC PD++LDN++++A + K
Sbjct  82   KDGVGICAPDLRLDNSTSIAQVMK  105



>ref|NP_200359.1| putative glycerophosphoryl diester phosphodiesterase 1 [Arabidopsis 
thaliana]
 sp|Q9FJ62.1|GPDL4_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL4; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
4; Short=ATGDPDL4; AltName: Full=Glycerophosphodiesterase-like 
1; AltName: Full=Protein SHV3-LIKE 1; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08565.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU94382.1| At5g55480 [Arabidopsis thaliana]
 gb|AAV59273.1| At5g55480 [Arabidopsis thaliana]
 gb|AED96633.1| putative glycerophosphoryl diester phosphodiesterase 1 [Arabidopsis 
thaliana]
Length=766

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +2

Query  272  NSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGI  451
             S S WQTL+GDAPLVIARGGFSGL PDSS +AYSF   TS+   ++WCDVQLTKD +G+
Sbjct  37   RSKSPWQTLTGDAPLVIARGGFSGLLPDSSLDAYSFVSQTSVPGAVLWCDVQLTKDAIGL  96

Query  452  CFPDIKLDNASNVATLF  502
            CFPD+K+ NASN+  ++
Sbjct  97   CFPDVKMMNASNIQDVY  113



>emb|CDY36746.1| BnaA03g11400D [Brassica napus]
Length=766

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +2

Query  275  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGIC  454
            S S WQTL+G+APLVIARGGFSGLFPDSSFNAYSF   TS    ++WCDVQLTKDGVGIC
Sbjct  40   SKSPWQTLTGEAPLVIARGGFSGLFPDSSFNAYSFVASTSAPDAVLWCDVQLTKDGVGIC  99

Query  455  FPDIKLDNASNV  490
            FP + + N SNV
Sbjct  100  FPYVTMYNDSNV  111



>ref|XP_011013351.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 3/84 (4%)
 Frame = +2

Query  254  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLT  433
            +AQGS    S WQTL+G+ PLVIARGGFSGLFPDSS  A+ FA  TSL  V++WCDVQLT
Sbjct  25   SAQGSA---STWQTLTGNPPLVIARGGFSGLFPDSSSAAFQFAPLTSLPDVVLWCDVQLT  81

Query  434  KDGVGICFPDIKLDNASNVATLFK  505
            KDGVGIC PD++LDN++++A + K
Sbjct  82   KDGVGICAPDLRLDNSTSIAQVMK  105



>ref|XP_010443178.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
[Camelina sativa]
Length=767

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +2

Query  275  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGIC  454
            S S WQTL+GDAP +IARGGFSGL PDSS +AYSF G TS+   ++WCD+QLTK+ +GIC
Sbjct  39   SKSPWQTLTGDAPRIIARGGFSGLLPDSSLDAYSFVGQTSVPDAVLWCDLQLTKEAIGIC  98

Query  455  FPDIKLDNASNVATLF  502
            FPD+K+ NASN+  ++
Sbjct  99   FPDVKMMNASNIQEVY  114



>ref|XP_010482994.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Camelina 
sativa]
Length=769

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +2

Query  275  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGIC  454
            S S WQTL+GDAP +IARGGFSGL PDSS +AYSF G TS+   ++WCD+QLTKD  GIC
Sbjct  41   SKSPWQTLTGDAPRIIARGGFSGLLPDSSLDAYSFVGQTSVPDAVLWCDLQLTKDAFGIC  100

Query  455  FPDIKLDNASNVATLF  502
            FPD+K+ NASN+  ++
Sbjct  101  FPDVKMMNASNIQEVY  116



>emb|CDY11996.1| BnaC03g14220D [Brassica napus]
Length=773

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +2

Query  275  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGIC  454
            S S WQTL+G+APL+IARGGFSG+FPDSSFNAYSF   TS    ++WCDVQLTKDGVGIC
Sbjct  40   SKSPWQTLTGEAPLIIARGGFSGMFPDSSFNAYSFVASTSAPDAVLWCDVQLTKDGVGIC  99

Query  455  FPDIKLDNASNV  490
            FP + + N SNV
Sbjct  100  FPYVTMYNDSNV  111



>ref|XP_011014930.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
 ref|XP_011014931.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 3/84 (4%)
 Frame = +2

Query  254  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLT  433
            +AQGS    S WQTL+G+ PLVIARGGFSGLFPDSS  A+ FA  TSL  V++WCDVQLT
Sbjct  25   SAQGSA---STWQTLTGNPPLVIARGGFSGLFPDSSSVAFQFATLTSLPDVVLWCDVQLT  81

Query  434  KDGVGICFPDIKLDNASNVATLFK  505
            KDGVGIC PD++LDN++++A + K
Sbjct  82   KDGVGICAPDLRLDNSTSIAQVMK  105



>ref|XP_011014752.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
 ref|XP_011014753.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 3/84 (4%)
 Frame = +2

Query  254  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLT  433
            +AQGS    S WQTL+G+ PLVIARGGFSGLFPDSS  A+ FA  TSL  V++WCDVQLT
Sbjct  25   SAQGSA---STWQTLTGNPPLVIARGGFSGLFPDSSSVAFQFATLTSLPDVVLWCDVQLT  81

Query  434  KDGVGICFPDIKLDNASNVATLFK  505
            KDGVGIC PD++LDN++++A + K
Sbjct  82   KDGVGICAPDLRLDNSTSIAQVMK  105



>gb|AAL07129.1| unknown protein [Arabidopsis thaliana]
Length=759

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 5/98 (5%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQ---GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGX  388
            LLLC  +   L+AAQ    S    S W TL+GD PLVIARGGFSGLFPDSS++AY+FA  
Sbjct  10   LLLCGVILIQLLAAQIHAQSKKPKSPWPTLTGDPPLVIARGGFSGLFPDSSYDAYNFAIL  69

Query  389  TSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            TS+   ++WCDVQLTKD +GICFPD+ + N+S++  ++
Sbjct  70   TSVPDAVLWCDVQLTKDALGICFPDLTMRNSSSIEAVY  107



>ref|NP_567755.1| glycerophosphoryl diester phosphodiesterase-like 3 [Arabidopsis 
thaliana]
 sp|Q9SZ11.3|GPDL3_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL3; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
3; Short=ATGDPDL3; AltName: Full=Glycerophosphodiesterase-like 
2; AltName: Full=Protein MUTANT ROOT HAIR 5; AltName: Full=Protein 
SHAVEN 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE85238.1| glycerophosphoryl diester phosphodiesterase-like 3 [Arabidopsis 
thaliana]
Length=759

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 5/98 (5%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQ---GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGX  388
            LLLC  +   L+AAQ    S    S W TL+GD PLVIARGGFSGLFPDSS++AY+FA  
Sbjct  10   LLLCGVILIQLLAAQIHAQSKKPKSPWPTLTGDPPLVIARGGFSGLFPDSSYDAYNFAIL  69

Query  389  TSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            TS+   ++WCDVQLTKD +GICFPD+ + N+S++  ++
Sbjct  70   TSVPDAVLWCDVQLTKDALGICFPDLTMRNSSSIEAVY  107



>emb|CAB36515.1| putative protein [Arabidopsis thaliana]
 emb|CAB79524.1| putative protein [Arabidopsis thaliana]
Length=770

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 5/98 (5%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQ---GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGX  388
            LLLC  +   L+AAQ    S    S W TL+GD PLVIARGGFSGLFPDSS++AY+FA  
Sbjct  21   LLLCGVILIQLLAAQIHAQSKKPKSPWPTLTGDPPLVIARGGFSGLFPDSSYDAYNFAIL  80

Query  389  TSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            TS+   ++WCDVQLTKD +GICFPD+ + N+S++  ++
Sbjct  81   TSVPDAVLWCDVQLTKDALGICFPDLTMRNSSSIEAVY  118



>emb|CDY71959.1| BnaCnng75290D, partial [Brassica napus]
Length=328

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 68/90 (76%), Gaps = 3/90 (3%)
 Frame = +2

Query  221  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLT  400
            L+L+    T + AQ    S S WQTL+G APL+IARGGFSGL PDSS +AYS    TS++
Sbjct  24   LILIQLLPTQLLAQ---RSKSPWQTLTGSAPLIIARGGFSGLLPDSSVDAYSIVSQTSVS  80

Query  401  XVIMWCDVQLTKDGVGICFPDIKLDNASNV  490
              ++WCDVQLTKDGVGICFPD+K+ NAS++
Sbjct  81   DAVLWCDVQLTKDGVGICFPDVKMMNASSI  110



>emb|CDX94294.1| BnaC01g18900D [Brassica napus]
Length=757

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 71/96 (74%), Gaps = 3/96 (3%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTS  394
            LLLC  V   L+A Q  +    + W+TLSG +P VIARGGFSGLFPDSS +AY+FA  TS
Sbjct  9    LLLCGVVLIQLLAVQIDAQRPKTHWKTLSGFSPRVIARGGFSGLFPDSSLDAYNFAMLTS  68

Query  395  LTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            +   ++WCD+QLTKDG GICFPD+ + NASNV T++
Sbjct  69   VADAVLWCDLQLTKDGAGICFPDLTMSNASNVETVY  104



>ref|XP_007146559.1| hypothetical protein PHAVU_006G050800g [Phaseolus vulgaris]
 gb|ESW18553.1| hypothetical protein PHAVU_006G050800g [Phaseolus vulgaris]
Length=765

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 68/88 (77%), Gaps = 2/88 (2%)
 Frame = +2

Query  236  SAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMW  415
            S + LV+AQGS  +T+ W TLSG  PLVIARGGFSG++PDSS  AYS A  TSL  VI+W
Sbjct  22   SVLPLVSAQGS--NTTSWNTLSGSPPLVIARGGFSGIYPDSSDIAYSLAAQTSLANVILW  79

Query  416  CDVQLTKDGVGICFPDIKLDNASNVATL  499
            CDVQLTKD  GIC PDIKL+NA+++  +
Sbjct  80   CDVQLTKDREGICIPDIKLENATDIGHV  107



>ref|XP_010496109.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Camelina sativa]
Length=1128

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = +2

Query  242  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWC  418
            + L A Q  +  S S+WQTLSG+AP VIARGGFSGL PDSS +AY+ A  TS+  V++WC
Sbjct  30   IQLFAPQIDAQRSRSRWQTLSGEAPRVIARGGFSGLLPDSSIDAYNLAIQTSVADVVLWC  89

Query  419  DVQLTKDGVGICFPDIKLDNASNVATLF  502
            DVQLTKDGVGICFPD+ L NAS V  ++
Sbjct  90   DVQLTKDGVGICFPDLNLANASTVQFVY  117



>ref|XP_009137635.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=1321

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 69/96 (72%), Gaps = 3/96 (3%)
 Frame = +2

Query  224  LLLCSAVTLVAAQGSTNST---SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTS  394
            +LLC  V +      T++    S W+TLSGDAP VI+RGGFSGLFPDSS +AY+FA  TS
Sbjct  6    VLLCGVVLIHVFASQTDAQRPRSPWKTLSGDAPRVISRGGFSGLFPDSSLDAYNFALQTS  65

Query  395  LTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            +   I+WCDVQLTKDG GICFPD+ + NAS +  ++
Sbjct  66   VADAILWCDVQLTKDGAGICFPDLNMSNASTIEVVY  101



>ref|XP_010675854.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Beta vulgaris subsp. vulgaris]
Length=764

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = +2

Query  209  SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGX  388
            S+  +++        +AQ +T S S W TL+G  PLVIA+GGFSGLFPDSS NAY FA  
Sbjct  20   SLIVIIVFLQFFAFASAQQAT-SNSPWLTLNGSPPLVIAKGGFSGLFPDSSANAYQFATM  78

Query  389  TSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
             S+  V++WCDVQLT+DGVGICFP++KLDN+S +  +F 
Sbjct  79   VSVPDVVLWCDVQLTRDGVGICFPNLKLDNSSGIEHVFP  117



>ref|XP_010252664.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Nelumbo nucifera]
Length=756

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 75/102 (74%), Gaps = 5/102 (5%)
 Frame = +2

Query  194  MWKLRSIFNLLLLCSAVTLVAAQ---GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  364
            M     +F L +L SAV LVAAQ    S N+TS WQTL G+APLVIA+GGFSG+FPDSS 
Sbjct  1    MTTSHPLFLLFVLHSAV-LVAAQSYRASKNTTSPWQTLHGNAPLVIAKGGFSGIFPDSSI  59

Query  365  NAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNV  490
            +AY  +    L+ VI+WCDVQLTKDG GICFP + LDN+S++
Sbjct  60   DAYE-STLLLLSNVILWCDVQLTKDGAGICFPYLNLDNSSDI  100



>ref|XP_009142640.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=757

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 3/96 (3%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTS  394
            LLLC  V   L+A Q  +    ++W+TLSG +P VIARGGFSGLFPDSS +AY+FA  TS
Sbjct  9    LLLCGVVLIQLLAVQIDAQRPKTQWKTLSGFSPRVIARGGFSGLFPDSSLDAYNFAMQTS  68

Query  395  LTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            +   ++WCD+QLTKDG GICFPD+ + NASNV +++
Sbjct  69   VLDAVLWCDLQLTKDGAGICFPDLTMSNASNVESVY  104



>emb|CDX89312.1| BnaA01g15810D [Brassica napus]
Length=757

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 3/96 (3%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTS  394
            LLLC  V   L+A Q  +    ++W+TLSG +P VIARGGFSGLFPDSS +AY+FA  TS
Sbjct  9    LLLCGVVLIQLLAVQIDAQRPKTQWKTLSGFSPRVIARGGFSGLFPDSSLDAYNFAMQTS  68

Query  395  LTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            +   ++WCD+QLTKDG GICFPD+ + NASNV +++
Sbjct  69   VLDAVLWCDLQLTKDGAGICFPDLTMSNASNVESVY  104



>ref|XP_010913178.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 isoform 
X2 [Elaeis guineensis]
Length=674

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 74/102 (73%), Gaps = 2/102 (2%)
 Frame = +2

Query  197  WKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYS  376
            W++  +    L    + LV AQG TNS S+WQTLSG+AP +IA+GGFSGLFPDSS  A+ 
Sbjct  8    WEVSFLVAFFLAVQHLGLVTAQG-TNS-SRWQTLSGNAPAIIAKGGFSGLFPDSSAYAFQ  65

Query  377  FAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            FA   S +  I+WCDVQLT D VGIC PDIKL+N +N+A+++
Sbjct  66   FALAISSSDTILWCDVQLTMDKVGICVPDIKLNNCTNIASVY  107



>ref|XP_006283180.1| hypothetical protein CARUB_v10004210mg [Capsella rubella]
 gb|EOA16078.1| hypothetical protein CARUB_v10004210mg [Capsella rubella]
Length=757

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 71/96 (74%), Gaps = 3/96 (3%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTS  394
            LLLC  V   L+A+   +  S S W TL+GDAPLVIARGGFSGLFPDSS++AY+FA  TS
Sbjct  10   LLLCVVVLIQLLASHIHAQRSKSPWPTLTGDAPLVIARGGFSGLFPDSSYDAYNFAMLTS  69

Query  395  LTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            +    +WCDVQLTKD +GICFPD+ + NAS +  ++
Sbjct  70   VPDAALWCDVQLTKDALGICFPDLNMANASTIDGVY  105



>ref|XP_010913177.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 isoform 
X1 [Elaeis guineensis]
Length=759

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 74/102 (73%), Gaps = 2/102 (2%)
 Frame = +2

Query  197  WKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYS  376
            W++  +    L    + LV AQG TNS S+WQTLSG+AP +IA+GGFSGLFPDSS  A+ 
Sbjct  8    WEVSFLVAFFLAVQHLGLVTAQG-TNS-SRWQTLSGNAPAIIAKGGFSGLFPDSSAYAFQ  65

Query  377  FAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            FA   S +  I+WCDVQLT D VGIC PDIKL+N +N+A+++
Sbjct  66   FALAISSSDTILWCDVQLTMDKVGICVPDIKLNNCTNIASVY  107



>emb|CDY46687.1| BnaA03g48210D [Brassica napus]
Length=717

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = +2

Query  242  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWC  418
            + L+AAQ  +  S SKWQTL+G +P VIARGGFSGLFPDSS +AY+FA  TS+  V++WC
Sbjct  13   IQLLAAQTDAQGSKSKWQTLTGFSPRVIARGGFSGLFPDSSIDAYNFAMLTSVEDVVLWC  72

Query  419  DVQLTKDGVGICFPDIKLDNASNVATLF  502
            D+QLTKDG GICFP + + NASN+   +
Sbjct  73   DLQLTKDGAGICFPGLTMSNASNIEAAY  100



>ref|XP_009137609.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=759

 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = +2

Query  242  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWC  418
            + L+AAQ  +  S SKWQTL+G +P VIARGGFSGLFPDSS +AY+FA  TS+  V++WC
Sbjct  13   IQLLAAQTDAQGSKSKWQTLTGFSPRVIARGGFSGLFPDSSIDAYNFAMLTSVEDVVLWC  72

Query  419  DVQLTKDGVGICFPDIKLDNASNVATLF  502
            D+QLTKDG GICFP + + NASN+   +
Sbjct  73   DLQLTKDGAGICFPGLTMSNASNIEAAY  100



>ref|XP_009361078.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 67/89 (75%), Gaps = 4/89 (4%)
 Frame = +2

Query  224  LLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTX  403
            LLL S V LV+AQGS    SKW+TLSGD P V+ARGGFSGLFP  S  A++ A  TSL  
Sbjct  12   LLLHSVVALVSAQGS----SKWKTLSGDPPKVVARGGFSGLFPGYSSAAFNLALLTSLQD  67

Query  404  VIMWCDVQLTKDGVGICFPDIKLDNASNV  490
             ++WCDVQLTKDG GICFPD+ L+N SN+
Sbjct  68   AVLWCDVQLTKDGAGICFPDLLLNNNSNI  96



>ref|XP_010496108.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=764

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 69/96 (72%), Gaps = 3/96 (3%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTS  394
            LL C  V   L A Q  +  S S+WQTL+G+ P VIARGGFSGL PDSS +AY+ A  TS
Sbjct  16   LLFCGVVLIHLFATQIDAQRSRSRWQTLTGEVPRVIARGGFSGLLPDSSLDAYNLAIQTS  75

Query  395  LTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            +  V++WCDVQLTKDGVGIC+PD+ L NAS V  ++
Sbjct  76   VADVVLWCDVQLTKDGVGICYPDLNLANASTVQFVY  111



>ref|XP_002864395.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH40654.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=757

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +2

Query  272  NSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGI  451
             S S WQTL+GDAP +IARGGFSGL PDSS +AYSF   TS+   ++WCDVQLTKD +GI
Sbjct  28   RSKSPWQTLTGDAPRIIARGGFSGLLPDSSIDAYSFVSQTSVPGTLLWCDVQLTKDAIGI  87

Query  452  CFPDIKLDNASNVATLF  502
            CFPD+K+ NAS++  ++
Sbjct  88   CFPDVKMMNASHIQDVY  104



>ref|XP_002300351.2| hypothetical protein POPTR_0001s37160g [Populus trichocarpa]
 gb|EEE85156.2| hypothetical protein POPTR_0001s37160g [Populus trichocarpa]
Length=754

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 68/84 (81%), Gaps = 3/84 (4%)
 Frame = +2

Query  254  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLT  433
            +AQGS  +   WQTL+G+ PLVIARGGFSGLFPDSS +A+ FA  TSL  V++WCDVQLT
Sbjct  25   SAQGSATT---WQTLTGNPPLVIARGGFSGLFPDSSSDAFQFATLTSLPGVVLWCDVQLT  81

Query  434  KDGVGICFPDIKLDNASNVATLFK  505
            KD VGIC PD++LDN++++A + +
Sbjct  82   KDSVGICAPDLRLDNSTSIAQVMQ  105



>ref|XP_007146552.1| hypothetical protein PHAVU_006G050300g [Phaseolus vulgaris]
 gb|ESW18546.1| hypothetical protein PHAVU_006G050300g [Phaseolus vulgaris]
Length=714

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 71/95 (75%), Gaps = 3/95 (3%)
 Frame = +2

Query  221  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLT  400
            L+L  S V LV++ G     S W+TL G  PLVIARGGFSG+FPDSS  AY+ A  TS  
Sbjct  14   LILQYSLVALVSSAGPP---SGWKTLQGSPPLVIARGGFSGIFPDSSSLAYNLALNTSSP  70

Query  401  XVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
             VI+WCDVQLTKDG GICFP++KLDNA++++ +++
Sbjct  71   NVILWCDVQLTKDGTGICFPELKLDNATDISVVYQ  105



>ref|XP_009588257.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana tomentosiformis]
Length=741

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +2

Query  296  LSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLD  475
             +GDAPLVIARGGFSGLFPDSS++AY  A  TSL  VI WCDVQLTKDGVGIC PD+KLD
Sbjct  23   FAGDAPLVIARGGFSGLFPDSSYDAYMVAMETSLANVIAWCDVQLTKDGVGICLPDLKLD  82

Query  476  NASNVATLFK  505
            NAS++   FK
Sbjct  83   NASDIDVYFK  92



>ref|XP_009120058.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Brassica rapa]
Length=768

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 69/94 (73%), Gaps = 3/94 (3%)
 Frame = +2

Query  221  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLT  400
            L+L+    T + AQ    S S WQTL+G APL+IARGGFSGL PDSS +AYS    TS++
Sbjct  24   LILIHLLPTQLLAQ---RSKSPWQTLTGSAPLIIARGGFSGLLPDSSVDAYSIVSQTSVS  80

Query  401  XVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
              ++WCDVQLTKDGVGICFPD+K+ NAS++   +
Sbjct  81   GAVLWCDVQLTKDGVGICFPDVKMMNASSIQDAY  114



>emb|CDY58867.1| BnaC09g52640D [Brassica napus]
Length=722

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 72/104 (69%), Gaps = 2/104 (2%)
 Frame = +2

Query  194  MWKLR-SIFNLLLLCSAVTLVAAQG-STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFN  367
            M++LR S F LL +      ++ Q  +  S S WQTL+G+APL+IARGGFSG+FPDSS  
Sbjct  11   MFRLRASKFLLLYVLILSQFLSTQLLAQRSKSPWQTLTGEAPLIIARGGFSGMFPDSSVT  70

Query  368  AYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATL  499
            AYSF   TS+   ++WCDVQLTKDGVGI FPD+ +   SNV  L
Sbjct  71   AYSFVSATSVPDAVLWCDVQLTKDGVGISFPDVTMYKDSNVKML  114



>emb|CDY17323.1| BnaA10g09570D [Brassica napus]
Length=768

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 69/94 (73%), Gaps = 3/94 (3%)
 Frame = +2

Query  221  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLT  400
            L+L+    T + AQ    S S WQTL+G APL+IARGGFSGL PDSS +AYS    TS++
Sbjct  24   LILIQLLPTQLLAQ---RSKSPWQTLTGSAPLIIARGGFSGLLPDSSVDAYSIVSQTSVS  80

Query  401  XVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
              ++WCDVQLTKDGVGICFPD+K+ NAS++   +
Sbjct  81   GAVLWCDVQLTKDGVGICFPDVKMMNASSIQDAY  114



>emb|CDX86765.1| BnaA09g21550D [Brassica napus]
Length=166

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 71/98 (72%), Gaps = 8/98 (8%)
 Frame = +2

Query  194  MWKLRS----IFNLLLLCSAV-TLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDS  358
            M++LR+    + ++L+L   + T + AQ    S S WQTL+G+APL+IARGGFSGLFPDS
Sbjct  11   MFRLRASKFLLLSVLILSQFLSTQLLAQ---RSKSPWQTLTGEAPLIIARGGFSGLFPDS  67

Query  359  SFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKL  472
            S  AYSF   TS+   ++WCDVQLTKDGVGI FPD+ +
Sbjct  68   SVTAYSFVSATSVPDAVLWCDVQLTKDGVGISFPDVTM  105



>ref|XP_010252665.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Nelumbo nucifera]
Length=754

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  278  TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICF  457
            TS WQTLSG+APLVIA+GGFSG+FPDSS++AY+ A  TSL  V++WCDVQLTKDG GICF
Sbjct  32   TSPWQTLSGNAPLVIAKGGFSGIFPDSSYHAYALALITSLPNVVLWCDVQLTKDGDGICF  91

Query  458  PDIKLDNASNVATLF  502
            P + L N+S+++ +F
Sbjct  92   PYLNLGNSSSISYVF  106


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 43/78 (55%), Gaps = 9/78 (12%)
 Frame = +2

Query  257  AQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTK  436
            A  STNS       SG APLVI+  G SG++P S+  AY  A        ++ C VQ+T+
Sbjct  346  AHLSTNS-------SGKAPLVISHNGASGIYPSSTDIAYKQAFDDGAD--VIDCAVQMTQ  396

Query  437  DGVGICFPDIKLDNASNV  490
            DGV IC   I L + +NV
Sbjct  397  DGVSICLGSINLMDGTNV  414



>ref|XP_006297062.1| hypothetical protein CARUB_v10013062mg [Capsella rubella]
 gb|EOA29960.1| hypothetical protein CARUB_v10013062mg [Capsella rubella]
Length=729

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = +2

Query  278  TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICF  457
            +S WQTLSG  P+VIARGGFSG+FPDSS  AY  A  T+ T V +WCD+QLTKDGVGICF
Sbjct  22   SSSWQTLSGKPPVVIARGGFSGIFPDSSIQAYQLASITTSTDVTLWCDLQLTKDGVGICF  81

Query  458  PDIKLDNASNVATLF  502
            P++ LDN SNV  ++
Sbjct  82   PNLNLDNGSNVMNVY  96



>emb|CDX92806.1| BnaC07g40640D [Brassica napus]
Length=716

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = +2

Query  242  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWC  418
            + L+A Q  +  S SKWQTL+G +P VIARGGFSGLFPDSS +AY+FA  TS+  V++WC
Sbjct  13   IQLLAVQTDAQRSKSKWQTLTGFSPRVIARGGFSGLFPDSSIDAYNFAMLTSVEDVVLWC  72

Query  419  DVQLTKDGVGICFPDIKLDNASNVATLF  502
            D+QLTKDG GICFP + + NASN+   +
Sbjct  73   DLQLTKDGAGICFPGLTMSNASNIEAAY  100



>ref|XP_006413151.1| hypothetical protein EUTSA_v10024494mg [Eutrema salsugineum]
 gb|ESQ54604.1| hypothetical protein EUTSA_v10024494mg [Eutrema salsugineum]
Length=757

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 70/96 (73%), Gaps = 3/96 (3%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTS  394
            LLLC  V   L+AAQ  +  S S W TL+GD P VIARGGFSGLFPDSS +AY FA  TS
Sbjct  9    LLLCGVVLIQLLAAQIDAQKSKSPWLTLTGDFPRVIARGGFSGLFPDSSLDAYKFAMITS  68

Query  395  LTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            +  V++WCD+QLTKDG GICFP + + NAS++  ++
Sbjct  69   VPDVVLWCDLQLTKDGAGICFPGLTMSNASSINGVY  104



>emb|CDY12600.1| BnaA02g12680D [Brassica napus]
Length=831

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 65/88 (74%), Gaps = 1/88 (1%)
 Frame = +2

Query  242  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWC  418
            + L AAQ  +  S S WQTLSGDAPLVIA GGFSGLFPDS  +AY  A  TS+   ++WC
Sbjct  622  IQLFAAQTNAKRSRSPWQTLSGDAPLVIASGGFSGLFPDSILDAYKLAMQTSVPGAVLWC  681

Query  419  DVQLTKDGVGICFPDIKLDNASNVATLF  502
            DVQLTKD  GIC+PD+KL+N S + +++
Sbjct  682  DVQLTKDDFGICYPDLKLNNHSTIESVY  709



>ref|XP_009127505.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=1313

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 65/88 (74%), Gaps = 1/88 (1%)
 Frame = +2

Query  242  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWC  418
            + L AAQ  +  S S WQTLSGDAPLVIA GGFSGLFPDS  +AY  A  TS+   ++WC
Sbjct  14   IQLFAAQTNAKRSRSPWQTLSGDAPLVIASGGFSGLFPDSILDAYKLAMQTSVPGAVLWC  73

Query  419  DVQLTKDGVGICFPDIKLDNASNVATLF  502
            DVQLTKD  GIC+PD+KL+N S + +++
Sbjct  74   DVQLTKDDFGICYPDLKLNNHSTIESVY  101



>ref|XP_004294052.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Fragaria vesca subsp. vesca]
Length=753

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 76/106 (72%), Gaps = 6/106 (6%)
 Frame = +2

Query  194  MWKLRSIFNLL--LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFN  367
            MW  R+   +L  LL  ++ LV+AQGS    S W+TL+GD PLVIARGGFSGLFP  S  
Sbjct  1    MWNSRAPLFVLAALLFYSLALVSAQGS----SPWKTLTGDPPLVIARGGFSGLFPGFSSA  56

Query  368  AYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
            AY+ A  TS+  V+++CDVQLTK+  GICFPD+ L+N+SNV  +F+
Sbjct  57   AYNLALITSVPDVVLYCDVQLTKEAAGICFPDLLLNNSSNVDQVFE  102



>ref|XP_009396661.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=744

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = +2

Query  215  FNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTS  394
             N+LL    V L  A  +  S +KWQTLSG+AP VIARGGFSGLFP+SS  AY FA  TS
Sbjct  3    LNVLLFI--VLLHGAAAAVVSPTKWQTLSGNAPAVIARGGFSGLFPESSQFAYQFAQSTS  60

Query  395  LTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            L  V+++CD+QLTKDG GIC  D++LDN++ ++ +F
Sbjct  61   LKNVVLYCDLQLTKDGAGICHSDLRLDNSTTISAVF  96



>emb|CDX86766.1| BnaA09g21560D [Brassica napus]
Length=633

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = +2

Query  266  STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGV  445
            +  S S WQTL+G+APLVIARGGFSGLFPDSS  AYSF   TS+   ++WCDVQLTKDGV
Sbjct  37   AQRSKSPWQTLTGEAPLVIARGGFSGLFPDSSVTAYSFVSATSVPDAVLWCDVQLTKDGV  96

Query  446  GICFPDIKL  472
            GICFPD+ +
Sbjct  97   GICFPDVTM  105



>ref|XP_010419030.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=772

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 72/102 (71%), Gaps = 5/102 (5%)
 Frame = +2

Query  194  MWKLRSIFNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  364
            M  LRS  + +LLC  V   L A +  +  S S+WQTLSG+AP VIARGGFSGL PDSS 
Sbjct  14   MLLLRS--STILLCGVVLIQLFAPRIDAQRSRSRWQTLSGEAPRVIARGGFSGLLPDSSL  71

Query  365  NAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNV  490
            +AY+ A   S+  V++WCDVQLTK GVGICFPD+ L NAS V
Sbjct  72   DAYNLAIQKSVADVVLWCDVQLTKYGVGICFPDLNLANASTV  113



>emb|CDY60415.1| BnaC02g45340D [Brassica napus]
Length=1186

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 65/88 (74%), Gaps = 1/88 (1%)
 Frame = +2

Query  242  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWC  418
            + L AAQ  +  S S WQTLSGDAPLVIA GGFSGLFPDS  +AY  A  TS+   ++WC
Sbjct  14   IQLFAAQTNAKRSRSPWQTLSGDAPLVIASGGFSGLFPDSILDAYKLAMQTSVPGAVLWC  73

Query  419  DVQLTKDGVGICFPDIKLDNASNVATLF  502
            DVQLTKD  G+C+PD+KL+N S + +++
Sbjct  74   DVQLTKDDFGMCYPDLKLNNHSTIESVY  101



>emb|CDX92782.1| BnaC07g40400D [Brassica napus]
Length=1322

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 68/96 (71%), Gaps = 3/96 (3%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTS  394
            + LC  V   L A+Q  +    S W+TLSGDAP VI+RGGFSGLFPDSS +AY FA  TS
Sbjct  6    VFLCGVVLIHLFASQTDAQRPRSPWKTLSGDAPRVISRGGFSGLFPDSSLDAYIFALQTS  65

Query  395  LTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            +   ++WCDVQLTKDG GICFPD+ + NAS +  ++
Sbjct  66   VADAVLWCDVQLTKDGAGICFPDLNMSNASIIEVVY  101



>ref|XP_010415240.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=780

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 69/95 (73%), Gaps = 4/95 (4%)
 Frame = +2

Query  230  LCSAVTLV---AAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSL  397
            LC  + L+   AAQ  +  STS++  L GDAP VIARGGFSGL PDSS +AY+ A  TS+
Sbjct  20   LCCGIVLILLFAAQIDAQRSTSRFIYLPGDAPRVIARGGFSGLLPDSSLDAYNLAIQTSV  79

Query  398  TXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
              V++WCDVQLTKDGVGICFPD+ + NAS V  ++
Sbjct  80   ADVVLWCDVQLTKDGVGICFPDLNMANASTVQNVY  114



>gb|EYU27402.1| hypothetical protein MIMGU_mgv1a001806mg [Erythranthe guttata]
Length=757

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 72/103 (70%), Gaps = 1/103 (1%)
 Frame = +2

Query  197  WKLRSIFNLLLLCSAVTLVAAQGSTNSTS-KWQTLSGDAPLVIARGGFSGLFPDSSFNAY  373
            W   ++     LCS+  +VA +  ++S   KWQTL+G+ PLVIA+GGFSG+FPDSS NAY
Sbjct  5    WHFCTLILFFWLCSSPPVVAGRRGSSSGGGKWQTLTGNPPLVIAKGGFSGIFPDSSLNAY  64

Query  374  SFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
              A  T L   + WC+V LTKDG GICFP+++L+NASN+  ++
Sbjct  65   RLAVETGLRNSLAWCEVYLTKDGAGICFPELRLENASNIGEVY  107



>gb|AAO42211.1| unknown protein [Arabidopsis thaliana]
Length=729

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +2

Query  278  TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICF  457
            +S WQTLSG  P VIARGGFSG+FPDSS  AY     T+   V++WCD+QLTKDGVGICF
Sbjct  22   SSSWQTLSGKPPAVIARGGFSGMFPDSSIQAYQLVNITTSPDVMLWCDLQLTKDGVGICF  81

Query  458  PDIKLDNASNV  490
            P++KLDN SNV
Sbjct  82   PNLKLDNGSNV  92



>ref|NP_188688.1| glycerophosphodiester phosphodiesterase-like protein [Arabidopsis 
thaliana]
 sp|F4JEQ1.1|GPDL5_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL5; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
5; Short=ATGDPDL5; AltName: Full=Glycerophosphodiesterase-like 
4; AltName: Full=Protein SHV3-LIKE 3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE76390.1| glycerophosphodiester phosphodiesterase-like protein [Arabidopsis 
thaliana]
Length=729

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +2

Query  278  TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICF  457
            +S WQTLSG  P VIARGGFSG+FPDSS  AY     T+   V++WCD+QLTKDGVGICF
Sbjct  22   SSSWQTLSGKPPAVIARGGFSGMFPDSSIQAYQLVNITTSPDVMLWCDLQLTKDGVGICF  81

Query  458  PDIKLDNASNV  490
            P++KLDN SNV
Sbjct  82   PNLKLDNGSNV  92



>ref|XP_007020655.1| SHV3-like 2, putative isoform 4, partial [Theobroma cacao]
 gb|EOY12180.1| SHV3-like 2, putative isoform 4, partial [Theobroma cacao]
Length=559

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  281  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFP  460
            S+WQTL+GD P VIARGGFSG+F DSS  AY  A  T  T VI+WCDVQL+KD  GICFP
Sbjct  1    SRWQTLNGDVPFVIARGGFSGMFSDSSPAAYRLALLTGPTNVILWCDVQLSKDAAGICFP  60

Query  461  DIKLDNASNVATLF  502
            D+KLDN S++ T+F
Sbjct  61   DLKLDNNSDITTVF  74



>ref|XP_006406374.1| hypothetical protein EUTSA_v10020151mg [Eutrema salsugineum]
 gb|ESQ47827.1| hypothetical protein EUTSA_v10020151mg [Eutrema salsugineum]
Length=727

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +2

Query  269  TNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVG  448
            T S S WQTLSG+ P+VIARGGFSGLFPDSS  AY     T+   V +WCD+QLTKDGVG
Sbjct  19   TASASSWQTLSGNPPVVIARGGFSGLFPDSSEYAYELVNLTTSEDVTLWCDLQLTKDGVG  78

Query  449  ICFPDIKLDNASNVATLF  502
            ICFP++ LDN S+V  ++
Sbjct  79   ICFPNLNLDNGSDVVDVY  96



>emb|CDY19634.1| BnaA05g20420D [Brassica napus]
Length=726

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +2

Query  269  TNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVG  448
            T S+S WQTL G  P+V+ARGGFSGL PDSS NAY     T+   V +WCD+QLTKDG G
Sbjct  19   TASSSSWQTLHGKPPVVVARGGFSGLLPDSSENAYKMVKLTTSPDVTLWCDLQLTKDGAG  78

Query  449  ICFPDIKLDNASNVATLF  502
            ICFP++ LDNASNV  ++
Sbjct  79   ICFPNLNLDNASNVKDVY  96



>ref|XP_009145621.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=726

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +2

Query  269  TNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVG  448
            T S+S WQTL G  P+V+ARGGFSGL PDSS NAY     T+   V +WCD+QLTKDG G
Sbjct  19   TASSSSWQTLHGKPPVVVARGGFSGLLPDSSENAYKMVKLTTSPDVTLWCDLQLTKDGAG  78

Query  449  ICFPDIKLDNASNVATLF  502
            ICFP++ LDNASNV  ++
Sbjct  79   ICFPNLNLDNASNVKDVY  96



>ref|XP_002883252.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH59511.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=731

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +2

Query  278  TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICF  457
            +S WQTLSG  P VIARGGFSG+FPDSS  AY     T+   V++WCD+QLTKDGVGICF
Sbjct  22   SSSWQTLSGKPPAVIARGGFSGMFPDSSSQAYQLVNITTSPDVMLWCDLQLTKDGVGICF  81

Query  458  PDIKLDNASNVATLF  502
            P++ LDN S+V T++
Sbjct  82   PNLNLDNGSDVMTIY  96



>ref|XP_004500131.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Cicer arietinum]
Length=704

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  281  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFP  460
            S W+TL G  PLVIARGGFSG+FPDSS  +Y+ A  TS   V +WCDVQLTKDGVGICFP
Sbjct  22   SGWKTLQGSPPLVIARGGFSGIFPDSSSPSYNLALKTSSLNVTLWCDVQLTKDGVGICFP  81

Query  461  DIKLDNASNVATLF  502
            D KLDNA++++ ++
Sbjct  82   DFKLDNATDISVVY  95



>ref|XP_008806340.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=808

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 67/94 (71%), Gaps = 2/94 (2%)
 Frame = +2

Query  221  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLT  400
              L    + LV A+  T+++S+WQTLSG AP +IARGGFSGLFPDSS +A+ F    S  
Sbjct  64   FFLAVQHLGLVTAK--TSNSSRWQTLSGRAPAIIARGGFSGLFPDSSLDAFLFGVSVSSN  121

Query  401  XVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
               +WC+VQLTKD VGIC PDIKLDN +N+A ++
Sbjct  122  DSFLWCNVQLTKDNVGICVPDIKLDNCTNIANVY  155



>gb|KCW78936.1| hypothetical protein EUGRSUZ_C00368 [Eucalyptus grandis]
Length=737

 Score =   108 bits (269),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +2

Query  194  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  373
            M++    F+LL+  S     +    T+S +KW+TL+GD P+VIARGGFSG+FPDSS  A 
Sbjct  1    MFRCLLFFSLLIHSSLAQKSSGGSGTSSPTKWKTLNGDKPVVIARGGFSGIFPDSSEFAV  60

Query  374  SFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
              A  +S+  V+++CD+QLTKDG+GIC PDIKLDN +++A +F
Sbjct  61   DMATTSSMGDVVLYCDLQLTKDGIGICQPDIKLDNTTDIAMVF  103



>ref|NP_001185333.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
 gb|AEE34580.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
Length=785

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 72/118 (61%), Gaps = 25/118 (21%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSG----------------------DAPLVIAR  328
            LL C  V   L AAQ  +  STS+WQTL+G                      DAPLVIAR
Sbjct  18   LLFCGVVLIHLFAAQIDAQRSTSRWQTLNGESCSHFISFFCALFPRKQENLCDAPLVIAR  77

Query  329  GGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            GGFSGL+PDSS  AY  A  TS+  V++WCD+QLTKDG+GICFPD+ L NAS +  ++
Sbjct  78   GGFSGLYPDSSIAAYQLATLTSVADVVLWCDLQLTKDGLGICFPDLNLANASTIDRVY  135



>ref|XP_003579951.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Brachypodium distachyon]
Length=744

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 68/99 (69%), Gaps = 12/99 (12%)
 Frame = +2

Query  230  LCSAVT--------LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  385
            +CSAV         + AAQG+    S W+TLSGDAP +IA+GGFSGLFPDSS  AY FA 
Sbjct  7    VCSAVASFVLLWLGVAAAQGA----SSWKTLSGDAPAIIAKGGFSGLFPDSSEFAYQFAL  62

Query  386  XTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
              S    I++CDV+LTKDG+G+C PDIKLDN +N+   +
Sbjct  63   IASSPDTILYCDVRLTKDGLGVCLPDIKLDNCTNIPEFY  101



>dbj|BAD17454.1| glycerophosphoryl diester phosphodiesterase 2 precursor-like 
protein [Oryza sativa Japonica Group]
Length=136

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +2

Query  281  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFP  460
            S W+TLSG+ P +IA+GGFSGLFPDSS  AY F    S     +WCDVQLTKDG GIC P
Sbjct  30   STWKTLSGNPPAIIAKGGFSGLFPDSSDFAYGFVAAASSPDTALWCDVQLTKDGAGICLP  89

Query  461  DIKLDNASNVATLF  502
            DI++DN +N+A ++
Sbjct  90   DIRMDNCTNIANVY  103



>ref|XP_010474169.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Camelina sativa]
Length=388

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +2

Query  287  WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDI  466
            +  L GDAP VIARGGFSGL PDSS +AY+ A  TS+  V++WCDVQLTKDGVGICFPD+
Sbjct  107  YHYLPGDAPRVIARGGFSGLLPDSSIDAYNLAIQTSVADVVLWCDVQLTKDGVGICFPDL  166

Query  467  KLDNASNVATLF  502
             L NAS V  ++
Sbjct  167  NLANASTVQFVY  178



>gb|KHN28414.1| Putative glycerophosphoryl diester phosphodiesterase 2 [Glycine 
soja]
Length=709

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 66/94 (70%), Gaps = 3/94 (3%)
 Frame = +2

Query  221  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLT  400
            L+L  S V LV++ G       W+TL G  PLVIARGGFSG+FPDSS  AYS    T   
Sbjct  10   LILQYSLVALVSSAGPRGG---WKTLQGSPPLVIARGGFSGIFPDSSSLAYSLTLDTCGP  66

Query  401  XVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
             V +WCDVQLTKDGVGICFP++KLDNAS+++  +
Sbjct  67   NVTLWCDVQLTKDGVGICFPELKLDNASDISIAY  100



>emb|CDY46667.1| BnaA03g48410D [Brassica napus]
Length=1323

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 69/98 (70%), Gaps = 5/98 (5%)
 Frame = +2

Query  224  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGD--APLVIARGGFSGLFPDSSFNAYSFAGX  388
            +LLC  V   L A+Q  +    S W+TLSG+  AP VI+RGGFSGLFPDSS +AY+FA  
Sbjct  6    VLLCGVVLIHLFASQTDAQRPGSPWKTLSGESVAPRVISRGGFSGLFPDSSLDAYNFALQ  65

Query  389  TSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            TS+   +MWCDVQLTKDG GICFP + + NASN+   +
Sbjct  66   TSVADAVMWCDVQLTKDGAGICFPGLTMSNASNIEAAY  103



>ref|XP_003553031.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Glycine max]
Length=722

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 66/94 (70%), Gaps = 3/94 (3%)
 Frame = +2

Query  221  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLT  400
            L+L  S V LV++ G       W+TL G  PLVIARGGFSG+FPDSS  AYS    T   
Sbjct  10   LILQYSLVALVSSAGPRGG---WKTLQGSPPLVIARGGFSGIFPDSSSLAYSLTLDTCGP  66

Query  401  XVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
             V +WCDVQLTKDGVGICFP++KLDNAS+++  +
Sbjct  67   NVTLWCDVQLTKDGVGICFPELKLDNASDISIAY  100



>ref|XP_004293798.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Fragaria vesca subsp. vesca]
Length=751

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +2

Query  242  VTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCD  421
            V LV+A   + +TS+WQTL G  PLVIARGGFSGLFP SS  AY F   TS+  V++WCD
Sbjct  22   VALVSADKDS-TTSQWQTLKGKPPLVIARGGFSGLFPGSSSVAYDFTLSTSVPDVLLWCD  80

Query  422  VQLTKDGVGICFPDIKLDNASNVATLF  502
            VQLTK+G GICFPD+ L N+S+V  ++
Sbjct  81   VQLTKEGAGICFPDLLLSNSSDVDIIY  107



>ref|XP_003530776.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Glycine max]
Length=727

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = +2

Query  221  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLT  400
            L +L    +LVA   S    S W+TL G  P+VIARGGFSG+FPDSS  AY  A  T   
Sbjct  7    LAILILQYSLVALVSSAGPPSGWKTLQGSPPMVIARGGFSGIFPDSSSLAYGLALDTCGP  66

Query  401  XVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
             V +WCDVQLTKDGVGICFP++KLDNA++++  +
Sbjct  67   NVTLWCDVQLTKDGVGICFPELKLDNATDISIAY  100



>gb|KHM99502.1| Putative glycerophosphoryl diester phosphodiesterase 2 [Glycine 
soja]
Length=727

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = +2

Query  221  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLT  400
            L +L    +LVA   S    S W+TL G  P+VIARGGFSG+FPDSS  AY  A  T   
Sbjct  7    LAILILQYSLVALVSSAGPPSGWKTLQGSPPMVIARGGFSGIFPDSSSLAYGLALDTCGP  66

Query  401  XVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
             V +WCDVQLTKDGVGICFP++KLDNA++++  +
Sbjct  67   NVTLWCDVQLTKDGVGICFPELKLDNATDISIAY  100



>ref|XP_007142367.1| hypothetical protein PHAVU_008G274300g [Phaseolus vulgaris]
 gb|ESW14361.1| hypothetical protein PHAVU_008G274300g [Phaseolus vulgaris]
Length=753

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 72/103 (70%), Gaps = 5/103 (5%)
 Frame = +2

Query  194  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  373
            MW  R++  +LLL S + +V+AQ      S W+TL+G  PLV+ARGGFSG+FPDSS +AY
Sbjct  1    MWNPRALSAVLLLHSLIAIVSAQ-----ISAWKTLNGGPPLVVARGGFSGIFPDSSDSAY  55

Query  374  SFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            S A  T+   V + CDVQLTKD VGIC PDI L N++ +A+ +
Sbjct  56   SLAVITTGPDVYVSCDVQLTKDAVGICLPDINLANSTYIASRY  98



>ref|XP_009415406.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=760

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 67/93 (72%), Gaps = 5/93 (5%)
 Frame = +2

Query  224  LLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTX  403
             L    VT++A      + S W TL+G+AP ++A+GGFSGLFPDSS +AYSFA   S   
Sbjct  20   FLFLQQVTVIA-----RNASAWLTLTGNAPAIVAKGGFSGLFPDSSHDAYSFALIASSPD  74

Query  404  VIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
             I+WCDV+LTKDG+GIC PDIKLDN ++++ ++
Sbjct  75   TILWCDVRLTKDGLGICLPDIKLDNCTDISNIY  107



>emb|CBI18678.3| unnamed protein product [Vitis vinifera]
Length=756

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 77/103 (75%), Gaps = 7/103 (7%)
 Frame = +2

Query  194  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  373
            M +   +F+LL+L ++     AQ +++ T  WQTL+GD P+VIARGGFSGLFP+SS  A+
Sbjct  1    MIRCLVLFSLLILSTS-----AQKTSSQT--WQTLNGDEPVVIARGGFSGLFPESSQFAH  53

Query  374  SFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
              A  TSL+ VI++C++QLTKD VGIC  DI+LDN++N+A +F
Sbjct  54   QIALSTSLSNVILYCNLQLTKDSVGICQTDIRLDNSTNIAAVF  96



>ref|XP_007146553.1| hypothetical protein PHAVU_006G0504001g, partial [Phaseolus vulgaris]
 gb|ESW18547.1| hypothetical protein PHAVU_006G0504001g, partial [Phaseolus vulgaris]
Length=503

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = +2

Query  251  VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQL  430
            V+AQ S  +T  W TLSG+ PLVIARGGFSG+FPDSS  AY F    SL  VI+WCDVQL
Sbjct  28   VSAQVSNATT--WNTLSGNPPLVIARGGFSGIFPDSSEKAYIFGVTASLKNVIVWCDVQL  85

Query  431  TKDGVGICFPDIKLDNASNVA  493
            TKD  GIC P++KL+NA+++A
Sbjct  86   TKDSQGICVPNVKLENATDIA  106



>ref|XP_010656583.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7 [Vitis 
vinifera]
Length=750

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 77/103 (75%), Gaps = 7/103 (7%)
 Frame = +2

Query  194  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  373
            M +   +F+LL+L ++     AQ +++ T  WQTL+GD P+VIARGGFSGLFP+SS  A+
Sbjct  1    MIRCLVLFSLLILSTS-----AQKTSSQT--WQTLNGDEPVVIARGGFSGLFPESSQFAH  53

Query  374  SFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
              A  TSL+ VI++C++QLTKD VGIC  DI+LDN++N+A +F
Sbjct  54   QIALSTSLSNVILYCNLQLTKDSVGICQTDIRLDNSTNIAAVF  96



>ref|XP_002862842.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH39100.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=719

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +2

Query  278  TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICF  457
            +S W+TLSG  P VIARGGFSG+FPDSS  AY     T+   V++WCD+QLTKDGVGICF
Sbjct  22   SSSWKTLSGKPPAVIARGGFSGMFPDSSIQAYQLVNITTSPEVMLWCDLQLTKDGVGICF  81

Query  458  PDIKLDNASNVATLF  502
            P++ L N SNV +++
Sbjct  82   PNLNLHNGSNVISIY  96



>gb|AES70468.2| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=717

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  281  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFP  460
            S W+TL G  P+VIARGGFSG+FPDSS  +Y+ A   S   + +WCD+QLTKDGVGICFP
Sbjct  26   SGWKTLQGSPPVVIARGGFSGIFPDSSLASYNLALKASSPNITLWCDLQLTKDGVGICFP  85

Query  461  DIKLDNASNVATLF  502
            D+KLDNA++++ ++
Sbjct  86   DVKLDNATDISVVY  99



>ref|XP_003600217.1| Glycerophosphodiesterase-like protein [Medicago truncatula]
Length=740

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  281  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFP  460
            S W+TL G  P+VIARGGFSG+FPDSS  +Y+ A   S   + +WCD+QLTKDGVGICFP
Sbjct  49   SGWKTLQGSPPVVIARGGFSGIFPDSSLASYNLALKASSPNITLWCDLQLTKDGVGICFP  108

Query  461  DIKLDNASNVATLF  502
            D+KLDNA++++ ++
Sbjct  109  DVKLDNATDISVVY  122



>ref|XP_007146557.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
 gb|ESW18551.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
Length=667

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +2

Query  251  VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQL  430
            V+AQ S  +T  W TLSG+ PLVIARGGFSG+FPDSS +AY F    SL  VI+WCDVQL
Sbjct  27   VSAQVSNATT--WDTLSGNPPLVIARGGFSGIFPDSSESAYIFGVTASLKNVIVWCDVQL  84

Query  431  TKDGVGICFPDIKLDNASNVA  493
            TKD  GIC P++KL+NA+++A
Sbjct  85   TKDSQGICVPNVKLENATDIA  105



>gb|KHN28413.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Glycine 
soja]
Length=761

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = +2

Query  269  TNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVG  448
            TNST+ W TL+G  PLVIARGGFSG+FPDSS  AY FA  T L  +I WCDVQLTKD  G
Sbjct  31   TNSTT-WNTLTGAPPLVIARGGFSGIFPDSSDLAYIFAVRTGLKNLIAWCDVQLTKDRQG  89

Query  449  ICFPDIKLDNASNVATLF  502
            ICFPDIKL+NA+++   F
Sbjct  90   ICFPDIKLENATDINYAF  107



>ref|XP_007146558.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
 gb|ESW18552.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
Length=762

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +2

Query  251  VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQL  430
            V+AQ S  +T  W TLSG+ PLVIARGGFSG+FPDSS +AY F    SL  VI+WCDVQL
Sbjct  27   VSAQVSNATT--WDTLSGNPPLVIARGGFSGIFPDSSESAYIFGVTASLKNVIVWCDVQL  84

Query  431  TKDGVGICFPDIKLDNASNVA  493
            TKD  GIC P++KL+NA+++A
Sbjct  85   TKDSQGICVPNVKLENATDIA  105



>ref|XP_009364631.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Pyrus x bretschneideri]
 ref|XP_009364652.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Pyrus x bretschneideri]
Length=447

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 65/91 (71%), Gaps = 5/91 (5%)
 Frame = +2

Query  194  MWKLRS-IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  370
            M  LR+ +   LLL S V LV+AQ S    S+W+TLSGDAP V+ARGGFSGLFP  S  A
Sbjct  1    MCNLRALVVAALLLHSVVALVSAQRS----SQWKTLSGDAPKVVARGGFSGLFPGFSSAA  56

Query  371  YSFAGXTSLTXVIMWCDVQLTKDGVGICFPD  463
            +  A  TS+  VI+WCDVQLTKDG GICFPD
Sbjct  57   FDLALITSVPDVILWCDVQLTKDGAGICFPD  87



>ref|XP_009348463.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 60/79 (76%), Gaps = 4/79 (5%)
 Frame = +2

Query  254  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLT  433
            +AQGS    SKW+TLSGD P V+ARGGFSGLFP  S  A+S A  TSL   ++WCDVQLT
Sbjct  22   SAQGS----SKWKTLSGDPPKVVARGGFSGLFPGYSSAAFSLALLTSLQDAVLWCDVQLT  77

Query  434  KDGVGICFPDIKLDNASNV  490
            KDG GICFPD+ L+N SN+
Sbjct  78   KDGAGICFPDLLLNNNSNI  96



>ref|XP_009335427.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 66/91 (73%), Gaps = 5/91 (5%)
 Frame = +2

Query  194  MWKLRS-IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  370
            M  LR+ +   LLL S V LV+AQ S    S+W+TLSGD P V+ARGGFSGLFP  +  A
Sbjct  1    MCNLRALVVAALLLHSVVALVSAQRS----SQWKTLSGDPPKVVARGGFSGLFPGFTSAA  56

Query  371  YSFAGXTSLTXVIMWCDVQLTKDGVGICFPD  463
            ++FA  TS+  VI+WCDVQLTKDG GICFPD
Sbjct  57   FNFALITSVPDVILWCDVQLTKDGAGICFPD  87



>ref|XP_010675853.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Beta vulgaris subsp. vulgaris]
Length=752

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 63/98 (64%), Gaps = 9/98 (9%)
 Frame = +2

Query  212  IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXT  391
            +  L L CSA           + S W TL G  PLVIA  GFSGLFP SS  AY+ A  T
Sbjct  15   LLQLSLFCSA---------QKTPSSWLTLDGFPPLVIAHNGFSGLFPPSSSYAYNLAMMT  65

Query  392  SLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
            S+  V++WCDVQLTKD  GICFPDIKLDN+SNV  +++
Sbjct  66   SVPDVVLWCDVQLTKDAAGICFPDIKLDNSSNVNLVYE  103



>ref|NP_001142429.1| uncharacterized protein LOC100274608 [Zea mays]
 gb|ACG23909.1| hypothetical protein [Zea mays]
Length=364

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 62/93 (67%), Gaps = 1/93 (1%)
 Frame = +2

Query  215  FNLLLLCSAVTLVAAQGS-TNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXT  391
            F  LL C    +V A G      S ++TLSG APLV+A+GGFSG+FPDSS  AYSFA  T
Sbjct  28   FAALLGCVVALVVGAAGQGPRPPSDYKTLSGAAPLVVAKGGFSGVFPDSSQGAYSFAMIT  87

Query  392  SLTXVIMWCDVQLTKDGVGICFPDIKLDNASNV  490
            S     MWCDVQLTKDGVG+C  DI + N ++V
Sbjct  88   SAPDTAMWCDVQLTKDGVGVCLRDINMKNCTSV  120



>gb|AFW58563.1| hypothetical protein ZEAMMB73_741781 [Zea mays]
Length=178

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +2

Query  266  STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGV  445
            +    S W+TLSG AP ++A+GGFSGLFPDSS  AY FA   S    I++CDV+LTKD +
Sbjct  22   AAQKASSWKTLSGKAPAIVAKGGFSGLFPDSSEYAYQFALLASSPDTILYCDVRLTKDEI  81

Query  446  GICFPDIKLDNASNVATLF  502
            GIC PDIK+DN +N+   +
Sbjct  82   GICLPDIKMDNCTNIPDFY  100



>gb|EMT15515.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Aegilops 
tauschii]
Length=880

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 61/83 (73%), Gaps = 7/83 (8%)
 Frame = +2

Query  254  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLT  433
            A +GST     W+TLSGDAP VIA+GGFSGLFPDSS  AYSFA     +    WCDV+LT
Sbjct  26   AQKGST-----WKTLSGDAPAVIAKGGFSGLFPDSSDPAYSFAASNQDSA--QWCDVRLT  78

Query  434  KDGVGICFPDIKLDNASNVATLF  502
            KDGVGIC PDIK+DN + ++ LF
Sbjct  79   KDGVGICLPDIKMDNCTTISDLF  101



>gb|EMT29224.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Aegilops 
tauschii]
Length=849

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 62/85 (73%), Gaps = 4/85 (5%)
 Frame = +2

Query  248  LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQ  427
            + AAQG     S W+TLSG+AP +IA+GGFSGLFPDSS  AY FA   S    I++CDV+
Sbjct  20   VAAAQGD----SPWKTLSGNAPAIIAKGGFSGLFPDSSEFAYQFAMIASSPDTILYCDVR  75

Query  428  LTKDGVGICFPDIKLDNASNVATLF  502
            LTKDG+G+C PDIK+DN +N+   +
Sbjct  76   LTKDGLGVCLPDIKMDNCTNIPDFY  100



>ref|XP_008349893.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 3 [Malus domestica]
Length=448

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 65/91 (71%), Gaps = 5/91 (5%)
 Frame = +2

Query  194  MWKLRS-IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  370
            M  LR+ +   LLL S   LV+AQ S    S+W+TLSGDAP V+ARGGFSGLFP  S  A
Sbjct  1    MCNLRALVVAALLLHSVXALVSAQRS----SQWKTLSGDAPKVVARGGFSGLFPGFSSAA  56

Query  371  YSFAGXTSLTXVIMWCDVQLTKDGVGICFPD  463
            ++ A  TS+  VI+WCDVQLTKDG GICFPD
Sbjct  57   FNLALITSVPDVILWCDVQLTKDGAGICFPD  87



>ref|XP_006652401.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Oryza brachyantha]
Length=745

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 68/95 (72%), Gaps = 5/95 (5%)
 Frame = +2

Query  221  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLT  400
            L+LL   V   A +GS+     W+TL+G+AP +IA+GGFSG+FPDSS  AY FA   S +
Sbjct  13   LVLLWLGVAAAAQKGSS-----WKTLNGNAPAIIAKGGFSGIFPDSSEFAYQFALIASSS  67

Query  401  XVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
              I++CDV+LTKDG+GIC PDIK+DN +N+   ++
Sbjct  68   DTILYCDVRLTKDGLGICLPDIKMDNCTNIPDFYQ  102



>ref|XP_010943202.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Elaeis guineensis]
Length=770

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +2

Query  281  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFP  460
            +KW+TLSG+APLVIARGGFSG+FP+SS  AY FA  +SL   ++ CD+QLTKDG GIC  
Sbjct  44   AKWKTLSGNAPLVIARGGFSGIFPESSQFAYQFALASSLKETVLLCDLQLTKDGAGICLS  103

Query  461  DIKLDNASNVATLF  502
            D+KLDN++ ++++F
Sbjct  104  DLKLDNSTTISSVF  117



>ref|XP_008364336.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=549

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 60/80 (75%), Gaps = 4/80 (5%)
 Frame = +2

Query  251  VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQL  430
            V+AQGS    SKW+TLSGD P VIARGGFSGLFP  S  A+S A  TS+   ++WCDVQL
Sbjct  21   VSAQGS----SKWKTLSGDPPKVIARGGFSGLFPGYSSAAFSLALITSVQDAVLWCDVQL  76

Query  431  TKDGVGICFPDIKLDNASNV  490
            TKD  GICFPD+ L+N SN+
Sbjct  77   TKDXAGICFPDLLLNNNSNI  96



>ref|XP_010488033.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL5-like 
[Camelina sativa]
Length=266

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +2

Query  278  TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICF  457
            +S W+TLSG  P VIARGGFSG+FPDSS  AY     T+   + +WC++QLTKDGVGICF
Sbjct  22   SSSWRTLSGKPPAVIARGGFSGIFPDSSIQAYELVNITTSPDITLWCELQLTKDGVGICF  81

Query  458  PDIKLDNASNVATLF  502
            P++ L N S V   +
Sbjct  82   PNLNLQNGSTVKKFY  96



>ref|NP_001047275.1| Os02g0588500 [Oryza sativa Japonica Group]
 dbj|BAD17453.1| putative GPI-anchored protein [Oryza sativa Japonica Group]
 dbj|BAF09189.1| Os02g0588500 [Oryza sativa Japonica Group]
 gb|EAZ23618.1| hypothetical protein OsJ_07316 [Oryza sativa Japonica Group]
Length=749

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +2

Query  281  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFP  460
            S W+TLSG+ P +IA+GGFSGLFPDSS  AY F    S     +WCDVQLTKDG GIC P
Sbjct  30   STWKTLSGNPPAIIAKGGFSGLFPDSSDFAYGFVAAASSPDTALWCDVQLTKDGAGICLP  89

Query  461  DIKLDNASNVATLF  502
            DI++DN +N+A ++
Sbjct  90   DIRMDNCTNIANVY  103



>ref|NP_001053060.1| Os04g0472300 [Oryza sativa Japonica Group]
 emb|CAE02867.2| OSJNBb0022F23.4 [Oryza sativa Japonica Group]
 dbj|BAF14974.1| Os04g0472300 [Oryza sativa Japonica Group]
 dbj|BAG91894.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61172.1| hypothetical protein OsJ_15144 [Oryza sativa Japonica Group]
Length=740

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = +2

Query  227  LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXV  406
            L+ S V L     +    S W+TLSG+AP +IA+GGFSG+FPDSS  AY FA   S    
Sbjct  9    LVSSLVFLWLGVAAAQKASSWKTLSGNAPAIIAKGGFSGIFPDSSEFAYQFALIASSPDT  68

Query  407  IMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
            I++CDV+LTKDG+GIC PDIK+DN +N+   ++
Sbjct  69   ILYCDVRLTKDGLGICLPDIKMDNCTNIPDFYQ  101



>emb|CAH67272.1| B0806H07.1 [Oryza sativa Indica Group]
 gb|EEC77457.1| hypothetical protein OsI_16271 [Oryza sativa Indica Group]
Length=740

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = +2

Query  227  LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXV  406
            L+ S V L     +    S W+TLSG+AP +IA+GGFSG+FPDSS  AY FA   S    
Sbjct  9    LVSSLVFLWLGVAAAQKASSWKTLSGNAPAIIAKGGFSGIFPDSSEFAYQFALIASSPDT  68

Query  407  IMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
            I++CDV+LTKDG+GIC PDIK+DN +N+   ++
Sbjct  69   ILYCDVRLTKDGLGICLPDIKMDNCTNIPDFYQ  101



>ref|XP_008366428.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=752

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 65/91 (71%), Gaps = 5/91 (5%)
 Frame = +2

Query  194  MWKLRS-IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  370
            M  LR+ +   LLL S   LV+AQ S    S+W+TLSGDAP V+ARGGFSGLFP  S  A
Sbjct  1    MCNLRALVVAALLLHSVXALVSAQRS----SQWKTLSGDAPKVVARGGFSGLFPGFSSAA  56

Query  371  YSFAGXTSLTXVIMWCDVQLTKDGVGICFPD  463
            ++ A  TS+  VI+WCDVQLTKDG GICFPD
Sbjct  57   FNLALITSVPDVILWCDVQLTKDGAGICFPD  87



>ref|XP_006856834.1| hypothetical protein AMTR_s00055p00174750 [Amborella trichopoda]
 gb|ERN18301.1| hypothetical protein AMTR_s00055p00174750 [Amborella trichopoda]
Length=763

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +2

Query  266  STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGV  445
            S NST  W+TL+G+AP+VIARGGFSGLFPDSS  A+ F    +L   I WCDVQLTKDG 
Sbjct  29   SRNSTRIWRTLTGNAPVVIARGGFSGLFPDSSTFAFDFPNSLNLPRPISWCDVQLTKDGK  88

Query  446  GICFPDIKLDNASNVATLFK  505
            G+C P + LDN +N+  +++
Sbjct  89   GVCLPSLLLDNCTNIQEIYQ  108



>gb|EMS58329.1| putative glycerophosphoryl diester phosphodiesterase 1 [Triticum 
urartu]
Length=744

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 62/85 (73%), Gaps = 4/85 (5%)
 Frame = +2

Query  248  LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQ  427
            + AAQG     S W+TLSG+AP +IA+GGFSGLFPDSS  AY FA   S    I++CDV+
Sbjct  20   VAAAQGD----SPWKTLSGNAPAIIAKGGFSGLFPDSSEFAYQFAMIASSPDTILYCDVR  75

Query  428  LTKDGVGICFPDIKLDNASNVATLF  502
            LTKDG+G+C P+IK+DN +N+   +
Sbjct  76   LTKDGLGVCLPEIKMDNCTNIPDFY  100



>ref|XP_004973845.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X2 [Setaria italica]
Length=679

 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 66/98 (67%), Gaps = 6/98 (6%)
 Frame = +2

Query  227  LLCSAVTLV-----AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXT  391
            LLC    +V     AAQG     S ++TL GDAP V+A+GGFSG+FPDSS +AYSFA   
Sbjct  19   LLCCGCVMVLAGAAAAQGP-RLPSAYKTLRGDAPRVVAKGGFSGVFPDSSSDAYSFALIA  77

Query  392  SLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
            S     +WCDVQLTKDGVG+C  DI ++N +NVA  ++
Sbjct  78   SAPGTTLWCDVQLTKDGVGVCLRDINMNNCTNVAHTYQ  115



>ref|XP_008811210.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3 isoform X2 [Phoenix dactylifera]
Length=600

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +2

Query  287  WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDI  466
            W+TLSG+APLVIARGGFSG+FP+SS  AY FA  TSL   ++ CD+QLTKDG GIC  D+
Sbjct  48   WKTLSGNAPLVIARGGFSGIFPESSQFAYQFALATSLKETVLLCDLQLTKDGAGICRSDL  107

Query  467  KLDNASNVATLF  502
            +LDN++ ++T+F
Sbjct  108  RLDNSTTISTVF  119



>ref|XP_004973844.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X1 [Setaria italica]
Length=768

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 66/98 (67%), Gaps = 6/98 (6%)
 Frame = +2

Query  227  LLCSAVTLV-----AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXT  391
            LLC    +V     AAQG     S ++TL GDAP V+A+GGFSG+FPDSS +AYSFA   
Sbjct  19   LLCCGCVMVLAGAAAAQGP-RLPSAYKTLRGDAPRVVAKGGFSGVFPDSSSDAYSFALIA  77

Query  392  SLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
            S     +WCDVQLTKDGVG+C  DI ++N +NVA  ++
Sbjct  78   SAPGTTLWCDVQLTKDGVGVCLRDINMNNCTNVAHTYQ  115



>ref|XP_006586115.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X2 [Glycine max]
Length=666

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 61/83 (73%), Gaps = 2/83 (2%)
 Frame = +2

Query  257  AQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTK  436
            A+GS  +T  W TL+G  PLVIARGG SG+FPDSS  AY  A   SL  +I+WCDVQLTK
Sbjct  27   ARGSHRTT--WNTLTGSPPLVIARGGSSGIFPDSSEYAYELAAQISLKNLIVWCDVQLTK  84

Query  437  DGVGICFPDIKLDNASNVATLFK  505
            DG GIC  +IKL+NA+++  +F+
Sbjct  85   DGEGICISNIKLENATDIDKIFE  107



>gb|EAY86479.1| hypothetical protein OsI_07859 [Oryza sativa Indica Group]
Length=709

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +2

Query  281  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFP  460
            S W+TLSG+ P +IA+GGFSGLFPDSS  AY F    S     +WCDVQLT+DG GIC P
Sbjct  30   STWKTLSGNPPAIIAKGGFSGLFPDSSDFAYGFVAAASSPDTALWCDVQLTRDGAGICLP  89

Query  461  DIKLDNASNVATLF  502
            DI++DN +N+A ++
Sbjct  90   DIRMDNCTNIANVY  103



>ref|XP_004975931.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Setaria italica]
Length=747

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 64/85 (75%), Gaps = 4/85 (5%)
 Frame = +2

Query  248  LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQ  427
            + AAQ +T+    W+TLSG AP ++A+GGFSGLFPDSS +AY F   +S    +++CDV+
Sbjct  20   VAAAQKATS----WKTLSGKAPAIVAKGGFSGLFPDSSPDAYGFVQYSSSPDTVLYCDVR  75

Query  428  LTKDGVGICFPDIKLDNASNVATLF  502
            LTKD VG+C PDIK+DN +N+A ++
Sbjct  76   LTKDEVGLCLPDIKMDNCTNIADIY  100



>ref|XP_008811209.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 isoform X1 [Phoenix dactylifera]
Length=768

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +2

Query  287  WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDI  466
            W+TLSG+APLVIARGGFSG+FP+SS  AY FA  TSL   ++ CD+QLTKDG GIC  D+
Sbjct  48   WKTLSGNAPLVIARGGFSGIFPESSQFAYQFALATSLKETVLLCDLQLTKDGAGICRSDL  107

Query  467  KLDNASNVATLF  502
            +LDN++ ++T+F
Sbjct  108  RLDNSTTISTVF  119



>gb|EMS62136.1| putative glycerophosphoryl diester phosphodiesterase 1 [Triticum 
urartu]
Length=748

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 56/74 (76%), Gaps = 2/74 (3%)
 Frame = +2

Query  281  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFP  460
            S W+TLSGDAP VIA+GGFSGLFPDSS  AY FA     +    WCDV+LTKDGVGIC P
Sbjct  31   SAWKTLSGDAPAVIAKGGFSGLFPDSSDPAYLFAASNQDSA--QWCDVRLTKDGVGICLP  88

Query  461  DIKLDNASNVATLF  502
            DIK+DN + ++ LF
Sbjct  89   DIKMDNCTTISDLF  102



>ref|XP_003530778.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X1 [Glycine max]
Length=761

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 61/83 (73%), Gaps = 2/83 (2%)
 Frame = +2

Query  257  AQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTK  436
            A+GS  +T  W TL+G  PLVIARGG SG+FPDSS  AY  A   SL  +I+WCDVQLTK
Sbjct  27   ARGSHRTT--WNTLTGSPPLVIARGGSSGIFPDSSEYAYELAAQISLKNLIVWCDVQLTK  84

Query  437  DGVGICFPDIKLDNASNVATLFK  505
            DG GIC  +IKL+NA+++  +F+
Sbjct  85   DGEGICISNIKLENATDIDKIFE  107



>dbj|BAJ85772.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 61/85 (72%), Gaps = 4/85 (5%)
 Frame = +2

Query  248  LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQ  427
            +  AQG     S W+TLSG+AP +IA+GGFSGLFPDSS  AY FA   S    +++CDV+
Sbjct  20   VATAQGD----SPWKTLSGNAPAIIAKGGFSGLFPDSSEFAYQFAMIASSPDTVLYCDVR  75

Query  428  LTKDGVGICFPDIKLDNASNVATLF  502
            LTKDG+G+C PDIK+DN +N+   +
Sbjct  76   LTKDGLGVCLPDIKMDNCTNIPDFY  100



>dbj|BAJ87963.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 61/85 (72%), Gaps = 4/85 (5%)
 Frame = +2

Query  248  LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQ  427
            +  AQG     S W+TLSG+AP +IA+GGFSGLFPDSS  AY FA   S    +++CDV+
Sbjct  20   VATAQGD----SPWKTLSGNAPAIIAKGGFSGLFPDSSEFAYQFAMIASSPDTVLYCDVR  75

Query  428  LTKDGVGICFPDIKLDNASNVATLF  502
            LTKDG+G+C PDIK+DN +N+   +
Sbjct  76   LTKDGLGVCLPDIKMDNCTNIPDFY  100



>ref|XP_004979884.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Setaria italica]
Length=1128

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 64/97 (66%), Gaps = 6/97 (6%)
 Frame = +2

Query  227  LLCSAVTLVAAQGSTNSTSKW-----QTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXT  391
            LLC    +V A G+  +   W     +TLSGDAP V+A+GGFSG+FPDSS +AYSF    
Sbjct  19   LLCCGCVMVLA-GAAAAQGPWLPYAYKTLSGDAPRVVAKGGFSGVFPDSSSDAYSFTLMA  77

Query  392  SLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            S     +WCDVQLTKDGVG+C  DI +DN +NVA  +
Sbjct  78   SAAGTTLWCDVQLTKDGVGVCLRDINMDNCTNVAQAY  114



>ref|XP_010687738.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010687740.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010687741.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Beta vulgaris subsp. vulgaris]
Length=751

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 63/89 (71%), Gaps = 2/89 (2%)
 Frame = +2

Query  242  VTLVAAQG--STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMW  415
            + L+ AQ   +  +   W TL+G+ P VIARGGFSGLFPDSS  AY F G  SL   I++
Sbjct  12   IGLITAQKPPANPAPPSWLTLNGERPAVIARGGFSGLFPDSSRFAYDFVGQVSLPDSILY  71

Query  416  CDVQLTKDGVGICFPDIKLDNASNVATLF  502
            CD+QLTKDGVG C  ++KLDN++N+A LF
Sbjct  72   CDLQLTKDGVGFCQSELKLDNSTNIALLF  100



>tpg|DAA63616.1| TPA: hypothetical protein ZEAMMB73_629479 [Zea mays]
Length=364

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 64/98 (65%), Gaps = 3/98 (3%)
 Frame = +2

Query  215  FNLLLLCSAVTLV--AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGX  388
            F  LL C  V LV  AA       S ++TLSG APLV+A+GGFSG+FPDSS  AYSFA  
Sbjct  28   FAALLGC-VVALVGGAAGQGPRPPSDYKTLSGAAPLVVAKGGFSGVFPDSSQGAYSFAMI  86

Query  389  TSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            TS     MWCDVQLTKDGVG+C  DI + N ++V   +
Sbjct  87   TSAPDTAMWCDVQLTKDGVGVCLRDINMKNCTSVDQAY  124



>gb|AAV64200.1| unknown [Zea mays]
 tpg|DAA63617.1| TPA: hypothetical protein ZEAMMB73_629479 [Zea mays]
Length=382

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 63/94 (67%), Gaps = 3/94 (3%)
 Frame = +2

Query  215  FNLLLLCSAVTLV--AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGX  388
            F  LL C  V LV  AA       S ++TLSG APLV+A+GGFSG+FPDSS  AYSFA  
Sbjct  28   FAALLGC-VVALVGGAAGQGPRPPSDYKTLSGAAPLVVAKGGFSGVFPDSSQGAYSFAMI  86

Query  389  TSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNV  490
            TS     MWCDVQLTKDGVG+C  DI + N ++V
Sbjct  87   TSAPDTAMWCDVQLTKDGVGVCLRDINMKNCTSV  120



>emb|CDY36036.1| BnaC03g41620D [Brassica napus]
Length=849

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +2

Query  275  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGIC  454
            S S WQTLSG  P+VIARGGFSG+FPDSS  AY     T+   + +WCD+QLTKDGVGIC
Sbjct  151  SASSWQTLSGKPPVVIARGGFSGVFPDSSSKAYELVSVTTSLNLALWCDLQLTKDGVGIC  210

Query  455  FPDIKLDNASNVATLF  502
            FP++ L N S+V  ++
Sbjct  211  FPNLNLYNDSDVKDVY  226



>ref|NP_001169682.1| hypothetical protein precursor [Zea mays]
 gb|ACN34414.1| unknown [Zea mays]
 gb|ACN34504.1| unknown [Zea mays]
 gb|AFW62775.1| hypothetical protein ZEAMMB73_123565 [Zea mays]
Length=753

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 59/84 (70%), Gaps = 5/84 (6%)
 Frame = +2

Query  251  VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQL  430
            VA  GST     W+TLSG AP V+A+GGFSGLFPDSS  AY F G +S     +WCDV+L
Sbjct  31   VAQNGST-----WKTLSGKAPAVVAKGGFSGLFPDSSDYAYQFVGISSSPDTTVWCDVRL  85

Query  431  TKDGVGICFPDIKLDNASNVATLF  502
            TKDG GIC P I +DN + +A++F
Sbjct  86   TKDGAGICLPSINMDNCTIIASVF  109



>ref|XP_010109457.1| putative glycerophosphoryl diester phosphodiesterase 3 [Morus 
notabilis]
 gb|EXC22605.1| putative glycerophosphoryl diester phosphodiesterase 3 [Morus 
notabilis]
Length=749

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = +2

Query  257  AQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTK  436
            AQ +  ++ KW TLSG+ P+V+ARGGFSGLFP+SS  A   A  T ++ V+++C++QLTK
Sbjct  17   AQKAPETSPKWLTLSGEQPIVVARGGFSGLFPESSSFANQIAVSTGMSDVVVFCNLQLTK  76

Query  437  DGVGICFPDIKLDNASNVATLF  502
            DG+G+C PDI++DN++ +++++
Sbjct  77   DGIGVCLPDIRIDNSTTISSIY  98



>gb|AAV64238.1| unknown [Zea mays]
Length=382

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 63/94 (67%), Gaps = 3/94 (3%)
 Frame = +2

Query  215  FNLLLLCSAVTLV--AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGX  388
            F  LL C  V LV  AA       S ++TLSG APLV+A+GGFSG+FPDSS  AYSFA  
Sbjct  28   FAALLGC-VVALVGGAAGQGPRLPSDYKTLSGAAPLVVAKGGFSGVFPDSSQGAYSFAMI  86

Query  389  TSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNV  490
            TS     MWCDVQLTKDGVG+C  DI + N ++V
Sbjct  87   TSAPDTAMWCDVQLTKDGVGVCLRDINMKNCTSV  120



>ref|XP_006344951.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2-like, partial [Solanum tuberosum]
Length=397

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +2

Query  293  TLSGDAPLVIARGGFSGLFPDSSFNAYSFAG-XTSLTXVIMWCDVQLTKDGVGICFPDIK  469
            TLSGDAPLVIA GGFSGLF DSS+ AY  A   TSL  VI+WCDVQLTK+ V +CFPD+K
Sbjct  3    TLSGDAPLVIAXGGFSGLFLDSSYEAYIMAILETSLPNVIIWCDVQLTKNEVDMCFPDLK  62

Query  470  LDNASNVATLFK  505
            LDN S++   +K
Sbjct  63   LDNTSDIDAYYK  74



>ref|XP_010545539.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL5 [Tarenaya 
hassleriana]
Length=732

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +2

Query  269  TNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVG  448
            T S+S W TL+G+ P+VIARGGFSG+FPDSS  AY  A  TS   V +WCD+QL KD +G
Sbjct  23   TTSSSSWLTLNGEPPVVIARGGFSGMFPDSSIVAYDSATVTSTPNVTLWCDLQLAKDDIG  82

Query  449  ICFPDIKLDNASNVATLF  502
             CFP +  +N SN+  +F
Sbjct  83   FCFPHLSFENGSNIEYVF  100



>ref|NP_001168748.1| uncharacterized protein LOC100382543 precursor [Zea mays]
 gb|ACN30591.1| unknown [Zea mays]
Length=747

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +2

Query  281  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFP  460
            S W+TLSG AP ++A+GGFSGLFPDSS  AY FA   S    I++CDV+LTKD +GIC P
Sbjct  27   SSWKTLSGKAPAIVAKGGFSGLFPDSSEYAYQFALLASSPDTILYCDVRLTKDEIGICLP  86

Query  461  DIKLDNASNVATLF  502
            DIK+DN +N+   +
Sbjct  87   DIKMDNCTNIPDFY  100



>gb|EMT33222.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Aegilops 
tauschii]
Length=772

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +2

Query  281  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFP  460
            S ++TL GDAPLVIA+GGFSG+FPDSS+ A+SFA   S     +WCDVQLTKDGVGIC  
Sbjct  42   SSYKTLRGDAPLVIAKGGFSGVFPDSSYYAFSFALLASAPDTSLWCDVQLTKDGVGICLR  101

Query  461  DIKLDNASNVATLF  502
            DI + N +N A ++
Sbjct  102  DINMSNCTNAAQVY  115



>ref|XP_009390640.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Musa acuminata subsp. malaccensis]
Length=755

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +2

Query  266  STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGV  445
            +  ++S W+TLSG++P +IA+GGFSGLFPDSSF AY      S     +WCDV+LTKD V
Sbjct  26   TARTSSAWRTLSGNSPAIIAKGGFSGLFPDSSFYAYKSVSLFSANDTTLWCDVRLTKDSV  85

Query  446  GICFPDIKLDNASNVATLF  502
            GIC PDIKLDN + +   F
Sbjct  86   GICLPDIKLDNCTTIQYYF  104



>ref|XP_011033465.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like 
[Populus euphratica]
Length=744

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 67/98 (68%), Gaps = 0/98 (0%)
 Frame = +2

Query  212  IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXT  391
            +   LLL S V       S +++ KW TL+G+ P VIARGGFSGLFP+SS  A   A  T
Sbjct  1    MIKYLLLVSFVIHATLANSESASKKWLTLNGERPSVIARGGFSGLFPESSDFANQMALGT  60

Query  392  SLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
            S+  V++ C++QLTKDGVGIC  DI+LDN +N+A LF+
Sbjct  61   SVHDVVVLCNLQLTKDGVGICQGDIRLDNTTNIAMLFE  98



>ref|XP_002446646.1| hypothetical protein SORBIDRAFT_06g019730 [Sorghum bicolor]
 gb|EES10974.1| hypothetical protein SORBIDRAFT_06g019730 [Sorghum bicolor]
Length=749

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +2

Query  281  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFP  460
            S W+TLSG AP ++A+GGFSGLFPDSS  AY FA   S    I++CDV+LTKD +GIC P
Sbjct  29   SSWKTLSGKAPAIVAKGGFSGLFPDSSEYAYQFALVASSPDTILYCDVRLTKDEIGICLP  88

Query  461  DIKLDNASNVATLF  502
            DI++DN +N+   +
Sbjct  89   DIRMDNCTNIPDFY  102



>ref|XP_002308389.2| hypothetical protein POPTR_0006s20170g [Populus trichocarpa]
 gb|EEE91912.2| hypothetical protein POPTR_0006s20170g [Populus trichocarpa]
Length=731

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 66/98 (67%), Gaps = 0/98 (0%)
 Frame = +2

Query  212  IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXT  391
            +   LLL S V       S +++ KW TL+G  P VIARGGFSGLFP+SS  A   A  T
Sbjct  1    MIKYLLLVSLVIHATLANSESASKKWLTLNGQRPSVIARGGFSGLFPESSDFANQMALGT  60

Query  392  SLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
            S+  V++ C++QLTKDGVGIC  DI+LDN +N+A LF+
Sbjct  61   SVHDVVVLCNLQLTKDGVGICQGDIRLDNTTNIAMLFE  98



>ref|XP_004491451.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cicer arietinum]
Length=762

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 59/81 (73%), Gaps = 2/81 (2%)
 Frame = +2

Query  251  VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQL  430
            V+AQ  TN  S W TL+G+ PLVIA GGFSG+FPDSS  AYS A  TSL  V +WCDVQL
Sbjct  26   VSAQ--TNKRSDWNTLTGNPPLVIAHGGFSGIFPDSSGAAYSLALQTSLPDVALWCDVQL  83

Query  431  TKDGVGICFPDIKLDNASNVA  493
            TKD  GIC P++ L N++ V+
Sbjct  84   TKDAAGICLPNVNLLNSTYVS  104



>gb|KFK39359.1| hypothetical protein AALP_AA3G234500 [Arabis alpina]
Length=752

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +2

Query  266  STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGV  445
             T S S WQTLSG  P+V+ARGGFSG+FP SS +AY      +   V +WCD+QLTKDGV
Sbjct  21   HTASASSWQTLSGKPPVVVARGGFSGMFPYSSKDAYELVKLIT-PGVTLWCDLQLTKDGV  79

Query  446  GICFPDIKLDNASNVATL  499
            GICFP + LDNAS+V  +
Sbjct  80   GICFPSLNLDNASDVKNI  97



>ref|XP_008799657.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=760

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +2

Query  287  WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDI  466
            W+TLSG+APLVIARGG+SG+FP+SS  AY FA  TSL   ++ CD+QL+KDG GIC  ++
Sbjct  36   WKTLSGNAPLVIARGGYSGIFPESSQFAYQFALATSLKETVLLCDLQLSKDGAGICHSNL  95

Query  467  KLDNASNVATLF  502
            KLDN++ ++T F
Sbjct  96   KLDNSTTISTAF  107



>emb|CDY11831.1| BnaC03g12570D [Brassica napus]
Length=566

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 70/103 (68%), Gaps = 3/103 (3%)
 Frame = +2

Query  203  LRS--IFNLLLL-CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  373
            LRS  IF+L L  C A     A  +     KW TL+G  P V+ARGGFSGLFP+SS +A 
Sbjct  2    LRSFIIFSLFLHSCVAAPKTPAAVAAVPAKKWLTLNGQEPGVVARGGFSGLFPESSASAN  61

Query  374  SFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            +FA  TS   + M C++Q+TKDGVGIC PDI+LDN++ ++TLF
Sbjct  62   AFAISTSSPGLTMLCNLQMTKDGVGICLPDIRLDNSTTISTLF  104



>ref|XP_010064948.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Eucalyptus grandis]
Length=746

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  PLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNV  490
            PLVIA+GGFSG+FPDSS+ AYS A  TS+  V+ WCDVQLTKDG GIC P +KLDN++++
Sbjct  32   PLVIAKGGFSGIFPDSSYAAYSLALITSVPDVVSWCDVQLTKDGAGICAPSVKLDNSTDI  91

Query  491  ATLFK  505
            + +FK
Sbjct  92   SNIFK  96



>ref|XP_002452366.1| hypothetical protein SORBIDRAFT_04g024440 [Sorghum bicolor]
 gb|EES05342.1| hypothetical protein SORBIDRAFT_04g024440 [Sorghum bicolor]
Length=753

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +2

Query  281  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFP  460
            S W+TLSG AP+++A+GGFSGLFP+SS  AY   G  S    +MWCDV+LTKDG GIC P
Sbjct  35   STWKTLSGKAPVIVAKGGFSGLFPESSLYAYQILGSLSSPDTVMWCDVRLTKDGGGICLP  94

Query  461  DIKLDNASNVATLF  502
             I +DN + +A  F
Sbjct  95   SIDMDNCTTIANFF  108



>ref|XP_004491450.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Cicer arietinum]
Length=755

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 67/103 (65%), Gaps = 4/103 (4%)
 Frame = +2

Query  194  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  373
            MW  R++F+ L    A+       + +  S W TL+G+ PLV+A GGFSG+FP SS  AY
Sbjct  1    MWTPRALFSTL----ALLFHLLHSARSDRSPWNTLTGNPPLVVAHGGFSGVFPQSSEVAY  56

Query  374  SFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            + A  TS   V +WCDVQLTKD VGIC P++ LDN++ ++ +F
Sbjct  57   NLAVMTSGPEVSIWCDVQLTKDEVGICLPNVILDNSTFISYIF  99



>ref|XP_002445920.1| hypothetical protein SORBIDRAFT_07g028050 [Sorghum bicolor]
 gb|EES15415.1| hypothetical protein SORBIDRAFT_07g028050 [Sorghum bicolor]
Length=885

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 64/95 (67%), Gaps = 6/95 (6%)
 Frame = +2

Query  233  CSAVTLV---AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSL--  397
            C  + LV   AAQG     S ++TLSG APLVIA+GGFSG+FPDSS +AYSFA   S   
Sbjct  132  CVVMALVGGAAAQGP-RLPSDYKTLSGAAPLVIAKGGFSGVFPDSSQDAYSFAKVASAPG  190

Query  398  TXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            T   MWCDVQLTKDGVG+C  DI ++N + V   +
Sbjct  191  TGTAMWCDVQLTKDGVGVCLRDINMNNCTTVGQAY  225



>ref|XP_006829998.1| hypothetical protein AMTR_s00252p00015420 [Amborella trichopoda]
 gb|ERM97414.1| hypothetical protein AMTR_s00252p00015420 [Amborella trichopoda]
Length=756

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +2

Query  284  KWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPD  463
            KW TLSG+AP VIARGGFSGLFP+SS  A SFA   SL+ V++ C++QLTKDG GIC  D
Sbjct  28   KWATLSGNAPEVIARGGFSGLFPESSDFANSFALSVSLSNVVLLCELQLTKDGRGICRSD  87

Query  464  IKLDNASNVATLF  502
            ++LDN++N+A ++
Sbjct  88   LRLDNSTNIADVY  100



>ref|XP_002866252.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42511.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=754

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 66/104 (63%), Gaps = 1/104 (1%)
 Frame = +2

Query  194  MWKLRSIFNLLL-LCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  370
            M +    F+L + LC A     A  +   T KW TL+G  P V+ARGGFSGLFP+SS  A
Sbjct  1    MLRFIIFFSLFIHLCVAAPKTPASAAAVPTKKWLTLNGQEPAVVARGGFSGLFPESSAPA  60

Query  371  YSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
               A  TS   + M C++Q+TKDGVG+C  DI+LDNA+ +++LF
Sbjct  61   NDMAISTSSPGLTMLCNLQMTKDGVGLCLSDIRLDNATTISSLF  104



>ref|XP_003544723.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=754

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +2

Query  281  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFP  460
            S W TL G APLV+ARGGFSG+ PDSS  AY+ A  ++   V +WCDVQLTKDGVGIC P
Sbjct  28   STWNTLGGGAPLVVARGGFSGILPDSSGAAYNLAVISTGPDVYIWCDVQLTKDGVGICQP  87

Query  461  DIKLDNASNVATLF  502
            DI L N++ +AT++
Sbjct  88   DINLANSTYIATIY  101



>gb|KHN23877.1| Putative glycerophosphoryl diester phosphodiesterase 3 [Glycine 
soja]
Length=754

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +2

Query  281  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFP  460
            S W TL G APLV+ARGGFSG+ PDSS  AY+ A  ++   V +WCDVQLTKDGVGIC P
Sbjct  28   STWNTLGGGAPLVVARGGFSGILPDSSGAAYNLAVISTGPDVYIWCDVQLTKDGVGICQP  87

Query  461  DIKLDNASNVATLF  502
            DI L N++ +AT++
Sbjct  88   DINLANSTYIATIY  101



>gb|AFW72078.1| hypothetical protein ZEAMMB73_869244 [Zea mays]
Length=360

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +2

Query  281  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFP  460
            S W+TLSG AP+++A+GGFSGLFPDSS  AY   G  S    +MWCDV+LTKDG GIC P
Sbjct  33   STWKTLSGKAPVIVAKGGFSGLFPDSSDFAYRILGTISSPDTVMWCDVRLTKDGDGICLP  92

Query  461  DIKLDNASNVATLF  502
             I +DN + +  +F
Sbjct  93   SINMDNCTMIDNVF  106



>emb|CDX82243.1| BnaA03g35780D [Brassica napus]
Length=275

 Score = 93.6 bits (231),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +2

Query  278  TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICF  457
            TS WQTLSG  P+VIARG FSG+FPDSS  AY +   T+   V +WCD+QLTKDGVGICF
Sbjct  152  TSSWQTLSGKPPVVIARGWFSGVFPDSSSKAYQWVSVTTSPNVALWCDLQLTKDGVGICF  211

Query  458  PDIKLDNASN  487
            P+  L N S+
Sbjct  212  PNPNLYNYSD  221



>gb|KHN43860.1| Putative glycerophosphoryl diester phosphodiesterase 3 [Glycine 
soja]
Length=753

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 61/84 (73%), Gaps = 5/84 (6%)
 Frame = +2

Query  251  VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQL  430
            ++AQ ST     W TLSG APLV+ARGGFSG+ PDSS  +Y+ A  TS   V +WCDVQL
Sbjct  23   ISAQRST-----WNTLSGGAPLVVARGGFSGMLPDSSDASYNLAVITSGPDVYIWCDVQL  77

Query  431  TKDGVGICFPDIKLDNASNVATLF  502
            TKDG+GIC PDI L N++ +A+ +
Sbjct  78   TKDGLGICQPDINLANSTYIASAY  101



>ref|XP_003519608.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=753

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 61/84 (73%), Gaps = 5/84 (6%)
 Frame = +2

Query  251  VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQL  430
            ++AQ ST     W TLSG APLV+ARGGFSG+ PDSS  +Y+ A  TS   V +WCDVQL
Sbjct  23   ISAQRST-----WNTLSGGAPLVVARGGFSGMLPDSSDASYNLAVITSGPDVYIWCDVQL  77

Query  431  TKDGVGICFPDIKLDNASNVATLF  502
            TKDG+GIC PDI L N++ +A+ +
Sbjct  78   TKDGLGICQPDINLANSTYIASAY  101



>tpg|DAA47913.1| TPA: hypothetical protein ZEAMMB73_887943 [Zea mays]
Length=607

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 59/93 (63%), Gaps = 4/93 (4%)
 Frame = +2

Query  233  CSAVTLV---AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTX  403
            C  + LV   AAQG     S ++TLSG APLV+ARGGFSG FPDSS  AYSF    S   
Sbjct  35   CVVMALVGGAAAQGP-RLPSDYKTLSGAAPLVVARGGFSGAFPDSSEGAYSFGASASAPG  93

Query  404  VIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
              MWCDVQLTKDGVG+C  D+ + N + V   +
Sbjct  94   TAMWCDVQLTKDGVGLCLRDVNMKNCTTVDQTY  126



>ref|XP_010241663.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Nelumbo nucifera]
 ref|XP_010241664.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Nelumbo nucifera]
Length=749

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = +2

Query  215  FNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTS  394
            F  L + SA+     +  + +  KW TL+GD PLVIARGGFSG+FP+SS  AY FA  TS
Sbjct  7    FIFLFIHSALAQKHVEDPSQN-QKWLTLNGDRPLVIARGGFSGVFPESSQFAYQFALSTS  65

Query  395  LTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            ++ V+++CD+QLTKDG GIC  +++LDN++ ++  +
Sbjct  66   ISDVVLFCDLQLTKDGNGICQTELRLDNSTTISAYY  101



>ref|NP_001170117.1| hypothetical protein [Zea mays]
 gb|ACN35879.1| unknown [Zea mays]
Length=713

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 58/89 (65%), Gaps = 4/89 (4%)
 Frame = +2

Query  233  CSAVTLV---AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTX  403
            C  + LV   AAQG     S ++TLSG APLV+ARGGFSG FPDSS  AYSF    S   
Sbjct  35   CVVMALVGGAAAQGP-RLPSDYKTLSGAAPLVVARGGFSGAFPDSSEGAYSFGASASAPG  93

Query  404  VIMWCDVQLTKDGVGICFPDIKLDNASNV  490
              MWCDVQLTKDGVG+C  D+ + N + V
Sbjct  94   TAMWCDVQLTKDGVGLCLRDVNMKNCTTV  122



>ref|XP_008645839.1| PREDICTED: uncharacterized protein LOC100384038 isoform X1 [Zea 
mays]
 ref|XP_008645847.1| PREDICTED: uncharacterized protein LOC100384038 isoform X1 [Zea 
mays]
 ref|XP_008645851.1| PREDICTED: uncharacterized protein LOC100384038 isoform X1 [Zea 
mays]
 ref|XP_008645857.1| PREDICTED: uncharacterized protein LOC100384038 isoform X1 [Zea 
mays]
 tpg|DAA47914.1| TPA: hypothetical protein ZEAMMB73_887943 [Zea mays]
Length=745

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 58/89 (65%), Gaps = 4/89 (4%)
 Frame = +2

Query  233  CSAVTLV---AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTX  403
            C  + LV   AAQG     S ++TLSG APLV+ARGGFSG FPDSS  AYSF    S   
Sbjct  35   CVVMALVGGAAAQGP-RLPSDYKTLSGAAPLVVARGGFSGAFPDSSEGAYSFGASASAPG  93

Query  404  VIMWCDVQLTKDGVGICFPDIKLDNASNV  490
              MWCDVQLTKDGVG+C  D+ + N + V
Sbjct  94   TAMWCDVQLTKDGVGLCLRDVNMKNCTTV  122



>ref|XP_009132086.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=752

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 69/103 (67%), Gaps = 3/103 (3%)
 Frame = +2

Query  203  LRS--IFNLLLL-CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  373
            LRS  IF+L L  C A        +     KW TL+G  P V+ARGGFSGLFP+SS +A 
Sbjct  2    LRSFIIFSLFLHSCVAAPQTPTAAAAVPAKKWLTLNGQEPGVVARGGFSGLFPESSASAN  61

Query  374  SFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            +FA  TS   + M C++Q+TKDGVGIC PDI+LDN++ ++TLF
Sbjct  62   AFAISTSSPGLTMLCNLQMTKDGVGICLPDIRLDNSTTISTLF  104



>emb|CDX88656.1| BnaA03g09930D [Brassica napus]
Length=775

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 69/103 (67%), Gaps = 3/103 (3%)
 Frame = +2

Query  203  LRS--IFNLLLL-CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  373
            LRS  IF+L L  C A        +     KW TL+G  P V+ARGGFSGLFP+SS +A 
Sbjct  2    LRSFIIFSLFLHSCVAAPQTPTAAAAVPAKKWLTLNGQEPGVVARGGFSGLFPESSASAN  61

Query  374  SFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            +FA  TS   + M C++Q+TKDGVGIC PDI+LDN++ ++TLF
Sbjct  62   AFAISTSSPGLTMLCNLQMTKDGVGICLPDIRLDNSTTISTLF  104



>emb|CDX71386.1| BnaC04g16210D [Brassica napus]
Length=189

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +2

Query  281  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFP  460
            +KW TL+G  P V+ARGGFSGLFP+SS +A   A  TS   + M C++Q+TKDGVG+C  
Sbjct  28   TKWLTLNGQEPAVVARGGFSGLFPESSASANDLAISTSSPGLTMLCNLQMTKDGVGLCLS  87

Query  461  DIKLDNASNVATLF  502
            DI+LDNA+ ++TLF
Sbjct  88   DIRLDNATTISTLF  101



>ref|XP_007142366.1| hypothetical protein PHAVU_008G274200g [Phaseolus vulgaris]
 gb|ESW14360.1| hypothetical protein PHAVU_008G274200g [Phaseolus vulgaris]
Length=758

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 65/103 (63%), Gaps = 0/103 (0%)
 Frame = +2

Query  194  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  373
            MW  R++   L     +       ++   S W+TL+G  PLV+ARGGFSG+FPDSS +AY
Sbjct  1    MWNPRALSAPLAALLLLLHALIAIASAQRSAWKTLNGGPPLVVARGGFSGIFPDSSDSAY  60

Query  374  SFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
            S A  T+   V + CDVQLTKD VGIC PDI L N++ +AT +
Sbjct  61   SLAVITTGPDVYVSCDVQLTKDAVGICLPDINLANSTYIATTY  103



>ref|XP_003575252.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
isoform X1 [Brachypodium distachyon]
Length=749

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 61/83 (73%), Gaps = 7/83 (8%)
 Frame = +2

Query  254  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLT  433
            A +GST     W+TLSGD P +IA+GGFSGLFPDSS NAY FA  +  + V  WCDV+LT
Sbjct  26   AQKGST-----WKTLSGDPPAIIAKGGFSGLFPDSSENAYLFATISQDSAV--WCDVRLT  78

Query  434  KDGVGICFPDIKLDNASNVATLF  502
            KDG GIC PDI++++ ++++  F
Sbjct  79   KDGSGICLPDIQMESCTSISNAF  101



>ref|XP_008782908.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=767

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +2

Query  281  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFP  460
            S WQTL+G+AP+VIA+GGFSG+FPDSS  AY        +  I WCDV+LTKDGVGIC P
Sbjct  40   SPWQTLTGNAPVVIAKGGFSGIFPDSSDAAYKLTYIAGSSDTISWCDVRLTKDGVGICLP  99

Query  461  DIKLDNASNVATLF  502
            ++ ++N +N+  ++
Sbjct  100  ELTINNGTNIQVVY  113



>ref|XP_010050300.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Eucalyptus grandis]
Length=792

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +2

Query  299  SGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDN  478
            +GD P+VIARGGFSG+FPDSS  A   A  +S+  V+++CD+QLTKDG+GIC PDIKLDN
Sbjct  25   AGDKPVVIARGGFSGIFPDSSEFAVDMATTSSMGDVVLYCDLQLTKDGIGICQPDIKLDN  84

Query  479  ASNVATLF  502
             +++A +F
Sbjct  85   TTDIAMVF  92



>ref|XP_008645878.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Zea mays]
 gb|AFW72077.1| hypothetical protein ZEAMMB73_869244 [Zea mays]
Length=750

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +2

Query  281  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFP  460
            S W+TLSG AP+++A+GGFSGLFPDSS  AY   G  S    +MWCDV+LTKDG GIC P
Sbjct  33   STWKTLSGKAPVIVAKGGFSGLFPDSSDFAYRILGTISSPDTVMWCDVRLTKDGDGICLP  92

Query  461  DIKLDNASNVATLF  502
             I +DN + +  +F
Sbjct  93   SINMDNCTMIDNVF  106



>ref|XP_010913956.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X1 [Elaeis guineensis]
Length=763

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 60/85 (71%), Gaps = 3/85 (4%)
 Frame = +2

Query  248  LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQ  427
            LV AQ    S   WQTL+G+AP+VIA+GGFSG+FPDSS  AY        +  I+WCDV+
Sbjct  32   LVTAQTPKGS---WQTLTGNAPVVIAKGGFSGIFPDSSDLAYKLTYLAGSSDTILWCDVR  88

Query  428  LTKDGVGICFPDIKLDNASNVATLF  502
            LTKDGVG+C P++ ++N +N+  ++
Sbjct  89   LTKDGVGVCLPELTINNGTNIDVVY  113



>ref|XP_009417318.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Musa acuminata subsp. malaccensis]
Length=753

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +2

Query  275  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGIC  454
            +  KW TLSG+AP +IA+GGFSGLF DSS+NAY      S +   +WCDV+LTKDGVGIC
Sbjct  26   TAQKWLTLSGNAPAIIAKGGFSGLFADSSYNAYKSVSLFSSSDTTLWCDVRLTKDGVGIC  85

Query  455  FPDIKLDNASNV  490
             PDI L+N +++
Sbjct  86   LPDITLNNCTDI  97



>ref|XP_010928867.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Elaeis guineensis]
Length=767

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +2

Query  281  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFP  460
            S WQTL+G+AP+VIA+GGFSG+FPDSS  AY        +  I WCDV+LTKDGVGIC P
Sbjct  40   SPWQTLTGNAPVVIAKGGFSGVFPDSSDAAYKLTYIAGSSDTISWCDVRLTKDGVGICLP  99

Query  461  DIKLDNASNVATLF  502
            ++ ++N +N+  ++
Sbjct  100  ELTINNGTNIQVVY  113



>ref|XP_011017989.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like 
[Populus euphratica]
Length=749

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +2

Query  212  IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXT  391
            I N+LL+   +    A  S +++ KW TL+G  P VIARGGFSGLFP+SS  A   A  T
Sbjct  2    IKNVLLVFLVIHATLA-NSESASKKWLTLNGRRPCVIARGGFSGLFPESSDFANQMALAT  60

Query  392  SLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
            SL+ V++ C +QLTKDGVGIC  D++LDN  N+A +F+
Sbjct  61   SLSDVVVLCHLQLTKDGVGICQGDVRLDNTKNIAMVFE  98



>ref|XP_010483370.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7 [Camelina 
sativa]
Length=753

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 63/104 (61%), Gaps = 1/104 (1%)
 Frame = +2

Query  194  MWKLRSIFNLLLL-CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  370
            M +   IF+L +  C       A        KW TLSG  P V+ARGGFSGLFP+SS  A
Sbjct  1    MLRFIIIFSLFIHSCVGAPRTPAAAVAVPGKKWLTLSGQEPAVVARGGFSGLFPESSAPA  60

Query  371  YSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
               A  TS   + M C++Q+TKDGVG+C  DI+LDNA+ ++TLF
Sbjct  61   NDMAVSTSSPGLTMLCNLQMTKDGVGLCLSDIRLDNATTISTLF  104



>ref|XP_007011972.1| SHV3-like 5 [Theobroma cacao]
 gb|EOY29591.1| SHV3-like 5 [Theobroma cacao]
Length=754

 Score = 94.0 bits (232),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +2

Query  284  KWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPD  463
            KWQTLSG  PLVIARGGFSGLFP+SS  A   A     T V ++C++QLTKDG+GIC  D
Sbjct  33   KWQTLSGQPPLVIARGGFSGLFPESSSFANDMANQLKSTDVALFCNLQLTKDGIGICLSD  92

Query  464  IKLDNASNVATLF  502
            I+LDN++ +  +F
Sbjct  93   IRLDNSTTIGMIF  105



>ref|XP_008798763.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 isoform X1 [Phoenix dactylifera]
Length=763

 Score = 93.6 bits (231),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +2

Query  281  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFP  460
            S WQTL+G+AP+VIA+GGFSG+FPDSS  AY        +  I WCDV+LTKDGVGIC P
Sbjct  42   SAWQTLTGNAPVVIAKGGFSGIFPDSSDLAYKLTYLVGSSDTISWCDVRLTKDGVGICLP  101

Query  461  DIKLDNASNVATLF  502
            ++ ++N +N+  ++
Sbjct  102  ELTINNGTNIQMVY  115



>ref|NP_001062173.1| Os08g0503200 [Oryza sativa Japonica Group]
 dbj|BAD09276.1| putative glycerophosphoryl diester phosphodiesterase 2 precursor 
[Oryza sativa Japonica Group]
 dbj|BAF24087.1| Os08g0503200 [Oryza sativa Japonica Group]
 dbj|BAG89421.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89557.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83836.1| hypothetical protein OsI_29787 [Oryza sativa Indica Group]
 gb|EEE68959.1| hypothetical protein OsJ_27854 [Oryza sativa Japonica Group]
Length=778

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +2

Query  287  WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFPDI  466
            ++TLSG+AP+VIA GGFSG+FPDSS NAY FA  ++    ++WC+VQLTKDGVGIC  D+
Sbjct  46   YKTLSGNAPIVIAEGGFSGVFPDSSKNAYVFALSSTSGDTVLWCNVQLTKDGVGICLRDL  105

Query  467  KLDNASNVATLFK  505
             +DN ++++  ++
Sbjct  106  LMDNCTSISQAYR  118



>ref|XP_004952935.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Setaria italica]
Length=745

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 58/83 (70%), Gaps = 5/83 (6%)
 Frame = +2

Query  254  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLT  433
            A +GST     W+TLSG AP++IA+GGFSGLFPDSS  AY F    S     + CDV+LT
Sbjct  27   AQKGST-----WKTLSGKAPVIIAKGGFSGLFPDSSDLAYQFVPIASSPDTALLCDVRLT  81

Query  434  KDGVGICFPDIKLDNASNVATLF  502
            KDG GIC P+IK+DN + ++ +F
Sbjct  82   KDGAGICLPNIKMDNCTFISDVF  104



>gb|KEH28442.1| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=659

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +2

Query  281  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFP  460
            S W TL+G  PLVI+ GGFSG+FPDSS +AY  A  TS     +WCDVQLTKD VGIC P
Sbjct  27   SVWNTLTGSPPLVISHGGFSGIFPDSSDSAYILAAATSTPNAALWCDVQLTKDAVGICLP  86

Query  461  DIKLDNASNVATLF  502
            ++ L N++N+  +F
Sbjct  87   NLNLLNSTNIFGVF  100



>ref|XP_003617676.1| Glycerophosphodiesterase-like protein [Medicago truncatula]
 gb|AET00635.1| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=754

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +2

Query  281  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFP  460
            S W TL+G  PLVI+ GGFSG+FPDSS +AY  A  TS     +WCDVQLTKD VGIC P
Sbjct  27   SVWNTLTGSPPLVISHGGFSGIFPDSSDSAYILAAATSTPNAALWCDVQLTKDAVGICLP  86

Query  461  DIKLDNASNVATLF  502
            ++ L N++N+  +F
Sbjct  87   NLNLLNSTNIFGVF  100



>emb|CDY02800.1| BnaC02g10890D [Brassica napus]
Length=748

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 63/104 (61%), Gaps = 1/104 (1%)
 Frame = +2

Query  194  MWKLRSIFNLLLL-CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  370
            M +   +F+LL+  C A     A   T    KW TLSG  P V+ARGGFSGLFP+SS  A
Sbjct  1    MLRFLILFSLLIHSCVAPPKTKAAAGTLPAKKWLTLSGKEPAVVARGGFSGLFPESSATA  60

Query  371  YSFAGXTSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
               A  +S   + M C++QLTKDG G C  DI+LDN++ ++T F
Sbjct  61   NDLAISSSSPDLTMLCNLQLTKDGAGFCLSDIRLDNSTTISTFF  104



>ref|XP_002325146.2| hypothetical protein POPTR_0018s11890g [Populus trichocarpa]
 gb|EEF03711.2| hypothetical protein POPTR_0018s11890g [Populus trichocarpa]
Length=751

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 68/98 (69%), Gaps = 1/98 (1%)
 Frame = +2

Query  212  IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXT  391
            I N+LL+   +    A  S +++ KW TL+G  P VIARGGFSGLFP+SS  A   A  T
Sbjct  2    IKNVLLVFLVIHATLA-NSESASKKWLTLNGRRPSVIARGGFSGLFPESSDFANQMALAT  60

Query  392  SLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFK  505
            SL+ V + C++QLTK+GVGIC  DI+LDN +N+A +F+
Sbjct  61   SLSGVAVLCNLQLTKEGVGICQGDIRLDNTTNIAMVFE  98



>emb|CDY02788.1| BnaC02g11010D [Brassica napus]
Length=745

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +2

Query  281  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFP  460
            +KW TL+G  P V+ARGGFSGLFP+SS +A   A  TS   + M C++Q+TKDGVG+C  
Sbjct  28   TKWLTLNGQEPAVVARGGFSGLFPESSASANDLAISTSSPGLTMLCNLQMTKDGVGLCLS  87

Query  461  DIKLDNASNVATLF  502
            DI+LDNA+ ++TLF
Sbjct  88   DIRLDNATTISTLF  101



>emb|CDY32730.1| BnaA02g07920D [Brassica napus]
Length=745

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +2

Query  281  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGXTSLTXVIMWCDVQLTKDGVGICFP  460
            +KW TL+G  P V+ARGGFSGLFP+SS +A   A  TS   + M C++Q+TKDGVG+C  
Sbjct  28   TKWLTLNGQEPAVVARGGFSGLFPESSASANDLAISTSSPGLTMLCNLQMTKDGVGLCLS  87

Query  461  DIKLDNASNVATLF  502
            DI+LDNA+ ++TLF
Sbjct  88   DIRLDNATTISTLF  101



>ref|XP_008679540.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Zea mays]
 gb|AFW65195.1| hypothetical protein ZEAMMB73_432164 [Zea mays]
Length=790

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = +2

Query  209  SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGX  388
            S F  LLL  AV   AAQG     S ++TLSG APLV+A GGFSGLFPDSS  AY+FA  
Sbjct  21   SSFAALLLGCAVVSAAAQGP-RLPSDYKTLSGAAPLVVAEGGFSGLFPDSSEGAYAFAVA  79

Query  389  TSLTXVIMWCDVQLTKDGVGICFPDIKLDNASNVATLF  502
             S     MWCDVQLTKDGVG+C  DI + N + V   F
Sbjct  80   ASAPGTAMWCDVQLTKDGVGVCLRDINMKNCTTVDQAF  117



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562345909905