BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF008P22

Length=620
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008240735.1|  PREDICTED: probable calcium-binding protein ...  93.2    3e-44   Prunus mume [ume]
ref|XP_011078930.1|  PREDICTED: probable calcium-binding protein ...    124   8e-43   Sesamum indicum [beniseed]
ref|XP_011075386.1|  PREDICTED: probable calcium-binding protein ...    121   1e-42   Sesamum indicum [beniseed]
ref|XP_009601106.1|  PREDICTED: probable calcium-binding protein ...    127   1e-42   Nicotiana tomentosiformis
emb|CDP14208.1|  unnamed protein product                                110   2e-40   Coffea canephora [robusta coffee]
emb|CBI30075.3|  unnamed protein product                              75.5    8e-40   Vitis vinifera
emb|CDY14768.1|  BnaC04g47650D                                        96.7    5e-39   Brassica napus [oilseed rape]
gb|EYU18659.1|  hypothetical protein MIMGU_mgv1a026895mg                113   7e-39   Erythranthe guttata [common monkey flower]
ref|XP_009141989.1|  PREDICTED: probable calcium-binding protein ...  94.7    2e-38   Brassica rapa
emb|CDY06925.1|  BnaA04g23900D                                        94.4    6e-38   
gb|EYU20776.1|  hypothetical protein MIMGU_mgv1a020784mg                110   2e-37   Erythranthe guttata [common monkey flower]
ref|XP_004249247.1|  PREDICTED: probable calcium-binding protein ...    102   5e-37   Solanum lycopersicum
ref|XP_009595400.1|  PREDICTED: probable calcium-binding protein ...    107   2e-36   Nicotiana tomentosiformis
ref|XP_010544017.1|  PREDICTED: probable calcium-binding protein ...  89.0    3e-35   Tarenaya hassleriana [spider flower]
ref|XP_006351283.1|  PREDICTED: probable calcium-binding protein ...  99.4    4e-35   Solanum tuberosum [potatoes]
ref|XP_009765839.1|  PREDICTED: probable calcium-binding protein ...    102   4e-35   Nicotiana sylvestris
ref|XP_010508721.1|  PREDICTED: probable calcium-binding protein ...  85.9    4e-35   Camelina sativa [gold-of-pleasure]
ref|XP_009763879.1|  PREDICTED: probable calcium-binding protein ...    102   4e-35   Nicotiana sylvestris
emb|CDY23852.1|  BnaC04g01850D                                        87.8    5e-35   Brassica napus [oilseed rape]
ref|XP_009622394.1|  PREDICTED: probable calcium-binding protein ...    102   1e-34   Nicotiana tomentosiformis
ref|XP_010102734.1|  putative calcium-binding protein CML36           77.0    1e-34   
ref|XP_010543513.1|  PREDICTED: probable calcium-binding protein ...  86.3    1e-34   Tarenaya hassleriana [spider flower]
ref|XP_006411405.1|  hypothetical protein EUTSA_v10017207mg           81.6    1e-33   Eutrema salsugineum [saltwater cress]
gb|KDP26218.1|  hypothetical protein JCGZ_22464                       99.8    1e-33   Jatropha curcas
ref|XP_004249249.1|  PREDICTED: probable calcium-binding protein ...  88.6    1e-33   Solanum lycopersicum
ref|XP_009789240.1|  PREDICTED: probable calcium-binding protein ...    130   1e-33   Nicotiana sylvestris
ref|XP_006295474.1|  hypothetical protein CARUB_v10024577mg           79.3    1e-33   Capsella rubella
ref|XP_002881773.1|  hypothetical protein ARALYDRAFT_903457           83.6    2e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_010273279.1|  PREDICTED: probable calcium-binding protein ...  77.4    2e-33   Nelumbo nucifera [Indian lotus]
ref|XP_010277607.1|  PREDICTED: probable calcium-binding protein ...    100   5e-33   Nelumbo nucifera [Indian lotus]
ref|XP_009142741.1|  PREDICTED: probable calcium-binding protein ...  84.7    5e-33   Brassica rapa
emb|CDX79938.1|  BnaA05g02180D                                        84.7    6e-33   
ref|XP_010517632.1|  PREDICTED: probable calcium-binding protein ...  76.6    6e-33   Camelina sativa [gold-of-pleasure]
gb|AAM61257.1|  calmodulin-like protein                               83.2    7e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181672.1|  putative calcium-binding protein CML35              83.2    7e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505921.1|  PREDICTED: probable calcium-binding protein ...  76.6    1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_006351257.1|  PREDICTED: probable calcium-binding protein ...  84.0    2e-32   Solanum tuberosum [potatoes]
ref|XP_007202521.1|  hypothetical protein PRUPE_ppa010940mg           91.3    3e-32   Prunus persica
emb|CAA48190.1|  calmodulin like protein                              79.3    8e-32   Arabidopsis thaliana [mouse-ear cress]
gb|KFK36989.1|  hypothetical protein AALP_AA4G198000                  78.6    1e-31   Arabis alpina [alpine rockcress]
ref|XP_008800223.1|  PREDICTED: calmodulin-like                       69.7    2e-31   Phoenix dactylifera
ref|XP_006296622.1|  hypothetical protein CARUB_v10014618mg           77.0    3e-31   Capsella rubella
ref|XP_003625055.1|  hypothetical protein MTR_7g090450                95.5    4e-31   Medicago truncatula
gb|AFK42347.1|  unknown                                               95.5    1e-30   Medicago truncatula
gb|KJB16379.1|  hypothetical protein B456_002G227200                  90.1    1e-30   Gossypium raimondii
ref|XP_004303614.1|  PREDICTED: probable calcium-binding protein ...  88.6    3e-30   Fragaria vesca subsp. vesca
ref|XP_008392376.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...  90.1    3e-29   
ref|XP_008376081.1|  PREDICTED: probable calcium-binding protein ...  89.4    3e-29   
ref|XP_010486615.1|  PREDICTED: probable calcium-binding protein ...  74.3    3e-29   Camelina sativa [gold-of-pleasure]
ref|XP_009341958.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...  88.6    6e-29   
ref|XP_010481256.1|  PREDICTED: probable calcium-binding protein ...  71.2    1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010464685.1|  PREDICTED: probable calcium-binding protein ...  72.0    1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_006364430.1|  PREDICTED: probable calcium-binding protein ...  83.2    2e-28   Solanum tuberosum [potatoes]
ref|XP_004493430.1|  PREDICTED: probable calcium-binding protein ...  81.3    6e-28   Cicer arietinum [garbanzo]
ref|NP_001265939.1|  Hop-interacting protein THI026                   82.8    6e-28   Solanum lycopersicum
ref|XP_007028573.1|  Calcium-binding EF-hand family protein, puta...  79.3    2e-27   
ref|XP_010554792.1|  PREDICTED: probable calcium-binding protein ...  91.7    7e-27   Tarenaya hassleriana [spider flower]
emb|CDY00910.1|  BnaC05g42900D                                        87.0    3e-26   
ref|XP_008373033.1|  PREDICTED: probable calcium-binding protein ...  82.4    3e-26   
gb|AGV22098.1|  calmodulin-like protein                               86.3    7e-26   Brassica juncea [brown mustard]
ref|XP_006288691.1|  hypothetical protein CARUB_v10002001mg           73.2    9e-26   
ref|XP_006421261.1|  hypothetical protein CICLE_v10005842mg           80.9    1e-25   Citrus clementina [clementine]
gb|KDO37862.1|  hypothetical protein CISIN_1g027592mg                 80.9    1e-25   Citrus sinensis [apfelsine]
emb|CDY60169.1|  BnaAnng16630D                                        85.1    2e-25   Brassica napus [oilseed rape]
ref|XP_006491566.1|  PREDICTED: probable calcium-binding protein ...  80.1    2e-25   Citrus sinensis [apfelsine]
ref|XP_009146864.1|  PREDICTED: probable calcium-binding protein ...  83.6    3e-25   Brassica rapa
ref|XP_010931583.1|  PREDICTED: probable calcium-binding protein ...  65.5    3e-25   Elaeis guineensis
gb|KDO37863.1|  hypothetical protein CISIN_1g027592mg                 77.4    2e-24   Citrus sinensis [apfelsine]
ref|XP_003554140.1|  PREDICTED: probable calcium-binding protein ...  72.8    2e-24   Glycine max [soybeans]
ref|XP_002276334.1|  PREDICTED: probable calcium-binding protein ...    105   4e-24   Vitis vinifera
ref|XP_007162132.1|  hypothetical protein PHAVU_001G126700g           70.5    8e-24   Phaseolus vulgaris [French bean]
ref|XP_008789596.1|  PREDICTED: probable calcium-binding protein ...  60.8    2e-23   Phoenix dactylifera
ref|XP_002323262.1|  Calmodulin-like family protein                   81.3    6e-23   Populus trichocarpa [western balsam poplar]
ref|XP_011033138.1|  PREDICTED: probable calcium-binding protein ...  79.7    8e-23   Populus euphratica
ref|XP_003521150.1|  PREDICTED: probable calcium-binding protein ...  72.0    1e-22   Glycine max [soybeans]
ref|XP_002308908.1|  Calmodulin-like family protein                   80.1    2e-22   Populus trichocarpa [western balsam poplar]
ref|XP_008790571.1|  PREDICTED: probable calcium-binding protein ...  67.0    2e-22   Phoenix dactylifera
ref|XP_009412818.1|  PREDICTED: probable calcium-binding protein ...  68.9    2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010924236.1|  PREDICTED: probable calcium-binding protein ...  65.9    3e-21   Elaeis guineensis
ref|XP_011027298.1|  PREDICTED: probable calcium-binding protein ...  76.6    5e-21   Populus euphratica
ref|XP_009399974.1|  PREDICTED: probable calcium-binding protein ...  67.8    7e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010938625.1|  PREDICTED: calmodulin-like protein 3             66.2    1e-20   Elaeis guineensis
ref|XP_010525531.1|  PREDICTED: probable calcium-binding protein ...  79.0    3e-20   Tarenaya hassleriana [spider flower]
gb|KJB35924.1|  hypothetical protein B456_006G133800                  66.6    5e-19   Gossypium raimondii
ref|XP_010056433.1|  PREDICTED: probable calcium-binding protein ...  65.9    5e-19   Eucalyptus grandis [rose gum]
gb|ABK24059.1|  unknown                                               54.7    1e-18   Picea sitchensis
ref|XP_008381742.1|  PREDICTED: probable calcium-binding protein ...  57.0    3e-18   Malus domestica [apple tree]
ref|XP_002970730.1|  hypothetical protein SELMODRAFT_94292            51.2    4e-18   
ref|XP_002969393.1|  hypothetical protein SELMODRAFT_91501            50.4    6e-18   
ref|XP_010062249.1|  PREDICTED: calcium-binding protein CML24-like    52.0    1e-17   Eucalyptus grandis [rose gum]
ref|XP_009351545.1|  PREDICTED: probable calcium-binding protein ...  54.3    2e-17   Pyrus x bretschneideri [bai li]
ref|XP_008389977.1|  PREDICTED: probable calcium-binding protein ...  55.5    2e-17   
ref|XP_009606381.1|  PREDICTED: probable calcium-binding protein ...  46.6    4e-17   Nicotiana tomentosiformis
gb|EYU30122.1|  hypothetical protein MIMGU_mgv1a025962mg              49.3    4e-17   Erythranthe guttata [common monkey flower]
ref|XP_006843397.1|  hypothetical protein AMTR_s00053p00122010        57.0    6e-17   Amborella trichopoda
ref|XP_008443339.1|  PREDICTED: probable calcium-binding protein ...  67.4    6e-17   
ref|XP_004241666.2|  PREDICTED: calcium-binding allergen Ole e 8-...  51.2    7e-17   Solanum lycopersicum
ref|XP_004159632.1|  PREDICTED: probable calcium-binding protein ...  65.1    8e-17   
ref|XP_004136671.1|  PREDICTED: probable calcium-binding protein ...  65.1    8e-17   
ref|XP_004503360.1|  PREDICTED: probable calcium-binding protein ...  57.0    8e-17   Cicer arietinum [garbanzo]
ref|XP_010922185.1|  PREDICTED: probable calcium-binding protein ...  65.1    9e-17   Elaeis guineensis
gb|EPS62655.1|  hypothetical protein M569_12136                       48.9    1e-16   Genlisea aurea
ref|XP_011072994.1|  PREDICTED: calcium-binding allergen Ole e 8-...  46.6    3e-16   Sesamum indicum [beniseed]
ref|XP_011070577.1|  PREDICTED: probable calcium-binding protein ...  59.3    3e-16   Sesamum indicum [beniseed]
ref|XP_008786895.1|  PREDICTED: probable calcium-binding protein ...  62.4    3e-16   Phoenix dactylifera
ref|XP_004498255.1|  PREDICTED: probable calcium-binding protein ...  48.5    4e-16   Cicer arietinum [garbanzo]
ref|XP_004169010.1|  PREDICTED: probable calcium-binding protein ...  49.7    4e-16   
ref|XP_007223528.1|  hypothetical protein PRUPE_ppa012032mg           52.8    4e-16   Prunus persica
ref|XP_008467096.1|  PREDICTED: probable calcium-binding protein ...  49.7    4e-16   Cucumis melo [Oriental melon]
ref|XP_004233476.1|  PREDICTED: probable calcium-binding protein ...  45.8    4e-16   Solanum lycopersicum
ref|XP_007033045.1|  Calmodulin like 23, putative                     48.9    5e-16   
ref|XP_010036330.1|  PREDICTED: probable calcium-binding protein ...  64.7    5e-16   Eucalyptus grandis [rose gum]
ref|XP_008221464.1|  PREDICTED: probable calcium-binding protein ...  52.8    6e-16   Prunus mume [ume]
gb|EPS63975.1|  hypothetical protein M569_10810                       54.3    6e-16   Genlisea aurea
ref|XP_010104706.1|  putative calcium-binding protein CML25           52.4    6e-16   Morus notabilis
ref|XP_006365410.1|  PREDICTED: calcium-binding allergen Ole e 8-...  49.3    7e-16   Solanum tuberosum [potatoes]
ref|XP_002882655.1|  hypothetical protein ARALYDRAFT_897194           82.4    9e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_010053891.1|  PREDICTED: calmodulin-like protein 3             50.8    1e-15   Eucalyptus grandis [rose gum]
ref|XP_004150619.1|  PREDICTED: probable calcium-binding protein ...  49.3    1e-15   
ref|XP_008801290.1|  PREDICTED: probable calcium-binding protein ...  50.1    1e-15   Phoenix dactylifera
ref|XP_009775333.1|  PREDICTED: probable calcium-binding protein ...  43.9    1e-15   Nicotiana sylvestris
gb|KJB50384.1|  hypothetical protein B456_008G168100                  50.4    1e-15   Gossypium raimondii
ref|XP_002534401.1|  Calcium-binding allergen Ole e, putative         82.0    1e-15   Ricinus communis
gb|KJB08532.1|  hypothetical protein B456_001G087100                  48.1    2e-15   Gossypium raimondii
ref|XP_006407598.1|  hypothetical protein EUTSA_v10021512mg           81.6    2e-15   Eutrema salsugineum [saltwater cress]
ref|XP_003544994.1|  PREDICTED: probable calcium-binding protein ...  45.1    2e-15   Glycine max [soybeans]
gb|KCW78265.1|  hypothetical protein EUGRSUZ_D02448                   50.4    2e-15   Eucalyptus grandis [rose gum]
ref|XP_003637661.1|  Calcium-binding pollen allergen                  46.6    2e-15   
ref|XP_006346894.1|  PREDICTED: probable calcium-binding protein ...  43.9    3e-15   Solanum tuberosum [potatoes]
ref|XP_009334418.1|  PREDICTED: probable calcium-binding protein ...  49.7    3e-15   Pyrus x bretschneideri [bai li]
ref|XP_010043960.1|  PREDICTED: probable calcium-binding protein ...  48.1    3e-15   Eucalyptus grandis [rose gum]
gb|EYU46532.1|  hypothetical protein MIMGU_mgv1a021796mg              51.6    3e-15   Erythranthe guttata [common monkey flower]
ref|XP_009379268.1|  PREDICTED: probable calcium-binding protein ...  44.3    4e-15   Pyrus x bretschneideri [bai li]
ref|XP_008378130.1|  PREDICTED: probable calcium-binding protein ...  50.1    4e-15   Malus domestica [apple tree]
ref|XP_006357771.1|  PREDICTED: calcium-binding protein CML24-like    43.1    4e-15   Solanum tuberosum [potatoes]
ref|XP_009804163.1|  PREDICTED: calcium-binding protein CML24-like    43.5    5e-15   Nicotiana sylvestris
emb|CDP16307.1|  unnamed protein product                              44.7    5e-15   Coffea canephora [robusta coffee]
ref|XP_008464718.1|  PREDICTED: probable calcium-binding protein ...  45.4    5e-15   Cucumis melo [Oriental melon]
ref|XP_009628802.1|  PREDICTED: probable calcium-binding protein ...  43.1    6e-15   Nicotiana tomentosiformis
ref|XP_008343178.1|  PREDICTED: probable calcium-binding protein ...  44.3    6e-15   Malus domestica [apple tree]
gb|AFK34900.1|  unknown                                               45.8    6e-15   Lotus japonicus
gb|KFK38406.1|  hypothetical protein AALP_AA3G109000                  79.7    6e-15   Arabis alpina [alpine rockcress]
ref|XP_003519336.1|  PREDICTED: probable calcium-binding protein ...  43.5    7e-15   Glycine max [soybeans]
ref|XP_007160425.1|  hypothetical protein PHAVU_002G320800g           50.1    7e-15   Phaseolus vulgaris [French bean]
ref|XP_008457589.1|  PREDICTED: probable calcium-binding protein ...  63.2    8e-15   Cucumis melo [Oriental melon]
ref|XP_006583713.1|  PREDICTED: probable calcium-binding protein ...  47.8    8e-15   Glycine max [soybeans]
ref|XP_007215081.1|  hypothetical protein PRUPE_ppa012612mg           47.8    9e-15   Prunus persica
ref|XP_011084270.1|  PREDICTED: calcium-binding allergen Ole e 8-...  44.3    1e-14   Sesamum indicum [beniseed]
ref|XP_002279679.1|  PREDICTED: probable calcium-binding protein ...  46.2    1e-14   Vitis vinifera
gb|AET05414.2|  EF hand calcium-binding family protein                51.6    1e-14   Medicago truncatula
ref|XP_003630938.1|  Calcium-binding pollen allergen                  52.0    1e-14   
ref|XP_004971250.1|  PREDICTED: probable calcium-binding protein ...  47.0    1e-14   
gb|AAZ20284.1|  calcium-binding pollen allergen                       47.0    2e-14   Arachis hypogaea [goober]
ref|XP_003524362.1|  PREDICTED: probable calcium-binding protein ...  49.3    2e-14   Glycine max [soybeans]
ref|XP_009770094.1|  PREDICTED: calmodulin-like                       56.2    2e-14   Nicotiana sylvestris
ref|XP_004230637.1|  PREDICTED: calmodulin-like                       55.8    2e-14   Solanum lycopersicum
ref|XP_004231987.1|  PREDICTED: calcium-binding protein CML24         42.7    2e-14   Solanum lycopersicum
emb|CDY40786.1|  BnaAnng06490D                                        48.1    2e-14   Brassica napus [oilseed rape]
ref|XP_003580040.2|  PREDICTED: probable calcium-binding protein ...  54.3    2e-14   
gb|KHN40730.1|  Putative calcium-binding protein CML25                47.0    2e-14   Glycine soja [wild soybean]
ref|NP_173866.1|  putative calcium-binding protein CML25              48.5    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002459097.1|  hypothetical protein SORBIDRAFT_03g045770        45.8    2e-14   Sorghum bicolor [broomcorn]
ref|NP_187630.1|  putative calcium-binding protein CML36              78.2    3e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008229213.1|  PREDICTED: probable calcium-binding protein ...  47.0    3e-14   Prunus mume [ume]
ref|XP_006852110.1|  hypothetical protein AMTR_s00049p00017460        49.7    4e-14   
ref|XP_010271345.1|  PREDICTED: probable calcium-binding protein ...  45.8    4e-14   Nelumbo nucifera [Indian lotus]
ref|XP_004960644.1|  PREDICTED: probable calcium-binding protein ...  45.1    4e-14   Setaria italica
ref|XP_002890700.1|  hypothetical protein ARALYDRAFT_335836           48.1    4e-14   
ref|XP_001768532.1|  predicted protein                                45.8    4e-14   
ref|XP_006415824.1|  hypothetical protein EUTSA_v10008816mg           48.9    4e-14   Eutrema salsugineum [saltwater cress]
ref|XP_007141898.1|  hypothetical protein PHAVU_008G235100g           43.9    5e-14   Phaseolus vulgaris [French bean]
ref|XP_002312460.2|  hypothetical protein POPTR_0008s13390g           48.9    5e-14   
ref|XP_010526084.1|  PREDICTED: calmodulin-like protein 4             47.8    5e-14   Tarenaya hassleriana [spider flower]
ref|XP_009103045.1|  PREDICTED: probable calcium-binding protein ...  46.6    5e-14   
gb|KJB15360.1|  hypothetical protein B456_002G172400                  45.8    5e-14   Gossypium raimondii
ref|XP_002525994.1|  Polcalcin Jun o, putative                        44.3    6e-14   Ricinus communis
ref|XP_004142374.1|  PREDICTED: probable calcium-binding protein ...  45.1    6e-14   Cucumis sativus [cucumbers]
ref|NP_001045400.1|  Os01g0949500                                     46.6    6e-14   
ref|XP_003616365.1|  Polcalcin Nic t                                  44.3    6e-14   Medicago truncatula
ref|XP_006304603.1|  hypothetical protein CARUB_v10011672mg           47.8    7e-14   Capsella rubella
ref|XP_011024051.1|  PREDICTED: probable calcium-binding protein ...  48.9    7e-14   Populus euphratica
ref|XP_011082591.1|  PREDICTED: calmodulin-like                       53.5    9e-14   Sesamum indicum [beniseed]
ref|XP_010477987.1|  PREDICTED: probable calcium-binding protein ...  47.0    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_011079925.1|  PREDICTED: calmodulin-like                       53.9    1e-13   Sesamum indicum [beniseed]
ref|XP_010924246.1|  PREDICTED: probable calcium-binding protein ...  64.7    1e-13   
ref|XP_009617304.1|  PREDICTED: calmodulin-like                       53.5    1e-13   Nicotiana tomentosiformis
ref|XP_010672963.1|  PREDICTED: probable calcium-binding protein ...  62.8    1e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010499149.1|  PREDICTED: probable calcium-binding protein ...  47.0    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_004159084.1|  PREDICTED: probable calcium-binding protein ...  45.1    1e-13   
emb|CDM86427.1|  unnamed protein product                              45.8    1e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011075365.1|  PREDICTED: probable calcium-binding protein ...  45.4    1e-13   Sesamum indicum [beniseed]
ref|XP_006430624.1|  hypothetical protein CICLE_v10013012mg           43.1    1e-13   Citrus clementina [clementine]
emb|CDM86445.1|  unnamed protein product                              45.8    2e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004151276.1|  PREDICTED: probable calcium-binding protein ...  61.6    2e-13   Cucumis sativus [cucumbers]
ref|XP_009797345.1|  PREDICTED: probable calcium-binding protein ...  45.1    2e-13   Nicotiana sylvestris
dbj|BAJ92507.1|  predicted protein                                    60.8    2e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001152603.1|  polcalcin Jun o 2                                45.1    2e-13   
ref|XP_010663678.1|  PREDICTED: calcium-binding allergen Ole e 8      45.8    2e-13   Vitis vinifera
ref|NP_001053179.1|  Os04g0492800                                     52.4    2e-13   
gb|ACG44451.1|  polcalcin Jun o 2                                     45.1    2e-13   Zea mays [maize]
ref|XP_008673034.1|  PREDICTED: polcalcin Jun o 2 isoform X1          45.1    2e-13   
emb|CDY24421.1|  BnaCnng04880D                                        45.1    2e-13   Brassica napus [oilseed rape]
ref|XP_006469245.1|  PREDICTED: probable calcium-binding protein ...  45.4    2e-13   Citrus sinensis [apfelsine]
ref|XP_009109853.1|  PREDICTED: probable calcium-binding protein ...  45.1    2e-13   Brassica rapa
ref|XP_010033692.1|  PREDICTED: probable calcium-binding protein ...  41.2    3e-13   Eucalyptus grandis [rose gum]
ref|XP_009608299.1|  PREDICTED: probable calcium-binding protein ...  44.3    3e-13   Nicotiana tomentosiformis
ref|XP_010109033.1|  putative calcium-binding protein CML23           42.0    3e-13   Morus notabilis
gb|AHA51383.1|  EF-hand_1 domain-containing protein                   45.1    3e-13   Hormiphora californensis
emb|CDX84967.1|  BnaC05g20880D                                        45.4    3e-13   
gb|KHM99973.1|  Putative calcium-binding protein CML25                45.1    3e-13   Glycine soja [wild soybean]
gb|KDP38112.1|  hypothetical protein JCGZ_04755                       43.5    3e-13   Jatropha curcas
gb|KEH26932.1|  EF hand calcium-binding family protein                45.4    3e-13   Medicago truncatula
gb|EMS57491.1|  putative calcium-binding protein CML18                43.9    3e-13   Triticum urartu
ref|XP_009113828.1|  PREDICTED: probable calcium-binding protein ...  45.1    3e-13   Brassica rapa
emb|CDP19328.1|  unnamed protein product                              51.2    3e-13   Coffea canephora [robusta coffee]
gb|ABK26821.1|  unknown                                               44.7    3e-13   Picea sitchensis
ref|XP_009370750.1|  PREDICTED: calmodulin-like protein 11            48.5    4e-13   Pyrus x bretschneideri [bai li]
gb|EYU44572.1|  hypothetical protein MIMGU_mgv1a015576mg              48.1    4e-13   Erythranthe guttata [common monkey flower]
gb|KDO60746.1|  hypothetical protein CISIN_1g029304mg                 44.7    4e-13   Citrus sinensis [apfelsine]
ref|XP_009595960.1|  PREDICTED: calcium-binding allergen Ole e 8-...  42.0    4e-13   Nicotiana tomentosiformis
gb|KDO48936.1|  hypothetical protein CISIN_1g031616mg                 47.8    4e-13   Citrus sinensis [apfelsine]
ref|XP_009411743.1|  PREDICTED: probable calcium-binding protein ...  60.8    4e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK26031.1|  unknown                                               44.7    4e-13   Picea sitchensis
ref|XP_003565059.1|  PREDICTED: probable calcium-binding protein ...  46.2    4e-13   Brachypodium distachyon [annual false brome]
ref|XP_009782225.1|  PREDICTED: calcium-binding allergen Ole e 8-...  42.0    4e-13   Nicotiana sylvestris
ref|XP_006471667.1|  PREDICTED: calmodulin-like protein 11-like       47.8    4e-13   Citrus sinensis [apfelsine]
gb|KJB60897.1|  hypothetical protein B456_009G330300                  44.3    5e-13   Gossypium raimondii
ref|XP_006574101.1|  PREDICTED: probable calcium-binding protein ...  44.7    5e-13   
gb|KFK44513.1|  hypothetical protein AALP_AA1G266400                  43.5    5e-13   Arabis alpina [alpine rockcress]
ref|XP_006443961.1|  hypothetical protein CICLE_v10022698mg           48.5    5e-13   Citrus clementina [clementine]
gb|EPS69688.1|  hypothetical protein M569_05080                       42.7    5e-13   Genlisea aurea
ref|XP_004235822.1|  PREDICTED: calcium-binding allergen Ole e 8-...  43.1    6e-13   Solanum lycopersicum
ref|XP_002440821.1|  hypothetical protein SORBIDRAFT_09g007360        45.8    7e-13   Sorghum bicolor [broomcorn]
ref|XP_007219711.1|  hypothetical protein PRUPE_ppa025855mg           43.9    7e-13   
gb|KDP33161.1|  hypothetical protein JCGZ_13426                       42.0    7e-13   Jatropha curcas
ref|XP_010549761.1|  PREDICTED: probable calcium-binding protein ...  44.7    7e-13   Tarenaya hassleriana [spider flower]
ref|XP_006652455.1|  PREDICTED: probable calcium-binding protein ...  52.0    7e-13   Oryza brachyantha
dbj|BAK01430.1|  predicted protein                                    43.9    8e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAH67730.1|  H0522A01.1                                           51.6    8e-13   Oryza sativa [red rice]
emb|CAD41532.1|  OSJNBb0091E11.1                                      51.6    8e-13   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ88405.1|  predicted protein                                    44.7    9e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003554273.1|  PREDICTED: calmodulin-3-like                     50.1    9e-13   Glycine max [soybeans]
ref|XP_009604908.1|  PREDICTED: probable calcium-binding protein ...  43.9    1e-12   Nicotiana tomentosiformis
ref|XP_002520954.1|  calmodulin, putative                             51.6    1e-12   Ricinus communis
ref|XP_010935758.1|  PREDICTED: neo-calmodulin-like                   48.9    1e-12   Elaeis guineensis
ref|XP_006014812.1|  PREDICTED: calmodulin                            53.9    1e-12   
ref|XP_008808019.1|  PREDICTED: calmodulin-like                       48.5    1e-12   Phoenix dactylifera
gb|KEH41232.1|  EF hand calcium-binding family protein                43.9    1e-12   Medicago truncatula
gb|ABK21927.1|  unknown                                               48.5    2e-12   Picea sitchensis
ref|XP_008368689.1|  PREDICTED: calmodulin-like protein 11            46.6    2e-12   
ref|XP_006095104.1|  PREDICTED: calmodulin-like                       47.8    2e-12   
ref|XP_008791135.1|  PREDICTED: calmodulin-like protein 8             47.4    2e-12   Phoenix dactylifera
ref|XP_006662725.1|  PREDICTED: probable calcium-binding protein ...  58.2    2e-12   Oryza brachyantha
ref|XP_009596484.1|  PREDICTED: probable calcium-binding protein ...  41.2    2e-12   Nicotiana tomentosiformis
emb|CBX25281.1|  hypothetical_protein                                 58.2    2e-12   Oryza brachyantha
ref|XP_009405944.1|  PREDICTED: neo-calmodulin-like                   45.4    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010917630.1|  PREDICTED: calmodulin-like protein 11            46.6    2e-12   
emb|CDO98355.1|  unnamed protein product                              41.2    2e-12   Coffea canephora [robusta coffee]
ref|XP_006663807.1|  PREDICTED: probable calcium-binding protein ...  58.2    2e-12   Oryza brachyantha
ref|XP_007910199.1|  PREDICTED: calmodulin-A-like                     53.1    2e-12   Callorhinchus milii [Australian ghost shark]
gb|KJB42986.1|  hypothetical protein B456_007G178400                  40.0    2e-12   Gossypium raimondii
ref|XP_009388516.1|  PREDICTED: calmodulin-like protein 8             45.4    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH41241.1|  EF hand calcium-binding family protein                42.0    2e-12   Medicago truncatula
ref|XP_004976061.1|  PREDICTED: probable calcium-binding protein ...  52.8    2e-12   Setaria italica
ref|XP_009408507.1|  PREDICTED: calmodulin-like protein 11            47.0    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008232680.1|  PREDICTED: calmodulin-like                       44.3    3e-12   Prunus mume [ume]
dbj|BAJ85572.1|  predicted protein                                    55.5    3e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006402687.1|  hypothetical protein EUTSA_v10006367mg           43.5    3e-12   Eutrema salsugineum [saltwater cress]
ref|XP_007052033.1|  EF hand calcium-binding family protein, puta...  45.1    3e-12   
ref|XP_004490807.1|  PREDICTED: calcium-binding protein CML24-like    42.4    3e-12   Cicer arietinum [garbanzo]
ref|XP_002322096.1|  calcium binding family protein                   41.2    3e-12   Populus trichocarpa [western balsam poplar]
ref|XP_004492663.1|  PREDICTED: probable calcium-binding protein ...  46.6    3e-12   Cicer arietinum [garbanzo]
ref|XP_002305867.1|  putative calmodulin-related family protein       42.0    3e-12   Populus trichocarpa [western balsam poplar]
ref|XP_005717351.1|  Calmodulin                                       44.7    3e-12   Chondrus crispus [carageen]
ref|XP_011012929.1|  PREDICTED: calmodulin-like protein 3             47.0    3e-12   Populus euphratica
ref|XP_009387065.1|  PREDICTED: uncharacterized CRM domain-contai...  48.1    3e-12   
gb|EMS57533.1|  putative calcium-binding protein CML36                57.4    4e-12   Triticum urartu
ref|XP_004486916.1|  PREDICTED: calmodulin-like protein 5-like        47.0    4e-12   
gb|ACF84808.1|  unknown                                               58.2    4e-12   Zea mays [maize]
ref|XP_003568726.2|  PREDICTED: probable calcium-binding protein ...  42.4    4e-12   
ref|XP_009801939.1|  PREDICTED: probable calcium-binding protein ...  41.2    4e-12   
ref|XP_003552345.1|  PREDICTED: probable calcium-binding protein ...  47.4    4e-12   
gb|ACU18369.1|  unknown                                               47.4    4e-12   
emb|CDX98375.1|  BnaC06g17360D                                        45.4    4e-12   
gb|KCW69357.1|  hypothetical protein EUGRSUZ_F02840                   42.7    4e-12   
emb|CDX67796.1|  BnaA07g18360D                                        45.4    4e-12   
gb|ADD38579.1|  Calmodulin                                            48.9    4e-12   
ref|XP_009403239.1|  PREDICTED: calmodulin-like protein 3             48.9    4e-12   
gb|KFO18269.1|  Calmodulin                                            52.0    4e-12   
gb|KJB24793.1|  hypothetical protein B456_004G160800                  45.1    4e-12   
ref|XP_010231590.1|  PREDICTED: probable calcium-binding protein ...  42.4    4e-12   
gb|ACO12252.1|  Calmodulin                                            49.3    5e-12   
gb|EMT17394.1|  Putative calcium-binding protein CML18                42.7    5e-12   
ref|XP_009380286.1|  PREDICTED: probable calcium-binding protein ...  39.7    5e-12   
ref|XP_008809156.1|  PREDICTED: probable calcium-binding protein ...  43.1    5e-12   
ref|XP_009104207.1|  PREDICTED: calmodulin-like protein 4             45.4    5e-12   
ref|XP_006367611.1|  PREDICTED: probable calcium-binding protein ...  40.0    6e-12   
gb|AHY86315.1|  Y-GECO1f                                              53.5    6e-12   
ref|XP_009419782.1|  PREDICTED: calmodulin-like protein 11            44.3    6e-12   
ref|XP_006341535.1|  PREDICTED: calcium-binding allergen Ole e 8-...  43.9    6e-12   
gb|AHY86314.1|  Y-GECO1                                               53.5    6e-12   
gb|EMS61663.1|  Calmodulin-like protein 5                             45.4    6e-12   
dbj|BAM78547.1|  GCaMP7a                                              50.4    7e-12   
ref|XP_011008803.1|  PREDICTED: probable calcium-binding protein ...  40.4    7e-12   
ref|XP_001785090.1|  predicted protein                                41.2    7e-12   
gb|EMT24894.1|  Putative calcium-binding protein CML22                54.7    7e-12   
ref|XP_005483194.1|  PREDICTED: calmodulin                            52.0    7e-12   
ref|XP_006664172.1|  PREDICTED: calmodulin-like protein 5-like        47.4    7e-12   
ref|XP_010279286.1|  PREDICTED: calmodulin-like protein 11            46.2    8e-12   
gb|EMT30279.1|  Calmodulin-like protein 5                             45.4    8e-12   
gb|AAF31152.1|AF078680_1  calcium-binding protein                     40.0    9e-12   
ref|XP_010525867.1|  PREDICTED: calmodulin-like protein 7             47.8    9e-12   
ref|XP_004302046.1|  PREDICTED: calmodulin-like protein 11            45.8    9e-12   
ref|XP_008550049.1|  PREDICTED: calmodulin-A-like                     51.2    9e-12   
ref|XP_009786057.1|  PREDICTED: calmodulin-like protein 8             48.9    9e-12   
ref|XP_010930452.1|  PREDICTED: uncharacterized protein LOC105051625  45.1    9e-12   
ref|XP_011002781.1|  PREDICTED: calcium-binding protein CML24-like    41.2    9e-12   
ref|XP_004228711.1|  PREDICTED: probable calcium-binding protein ...  39.3    1e-11   
ref|XP_003517059.1|  PREDICTED: probable calcium-binding protein ...  46.2    1e-11   
gb|KHN20471.1|  Putative calcium-binding protein CML25                45.8    1e-11   
ref|XP_006397493.1|  hypothetical protein EUTSA_v10001753mg           47.0    1e-11   
ref|XP_003372739.1|  EF hand domain containing protein                50.4    1e-11   
ref|XP_001765534.1|  predicted protein                                50.4    1e-11   
ref|XP_004867158.1|  PREDICTED: calmodulin isoform X3                 51.2    1e-11   
ref|XP_002442683.1|  hypothetical protein SORBIDRAFT_08g001200        59.7    1e-11   
ref|XP_011427007.1|  PREDICTED: calmodulin-A-like                     50.1    1e-11   
ref|XP_007134898.1|  hypothetical protein PHAVU_010G085100g           45.1    1e-11   
gb|KDP23657.1|  hypothetical protein JCGZ_23490                       45.8    1e-11   
ref|XP_002593251.1|  hypothetical protein BRAFLDRAFT_115029           45.4    1e-11   
gb|ABR17206.1|  unknown                                               43.1    1e-11   
ref|XP_010087110.1|  Calmodulin-like protein 11                       46.2    1e-11   
gb|KGG50401.1|  calmodulin                                            51.2    1e-11   
ref|XP_009400065.1|  PREDICTED: neo-calmodulin-like                   44.7    1e-11   
gb|EMS50469.1|  Calmodulin-like protein 5                             41.6    1e-11   
ref|NP_001237178.1|  uncharacterized protein LOC100527005             47.8    1e-11   
gb|EHH17309.1|  hypothetical protein EGK_13688                        50.4    2e-11   
gb|EYU40667.1|  hypothetical protein MIMGU_mgv1a015381mg              45.4    2e-11   
gb|KFK40244.1|  hypothetical protein AALP_AA3G348900                  44.7    2e-11   
ref|XP_009123945.1|  PREDICTED: calmodulin-like protein 5             45.1    2e-11   
ref|XP_010274712.1|  PREDICTED: calcium-binding allergen Ole e 8      40.4    2e-11   
ref|NP_001152624.1|  LOC100286265                                     56.6    2e-11   
ref|XP_007208587.1|  hypothetical protein PRUPE_ppa023004mg           44.7    2e-11   
ref|XP_011032625.1|  PREDICTED: calmodulin-like protein 11            44.7    2e-11   
emb|CAC34625.1|  putative calmodulin-related protein                  44.3    2e-11   
sp|Q9M7R0.1|ALL8_OLEEU  RecName: Full=Calcium-binding allergen Ol...  40.0    2e-11   
ref|XP_008119752.1|  PREDICTED: calmodulin                            50.8    2e-11   
ref|XP_011066820.1|  PREDICTED: neo-calmodulin-like                   51.2    2e-11   
gb|AGG76568.1|  red fluorescent calcium-binding protein RCaMP1h       50.1    2e-11   
ref|XP_009785827.1|  PREDICTED: uncharacterized CRM domain-contai...  42.7    2e-11   
ref|XP_007049574.1|  RNA-binding CRS1 / YhbY domain protein           44.3    2e-11   
ref|XP_006125555.1|  PREDICTED: calmodulin-like isoform X2            50.1    2e-11   
gb|ADJ53338.1|  GCaMP3                                                49.7    2e-11   
pdb|3SG5|A  Chain A, Crystal Structure Of Dimeric Gcamp3-d380y, Q...  50.1    2e-11   
ref|XP_011171909.1|  PREDICTED: neo-calmodulin-like                   51.2    2e-11   
ref|XP_011150176.1|  PREDICTED: neo-calmodulin-like isoform X3        51.2    2e-11   
ref|XP_007153253.1|  hypothetical protein PHAVU_003G019600g           40.8    2e-11   
dbj|GAM17285.1|  hypothetical protein SAMD00019534_004600             48.1    2e-11   
ref|XP_010551871.1|  PREDICTED: calcium-binding protein CML24-like    41.2    2e-11   
ref|NP_565996.1|  calmodulin-like protein MSS3                        47.0    2e-11   
gb|EFN67816.1|  Calmodulin                                            51.2    2e-11   
pdb|3SG4|A  Chain A, Crystal Structure Of Gcamp3-d380y, Lp(linker 2)  50.1    2e-11   
ref|XP_003521633.1|  PREDICTED: probable calcium-binding protein ...  46.6    2e-11   
pdb|3SG7|A  Chain A, Crystal Structure Of Gcamp3-kf(linker 1)         50.1    2e-11   
pdb|4IK3|A  Chain A, High Resolution Structure Of Gcamp3 At Ph 8.5    49.7    2e-11   
gb|EMT07142.1|  Putative calcium-binding protein CML10                45.8    2e-11   
gb|EMT30278.1|  Calmodulin-like protein 5                             44.7    2e-11   
gb|EZA54087.1|  Calmodulin                                            51.2    2e-11   
ref|XP_004241038.1|  PREDICTED: calmodulin-like protein 8             48.1    2e-11   
ref|XP_009611663.1|  PREDICTED: calmodulin-like protein 8             47.8    2e-11   
ref|XP_006120374.1|  PREDICTED: calmodulin, striated muscle-like      44.7    2e-11   
ref|XP_011150174.1|  PREDICTED: calmodulin-beta-like isoform X1       51.2    2e-11   
ref|XP_010506196.1|  PREDICTED: calmodulin-like protein 5             47.0    2e-11   
ref|XP_007295339.1|  calmodulin                                       47.8    2e-11   
ref|XP_006851809.1|  hypothetical protein AMTR_s00041p00030040        43.5    2e-11   
ref|XP_011150175.1|  PREDICTED: calmodulin-A-like isoform X2          51.2    2e-11   
ref|XP_005242003.1|  PREDICTED: calmodulin                            49.7    2e-11   
ref|XP_011090074.1|  PREDICTED: uncharacterized CRM domain-contai...  43.5    2e-11   
pdb|4IK1|A  Chain A, High Resolution Structure Of Gcampj At Ph 8.5    49.7    2e-11   
pdb|3SG3|A  Chain A, Crystal Structure Of Gcamp3-d380y                49.7    2e-11   
ref|XP_003400211.1|  PREDICTED: calmodulin-like                       51.2    2e-11   
ref|XP_011257081.1|  PREDICTED: neo-calmodulin-like isoform X3        51.2    2e-11   
ref|XP_003758346.1|  PREDICTED: calmodulin-like                       50.1    2e-11   
ref|XP_006296176.1|  hypothetical protein CARUB_v10025336mg           46.6    2e-11   
ref|XP_004897704.1|  PREDICTED: calmodulin-like protein 3             49.3    2e-11   
ref|XP_011288132.1|  PREDICTED: calmodulin                            50.1    2e-11   
ref|XP_010986526.1|  PREDICTED: calmodulin                            49.7    2e-11   
pdb|4IK5|A  Chain A, High Resolution Structure Of Delta-rest-gcamp3   49.7    2e-11   
ref|XP_011339099.1|  PREDICTED: neo-calmodulin-like isoform X3        51.2    2e-11   
ref|XP_005605456.1|  PREDICTED: calmodulin                            49.7    2e-11   
ref|XP_011257079.1|  PREDICTED: calmodulin-beta-like isoform X1       51.2    3e-11   
emb|CDY23356.1|  BnaC04g48840D                                        44.7    3e-11   
ref|XP_006122412.1|  PREDICTED: calmodulin                            49.7    3e-11   
ref|XP_011257080.1|  PREDICTED: calmodulin-A-like isoform X2          51.2    3e-11   
ref|XP_004336073.1|  Calmodulin, putative                             48.5    3e-11   
ref|XP_009142186.1|  PREDICTED: calmodulin-like protein 5             44.7    3e-11   
ref|XP_011339096.1|  PREDICTED: calmodulin-beta-like isoform X1       51.2    3e-11   
ref|XP_010517888.1|  PREDICTED: calmodulin-like protein 5             46.2    3e-11   
ref|NP_001146794.1|  uncharacterized protein LOC100280399             48.5    3e-11   
pdb|4OY4|A  Chain A, Calcium-free Campari V0.2                        49.7    3e-11   
ref|XP_003577074.1|  PREDICTED: probable calcium-binding protein ...  55.8    3e-11   
ref|XP_011339098.1|  PREDICTED: calmodulin-A-like isoform X2          50.8    3e-11   
ref|XP_011008351.1|  PREDICTED: probable calcium-binding protein ...  39.7    3e-11   
ref|XP_006432945.1|  hypothetical protein CICLE_v10003695mg           47.0    3e-11   
ref|XP_010238596.1|  PREDICTED: probable calcium-binding protein ...  43.9    3e-11   
ref|XP_001113485.1|  PREDICTED: calmodulin-like isoform 4             48.9    3e-11   
ref|NP_001270011.1|  calmodulin 2 (phosphorylase kinase, delta)       49.3    3e-11   
gb|KEH30330.1|  EF hand calcium-binding family protein                46.2    3e-11   
ref|XP_001751654.1|  predicted protein                                47.4    3e-11   
pdb|3WLC|A  Chain A, Crystal Structure Of Dimeric Gcamp6m             50.1    3e-11   
gb|KFK37167.1|  hypothetical protein AALP_AA4G222400                  48.9    3e-11   
ref|XP_006383679.1|  hypothetical protein POPTR_0005s23720g           44.7    3e-11   
gb|KHM98879.1|  Putative calcium-binding protein CML18                46.2    3e-11   
emb|CDY30399.1|  BnaA04g25000D                                        44.3    3e-11   
ref|XP_003465878.1|  PREDICTED: calmodulin-like                       47.4    3e-11   
ref|XP_007150430.1|  hypothetical protein PHAVU_005G152900g           48.5    4e-11   
gb|EEC67650.1|  hypothetical protein OsI_35060                        57.0    4e-11   
sp|P62184.2|CALM_RENRE  RecName: Full=Calmodulin; Short=CaM           48.9    4e-11   
ref|XP_009702107.1|  PREDICTED: calmodulin-like                       48.9    4e-11   
gb|AEO16865.1|  GEX-GECO1                                             51.6    4e-11   
ref|NP_001104289.1|  calmodulin                                       49.3    4e-11   
ref|XP_003536119.1|  PREDICTED: calmodulin-like protein 11-like       54.7    4e-11   
gb|EHB00855.1|  Calmodulin                                            49.7    4e-11   
ref|XP_004139379.1|  PREDICTED: calmodulin-like protein 8-like        43.9    4e-11   
ref|XP_005704341.1|  calmodulin isoform 1                             48.5    4e-11   
ref|XP_009048149.1|  hypothetical protein LOTGIDRAFT_148903           47.4    4e-11   
ref|XP_007200520.1|  hypothetical protein PRUPE_ppa012929mg           45.1    4e-11   
gb|ELK12789.1|  Calmodulin                                            49.3    4e-11   
ref|NP_191503.1|  calmodulin-like protein 4                           43.1    4e-11   
pdb|2K0J|A  Chain A, Solution Structure Of Cam Complexed To Drp1p     48.9    4e-11   
ref|XP_002734090.1|  PREDICTED: calmodulin-like                       46.2    4e-11   
pdb|4DJC|A  Chain A, 1.35 A Crystal Structure Of The Nav1.5 Diii-...  48.9    4e-11   
gb|ADP36946.1|  hypothetical protein                                  47.4    4e-11   
ref|XP_006839639.1|  PREDICTED: calmodulin                            49.3    4e-11   
gb|KFK41806.1|  hypothetical protein AALP_AA2G174300                  42.4    5e-11   
ref|XP_008305625.1|  PREDICTED: calmodulin-like                       47.8    5e-11   
ref|XP_005383080.1|  PREDICTED: calmodulin-like                       47.4    5e-11   
gb|ABD36085.1|  G-CaMP2                                               48.5    5e-11   
gb|ETE70432.1|  Calmodulin                                            48.9    5e-11   
ref|XP_003770562.1|  PREDICTED: calmodulin-like                       48.5    5e-11   
ref|XP_009398373.1|  PREDICTED: calmodulin-like isoform X2            45.8    5e-11   
gb|ABF18599.1|  His-6-tagged G-CaMP1.6                                48.5    5e-11   
gb|AEH27627.1|  calcium-sensing GFP protein                           48.5    5e-11   
pdb|3EVU|A  Chain A, Crystal Structure Of Calcium Bound Dimeric G...  48.5    5e-11   
ref|XP_008931196.1|  PREDICTED: calmodulin                            48.5    5e-11   
gb|EYU41429.1|  hypothetical protein MIMGU_mgv1a021942mg              45.8    5e-11   
pdb|3U0K|A  Chain A, Crystal Structure Of The Genetically Encoded...  49.7    5e-11   
ref|XP_010508448.1|  PREDICTED: calmodulin-like protein 5             45.4    5e-11   
gb|EHB18285.1|  Calmodulin                                            48.1    5e-11   
ref|XP_006445234.1|  hypothetical protein CICLE_v10022392mg           50.1    5e-11   
ref|XP_004963110.1|  PREDICTED: calmodulin-like protein 5-like        47.0    5e-11   
pdb|3SG6|A  Chain A, Crystal Structure Of Dimeric Gcamp2-lia(link...  48.5    5e-11   
ref|XP_006909678.1|  PREDICTED: calmodulin isoform X1                 48.5    5e-11   
dbj|BAE89379.1|  unnamed protein product                              48.5    5e-11   
ref|XP_007034907.1|  Calmodulin 8 isoform 1                           45.4    5e-11   
gb|ACH46218.1|  putative calmodulin variant 1                         47.4    6e-11   
ref|XP_005071796.1|  PREDICTED: calmodulin-like protein 3             47.0    6e-11   
pdb|3EK8|A  Chain A, Calcium-Saturated Gcamp2 T116vG87R MUTANT MO...  48.1    6e-11   
pdb|3SG2|A  Chain A, Crystal Structure Of Gcamp2-t116v,d381y          48.5    6e-11   
ref|XP_010996006.1|  PREDICTED: calmodulin                            48.9    6e-11   
emb|CDO99124.1|  unnamed protein product                              47.0    6e-11   
ref|XP_007532277.1|  PREDICTED: calmodulin                            48.9    6e-11   
emb|CAD79597.1|  calcium-sensing GFP analog                           48.1    6e-11   
pdb|3EVR|A  Chain A, Crystal Structure Of Calcium Bound Monomeric...  48.1    6e-11   
ref|XP_005383897.1|  PREDICTED: calmodulin-like protein 3 isoform X1  48.1    6e-11   
ref|XP_006868502.1|  PREDICTED: calmodulin                            48.9    6e-11   
ref|XP_011150177.1|  PREDICTED: neo-calmodulin-like isoform X4        50.4    6e-11   
gb|ABA95773.1|  EF hand family protein, expressed                     56.6    6e-11   
ref|XP_005416368.1|  PREDICTED: calmodulin                            48.1    6e-11   
ref|XP_005099688.1|  PREDICTED: calmodulin-like isoform X2            47.4    6e-11   
ref|XP_002593257.1|  hypothetical protein BRAFLDRAFT_59748            46.6    6e-11   
gb|AJE29627.1|  RA-CaM                                                47.8    6e-11   
ref|XP_006627766.1|  PREDICTED: calcium-binding protein 1-like        48.1    6e-11   
ref|XP_009607745.1|  PREDICTED: calmodulin-like protein 3             41.6    6e-11   
ref|XP_011436588.1|  PREDICTED: calmodulin-like                       47.4    6e-11   
ref|XP_006350654.1|  PREDICTED: calmodulin-like protein 11-like       47.8    6e-11   
gb|EHB02604.1|  Calmodulin                                            48.9    7e-11   
gb|ADT61781.1|  calmodulin                                            48.5    7e-11   
ref|XP_008791779.1|  PREDICTED: calmodulin-like protein 3             45.4    7e-11   
ref|NP_187405.1|  calmodulin-like protein 3                           45.4    7e-11   
gb|ELW48699.1|  Calmodulin                                            48.9    7e-11   
gb|AEO16867.1|  B-GECO1                                               49.7    7e-11   
ref|XP_009799072.1|  PREDICTED: probable calcium-binding protein ...  43.5    7e-11   
emb|CDO97169.1|  unnamed protein product                              41.2    7e-11   
ref|XP_006088486.1|  PREDICTED: calmodulin-like protein 3             51.2    7e-11   
ref|XP_010274270.1|  PREDICTED: calmodulin-like protein 11 isofor...  46.6    7e-11   
ref|XP_009799079.1|  PREDICTED: probable calcium-binding protein ...  43.5    7e-11   
sp|P14533.1|CABO_DORPE  RecName: Full=Squidulin; AltName: Full=Op...  43.9    7e-11   
pdb|3O78|A  Chain A, The Structure Of Ca2+ Sensor (Case-12)           48.1    7e-11   
ref|XP_010489170.1|  PREDICTED: calmodulin-like protein 1             46.2    7e-11   
gb|AFV80092.1|  calmodulin-like protein                               48.5    7e-11   
gb|KFO26283.1|  Calmodulin                                            47.8    7e-11   
ref|XP_011281779.1|  PREDICTED: calmodulin                            48.5    7e-11   
ref|XP_001765847.1|  predicted protein                                47.4    7e-11   
ref|XP_011073627.1|  PREDICTED: probable calcium-binding protein ...  40.0    7e-11   
pdb|3O77|A  Chain A, The Structure Of Ca2+ Sensor (Case-16)           48.1    7e-11   
emb|CDQ82670.1|  unnamed protein product                              48.1    8e-11   
ref|XP_004156491.1|  PREDICTED: calmodulin-like protein 8-like        43.1    8e-11   
ref|XP_011444268.1|  PREDICTED: calmodulin-like                       46.6    8e-11   
gb|ABU97105.1|  calmodulin                                            47.4    8e-11   
gb|AEO16870.1|  G-GECO1.2                                             49.7    8e-11   



>ref|XP_008240735.1| PREDICTED: probable calcium-binding protein CML36 [Prunus mume]
Length=229

 Score = 93.2 bits (230),  Expect(3) = 3e-44, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = +2

Query  95   GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  274
            GG  TPTSVLP  + + S D  + L  ++ QAFKLIDRD+DG + ++ELEALLS++GA+P
Sbjct  64   GGIRTPTSVLPERSGDWS-DFSTDLQLDMAQAFKLIDRDNDGVVSRKELEALLSRLGADP  122

Query  275  PSREELRLMLSEVDRDGDGCISLEGV  352
            PS+EE+ LMLSEVDR+G+G I+L+ +
Sbjct  123  PSQEEVMLMLSEVDREGNGSITLDAL  148


 Score = 73.2 bits (178),  Expect(3) = 3e-44, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GD RCTLEDCRRMI GVD NGDGFVCFEDF RMME Q
Sbjct  192  GDDRCTLEDCRRMIAGVDKNGDGFVCFEDFARMMELQ  228


 Score = 60.8 bits (146),  Expect(3) = 3e-44, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  381  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            P+ DSELRDAF  FD+DHDGKISAEELFNVF  IG
Sbjct  158  PAADSELRDAFKVFDSDHDGKISAEELFNVFTAIG  192


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +2

Query  101  ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  280
            E   +  L AL + + P       +EL  AFK+ D D DGKI  EEL  + + +G +  +
Sbjct  138  EGNGSITLDALLNRVGPVCGPAADSELRDAFKVFDSDHDGKISAEELFNVFTAIGDDRCT  197

Query  281  REELRLMLSEVDRDGDGCISLEGVQR  358
             E+ R M++ VD++GDG +  E   R
Sbjct  198  LEDCRRMIAGVDKNGDGFVCFEDFAR  223



>ref|XP_011078930.1| PREDICTED: probable calcium-binding protein CML36 [Sesamum indicum]
Length=220

 Score =   124 bits (311),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 77/93 (83%), Gaps = 4/93 (4%)
 Frame = +2

Query  80   GYKKPGGESTPTSVLPALNDEISPDEL----SGLYAELVQAFKLIDRDDDGKIRKEELEA  247
            G+KKP G STPTSVLP+L+ EISP+E     + +Y EL QAF++IDRD DGKI+KEELE 
Sbjct  44   GFKKPTGLSTPTSVLPSLSAEISPNEWPEIPADIYFELKQAFEMIDRDGDGKIKKEELEG  103

Query  248  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            LL ++G EPP +EEL+LML+EVDRDGDGCISLE
Sbjct  104  LLCRLGPEPPCQEELKLMLTEVDRDGDGCISLE  136


 Score = 76.6 bits (187),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQXR  600
            G+      L   K  GD+RCTLEDCRRMI GV+ NGDGFVCFEDF RMMEQQ R
Sbjct  167  GKITAEELLNVFKTIGDARCTLEDCRRMIRGVNRNGDGFVCFEDFSRMMEQQQR  220


 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 43/56 (77%), Gaps = 2/56 (4%)
 Frame = +3

Query  318  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            G   ++L   EF  + SAFAPP+ D ELRDAFDFFD+D DGKI+AEEL NVFKTIG
Sbjct  129  GDGCISLE--EFYAIGSAFAPPARDGELRDAFDFFDSDRDGKITAEELLNVFKTIG  182



>ref|XP_011075386.1| PREDICTED: probable calcium-binding protein CML36 [Sesamum indicum]
Length=221

 Score =   121 bits (303),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 77/93 (83%), Gaps = 4/93 (4%)
 Frame = +2

Query  80   GYKKPGGESTPTSVLPALNDEISPDELS----GLYAELVQAFKLIDRDDDGKIRKEELEA  247
            G KKP G STPTSVLP L+ +IS +E S     +Y EL QAF++IDRD DGKI+KEELEA
Sbjct  44   GSKKPNGLSTPTSVLPTLSADISAEEWSEISADVYFELKQAFEMIDRDGDGKIKKEELEA  103

Query  248  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            LL ++GAEPP++EEL+LMLS+VDRDGDGCI+LE
Sbjct  104  LLCRLGAEPPNQEELQLMLSDVDRDGDGCITLE  136


 Score = 79.0 bits (193),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  348  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            EF  + SAFAPP+CD ELRD FDFFD+D DGKI+AEELFNVFKTIG
Sbjct  137  EFYAIGSAFAPPTCDMELRDTFDFFDSDRDGKITAEELFNVFKTIG  182


 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQXR  600
            G+          K  GDS+CTLEDCRRMI GVD NGDGFVCFEDF RMME Q +
Sbjct  167  GKITAEELFNVFKTIGDSQCTLEDCRRMISGVDTNGDGFVCFEDFSRMMELQQQ  220



>ref|XP_009601106.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
tomentosiformis]
Length=219

 Score =   127 bits (319),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 76/93 (82%), Gaps = 4/93 (4%)
 Frame = +2

Query  80   GYKKPGGESTPTSVLPALNDEISPDELSGL----YAELVQAFKLIDRDDDGKIRKEELEA  247
            G+KKP G +TPTSVLP L++EIS D+ S +    YAELVQAF +ID D DGKI KEELEA
Sbjct  44   GFKKPNGLATPTSVLPTLSNEISADKWSEISAEVYAELVQAFHMIDTDGDGKIMKEELEA  103

Query  248  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            +LS+VG EPPS+EEL L+L EVDRDGDGCISLE
Sbjct  104  ILSRVGTEPPSKEELTLLLDEVDRDGDGCISLE  136


 Score = 73.2 bits (178),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            G+          +  GD RCTLEDCRRMI GVD NGDGFVCF+DFC MMEQQ
Sbjct  167  GKITAEKLFNVFRTIGDGRCTLEDCRRMIRGVDKNGDGFVCFDDFCLMMEQQ  218


 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = +3

Query  318  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            G   ++L   EF  +SSAF PPSCD ELRD FDFFD DHDGKI+AE+LFNVF+TIG
Sbjct  129  GDGCISL--EEFGAISSAFGPPSCDGELRDVFDFFDADHDGKITAEKLFNVFRTIG  182



>emb|CDP14208.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   110 bits (275),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 72/89 (81%), Gaps = 5/89 (6%)
 Frame = +2

Query  95   GGESTPTSVLP-ALNDEISPDELS----GLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  259
            G  +TPTSVLP  L+ EI+ DE S    G+Y ++ +AFK+IDRD DGKI ++ELEALLS+
Sbjct  66   GSPATPTSVLPPTLSSEITSDEWSEISGGVYEDVKEAFKMIDRDGDGKITRDELEALLSR  125

Query  260  VGAEPPSREELRLMLSEVDRDGDGCISLE  346
            VGAEPPS EEL ++LSEVDRDGDGCISLE
Sbjct  126  VGAEPPSAEELNMLLSEVDRDGDGCISLE  154


 Score = 82.8 bits (203),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  348  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            EF  + SAF PPSCDSE+RDAFDFFDTDHDG+I+AEEL+NVF+ IG
Sbjct  155  EFEAIGSAFGPPSCDSEMRDAFDFFDTDHDGRITAEELYNVFRVIG  200


 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQXR  600
            GR          +  GD +CTL++C+RMI GV  NG GFVCFEDF RMM Q  R
Sbjct  185  GRITAEELYNVFRVIGDGQCTLDECQRMISGVGKNGVGFVCFEDFSRMMMQLHR  238



>emb|CBI30075.3| unnamed protein product [Vitis vinifera]
Length=175

 Score = 75.5 bits (184),  Expect(3) = 8e-40, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  209  DDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            D DGKI K ELEALLS+VG EPPS EE+ +MLSEVDRDGDGCISLE
Sbjct  48   DGDGKITKRELEALLSRVGVEPPSEEEIMMMLSEVDRDGDGCISLE  93


 Score = 72.4 bits (176),  Expect(3) = 8e-40, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GD RCTLEDC+RMI GVD NGDGFVCFEDF RMMEQQ
Sbjct  138  GDDRCTLEDCQRMIAGVDKNGDGFVCFEDFSRMMEQQ  174


 Score = 63.9 bits (154),  Expect(3) = 8e-40, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = +3

Query  348  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            EF  +SSAF P +CD+ELRDAF FFDTD DGKI+AEEL  VF  IG
Sbjct  94   EFGAISSAFGP-ACDTELRDAFCFFDTDRDGKITAEELNQVFAAIG  138



>emb|CDY14768.1| BnaC04g47650D [Brassica napus]
Length=217

 Score = 96.7 bits (239),  Expect(3) = 5e-39, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 62/86 (72%), Gaps = 8/86 (9%)
 Frame = +2

Query  89   KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  268
            KPG  +TP SVLP  +D        G Y+EL+QAFKLIDRDDDG + + +L ALLS++  
Sbjct  51   KPGPAATPISVLPGDHD--------GFYSELIQAFKLIDRDDDGVVSRRDLAALLSRLSP  102

Query  269  EPPSREELRLMLSEVDRDGDGCISLE  346
            EPPS+EE+ LML EVD  GDGCISLE
Sbjct  103  EPPSQEEVTLMLQEVDGGGDGCISLE  128


 Score = 63.5 bits (153),  Expect(3) = 5e-39, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  588
            GD RCTLE+C RMI  VD NGDGFVCF+DFCRMME
Sbjct  176  GDERCTLEECVRMIATVDGNGDGFVCFDDFCRMME  210


 Score = 48.9 bits (115),  Expect(3) = 5e-39, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 31/47 (66%), Gaps = 5/47 (11%)
 Frame = +3

Query  360  LSSAFAPPSCDS-----ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+S  A  S DS     E+R+ F+FFD DHDG+ISAEEL  VF  IG
Sbjct  130  LASRVAGTSSDSDEGSVEMREVFEFFDVDHDGRISAEELHRVFGVIG  176



>gb|EYU18659.1| hypothetical protein MIMGU_mgv1a026895mg [Erythranthe guttata]
Length=224

 Score =   113 bits (283),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 73/93 (78%), Gaps = 5/93 (5%)
 Frame = +2

Query  83   YKKPGGESTPTSVLP-ALNDEISPDELS----GLYAELVQAFKLIDRDDDGKIRKEELEA  247
            +KKP G STPTSVLP A + EIS +E S     +Y +L QAF++IDRD DGK+ K ELE 
Sbjct  47   FKKPNGLSTPTSVLPTASSAEISTEEWSEISADVYFDLKQAFEMIDRDGDGKVTKAELED  106

Query  248  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            LL  +GA+PPSREELRLMLSEVDRDGDGCI+LE
Sbjct  107  LLCGLGADPPSREELRLMLSEVDRDGDGCITLE  139


 Score = 74.3 bits (181),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  348  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            EF  + SAFAPP+CD+E+R+ FDFFD+D DGKI+AEELF VF+TIG
Sbjct  140  EFHSIGSAFAPPTCDTEMRETFDFFDSDRDGKITAEELFGVFRTIG  185


 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 42/76 (55%), Gaps = 4/76 (5%)
 Frame = +1

Query  385  LATPSCETPSTSSIRITT----GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDG  552
             A P+C+T    +         G+          +  GD++CTLEDCRRMI GVD NGDG
Sbjct  148  FAPPTCDTEMRETFDFFDSDRDGKITAEELFGVFRTIGDAKCTLEDCRRMIRGVDRNGDG  207

Query  553  FVCFEDFCRMMEQQXR  600
            FVCFEDF  MM+   +
Sbjct  208  FVCFEDFSLMMDHHQQ  223



>ref|XP_009141989.1| PREDICTED: probable calcium-binding protein CML35 [Brassica rapa]
Length=215

 Score = 94.7 bits (234),  Expect(3) = 2e-38, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 60/86 (70%), Gaps = 9/86 (10%)
 Frame = +2

Query  89   KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  268
            KPG  +TP SVLP   D          Y+EL+QAFKLIDRDDDG + ++EL ALLS +  
Sbjct  50   KPGPAATPVSVLPGEQD---------FYSELIQAFKLIDRDDDGVVSRKELAALLSGLSP  100

Query  269  EPPSREELRLMLSEVDRDGDGCISLE  346
            EPPS+EE+ LML EVD  GDGCISLE
Sbjct  101  EPPSQEEVTLMLQEVDGGGDGCISLE  126


 Score = 63.9 bits (154),  Expect(3) = 2e-38, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  588
            GD RCTLE+C RMI  VD NGDGFVCF+DFCRMME
Sbjct  174  GDERCTLEECVRMIATVDGNGDGFVCFDDFCRMME  208


 Score = 48.5 bits (114),  Expect(3) = 2e-38, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 31/47 (66%), Gaps = 5/47 (11%)
 Frame = +3

Query  360  LSSAFAPPSCDS-----ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+S  A  S DS     E+R+ F+FFD DHDG+ISAEEL  VF  IG
Sbjct  128  LASRVAGTSSDSDEGSVEMREVFEFFDLDHDGRISAEELHRVFGVIG  174



>emb|CDY06925.1| BnaA04g23900D [Brassica napus]
Length=217

 Score = 94.4 bits (233),  Expect(3) = 6e-38, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 62/86 (72%), Gaps = 8/86 (9%)
 Frame = +2

Query  89   KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  268
            KPG  +TP SVLP  + +         Y+EL+QAFKLIDRDDDG + ++EL ALLS++  
Sbjct  51   KPGPAATPVSVLPGGDQD--------FYSELIQAFKLIDRDDDGVVSRKELAALLSRLSP  102

Query  269  EPPSREELRLMLSEVDRDGDGCISLE  346
            EPPS+EE+ LML EVD  GDGCISLE
Sbjct  103  EPPSQEEVTLMLQEVDGGGDGCISLE  128


 Score = 63.5 bits (153),  Expect(3) = 6e-38, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  588
            GD RCTLE+C RMI  VD NGDGFVCF+DFCRMME
Sbjct  176  GDERCTLEECVRMIATVDGNGDGFVCFDDFCRMME  210


 Score = 47.4 bits (111),  Expect(3) = 6e-38, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            E+R+ F+FFD DHDG+ISAEEL  VF  IG
Sbjct  147  EMREVFEFFDVDHDGRISAEELHRVFGVIG  176



>gb|EYU20776.1| hypothetical protein MIMGU_mgv1a020784mg [Erythranthe guttata]
Length=209

 Score =   110 bits (274),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 69/84 (82%), Gaps = 9/84 (11%)
 Frame = +2

Query  95   GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  274
            GG STPTSVLP+ +D         L +EL QAF++IDRD DGKI+KEELE LLS++GAEP
Sbjct  44   GGLSTPTSVLPSADD---------LCSELKQAFEMIDRDGDGKIKKEELEGLLSRLGAEP  94

Query  275  PSREELRLMLSEVDRDGDGCISLE  346
            PS+EEL+LM+SEVDRDGDGCISLE
Sbjct  95   PSQEELKLMVSEVDRDGDGCISLE  118


 Score = 73.6 bits (179),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  333  ALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
             ++  EF  + SAFAPP+CD ELR  FDFFD+D DGKI+AEELF VF+TIG
Sbjct  114  CISLEEFYAIGSAFAPPTCDGELRSTFDFFDSDRDGKITAEELFRVFETIG  164


 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 42/74 (57%), Gaps = 4/74 (5%)
 Frame = +1

Query  385  LATPSCETPSTSSIRITT----GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDG  552
             A P+C+    S+         G+          +  GD+RCTLEDCRRMI GVD NGDG
Sbjct  127  FAPPTCDGELRSTFDFFDSDRDGKITAEELFRVFETIGDARCTLEDCRRMIKGVDRNGDG  186

Query  553  FVCFEDFCRMMEQQ  594
            FVCFEDF  MM+Q 
Sbjct  187  FVCFEDFSLMMDQH  200



>ref|XP_004249247.1| PREDICTED: probable calcium-binding protein CML36 [Solanum lycopersicum]
Length=209

 Score =   102 bits (253),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 72/89 (81%), Gaps = 5/89 (6%)
 Frame = +2

Query  80   GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  259
            G++KP G STPTSVLP   +EIS  E+  +YAEL+ AF ++D D DGKIRKEELEA+LS+
Sbjct  41   GFRKPTGSSTPTSVLP---NEISAAEV--VYAELIHAFHMMDTDGDGKIRKEELEAILSR  95

Query  260  VGAEPPSREELRLMLSEVDRDGDGCISLE  346
            VG EPPS+EEL L+L EVD DGDGCISL+
Sbjct  96   VGTEPPSKEELMLLLEEVDVDGDGCISLQ  124


 Score = 79.7 bits (195),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +3

Query  333  ALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
             ++ +EF  +SSAF PP+CDSELRDAFDFFD DHDGKI+A+ELF+VF+ IG
Sbjct  120  CISLQEFGAISSAFGPPACDSELRDAFDFFDADHDGKITADELFSVFRQIG  170


 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQXR  600
            G+       +  ++ GDSRCTLE+CRRMI GVD NGDGFVCFEDFC MMEQQ R
Sbjct  155  GKITADELFSVFRQIGDSRCTLEECRRMIRGVDKNGDGFVCFEDFCIMMEQQHR  208


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            +EL  AF   D D DGKI  +EL ++  Q+G    + EE R M+  VD++GDG +  E
Sbjct  140  SELRDAFDFFDADHDGKITADELFSVFRQIGDSRCTLEECRRMIRGVDKNGDGFVCFE  197



>ref|XP_009595400.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
tomentosiformis]
Length=209

 Score =   107 bits (267),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 71/89 (80%), Gaps = 6/89 (7%)
 Frame = +2

Query  80   GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  259
            G+KKP G +TPTSVLP    EIS DE    ++E++QAF +ID D DGKIRKE+LEA+L++
Sbjct  44   GFKKPNGLATPTSVLPP--SEISADE----WSEILQAFHMIDSDGDGKIRKEQLEAILTR  97

Query  260  VGAEPPSREELRLMLSEVDRDGDGCISLE  346
            VG +PPS EEL  +L+EVDR+GDGCISLE
Sbjct  98   VGPDPPSEEELISLLNEVDRNGDGCISLE  126


 Score = 72.8 bits (177),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            G+          +  GD RCTL+DCRRMI GVD NGDGFVCFEDFC MMEQQ
Sbjct  157  GKITAEELFNVFRTIGDGRCTLDDCRRMIRGVDKNGDGFVCFEDFCLMMEQQ  208


 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 2/56 (4%)
 Frame = +3

Query  318  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            G   ++L   EF  +SSAF PP+CD ELR+AFDFFD DHDGKI+AEELFNVF+TIG
Sbjct  119  GDGCISL--EEFGAISSAFGPPACDDELRNAFDFFDADHDGKITAEELFNVFRTIG  172



>ref|XP_010544017.1| PREDICTED: probable calcium-binding protein CML35 [Tarenaya hassleriana]
Length=224

 Score = 89.0 bits (219),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 64/91 (70%), Gaps = 6/91 (7%)
 Frame = +2

Query  86   KKPGGESTPTSVLPALNDEISPDELSG----LYAELVQAFKLIDRDDDGKIRKEELEALL  253
            +KP   STP SVLP ++ + S  ++S      YAELVQAFKLIDRDDDG + + EL ALL
Sbjct  51   RKPDPASTPISVLPEISGDWS--QISAGDRDFYAELVQAFKLIDRDDDGMVSRSELAALL  108

Query  254  SQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            S++  +PPS+EE+ +ML  VD   DGCISLE
Sbjct  109  SRLSPDPPSQEEVSMMLRVVDGGDDGCISLE  139


 Score = 62.8 bits (151),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GD RCTLE+C+RMI  VD NGDG+VCF+DF RMME Q
Sbjct  187  GDERCTLEECQRMIATVDGNGDGYVCFDDFSRMMELQ  223


 Score = 44.3 bits (103),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            ELR+ F FFD D DG+ISAEEL  VF  IG
Sbjct  158  ELREVFGFFDADRDGRISAEELHRVFAVIG  187



>ref|XP_006351283.1| PREDICTED: probable calcium-binding protein CML36-like [Solanum 
tuberosum]
Length=211

 Score = 99.4 bits (246),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 70/89 (79%), Gaps = 5/89 (6%)
 Frame = +2

Query  80   GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  259
            G+ KP G STPTSVLP   +EIS  E+   YAEL+ AF ++D D DGKIRKEELEA+LS+
Sbjct  43   GFSKPTGSSTPTSVLP---NEISAAEVG--YAELIHAFHMMDTDGDGKIRKEELEAILSR  97

Query  260  VGAEPPSREELRLMLSEVDRDGDGCISLE  346
            VG EPPS+EEL L+L EVD +GDGCISL+
Sbjct  98   VGTEPPSKEELMLLLEEVDVNGDGCISLQ  126


 Score = 76.3 bits (186),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQXR  600
            G+       +  ++ GDSRCTLE+CRRMI GVD NGDGFVCFEDFC MMEQQ R
Sbjct  157  GKITADELFSVFRQIGDSRCTLEECRRMIRGVDKNGDGFVCFEDFCVMMEQQQR  210


 Score = 79.7 bits (195),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 46/56 (82%), Gaps = 2/56 (4%)
 Frame = +3

Query  318  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            G   ++L  +EF  +SSAF PP+CDSELRDAFDFFD DHDGKI+A+ELF+VF+ IG
Sbjct  119  GDGCISL--QEFGAISSAFGPPACDSELRDAFDFFDADHDGKITADELFSVFRQIG  172


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 38/70 (54%), Gaps = 7/70 (10%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDG-------  331
            +EL  AF   D D DGKI  +EL ++  Q+G    + EE R M+  VD++GDG       
Sbjct  142  SELRDAFDFFDADHDGKITADELFSVFRQIGDSRCTLEECRRMIRGVDKNGDGFVCFEDF  201

Query  332  CISLEGVQRA  361
            C+ +E  QR 
Sbjct  202  CVMMEQQQRC  211



>ref|XP_009765839.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
sylvestris]
Length=209

 Score =   102 bits (255),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 71/89 (80%), Gaps = 6/89 (7%)
 Frame = +2

Query  80   GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  259
            G++KP G +TPTSVLP   ++IS DE    ++E++QAF +ID   DGKIRKE+LEA+L++
Sbjct  44   GFQKPNGLATPTSVLPP--NDISADE----WSEILQAFHMIDSGGDGKIRKEQLEAILTR  97

Query  260  VGAEPPSREELRLMLSEVDRDGDGCISLE  346
            VG +PPS EEL  +L+EVDR+GDGCISLE
Sbjct  98   VGPDPPSEEELISLLNEVDRNGDGCISLE  126


 Score = 72.8 bits (177),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            G+          +  GD RCTLEDCR MI GVD NGDGFVCFEDFC MMEQQ
Sbjct  157  GKITAEELFNVFRTIGDGRCTLEDCRHMIRGVDKNGDGFVCFEDFCLMMEQQ  208


 Score = 80.1 bits (196),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 2/56 (4%)
 Frame = +3

Query  318  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            G   ++L   EF  +SSAF PP+CD ELR+AFDFFD +HDGKI+AEELFNVF+TIG
Sbjct  119  GDGCISL--EEFGAISSAFGPPACDDELRNAFDFFDANHDGKITAEELFNVFRTIG  172



>ref|XP_010508721.1| PREDICTED: probable calcium-binding protein CML35 [Camelina sativa]
Length=224

 Score = 85.9 bits (211),  Expect(3) = 4e-35, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 59/89 (66%), Gaps = 10/89 (11%)
 Frame = +2

Query  89   KPGG-ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  265
            KP G  +TP SVLP       P      Y ELVQAFKLIDRDDDG + + +L ALLS++ 
Sbjct  51   KPAGPTATPISVLP-------PQSSGDFYTELVQAFKLIDRDDDGVVSRGDLAALLSRLS  103

Query  266  AEPPSREELRLMLSEVDRDGD--GCISLE  346
             EPPS+EE+ LML EVD D D  GCISLE
Sbjct  104  PEPPSQEEVSLMLKEVDGDNDDGGCISLE  132


 Score = 65.9 bits (159),  Expect(3) = 4e-35, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GD RCTL++C RMI  VD NGDGFVCFEDFCRMME Q
Sbjct  180  GDERCTLDECVRMIATVDRNGDGFVCFEDFCRMMELQ  216


 Score = 43.9 bits (102),  Expect(3) = 4e-35, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            ELR+ F++FD D +GKISAEEL  VF  IG
Sbjct  151  ELREVFEYFDADRNGKISAEELHRVFGVIG  180



>ref|XP_009763879.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
sylvestris]
Length=225

 Score =   102 bits (253),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 72/92 (78%), Gaps = 9/92 (10%)
 Frame = +2

Query  98   GESTPTSVLPA-LNDEISPDELS-------GLYAELVQAFKLIDRDDDGKIRKEELEALL  253
            G STPTSVLP  L++EIS D+ S       G+Y++LVQAF LID D DGKIRKE+LEA+L
Sbjct  45   GISTPTSVLPTTLSNEISADDWSSEEISNSGVYSDLVQAFSLIDGDGDGKIRKEQLEAIL  104

Query  254  SQVGAE-PPSREELRLMLSEVDRDGDGCISLE  346
            S+VG + PPS EEL  +L+EVD++GDGCISLE
Sbjct  105  SRVGGKSPPSEEELISLLNEVDKNGDGCISLE  136


 Score = 73.2 bits (178),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            G+          +  GD+RCTLEDCRRMI  VD NGDGFVCFEDFC MMEQQ
Sbjct  173  GKITAEELFNVFRMIGDARCTLEDCRRMIRSVDKNGDGFVCFEDFCLMMEQQ  224


 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 41/62 (66%), Gaps = 8/62 (13%)
 Frame = +3

Query  318  GTATVALASREFSVLSSAFAPPS------CDSELRDAFDFFDTDHDGKISAEELFNVFKT  479
            G   ++L   +F ++SSAF  P          E+RDAFDFFD DHDGKI+AEELFNVF+ 
Sbjct  129  GDGCISL--EDFGIISSAFELPEEMTAEDGGDEMRDAFDFFDADHDGKITAEELFNVFRM  186

Query  480  IG  485
            IG
Sbjct  187  IG  188



>emb|CDY23852.1| BnaC04g01850D [Brassica napus]
Length=213

 Score = 87.8 bits (216),  Expect(3) = 5e-35, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 62/89 (70%), Gaps = 10/89 (11%)
 Frame = +2

Query  80   GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  259
            G  KPG  +TP SVLP  + +         Y+ELV+AFKLIDRDDDG + ++EL ALLS+
Sbjct  42   GNLKPGPAATPVSVLPQSSGD--------FYSELVEAFKLIDRDDDGVVSRKELAALLSR  93

Query  260  VGAEPPSREELRLMLSEVDRDGDGCISLE  346
            +  EPPS+EE+ +ML EV  D DGCISLE
Sbjct  94   LSPEPPSQEEVSMMLREV--DADGCISLE  120


 Score = 63.2 bits (152),  Expect(3) = 5e-35, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GD RCTLEDC RMI  VD NGDGFV F+DFCRMME Q
Sbjct  169  GDERCTLEDCVRMIATVDRNGDGFVRFDDFCRMMELQ  205


 Score = 44.7 bits (104),  Expect(3) = 5e-35, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            E+R+ F+FFD D DG+ISAEEL  VF  IG
Sbjct  140  EMREVFEFFDADRDGRISAEELHRVFGVIG  169



>ref|XP_009622394.1| PREDICTED: probable calcium-binding protein CML35 [Nicotiana 
tomentosiformis]
Length=225

 Score =   102 bits (253),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 74/97 (76%), Gaps = 9/97 (9%)
 Frame = +2

Query  83   YKKPGGESTPTSVLPA-LNDEISPDELS-------GLYAELVQAFKLIDRDDDGKIRKEE  238
            +K   G STPTSVLP  L++EIS ++ S       G+Y++LVQAF LID D DGKIRKE+
Sbjct  40   HKPYNGLSTPTSVLPTTLSNEISAEDWSSEEISNSGVYSDLVQAFSLIDGDGDGKIRKEQ  99

Query  239  LEALLSQVGAE-PPSREELRLMLSEVDRDGDGCISLE  346
            LEA+LS+VG + PPS EEL  +L+EVD++GDGCISLE
Sbjct  100  LEAILSRVGGKSPPSEEELISLLNEVDKNGDGCISLE  136


 Score = 71.6 bits (174),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            G+          +  GD+RCTLEDCRRMI  VD NGDGFVCFEDFC MME Q
Sbjct  173  GKITAEELFNVFRMIGDARCTLEDCRRMIRSVDKNGDGFVCFEDFCLMMEHQ  224


 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 42/62 (68%), Gaps = 8/62 (13%)
 Frame = +3

Query  318  GTATVALASREFSVLSSAFAPPSCDS------ELRDAFDFFDTDHDGKISAEELFNVFKT  479
            G   ++L   +F ++SSAF      +      E+RDAFDFFDTDHDGKI+AEELFNVF+ 
Sbjct  129  GDGCISL--EDFGIISSAFELTEATTAEDGGDEMRDAFDFFDTDHDGKITAEELFNVFRM  186

Query  480  IG  485
            IG
Sbjct  187  IG  188



>ref|XP_010102734.1| putative calcium-binding protein CML36 [Morus notabilis]
 gb|EXB93986.1| putative calcium-binding protein CML36 [Morus notabilis]
Length=231

 Score = 77.0 bits (188),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 66/91 (73%), Gaps = 5/91 (5%)
 Frame = +2

Query  95   GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ---VG  265
            GG  TPTSVLP ++ ++S D  + +++EL +AFKLIDRD+DG + ++ELEALLS+   VG
Sbjct  58   GGSVTPTSVLPEISGDLS-DFSADIHSELAEAFKLIDRDNDGIVSRKELEALLSRLGGVG  116

Query  266  AEPPSREELRLMLSEVD-RDGDGCISLEGVQ  355
            +   S + +  MLSEVD  DG+GCIS+E + 
Sbjct  117  SISESEDFVASMLSEVDGGDGEGCISVEALM  147


 Score = 62.8 bits (151),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GD RCTL+DCRRMI GV  +G+GFVCFEDF RMME Q
Sbjct  192  GDERCTLQDCRRMIDGVGRSGEGFVCFEDFSRMMELQ  228


 Score = 54.3 bits (129),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 3/51 (6%)
 Frame = +3

Query  333  ALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            AL SR   V S+A   P+ DSELR+AFDFFDTD DG+I+A+EL + F  IG
Sbjct  145  ALMSR---VGSAAACEPAGDSELREAFDFFDTDRDGRITADELHSFFTAIG  192



>ref|XP_010543513.1| PREDICTED: probable calcium-binding protein CML36 [Tarenaya hassleriana]
Length=215

 Score = 86.3 bits (212),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 66/88 (75%), Gaps = 2/88 (2%)
 Frame = +2

Query  95   GGESTPTSVLPALNDEISPDELSGLYA--ELVQAFKLIDRDDDGKIRKEELEALLSQVGA  268
             G  TPTSVLP ++ + +  + S  Y+  ELVQAFKLID+D+DG + +++LEALLS++G 
Sbjct  46   AGTVTPTSVLPEVSGDFAAVDASYPYSYLELVQAFKLIDKDNDGAVSRQDLEALLSRLGP  105

Query  269  EPPSREELRLMLSEVDRDGDGCISLEGV  352
            +P S+EE+ +ML ++DRDGDG I LE +
Sbjct  106  DPLSQEEIDVMLGDLDRDGDGAIRLEAL  133


 Score = 62.4 bits (150),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GD +CTLEDCRRMI  VD +GDGFVCF +F RMME Q
Sbjct  178  GDEQCTLEDCRRMIAAVDEDGDGFVCFGEFSRMMELQ  214


 Score = 45.4 bits (106),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 32/51 (63%), Gaps = 4/51 (8%)
 Frame = +3

Query  333  ALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            ALASR    + SA       +ELR+ F+FFD D DG ISAEEL  VF +IG
Sbjct  132  ALASR----VVSAGDLSRHSAELRETFEFFDADRDGLISAEELLRVFASIG  178


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 38/67 (57%), Gaps = 0/67 (0%)
 Frame = +2

Query  143  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRD  322
            +S  +LS   AEL + F+  D D DG I  EEL  + + +G E  + E+ R M++ VD D
Sbjct  138  VSAGDLSRHSAELRETFEFFDADRDGLISAEELLRVFASIGDEQCTLEDCRRMIAAVDED  197

Query  323  GDGCISL  343
            GDG +  
Sbjct  198  GDGFVCF  204



>ref|XP_006411405.1| hypothetical protein EUTSA_v10017207mg [Eutrema salsugineum]
 gb|ESQ52858.1| hypothetical protein EUTSA_v10017207mg [Eutrema salsugineum]
Length=226

 Score = 81.6 bits (200),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 65/90 (72%), Gaps = 6/90 (7%)
 Frame = +2

Query  89   KPGGESTPTSVLPALNDEISPDELSG---LYAELVQAFKLIDRDDDGKIRKEELEALLSQ  259
            KPG  +TP SVLP  + + S  ++SG    Y++L+QAFKLIDRDDDG + + +L ALLS+
Sbjct  50   KPGPAATPVSVLPENSGDWS--QISGDRDFYSDLIQAFKLIDRDDDGVVSRGDLAALLSR  107

Query  260  VGAEPPSREELRLMLSEVD-RDGDGCISLE  346
            +  +PPS+EE+ LML EVD  +  GCISLE
Sbjct  108  LSPDPPSQEEVSLMLREVDGGEESGCISLE  137


 Score = 62.0 bits (149),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GD RCT+++CRRMI  V  NGDGFVCFEDF RMME Q
Sbjct  186  GDERCTIDECRRMIATVGRNGDGFVCFEDFSRMMELQ  222


 Score = 47.4 bits (111),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            E+R+ F+FFD D DGKISAEEL+ VF  IG
Sbjct  157  EMREVFEFFDADRDGKISAEELYRVFGVIG  186



>gb|KDP26218.1| hypothetical protein JCGZ_22464 [Jatropha curcas]
Length=219

 Score = 99.8 bits (247),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 66/82 (80%), Gaps = 1/82 (1%)
 Frame = +2

Query  107  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  286
            TPTSVLP ++ + S D  +  Y++LVQAFKLIDRD+DG + + ELEALLS++GAEPPS+E
Sbjct  58   TPTSVLPEISGDWS-DISTDFYSDLVQAFKLIDRDNDGIVSRRELEALLSRLGAEPPSQE  116

Query  287  ELRLMLSEVDRDGDGCISLEGV  352
            E+  MLSEVD  GDGCIS+E +
Sbjct  117  EVATMLSEVDHVGDGCISVEAL  138


 Score = 70.9 bits (172),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 39/74 (53%), Gaps = 8/74 (11%)
 Frame = +1

Query  397  SCETPSTSSIRIT--------TGRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDG  552
            +CE      +R+          G+          K  GD RCT EDC RMI  VD NGDG
Sbjct  145  ACEPAGDDELRVAFEFFDADQDGKITAEELFGVYKAIGDERCTFEDCMRMIASVDKNGDG  204

Query  553  FVCFEDFCRMMEQQ  594
            FVCFEDFCRMME Q
Sbjct  205  FVCFEDFCRMMELQ  218


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  381  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            P+ D ELR AF+FFD D DGKI+AEELF V+K IG
Sbjct  148  PAGDDELRVAFEFFDADQDGKITAEELFGVYKAIG  182



>ref|XP_004249249.1| PREDICTED: probable calcium-binding protein CML36 [Solanum lycopersicum]
Length=239

 Score = 88.6 bits (218),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = +2

Query  119  VLPALNDEISPDELSG-LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELR  295
            VLP+ N +  P E+S  +Y+ELVQAF++ID D DGKI KEEL A+L++VG++PP+ EEL 
Sbjct  81   VLPSTNTQW-PSEISAEVYSELVQAFQMIDGDGDGKIHKEELSAILTRVGSDPPTEEELV  139

Query  296  LMLSEVDRDGDGCISLE  346
             +L+EVD +GDGCISL+
Sbjct  140  QLLNEVDVNGDGCISLQ  156


 Score = 82.0 bits (201),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +3

Query  333  ALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
             ++ +EF  +SSAF PPSCDSE+RD F+FFD +HDGKI+AEELFNVF+TIG
Sbjct  152  CISLQEFGAISSAFGPPSCDSEMRDTFEFFDANHDGKITAEELFNVFRTIG  202


 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            G+          +  GD RCTLE+CRRMI GVD NGDGFVCFEDF  MMEQQ
Sbjct  187  GKITAEELFNVFRTIGDGRCTLEECRRMIRGVDKNGDGFVCFEDFSLMMEQQ  238



>ref|XP_009789240.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
sylvestris]
Length=219

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 77/93 (83%), Gaps = 4/93 (4%)
 Frame = +2

Query  80   GYKKPGGESTPTSVLPALNDEISPDELSGL----YAELVQAFKLIDRDDDGKIRKEELEA  247
            G+KKP G +TPTSVLP L++EIS DE S +    YAELVQAF +ID D DGKIRKEELEA
Sbjct  44   GFKKPNGLATPTSVLPTLSNEISADEWSEISAEVYAELVQAFHVIDTDGDGKIRKEELEA  103

Query  248  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            +LS+VG EPPS+EEL L+L EVDRDGDGCISLE
Sbjct  104  ILSRVGTEPPSKEELTLLLDEVDRDGDGCISLE  136


 Score = 80.9 bits (198),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 43/56 (77%), Gaps = 2/56 (4%)
 Frame = +3

Query  318  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            G   ++L   EF  + SAF PPSCD ELRDAFDFFD DHDG I+AEELFNVF+TIG
Sbjct  129  GDGCISL--EEFGAIRSAFGPPSCDGELRDAFDFFDADHDGMITAEELFNVFRTIG  182


 Score = 73.6 bits (179),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GD RCTLEDCRRMI GVD NGDGFVCFEDFC MMEQQ
Sbjct  182  GDGRCTLEDCRRMIRGVDKNGDGFVCFEDFCFMMEQQ  218



>ref|XP_006295474.1| hypothetical protein CARUB_v10024577mg [Capsella rubella]
 gb|EOA28372.1| hypothetical protein CARUB_v10024577mg [Capsella rubella]
Length=215

 Score = 79.3 bits (194),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 55/84 (65%), Gaps = 8/84 (10%)
 Frame = +2

Query  80   GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  259
            G  KPG  +TP SVLP  + +         Y ELVQAFKLIDRD DG + + +L ALLS+
Sbjct  46   GNLKPGPTATPISVLPHNSGD--------FYTELVQAFKLIDRDHDGVVSRGDLAALLSR  97

Query  260  VGAEPPSREELRLMLSEVDRDGDG  331
            +  EPPS+EE+ LML EVD D DG
Sbjct  98   LSPEPPSQEEVSLMLKEVDGDDDG  121


 Score = 67.0 bits (162),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GD RCTLE+C RMI  VD NGDGFVCFEDFCRMME Q
Sbjct  175  GDERCTLEECIRMIATVDRNGDGFVCFEDFCRMMELQ  211


 Score = 44.3 bits (103),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            ELR+ F+FFD D +GKISAEEL  VF  IG
Sbjct  146  ELREVFEFFDADRNGKISAEELHRVFGVIG  175



>ref|XP_002881773.1| hypothetical protein ARALYDRAFT_903457 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58032.1| hypothetical protein ARALYDRAFT_903457 [Arabidopsis lyrata subsp. 
lyrata]
Length=216

 Score = 83.6 bits (205),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 59/89 (66%), Gaps = 8/89 (9%)
 Frame = +2

Query  80   GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  259
            G  K G  +TP SVLP  + +         YAEL+QAFKLIDRDDDG + + +L AL+S+
Sbjct  46   GNLKQGPTATPISVLPQNSGD--------FYAELIQAFKLIDRDDDGVVSRGDLAALISR  97

Query  260  VGAEPPSREELRLMLSEVDRDGDGCISLE  346
            +  EPPS+EE+ LML EVD    GCISLE
Sbjct  98   LSPEPPSQEEVSLMLREVDGGDGGCISLE  126


 Score = 63.9 bits (154),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            GD RCTLE+C RMI  VD NGDGFVCFEDFCRMM
Sbjct  174  GDERCTLEECMRMIATVDGNGDGFVCFEDFCRMM  207


 Score = 43.1 bits (100),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            ELR+ F+ FD D +GKISAEEL  VF  IG
Sbjct  145  ELREVFEIFDVDRNGKISAEELHRVFGVIG  174



>ref|XP_010273279.1| PREDICTED: probable calcium-binding protein CML36 [Nelumbo nucifera]
Length=221

 Score = 77.4 bits (189),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 63/91 (69%), Gaps = 5/91 (5%)
 Frame = +2

Query  89   KPGGESTPTSVLPALNDEISPDE---LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  259
            K GG +TP SVL + + EIS D     +  + +LV+AFK IDRD DGKI + ELE +LS+
Sbjct  48   KEGGATTPRSVLHSHSHEISGDWSDLQADFHFQLVEAFKFIDRDGDGKITRRELENILSR  107

Query  260  VGAEPPS--REELRLMLSEVDRDGDGCISLE  346
            +GA+ PS   + + + L EVDRDGDGCI+L+
Sbjct  108  LGADTPSEEMQMMLMELMEVDRDGDGCINLK  138


 Score = 63.2 bits (152),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  588
            GD RCT+EDCR MI GVD +GDGFVCFEDF RMME
Sbjct  183  GDDRCTIEDCRLMIGGVDTDGDGFVCFEDFLRMME  217


 Score = 49.3 bits (116),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 30/47 (64%), Gaps = 1/47 (2%)
 Frame = +3

Query  345  REFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            +E    S AF P    SELRDAFDFFD   DGKISA+EL  VF  +G
Sbjct  138  KETGATSPAFGPYD-GSELRDAFDFFDAGRDGKISADELHRVFTALG  183



>ref|XP_010277607.1| PREDICTED: probable calcium-binding protein CML36 [Nelumbo nucifera]
Length=219

 Score =   100 bits (249),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 66/90 (73%), Gaps = 4/90 (4%)
 Frame = +2

Query  89   KPGGESTPTSVLPALNDEISPD----ELSGLYAELVQAFKLIDRDDDGKIRKEELEALLS  256
            K GG +TP SVL + + EIS D      +  + E +QAFKLIDRD DGK+   ELE LLS
Sbjct  47   KGGGGATPKSVLRSCSQEISGDWSDLSAANTHLEHLQAFKLIDRDGDGKVTIHELEGLLS  106

Query  257  QVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            ++G EPPS+EE+ LML+E+D+DGDGCISLE
Sbjct  107  RIGGEPPSKEEMLLMLTEIDQDGDGCISLE  136


 Score = 68.2 bits (165),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  588
            G+      L      GD RCTLEDCRRMI  VD NGDGFVCFEDF RMME
Sbjct  166  GKISAEELLGVFSAIGDDRCTLEDCRRMIRSVDTNGDGFVCFEDFSRMME  215


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 1/46 (2%)
 Frame = +3

Query  348  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            EF  +SS+  P +  S+LR+AF+ FD D DGKISAEEL  VF  IG
Sbjct  137  EFEAISSSLVPAAL-SDLREAFNVFDADRDGKISAEELLGVFSAIG  181


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 42/79 (53%), Gaps = 4/79 (5%)
 Frame = +2

Query  122  LPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLM  301
              A++  + P  LS    +L +AF + D D DGKI  EEL  + S +G +  + E+ R M
Sbjct  138  FEAISSSLVPAALS----DLREAFNVFDADRDGKISAEELLGVFSAIGDDRCTLEDCRRM  193

Query  302  LSEVDRDGDGCISLEGVQR  358
            +  VD +GDG +  E   R
Sbjct  194  IRSVDTNGDGFVCFEDFSR  212



>ref|XP_009142741.1| PREDICTED: probable calcium-binding protein CML35 [Brassica rapa]
Length=213

 Score = 84.7 bits (208),  Expect(3) = 5e-33, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 61/89 (69%), Gaps = 10/89 (11%)
 Frame = +2

Query  80   GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  259
            G  KPG  +TP SVLP  + +         Y+ELV+AFKLIDRDDDG + +++L ALLS+
Sbjct  42   GKLKPGPAATPVSVLPQSSGD--------FYSELVEAFKLIDRDDDGVVSRKDLAALLSR  93

Query  260  VGAEPPSREELRLMLSEVDRDGDGCISLE  346
            +  EPPS EE+ +ML EV  D DGCISLE
Sbjct  94   LSPEPPSPEEVSMMLREV--DADGCISLE  120


 Score = 59.7 bits (143),  Expect(3) = 5e-33, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GD RCTLEDC RMI  VD NGDGFV F+DF RMME Q
Sbjct  169  GDERCTLEDCVRMIATVDRNGDGFVRFDDFRRMMELQ  205


 Score = 44.3 bits (103),  Expect(3) = 5e-33, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            E+R+ F+FFD D DG+ISAEEL  VF  IG
Sbjct  140  EMREVFEFFDADRDGRISAEELHRVFGVIG  169



>emb|CDX79938.1| BnaA05g02180D [Brassica napus]
Length=213

 Score = 84.7 bits (208),  Expect(3) = 6e-33, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 61/89 (69%), Gaps = 10/89 (11%)
 Frame = +2

Query  80   GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  259
            G  KPG  +TP SVLP  + +         Y+ELV+AFKLIDRDDDG + +++L ALLS+
Sbjct  42   GKLKPGPAATPVSVLPQSSGD--------FYSELVEAFKLIDRDDDGVVSRKDLAALLSR  93

Query  260  VGAEPPSREELRLMLSEVDRDGDGCISLE  346
            +  EPPS EE+ +ML EV  D DGCISLE
Sbjct  94   LSPEPPSPEEVSMMLREV--DADGCISLE  120


 Score = 59.3 bits (142),  Expect(3) = 6e-33, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GD RCTLEDC RMI  VD NGDGFV F+DF RMME Q
Sbjct  169  GDERCTLEDCVRMIATVDRNGDGFVRFDDFRRMMELQ  205


 Score = 44.7 bits (104),  Expect(3) = 6e-33, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            E+R+ F+FFD D DG+ISAEEL  VF  IG
Sbjct  140  EMREVFEFFDADRDGRISAEELHRVFGVIG  169



>ref|XP_010517632.1| PREDICTED: probable calcium-binding protein CML35 isoform X1 
[Camelina sativa]
 ref|XP_010517633.1| PREDICTED: probable calcium-binding protein CML35 isoform X2 
[Camelina sativa]
Length=224

 Score = 76.6 bits (187),  Expect(3) = 6e-33, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 58/89 (65%), Gaps = 11/89 (12%)
 Frame = +2

Query  89   KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  268
            KPG  +TP SVLP  + +         Y ELVQAFKLIDRDDDG + + +L ALLS++  
Sbjct  50   KPGPTATPISVLPQSSGD--------FYTELVQAFKLIDRDDDGVVSRGDLAALLSKLSP  101

Query  269  EPPSREELRLMLSEV---DRDGDGCISLE  346
            EPPS+EE+ LML EV     D  GCISLE
Sbjct  102  EPPSQEEVSLMLKEVDGDGDDDGGCISLE  130


 Score = 67.8 bits (164),  Expect(3) = 6e-33, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GD RCTLE+C RMI  VD NGDGFVCFEDFCRMME Q
Sbjct  178  GDERCTLEECVRMIATVDRNGDGFVCFEDFCRMMELQ  214


 Score = 44.3 bits (103),  Expect(3) = 6e-33, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            ELR+ F++FD D +GKISAEEL  VF  IG
Sbjct  149  ELREVFEYFDADRNGKISAEELHRVFGVIG  178



>gb|AAM61257.1| calmodulin-like protein [Arabidopsis thaliana]
Length=216

 Score = 83.2 bits (204),  Expect(3) = 7e-33, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 58/89 (65%), Gaps = 8/89 (9%)
 Frame = +2

Query  80   GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  259
            G  K G  +TP SVLP  + +         Y ELVQAFKLIDRDDDG + + +L AL+S+
Sbjct  46   GNLKQGPTATPISVLPQNSGD--------FYTELVQAFKLIDRDDDGVVSRGDLAALISR  97

Query  260  VGAEPPSREELRLMLSEVDRDGDGCISLE  346
            +  EPPS+EE+ LML EVD    GCISLE
Sbjct  98   LSHEPPSQEEVSLMLREVDGGDGGCISLE  126


 Score = 62.4 bits (150),  Expect(3) = 7e-33, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            GD RCTLE+C RMI  VD NGDGFVCF+DFCRMM
Sbjct  174  GDERCTLEECMRMIATVDGNGDGFVCFDDFCRMM  207


 Score = 42.7 bits (99),  Expect(3) = 7e-33, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            ELR+ F+ FD D +GKISAEEL  VF  IG
Sbjct  145  ELREVFEIFDVDRNGKISAEELHRVFGVIG  174



>ref|NP_181672.1| putative calcium-binding protein CML35 [Arabidopsis thaliana]
 sp|P30188.2|CML35_ARATH RecName: Full=Probable calcium-binding protein CML35; AltName: 
Full=Calmodulin-like protein 1; AltName: Full=Calmodulin-like 
protein 35 [Arabidopsis thaliana]
 gb|AAK26017.1|AF360307_1 putative calmodulin protein [Arabidopsis thaliana]
 gb|AAC78532.1| calmodulin-like protein [Arabidopsis thaliana]
 gb|AAL07243.1| putative calmodulin protein [Arabidopsis thaliana]
 gb|AEC09970.1| putative calcium-binding protein CML35 [Arabidopsis thaliana]
Length=216

 Score = 83.2 bits (204),  Expect(3) = 7e-33, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 58/89 (65%), Gaps = 8/89 (9%)
 Frame = +2

Query  80   GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  259
            G  K G  +TP SVLP  + +         Y ELVQAFKLIDRDDDG + + +L AL+S+
Sbjct  46   GNLKQGPTATPISVLPQNSGD--------FYTELVQAFKLIDRDDDGVVSRGDLAALISR  97

Query  260  VGAEPPSREELRLMLSEVDRDGDGCISLE  346
            +  EPPS+EE+ LML EVD    GCISLE
Sbjct  98   LSHEPPSQEEVSLMLREVDGGDGGCISLE  126


 Score = 62.4 bits (150),  Expect(3) = 7e-33, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            GD RCTLE+C RMI  VD NGDGFVCF+DFCRMM
Sbjct  174  GDERCTLEECMRMIATVDGNGDGFVCFDDFCRMM  207


 Score = 42.7 bits (99),  Expect(3) = 7e-33, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            ELR+ F+ FD D +GKISAEEL  VF  IG
Sbjct  145  ELREVFEIFDVDRNGKISAEELHRVFGVIG  174



>ref|XP_010505921.1| PREDICTED: probable calcium-binding protein CML35 [Camelina sativa]
Length=220

 Score = 76.6 bits (187),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 58/89 (65%), Gaps = 11/89 (12%)
 Frame = +2

Query  89   KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  268
            KPG  +TP SVLP  + +         Y ELVQAFKLIDRDDDG + + +L ALLS++  
Sbjct  50   KPGPTATPISVLPQSSGD--------FYTELVQAFKLIDRDDDGVVSRGDLAALLSRLSP  101

Query  269  EPPSREELRLMLSEV---DRDGDGCISLE  346
            EPPS+EE+ LML EV     D  GCISLE
Sbjct  102  EPPSQEEVSLMLKEVDGDGDDDGGCISLE  130


 Score = 66.2 bits (160),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GD RCTL++C RMI  VD NGDGFVCFEDFCRMME Q
Sbjct  178  GDERCTLDECVRMIATVDRNGDGFVCFEDFCRMMELQ  214


 Score = 44.3 bits (103),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            ELR+ F++FD D +GKISAEEL  VF  IG
Sbjct  149  ELREVFEYFDADRNGKISAEELHRVFGVIG  178



>ref|XP_006351257.1| PREDICTED: probable calcium-binding protein CML36-like [Solanum 
tuberosum]
Length=205

 Score = 84.0 bits (206),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +2

Query  119  VLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRL  298
            VLP+   +   +  + +Y+ELVQAF++ID D DGKI KEE+ A+L++VG++PP+ EEL  
Sbjct  47   VLPSTTTQWPSEIPAEVYSELVQAFQMIDVDGDGKIHKEEISAILTRVGSDPPTEEELVQ  106

Query  299  MLSEVDRDGDGCISLE  346
            +L+EVD +GDGCISL+
Sbjct  107  LLNEVDVNGDGCISLQ  122


 Score = 82.0 bits (201),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +3

Query  333  ALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
             ++ +EF  +SSAF PPSCDSE+RD F+FFD +HDGKI+AEELFNVF+TIG
Sbjct  118  CISLQEFGAISSAFGPPSCDSEMRDTFEFFDANHDGKITAEELFNVFRTIG  168


 Score = 70.9 bits (172),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            G+          +  GD RCTLE+CRRMI GVD NGDGFVCFEDF  MMEQQ
Sbjct  153  GKITAEELFNVFRTIGDGRCTLEECRRMIRGVDKNGDGFVCFEDFSLMMEQQ  204



>ref|XP_007202521.1| hypothetical protein PRUPE_ppa010940mg [Prunus persica]
 gb|EMJ03720.1| hypothetical protein PRUPE_ppa010940mg [Prunus persica]
Length=229

 Score = 91.3 bits (225),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 67/86 (78%), Gaps = 1/86 (1%)
 Frame = +2

Query  95   GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  274
            GG  TPTSVL   + + S D  + L  ++ QAFKLIDRD+DG + ++ELEALLS++GA+P
Sbjct  64   GGIGTPTSVLLERSGDWS-DFSTDLQLDMAQAFKLIDRDNDGVVSRKELEALLSRLGADP  122

Query  275  PSREELRLMLSEVDRDGDGCISLEGV  352
            PS+EE+ LMLSEVDR+G+G ISLE +
Sbjct  123  PSQEEVMLMLSEVDREGNGSISLEAL  148


 Score = 74.3 bits (181),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            G+      L      GD RCTLEDCRRMI GVD NGDGFVCFEDF RMME Q
Sbjct  177  GKISAEELLNVFTAIGDDRCTLEDCRRMIAGVDKNGDGFVCFEDFARMMELQ  228


 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  381  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            P+ DSELRDAF+ FD+DHDGKISAEEL NVF  IG
Sbjct  158  PAADSELRDAFEVFDSDHDGKISAEELLNVFTAIG  192


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGV  352
            +EL  AF++ D D DGKI  EEL  + + +G +  + E+ R M++ VD++GDG +  E  
Sbjct  162  SELRDAFEVFDSDHDGKISAEELLNVFTAIGDDRCTLEDCRRMIAGVDKNGDGFVCFEDF  221

Query  353  QR  358
             R
Sbjct  222  AR  223



>emb|CAA48190.1| calmodulin like protein [Arabidopsis thaliana]
Length=215

 Score = 79.3 bits (194),  Expect(3) = 8e-32, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 55/89 (62%), Gaps = 9/89 (10%)
 Frame = +2

Query  80   GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  259
            G  K G  +TP SV     D          Y ELVQAFKLIDRDDDG + + +L AL+S+
Sbjct  46   GNLKQGPTATPISVSSNSGD---------FYTELVQAFKLIDRDDDGVVSRGDLAALISR  96

Query  260  VGAEPPSREELRLMLSEVDRDGDGCISLE  346
            +  EPPS+EE+ LML EVD    GCISLE
Sbjct  97   LSHEPPSQEEVSLMLREVDGGDGGCISLE  125


 Score = 62.4 bits (150),  Expect(3) = 8e-32, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            GD RCTLE+C RMI  VD NGDGFVCF+DFCRMM
Sbjct  173  GDERCTLEECMRMIATVDGNGDGFVCFDDFCRMM  206


 Score = 42.7 bits (99),  Expect(3) = 8e-32, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            ELR+ F+ FD D +GKISAEEL  VF  IG
Sbjct  144  ELREVFEIFDVDRNGKISAEELHRVFGVIG  173



>gb|KFK36989.1| hypothetical protein AALP_AA4G198000 [Arabis alpina]
Length=225

 Score = 78.6 bits (192),  Expect(3) = 1e-31, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 58/91 (64%), Gaps = 11/91 (12%)
 Frame = +2

Query  80   GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  259
             +K     +TP SVLP           S  ++EL+QAFKLIDRDDDG + + +L  L+S+
Sbjct  51   NHKPNPSSTTPISVLPWSG--------SDFHSELIQAFKLIDRDDDGVVSRRDLANLISK  102

Query  260  VGAEPPSREELRLMLSEVDRDG--DGCISLE  346
            +  EPPS EE+ LML EVD DG  DGCISLE
Sbjct  103  LSPEPPSHEEVSLMLREVD-DGEEDGCISLE  132


 Score = 60.1 bits (144),  Expect(3) = 1e-31, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GD RCTL++CRRMI  VD NGDGFVCF DF  MME Q
Sbjct  179  GDERCTLDECRRMIATVDKNGDGFVCFHDFSCMMEIQ  215


 Score = 45.8 bits (107),  Expect(3) = 1e-31, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  390  DSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            + E+R+ F++FD D DG+ISAEEL+ VF  IG
Sbjct  148  EEEMREVFEYFDVDRDGRISAEELYRVFGVIG  179



>ref|XP_008800223.1| PREDICTED: calmodulin-like [Phoenix dactylifera]
Length=227

 Score = 69.7 bits (169),  Expect(3) = 2e-31, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 62/104 (60%), Gaps = 15/104 (14%)
 Frame = +2

Query  80   GYKKPGGESTPTSVLPA---LNDEISPDELSG---LYAEL--------VQAFKLIDRDDD  217
            G+   G  STP SVLPA   L     P   +G   L+  L         + F + D D D
Sbjct  42   GFISSGLHSTPRSVLPASPGLRPAEKPPSAAGSNDLWLFLPASSSSSVSELFAVFDCDGD  101

Query  218  GKIRKEELEALLSQVG-AEPPSREELRLMLSEVDRDGDGCISLE  346
            GKI ++ELEA+L ++G A+PP+ EE+  M++EVDRDGDGCISLE
Sbjct  102  GKITRQELEAVLRRLGGADPPTEEEVASMVAEVDRDGDGCISLE  145


 Score = 63.2 bits (152),  Expect(3) = 2e-31, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GD  CTLEDCRRMI GVD +GDGFVCFEDF RMM+ +
Sbjct  190  GDDGCTLEDCRRMIGGVDTDGDGFVCFEDFVRMMDGK  226


 Score = 50.4 bits (119),  Expect(3) = 2e-31, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 31/46 (67%), Gaps = 1/46 (2%)
 Frame = +3

Query  348  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            EF  + SAF PP+  +ELR+ F  FD D DGKISAEEL  VF  +G
Sbjct  146  EFGAIGSAFGPPA-GAELREVFAVFDDDGDGKISAEELQRVFVMLG  190



>ref|XP_006296622.1| hypothetical protein CARUB_v10014618mg [Capsella rubella]
 gb|EOA29520.1| hypothetical protein CARUB_v10014618mg [Capsella rubella]
Length=212

 Score = 77.0 bits (188),  Expect(3) = 3e-31, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 57/80 (71%), Gaps = 7/80 (9%)
 Frame = +2

Query  107  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  286
            TPTS+LP ++   S       Y E++QAFKLIDRD+DG + + +LE+LLS++G +P + +
Sbjct  57   TPTSILPDVSSPYS-------YVEILQAFKLIDRDNDGAVSRHDLESLLSRLGPDPLTED  109

Query  287  ELRLMLSEVDRDGDGCISLE  346
            E+ +M+ EVD DGDG I LE
Sbjct  110  EISVMIQEVDCDGDGAIRLE  129


 Score = 59.3 bits (142),  Expect(3) = 3e-31, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GD RCTL+DC+RMI  VD +GDGFVCF +F RMM+ Q
Sbjct  175  GDDRCTLDDCKRMIADVDEDGDGFVCFTEFSRMMDLQ  211


 Score = 46.2 bits (108),  Expect(3) = 3e-31, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 33/51 (65%), Gaps = 7/51 (14%)
 Frame = +3

Query  336  LASREFSVLSSAFAPPSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            LASR  S      + PS DS EL++ F+FFD D DG ISAEEL  VF TIG
Sbjct  131  LASRLVS------SDPSRDSAELKETFEFFDADRDGLISAEELLRVFSTIG  175



>ref|XP_003625055.1| hypothetical protein MTR_7g090450 [Medicago truncatula]
 gb|AES81273.1| EF hand calcium-binding family protein [Medicago truncatula]
 gb|AFK35504.1| unknown [Medicago truncatula]
Length=216

 Score = 95.5 bits (236),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 1/86 (1%)
 Frame = +2

Query  95   GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  274
             G  TPTSVLP ++ E S D    +  EL QAF+LIDRD+DG + +EELEA+L+++GA P
Sbjct  47   AGSQTPTSVLPEVSGEWS-DITVDVQCELAQAFRLIDRDNDGVVSREELEAVLTRLGARP  105

Query  275  PSREELRLMLSEVDRDGDGCISLEGV  352
            P+ EE+ LMLSEVD DG GCIS+E +
Sbjct  106  PTPEEIALMLSEVDSDGKGCISVETI  131


 Score = 66.6 bits (161),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GR      L   +  GD RCTLE+C+RMI GVD NGDGFVCF++F  MM+ Q
Sbjct  164  GRISAEELLRVFRAIGDERCTLEECKRMIAGVDKNGDGFVCFQEFSLMMDLQ  215



>gb|AFK42347.1| unknown [Medicago truncatula]
Length=216

 Score = 95.5 bits (236),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 1/86 (1%)
 Frame = +2

Query  95   GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  274
             G  TPTSVLP ++ E S D    +  EL QAF+LIDRD+DG + +EELEA+L+++GA P
Sbjct  47   AGSQTPTSVLPEVSGEWS-DITVDVQCELAQAFRLIDRDNDGVVSREELEAVLTRLGARP  105

Query  275  PSREELRLMLSEVDRDGDGCISLEGV  352
            P+ EE+ LMLSEVD DG GCIS+E +
Sbjct  106  PTPEEIALMLSEVDSDGKGCISVETI  131


 Score = 65.1 bits (157),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GR      L   +  GD RC LE+C+RMI GVD NGDGFVCF++F  MM+ Q
Sbjct  164  GRISAEELLRVFRAIGDERCALEECKRMIAGVDKNGDGFVCFQEFSLMMDLQ  215



>gb|KJB16379.1| hypothetical protein B456_002G227200 [Gossypium raimondii]
Length=223

 Score = 90.1 bits (222),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 59/86 (69%), Gaps = 7/86 (8%)
 Frame = +2

Query  98   GESTPTSVLPALNDEISPDEL---SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  268
            G  TPTSVLP    E S D L   +  Y EL QAFK +D+D+DG I + E+EALLS+   
Sbjct  61   GTGTPTSVLP----ETSVDWLDFSANFYVELCQAFKTMDKDNDGVITRSEVEALLSKFAR  116

Query  269  EPPSREELRLMLSEVDRDGDGCISLE  346
            +PPS+EE+  ML EVD DGDGCISLE
Sbjct  117  QPPSQEEISSMLGEVDGDGDGCISLE  142


 Score = 70.1 bits (170),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 45/77 (58%), Gaps = 5/77 (6%)
 Frame = +1

Query  379  HRLATPSCETPSTSSIRI----TTGRYPRRSCLTCSK-RSGDSRCTLEDCRRMILGVDNN  543
            +++A P+CE     +  I      G+      +   K + GD RCTLEDCR MI  VD N
Sbjct  146  NQVAGPACEPELRETFDIFDTDHDGKITAEELMAFYKEKLGDERCTLEDCRLMIASVDKN  205

Query  544  GDGFVCFEDFCRMMEQQ  594
            GDGFVCF+DF RMME Q
Sbjct  206  GDGFVCFDDFSRMMEMQ  222


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 37/62 (60%), Gaps = 1/62 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLS-QVGAEPPSREELRLMLSEVDRDGDGCISLEGV  352
            EL + F + D D DGKI  EEL A    ++G E  + E+ RLM++ VD++GDG +  +  
Sbjct  156  ELRETFDIFDTDHDGKITAEELMAFYKEKLGDERCTLEDCRLMIASVDKNGDGFVCFDDF  215

Query  353  QR  358
             R
Sbjct  216  SR  217



>ref|XP_004303614.1| PREDICTED: probable calcium-binding protein CML36 [Fragaria vesca 
subsp. vesca]
Length=210

 Score = 88.6 bits (218),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 64/91 (70%), Gaps = 9/91 (10%)
 Frame = +2

Query  86   KKPGG-ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  262
             KPGG  +TPTSVLP    E S         ++ QAF+LIDRD+DG + + ELEALL ++
Sbjct  46   HKPGGPAATPTSVLPGDWSEFSS-------VDMAQAFRLIDRDNDGVVSRTELEALLKRL  98

Query  263  -GAEPPSREELRLMLSEVDRDGDGCISLEGV  352
             GAEPP++EE+ +MLSEVD DGDGCI LE +
Sbjct  99   LGAEPPTQEEVAMMLSEVDGDGDGCIPLEAL  129


 Score = 70.9 bits (172),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 44/80 (55%), Gaps = 9/80 (11%)
 Frame = +1

Query  379  HRLATPSCETPSTSSIRIT--------TGRYPRRSCLTCSKRSGDSRCTLEDCRRMILGV  534
            HR   P CE  + S +R           G+      L+     GD RCTLE+CRRMI  V
Sbjct  131  HRFG-PGCEPAADSELREAFEVFDTDHDGKISAEELLSVFTAIGDERCTLEECRRMIAEV  189

Query  535  DNNGDGFVCFEDFCRMMEQQ  594
            D NGDGFVCF+DF RMM+ Q
Sbjct  190  DKNGDGFVCFQDFARMMDLQ  209


 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGV  352
            +EL +AF++ D D DGKI  EEL ++ + +G E  + EE R M++EVD++GDG +  +  
Sbjct  143  SELREAFEVFDTDHDGKISAEELLSVFTAIGDERCTLEECRRMIAEVDKNGDGFVCFQDF  202

Query  353  QR  358
             R
Sbjct  203  AR  204



>ref|XP_008392376.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-binding protein 
CML36 [Malus domestica]
Length=220

 Score = 90.1 bits (222),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 67/88 (76%), Gaps = 7/88 (8%)
 Frame = +2

Query  95   GGESTPTSVLPALNDEISPDELSGLYAEL--VQAFKLIDRDDDGKIRKEELEALLSQVGA  268
            GG +TPTSVLP    E S D  S   A+L   QAFKLIDRD+DG + ++ELEALLS++G 
Sbjct  57   GGIATPTSVLP----EKSGD-WSDFSADLDMAQAFKLIDRDNDGVVSRKELEALLSRLGN  111

Query  269  EPPSREELRLMLSEVDRDGDGCISLEGV  352
            +PPS+EE+ LMLSEVDRDG+G I+LE +
Sbjct  112  DPPSQEEVTLMLSEVDRDGNGSITLEAL  139


 Score = 65.5 bits (158),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            G+      L      GD RCTLE+CRRMI GVD +GDGFVCFE+F  MME Q
Sbjct  168  GKISAEELLRVFTAIGDERCTLEECRRMIDGVDKDGDGFVCFEEFVHMMELQ  219


 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  381  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            P+ DSELRDAF+  DTD+DGKISAEEL  VF  IG
Sbjct  149  PAADSELRDAFEVXDTDNDGKISAEELLRVFTAIG  183


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = +2

Query  119  VLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRL  298
             L AL +++ P       +EL  AF++ D D+DGKI  EEL  + + +G E  + EE R 
Sbjct  135  TLEALLNQVGPVSGPAADSELRDAFEVXDTDNDGKISAEELLRVFTAIGDERCTLEECRR  194

Query  299  MLSEVDRDGDGCISLE  346
            M+  VD+DGDG +  E
Sbjct  195  MIDGVDKDGDGFVCFE  210



>ref|XP_008376081.1| PREDICTED: probable calcium-binding protein CML36 [Malus domestica]
Length=281

 Score = 89.4 bits (220),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 64/87 (74%), Gaps = 3/87 (3%)
 Frame = +2

Query  95   GGESTPTSVLPALNDEISPDELSG-LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAE  271
            GG +TPTSVL   + + S  E S  L  ++ +AFKLIDRD+DG + ++ELEALL Q+G  
Sbjct  116  GGVTTPTSVLAERSGDWS--EFSADLQLDMAKAFKLIDRDNDGVVSRKELEALLCQLGNN  173

Query  272  PPSREELRLMLSEVDRDGDGCISLEGV  352
            PPS+EE+ LMLSEVDRDG G I+LE +
Sbjct  174  PPSQEEVTLMLSEVDRDGSGSITLEAL  200


 Score = 66.2 bits (160),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            G+      L      GD RCTLE+CRRMI  VD NGDGFVCFE+F  MME Q
Sbjct  229  GKISAEELLRVFTAIGDERCTLEECRRMIAEVDKNGDGFVCFEEFVHMMELQ  280


 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  381  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            P  DSELRDAF+ FDTD+DGKISAEEL  VF  IG
Sbjct  210  PPADSELRDAFEVFDTDNDGKISAEELLRVFTAIG  244


 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            +EL  AF++ D D+DGKI  EEL  + + +G E  + EE R M++EVD++GDG +  E
Sbjct  214  SELRDAFEVFDTDNDGKISAEELLRVFTAIGDERCTLEECRRMIAEVDKNGDGFVCFE  271



>ref|XP_010486615.1| PREDICTED: probable calcium-binding protein CML36 [Camelina sativa]
Length=218

 Score = 74.3 bits (181),  Expect(3) = 3e-29, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 60/85 (71%), Gaps = 3/85 (4%)
 Frame = +2

Query  95   GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  274
            GG  TPTS+LP ++   SP   S  Y E++QAFKLIDRD+DG I + +LE+LL+++G +P
Sbjct  51   GGSVTPTSILPEVSCNPSPPPYS--YVEILQAFKLIDRDNDGAISRHDLESLLTRLGPDP  108

Query  275  PSREELRLMLSEVDRDG-DGCISLE  346
             + +E+ +M+ EV  +G DG I LE
Sbjct  109  LTEDEINVMIKEVGCEGDDGTIRLE  133


 Score = 56.6 bits (135),  Expect(3) = 3e-29, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            GD RCTL+DC+RMI  VD +GDGFVCF +F RMM
Sbjct  180  GDERCTLDDCKRMIADVDEDGDGFVCFTEFSRMM  213


 Score = 45.1 bits (105),  Expect(3) = 3e-29, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 1/36 (3%)
 Frame = +3

Query  381  PSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            PS DS E+++ F+FFD D DG ISAEEL  VF TIG
Sbjct  145  PSRDSAEMKETFEFFDADRDGLISAEELLRVFSTIG  180



>ref|XP_009341958.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-binding protein 
CML36, partial [Pyrus x bretschneideri]
Length=291

 Score = 88.6 bits (218),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 66/86 (77%), Gaps = 3/86 (3%)
 Frame = +2

Query  95   GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  274
            GG +TPTSVLP  + + S D  + L  ++ QAFKLIDRD+DG + ++ELEALL ++G  P
Sbjct  128  GGITTPTSVLPEKSGDWS-DFSADL--DMAQAFKLIDRDNDGVVSRKELEALLCRLGNAP  184

Query  275  PSREELRLMLSEVDRDGDGCISLEGV  352
            PS+EE+ LMLSEVDRDG+G I+LE +
Sbjct  185  PSQEEVTLMLSEVDRDGNGSITLEAL  210


 Score = 65.9 bits (159),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            G+      L      GD RCTLE+CRRMI GVD +GDGFVCFE+F  MME Q
Sbjct  239  GKISAEELLRVFTAIGDERCTLEECRRMIDGVDKDGDGFVCFEEFVHMMELQ  290


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  381  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            P+ DSELRDAF+ FDTD+DGKISAEEL  VF  IG
Sbjct  220  PAADSELRDAFEVFDTDNDGKISAEELLRVFTAIG  254


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = +2

Query  119  VLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRL  298
             L AL +++ P       +EL  AF++ D D+DGKI  EEL  + + +G E  + EE R 
Sbjct  206  TLEALLNQVGPVSGPAADSELRDAFEVFDTDNDGKISAEELLRVFTAIGDERCTLEECRR  265

Query  299  MLSEVDRDGDGCISLE  346
            M+  VD+DGDG +  E
Sbjct  266  MIDGVDKDGDGFVCFE  281



>ref|XP_010481256.1| PREDICTED: probable calcium-binding protein CML36 [Camelina sativa]
Length=220

 Score = 71.2 bits (173),  Expect(3) = 1e-28, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 59/86 (69%), Gaps = 3/86 (3%)
 Frame = +2

Query  95   GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  274
            GG  TPTS+LP ++ + SP      Y E++QAFKLIDRD+DG I + +LE+LLS++G +P
Sbjct  51   GGSVTPTSILPEVSCDTSPPPPYS-YVEILQAFKLIDRDNDGAISRHDLESLLSRLGPDP  109

Query  275  PSREELRLMLSEV--DRDGDGCISLE  346
             + +E+ +M+ EV  +   DG I LE
Sbjct  110  LTEDEINVMIKEVGCEEGDDGTIRLE  135


 Score = 57.0 bits (136),  Expect(3) = 1e-28, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            GD RCTL+DC+RMI  VD +GDGFVCF +F RMM
Sbjct  182  GDERCTLDDCKRMIADVDEDGDGFVCFTEFSRMM  215


 Score = 45.8 bits (107),  Expect(3) = 1e-28, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 1/36 (3%)
 Frame = +3

Query  381  PSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            PS DS EL++ F+FFD D DG ISAEEL  VF TIG
Sbjct  147  PSRDSAELKETFEFFDADRDGLISAEELLRVFSTIG  182



>ref|XP_010464685.1| PREDICTED: probable calcium-binding protein CML36 [Camelina sativa]
Length=221

 Score = 72.0 bits (175),  Expect(3) = 1e-28, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 59/86 (69%), Gaps = 4/86 (5%)
 Frame = +2

Query  95   GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  274
            GG  TPTS+LP ++   SP   S  Y E++QAFKLIDRD+DG I + +LE+LL+++G +P
Sbjct  53   GGSVTPTSILPEVSCNPSPPPYS--YVEILQAFKLIDRDNDGAISRHDLESLLTRLGPDP  110

Query  275  PSREELRLMLSEV--DRDGDGCISLE  346
             + +E+ +M+ EV  +   DG I LE
Sbjct  111  LTEDEINVMIKEVGCEEGDDGTIRLE  136


 Score = 56.6 bits (135),  Expect(3) = 1e-28, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            GD RCTL+DC+RMI  VD +GDGFVCF +F RMM
Sbjct  183  GDERCTLDDCKRMIADVDEDGDGFVCFTEFSRMM  216


 Score = 45.1 bits (105),  Expect(3) = 1e-28, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 1/36 (3%)
 Frame = +3

Query  381  PSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            PS DS E+++ F+FFD D DG ISAEEL  VF TIG
Sbjct  148  PSRDSAEMKETFEFFDADRDGLISAEELLRVFSTIG  183



>ref|XP_006364430.1| PREDICTED: probable calcium-binding protein CML35-like [Solanum 
tuberosum]
Length=216

 Score = 83.2 bits (204),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 71/89 (80%), Gaps = 7/89 (8%)
 Frame = +2

Query  107  TPTSVLPALNDEISPDELS-----GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAE  271
            TPTSVLP L++EIS D+ S     G+Y++LVQAF +ID + DGKIRKE+LEA+LS+VG +
Sbjct  44   TPTSVLPTLSNEISADDWSEISTAGVYSDLVQAFSVID-NGDGKIRKEQLEAILSRVGGK  102

Query  272  -PPSREELRLMLSEVDRDGDGCISLEGVQ  355
             PP+ EEL L+L E+D++GDGCISLE  +
Sbjct  103  SPPTEEELVLLLDELDKNGDGCISLENFE  131


 Score = 70.1 bits (170),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            G+          +  GD RCTLE+C+RMI  VD NGDGFVCFEDFC MMEQQ
Sbjct  164  GKITGEELFNVFRMIGDERCTLEECKRMITSVDKNGDGFVCFEDFCLMMEQQ  215


 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 41/61 (67%), Gaps = 7/61 (11%)
 Frame = +3

Query  318  GTATVALASREFSVLSSAF--APPSCD---SELRDAFDFFDTDHDGKISAEELFNVFKTI  482
            G   ++L +  F  ++SAF   PPS      E+RDAFDFFD DHDGKI+ EELFNVF+ I
Sbjct  121  GDGCISLEN--FETITSAFEPTPPSAAEDAGEMRDAFDFFDEDHDGKITGEELFNVFRMI  178

Query  483  G  485
            G
Sbjct  179  G  179


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
             E+  AF   D D DGKI  EEL  +   +G E  + EE + M++ VD++GDG +  E
Sbjct  149  GEMRDAFDFFDEDHDGKITGEELFNVFRMIGDERCTLEECKRMITSVDKNGDGFVCFE  206



>ref|XP_004493430.1| PREDICTED: probable calcium-binding protein CML36-like [Cicer 
arietinum]
Length=214

 Score = 81.3 bits (199),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 61/86 (71%), Gaps = 4/86 (5%)
 Frame = +2

Query  95   GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  274
            GG  TPTSVLP ++ + S D    +  EL QAF+LIDRD+DG + +EELE +L+++GA  
Sbjct  52   GGSQTPTSVLPEISGDWS-DVTVDVQWELSQAFRLIDRDNDGVVSREELELVLTRLGARA  110

Query  275  PSREELRLMLSEVDRDGDGCISLEGV  352
               EE+ +ML+EVD DG GCIS+E +
Sbjct  111  ---EEIAIMLTEVDGDGRGCISVEAI  133


 Score = 70.1 bits (170),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GR      L   K  GD RCTLE+CRRMI GVD N DGFVCFEDF RMME Q
Sbjct  162  GRISAEELLRVFKAIGDERCTLEECRRMIEGVDKNRDGFVCFEDFSRMMELQ  213


 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  381  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            P+ + ELR+AF+ FDTD DG+ISAEEL  VFK IG
Sbjct  143  PNPEEELREAFEVFDTDRDGRISAEELLRVFKAIG  177



>ref|NP_001265939.1| Hop-interacting protein THI026 [Solanum lycopersicum]
 gb|AEW69790.1| Hop-interacting protein THI026 [Solanum lycopersicum]
Length=214

 Score = 82.8 bits (203),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 71/90 (79%), Gaps = 7/90 (8%)
 Frame = +2

Query  104  STPTSVLPALNDEISPDELS-----GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  268
            STPTSVLP L++EIS DE S     G+Y++LV+AF +ID + DGKI+KE+LEA+LS+VG 
Sbjct  41   STPTSVLPTLSNEISADEWSDISTAGVYSDLVRAFSVID-NGDGKIKKEKLEAILSRVGG  99

Query  269  E-PPSREELRLMLSEVDRDGDGCISLEGVQ  355
            + PPS EEL L+L E+D +GDGCISLE  +
Sbjct  100  KSPPSEEELVLLLDELDENGDGCISLENFE  129


 Score = 68.6 bits (166),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            G+          +  GD RCTLE+C+RMI  VD NGDGFVCF+DFC MMEQQ
Sbjct  162  GKITGEELFNVFRMIGDERCTLEECKRMITSVDKNGDGFVCFDDFCLMMEQQ  213


 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 37/56 (66%), Gaps = 5/56 (9%)
 Frame = +3

Query  333  ALASREFSVLSSAF--APPSCDS---ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
             ++   F  ++SAF   P S      E+RDAFDFFD DHDGKI+ EELFNVF+ IG
Sbjct  122  CISLENFETITSAFESTPTSAAGDAGEMRDAFDFFDEDHDGKITGEELFNVFRMIG  177


 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 0/69 (0%)
 Frame = +2

Query  140  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDR  319
            E +P   +G   E+  AF   D D DGKI  EEL  +   +G E  + EE + M++ VD+
Sbjct  136  ESTPTSAAGDAGEMRDAFDFFDEDHDGKITGEELFNVFRMIGDERCTLEECKRMITSVDK  195

Query  320  DGDGCISLE  346
            +GDG +  +
Sbjct  196  NGDGFVCFD  204



>ref|XP_007028573.1| Calcium-binding EF-hand family protein, putative [Theobroma cacao]
 gb|EOY09075.1| Calcium-binding EF-hand family protein, putative [Theobroma cacao]
Length=180

 Score = 79.3 bits (194),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGV  352
            +EL QAFK+ID+D+DG I + ELEALLS+V  +PPSREE+ LMLSEV  DG GCISL+ +
Sbjct  35   SELCQAFKIIDKDNDGVITRSELEALLSKVARQPPSREEVSLMLSEVYGDGVGCISLDTL  94

Query  353  Q  355
             
Sbjct  95   M  95


 Score = 70.5 bits (171),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 47/81 (58%), Gaps = 10/81 (12%)
 Frame = +1

Query  382  RLATPSCETPS-TSSIRIT--------TGRYPRRSCLTCSKRS-GDSRCTLEDCRRMILG  531
            ++  P+C+ P+    +R T         G+      +   K + GD RCTLEDCRRMI  
Sbjct  97   QVVVPACDEPACEPELRETFDIFDTDHDGKITAEELMAFFKETIGDERCTLEDCRRMIAS  156

Query  532  VDNNGDGFVCFEDFCRMMEQQ  594
            VD NGDGFVCFEDF RMME Q
Sbjct  157  VDKNGDGFVCFEDFARMMELQ  177


 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  318  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFK-TIG  485
            G   ++L +    V+  A   P+C+ ELR+ FD FDTDHDGKI+AEEL   FK TIG
Sbjct  85   GVGCISLDTLMTQVVVPACDEPACEPELRETFDIFDTDHDGKITAEELMAFFKETIG  141


 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 1/62 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQ-VGAEPPSREELRLMLSEVDRDGDGCISLEGV  352
            EL + F + D D DGKI  EEL A   + +G E  + E+ R M++ VD++GDG +  E  
Sbjct  111  ELRETFDIFDTDHDGKITAEELMAFFKETIGDERCTLEDCRRMIASVDKNGDGFVCFEDF  170

Query  353  QR  358
             R
Sbjct  171  AR  172



>ref|XP_010554792.1| PREDICTED: probable calcium-binding protein CML35 [Tarenaya hassleriana]
Length=218

 Score = 91.7 bits (226),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 63/93 (68%), Gaps = 14/93 (15%)
 Frame = +2

Query  80   GYKKPGGESTPTSVLPALNDEISPDELSG----LYAELVQAFKLIDRDDDGKIRKEELEA  247
            G +KP   STPTSV+P         E+SG     Y ELVQAFKLIDRDDDG + + EL A
Sbjct  50   GDRKPSPASTPTSVIP---------EISGGDRDFYTELVQAFKLIDRDDDGVVSRNELAA  100

Query  248  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            +L ++  EPPS EE+R+ML EVD  GDGCISLE
Sbjct  101  VLRRLSPEPPSEEEVRMMLREVD-GGDGCISLE  132


 Score = 55.8 bits (133),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  588
            GR      L      GD RCTL++CRRMI  VD  GDGFV F+DF RMME
Sbjct  166  GRISAEELLRVFGVIGDDRCTLDECRRMIATVDMKGDGFVRFDDFSRMME  215



>emb|CDY00910.1| BnaC05g42900D [Brassica napus]
Length=218

 Score = 87.0 bits (214),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 61/84 (73%), Gaps = 4/84 (5%)
 Frame = +2

Query  95   GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  274
            GG  TPTS+LP ++   SP      Y E++QAFKLIDRD+DG + + +LE+LL+++G +P
Sbjct  50   GGSVTPTSILPEVSAVHSPYS----YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDP  105

Query  275  PSREELRLMLSEVDRDGDGCISLE  346
            P+ EE+ +ML EVD DGDG I LE
Sbjct  106  PTEEEIDVMLKEVDCDGDGTIRLE  129


 Score = 58.5 bits (140),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            G+      L      GD RCTLE+C RMI  VD++G+GFVCF +F RMM+ Q
Sbjct  166  GKISAEELLRVFSAIGDERCTLEECERMIAAVDDDGNGFVCFAEFSRMMDLQ  217



>ref|XP_008373033.1| PREDICTED: probable calcium-binding protein CML36 [Malus domestica]
Length=223

 Score = 82.4 bits (202),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 59/80 (74%), Gaps = 3/80 (4%)
 Frame = +2

Query  116  SVLPALNDEISPDELSG-LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREEL  292
            SVLP  + E S  E S  L  ++ QAFK IDRD+DG + ++ELEALL ++G +P SREE+
Sbjct  65   SVLPERSGEWS--EFSADLQLDMAQAFKXIDRDNDGVVSRKELEALLCRLGNDPQSREEV  122

Query  293  RLMLSEVDRDGDGCISLEGV  352
             LMLSEVDRDG+G ISLE V
Sbjct  123  TLMLSEVDRDGNGSISLEAV  142


 Score = 63.2 bits (152),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            G+      L+  +  GD  CTLE+C RMI G D NGDGFVCFE+F  MME+Q
Sbjct  171  GKISAEELLSFFRAIGDEGCTLEECGRMIAGADKNGDGFVCFEEFAHMMERQ  222


 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  381  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            P+ DSELRDAF+ FDTD+DGKISAEEL + F+ IG
Sbjct  152  PAADSELRDAFEVFDTDNDGKISAEELLSFFRAIG  186



>gb|AGV22098.1| calmodulin-like protein [Brassica juncea]
Length=208

 Score = 86.3 bits (212),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 61/84 (73%), Gaps = 4/84 (5%)
 Frame = +2

Query  95   GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  274
            GG  TPTS+LP ++   SP      Y E++QAFKLIDRD+DG + + +LE+LL+++G +P
Sbjct  45   GGSVTPTSILPEVSAVHSPYS----YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDP  100

Query  275  PSREELRLMLSEVDRDGDGCISLE  346
            P+ EE+ +ML EVD DGDG + LE
Sbjct  101  PTEEEIDVMLREVDCDGDGTVRLE  124


 Score = 58.2 bits (139),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            G+      L      GD RCTLE+C RMI  VD++G+GFVCF +F RMM+ Q
Sbjct  156  GKISAEELLRVFSAIGDERCTLEECERMIAAVDDDGNGFVCFTEFSRMMDLQ  207



>ref|XP_006288691.1| hypothetical protein CARUB_v10002001mg [Capsella rubella]
 gb|EOA21589.1| hypothetical protein CARUB_v10002001mg [Capsella rubella]
Length=199

 Score = 73.2 bits (178),  Expect(3) = 9e-26, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  170  YAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEG  349
            + EL++AF LID+D+DG + + +LEALL+Q+G  PP+++E+ +ML EVDRDG G IS++ 
Sbjct  54   HLELLKAFTLIDKDNDGAVSRHDLEALLTQLGPNPPNKDEINVMLREVDRDGHGTISIDT  113

Query  350  V  352
            +
Sbjct  114  L  114


 Score = 54.7 bits (130),  Expect(3) = 9e-26, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  588
            GD RCTLE+C RMI  VD +GDGFV F +F RMM+
Sbjct  163  GDDRCTLEECSRMIAAVDEDGDGFVSFNEFSRMMD  197


 Score = 36.2 bits (82),  Expect(3) = 9e-26, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  393  SELRDAFDFFDTDHDGKISAEELFNVF  473
            +EL++ F+ FD+D +G ISAEEL  VF
Sbjct  132  TELKETFELFDSDRNGLISAEELLRVF  158



>ref|XP_006421261.1| hypothetical protein CICLE_v10005842mg [Citrus clementina]
 gb|ESR34501.1| hypothetical protein CICLE_v10005842mg [Citrus clementina]
 gb|KDO37861.1| hypothetical protein CISIN_1g027592mg [Citrus sinensis]
Length=221

 Score = 80.9 bits (198),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 63/85 (74%), Gaps = 3/85 (4%)
 Frame = +2

Query  107  TPTSVLPALN---DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP  277
            TPTSVL  ++    ++S D    +  ELVQA KL+DRD+DG + + ELEALL ++GA+PP
Sbjct  55   TPTSVLHEISGDWSDMSADISLDMNYELVQACKLLDRDNDGVVLRSELEALLIRLGADPP  114

Query  278  SREELRLMLSEVDRDGDGCISLEGV  352
            ++EE++ MLSEVDR+GDG I LE +
Sbjct  115  TQEEVKSMLSEVDREGDGYIPLEAL  139


 Score = 62.8 bits (151),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            G+           + GD  CTL+DCR MI  VD NGDGFVCFEDF RMME Q
Sbjct  169  GKITAEELFGVFTKLGDELCTLDDCRGMIALVDKNGDGFVCFEDFSRMMELQ  220


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +3

Query  351  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
             S + ++   P+C+ EL++ FDFFD DHDGKI+AEELF VF  +G
Sbjct  140  ISRVGNSSCEPACEPELKETFDFFDADHDGKITAEELFGVFTKLG  184



>gb|KDO37862.1| hypothetical protein CISIN_1g027592mg [Citrus sinensis]
Length=208

 Score = 80.9 bits (198),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 63/85 (74%), Gaps = 3/85 (4%)
 Frame = +2

Query  107  TPTSVLPALN---DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP  277
            TPTSVL  ++    ++S D    +  ELVQA KL+DRD+DG + + ELEALL ++GA+PP
Sbjct  55   TPTSVLHEISGDWSDMSADISLDMNYELVQACKLLDRDNDGVVLRSELEALLIRLGADPP  114

Query  278  SREELRLMLSEVDRDGDGCISLEGV  352
            ++EE++ MLSEVDR+GDG I LE +
Sbjct  115  TQEEVKSMLSEVDREGDGYIPLEAL  139


 Score = 62.4 bits (150),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            G+           + GD  CTL+DCR MI  VD NGDGFVCFEDF RMME Q
Sbjct  156  GKITAEELFGVFTKLGDELCTLDDCRGMIALVDKNGDGFVCFEDFSRMMELQ  207


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 38/67 (57%), Gaps = 0/67 (0%)
 Frame = +2

Query  158  LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  337
            L  L + L + F   D D DGKI  EEL  + +++G E  + ++ R M++ VD++GDG +
Sbjct  136  LEALISRLKETFDFFDADHDGKITAEELFGVFTKLGDELCTLDDCRGMIALVDKNGDGFV  195

Query  338  SLEGVQR  358
              E   R
Sbjct  196  CFEDFSR  202



>emb|CDY60169.1| BnaAnng16630D [Brassica napus]
Length=208

 Score = 85.1 bits (209),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 61/84 (73%), Gaps = 4/84 (5%)
 Frame = +2

Query  95   GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  274
            GG  TPTS+LP ++   SP      Y E++QAFKLIDRD+DG + + +LE+LL+++G +P
Sbjct  45   GGSVTPTSILPEVSAVHSPYS----YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDP  100

Query  275  PSREELRLMLSEVDRDGDGCISLE  346
            P+ EE+ +ML EV+ DGDG + LE
Sbjct  101  PTEEEIDVMLKEVNCDGDGTVRLE  124


 Score = 58.2 bits (139),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            G+      L      GD RCTLE+C RMI  VD++G+GFVCF +F RMM+ Q
Sbjct  156  GKISAEELLRVFSAIGDERCTLEECERMIAAVDDDGNGFVCFTEFSRMMDLQ  207



>ref|XP_006491566.1| PREDICTED: probable calcium-binding protein CML36-like [Citrus 
sinensis]
Length=221

 Score = 80.1 bits (196),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 62/85 (73%), Gaps = 3/85 (4%)
 Frame = +2

Query  107  TPTSVLPALN---DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP  277
            TPTSVL  ++    ++S D    L  ELVQA KL+DRD+DG + + ELEALL ++GA+PP
Sbjct  55   TPTSVLHEISGDWSDMSADISLDLNYELVQACKLLDRDNDGVVLRSELEALLIRLGADPP  114

Query  278  SREELRLMLSEVDRDGDGCISLEGV  352
            ++EE+  MLSEVDR+GDG I LE +
Sbjct  115  TQEEVSSMLSEVDREGDGYIPLEAL  139


 Score = 62.8 bits (151),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            G+           + GD  CTL+DCR MI  VD NGDGFVCFEDF RMME Q
Sbjct  169  GKITAEELFGVFTKLGDELCTLDDCRGMIALVDKNGDGFVCFEDFSRMMELQ  220


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +3

Query  351  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
             S + ++   P+C+ EL++ FDFFD DHDGKI+AEELF VF  +G
Sbjct  140  ISRVGNSSCEPACEPELKETFDFFDADHDGKITAEELFGVFTKLG  184



>ref|XP_009146864.1| PREDICTED: probable calcium-binding protein CML36 [Brassica rapa]
Length=245

 Score = 83.6 bits (205),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 60/84 (71%), Gaps = 4/84 (5%)
 Frame = +2

Query  95   GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  274
            GG  TPTS+LP ++   SP      Y E++QAFKLIDRD+DG + + +LE+LL+++G +P
Sbjct  82   GGSVTPTSILPEVSAVHSPYS----YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDP  137

Query  275  PSREELRLMLSEVDRDGDGCISLE  346
             + EE+ +ML EVD DGDG + LE
Sbjct  138  LTEEEIDVMLKEVDCDGDGTVRLE  161


 Score = 58.9 bits (141),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            G+      L      GD RCTLE+C RMI  VD++G+GFVCF +F RMM+ Q
Sbjct  193  GKISAEELLRVFSAIGDERCTLEECERMIAAVDDDGNGFVCFTEFSRMMDLQ  244



>ref|XP_010931583.1| PREDICTED: probable calcium-binding protein CML36 [Elaeis guineensis]
Length=215

 Score = 65.5 bits (158),  Expect(3) = 3e-25, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GD RCTLEDCRRMI  VD++GDGFVCFEDF RMM+ Q
Sbjct  178  GDKRCTLEDCRRMIGVVDSDGDGFVCFEDFVRMMDGQ  214


 Score = 49.7 bits (117),  Expect(3) = 3e-25, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  203  DRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            +++ DG+I + ELE +L ++G +PP+ EE+  ML+E DR GDG I LE
Sbjct  86   EKEGDGRITRRELEVVLRRLGPDPPTEEEVVAMLAEADRAGDGSIRLE  133


 Score = 47.0 bits (110),  Expect(3) = 3e-25, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 28/46 (61%), Gaps = 1/46 (2%)
 Frame = +3

Query  348  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            E   L SAF PP    ELR+ F  FD D DG ISAEEL  +F T+G
Sbjct  134  EIVALGSAFGPPVV-PELRETFAVFDGDGDGMISAEELLAMFVTLG  178



>gb|KDO37863.1| hypothetical protein CISIN_1g027592mg [Citrus sinensis]
Length=212

 Score = 77.4 bits (189),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 59/78 (76%), Gaps = 3/78 (4%)
 Frame = +2

Query  107  TPTSVLPALN---DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP  277
            TPTSVL  ++    ++S D    +  ELVQA KL+DRD+DG + + ELEALL ++GA+PP
Sbjct  55   TPTSVLHEISGDWSDMSADISLDMNYELVQACKLLDRDNDGVVLRSELEALLIRLGADPP  114

Query  278  SREELRLMLSEVDRDGDG  331
            ++EE++ MLSEVDR+GDG
Sbjct  115  TQEEVKSMLSEVDREGDG  132


 Score = 62.4 bits (150),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 40/79 (51%), Gaps = 8/79 (10%)
 Frame = +1

Query  382  RLATPSCETPSTSSIRIT--------TGRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVD  537
            R+   SCE      ++ T         G+           + GD  CTL+DCR MI  VD
Sbjct  133  RVGNSSCEPACEPELKETFDFFDADHDGKITAEELFGVFTKLGDELCTLDDCRGMIALVD  192

Query  538  NNGDGFVCFEDFCRMMEQQ  594
             NGDGFVCFEDF RMME Q
Sbjct  193  KNGDGFVCFEDFSRMMELQ  211


 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  381  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            P+C+ EL++ FDFFD DHDGKI+AEELF VF  +G
Sbjct  141  PACEPELKETFDFFDADHDGKITAEELFGVFTKLG  175



>ref|XP_003554140.1| PREDICTED: probable calcium-binding protein CML36-like [Glycine 
max]
Length=218

 Score = 72.8 bits (177),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQXR  600
            GR      L   K  GD RCTLE+CRRMI GVD NGDGFVCFEDF RMME Q +
Sbjct  164  GRISAEELLRVFKAIGDERCTLEECRRMIEGVDRNGDGFVCFEDFSRMMELQQQ  217


 Score = 67.0 bits (162),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +2

Query  80   GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  259
             +K   G  TPTSVLP ++ + S      +  +L QAF+LIDRD+DG + +++LEALL+ 
Sbjct  48   NHKPSAGNQTPTSVLPGVSGDWSDVAAVDVRWDLAQAFRLIDRDNDGVVTRQDLEALLTC  107

Query  260  VGAEPPSREELRLMLSEVDRDG  325
            +GA  P  +++ +ML EVD DG
Sbjct  108  LGAS-PCPDDVAVMLGEVDGDG  128


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  REFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            R  S + S   P S   EL++AF+ FDTD DG+ISAEEL  VFK IG
Sbjct  133  RLMSYVGSGLKPGSDPDELKEAFEVFDTDRDGRISAEELLRVFKAIG  179


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGVQ  355
            EL +AF++ D D DG+I  EEL  +   +G E  + EE R M+  VDR+GDG +  E   
Sbjct  150  ELKEAFEVFDTDRDGRISAEELLRVFKAIGDERCTLEECRRMIEGVDRNGDGFVCFEDFS  209

Query  356  R  358
            R
Sbjct  210  R  210



>ref|XP_002276334.1| PREDICTED: probable calcium-binding protein CML35 [Vitis vinifera]
Length=222

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 63/82 (77%), Gaps = 3/82 (4%)
 Frame = +2

Query  110  PTSVLPALNDEIS---PDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  280
            PTSVLP  + EIS    D  S +  ELV AFK+IDRD DGKI K ELEALLS+VG EPPS
Sbjct  59   PTSVLPMHSYEISGDWSDFSSDIQTELVHAFKMIDRDGDGKITKRELEALLSRVGVEPPS  118

Query  281  REELRLMLSEVDRDGDGCISLE  346
             EE+ +MLSEVDRDGDGCISLE
Sbjct  119  EEEIMMMLSEVDRDGDGCISLE  140


 Score = 72.8 bits (177),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GD RCTLEDC+RMI GVD NGDGFVCFEDF RMMEQQ
Sbjct  185  GDDRCTLEDCQRMIAGVDKNGDGFVCFEDFSRMMEQQ  221


 Score = 63.5 bits (153),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 40/56 (71%), Gaps = 3/56 (5%)
 Frame = +3

Query  318  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            G   ++L   EF  +SSAF P +CD+ELRDAF FFDTD DGKI+AEEL  VF  IG
Sbjct  133  GDGCISL--EEFGAISSAFGP-ACDTELRDAFCFFDTDRDGKITAEELNQVFAAIG  185



>ref|XP_007162132.1| hypothetical protein PHAVU_001G126700g [Phaseolus vulgaris]
 gb|ESW34126.1| hypothetical protein PHAVU_001G126700g [Phaseolus vulgaris]
Length=215

 Score = 70.5 bits (171),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  588
            GR      L   +  GD RCTLE+CRRMI GVD NGDGFVCFEDF RMME
Sbjct  163  GRISAEELLRVFRAIGDERCTLEECRRMIEGVDRNGDGFVCFEDFSRMME  212


 Score = 67.0 bits (162),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 58/87 (67%), Gaps = 6/87 (7%)
 Frame = +2

Query  95   GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  274
             G  TPTSVLP ++ + S D    +  +L QAF+LIDRD+DG + +++LEA+L+++GA  
Sbjct  54   AGSLTPTSVLPGVSGDWS-DVTVDVRWDLAQAFRLIDRDNDGVVSRQDLEAVLTRLGA--  110

Query  275  PSREELRLMLSEVDRDGDGCISLEGVQ  355
                ++ LMLSEV+    GCI++E + 
Sbjct  111  ---SDVALMLSEVEGGAGGCITVEALM  134


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGVQ  355
            EL +AF + D D DG+I  EEL  +   +G E  + EE R M+  VDR+GDG +  E   
Sbjct  149  ELKEAFAVFDTDRDGRISAEELLRVFRAIGDERCTLEECRRMIEGVDRNGDGFVCFEDFS  208

Query  356  R  358
            R
Sbjct  209  R  209



>ref|XP_008789596.1| PREDICTED: probable calcium-binding protein CML36 [Phoenix dactylifera]
Length=209

 Score = 60.8 bits (146),  Expect(3) = 2e-23, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GD RCTLEDCRRMI  VD++ DGFVCFEDF RMM  Q
Sbjct  172  GDERCTLEDCRRMIGVVDSDCDGFVCFEDFVRMMHGQ  208


 Score = 50.1 bits (118),  Expect(3) = 2e-23, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 30/47 (64%), Gaps = 1/47 (2%)
 Frame = +3

Query  345  REFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            +E   L SAF PP    ELR+ F  FD D DGKISAEEL  +F T+G
Sbjct  127  QEIVALGSAFGPPVA-PELRETFAVFDVDGDGKISAEELLAMFVTLG  172


 Score = 45.1 bits (105),  Expect(3) = 2e-23, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  203  DRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGV  352
            +R+ + ++ + ELE +L ++G +PP+ EE+  ML+E DR GDG I L+ +
Sbjct  80   EREGEERVTRRELEVVLQRLGPDPPTEEEVAAMLAEADRGGDGSIRLQEI  129



>ref|XP_002323262.1| Calmodulin-like family protein [Populus trichocarpa]
 gb|EEF05023.1| Calmodulin-like family protein [Populus trichocarpa]
Length=216

 Score = 81.3 bits (199),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +2

Query  95   GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  274
             G  TPTSVLP ++ + S D  +  Y EL QAFK+IDRD+DG + + ELEALL+++GAEP
Sbjct  56   AGFRTPTSVLPQISGDWS-DMSTDFYFELTQAFKVIDRDNDGLVSRNELEALLTRLGAEP  114

Query  275  PSREELRLMLSEVD  316
            PS +E+ +ML EVD
Sbjct  115  PSSQEMAVMLGEVD  128


 Score = 53.1 bits (126),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 5/50 (10%)
 Frame = +3

Query  336  LASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            LASR    L SA  P   D ELRDAF FFD+D DGKI+AEEL NV+K  G
Sbjct  135  LASR----LGSACEPAGGD-ELRDAFVFFDSDRDGKITAEELLNVYKAFG  179


 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            G+      L   K  GD +CTLEDC+ MI  VD NGDGFVCFEDFCRMME Q
Sbjct  164  GKITAEELLNVYKAFGDEKCTLEDCKGMIAVVDKNGDGFVCFEDFCRMMELQ  215



>ref|XP_011033138.1| PREDICTED: probable calcium-binding protein CML36 [Populus euphratica]
Length=216

 Score = 79.7 bits (195),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +2

Query  95   GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  274
             G  TPTSVLP ++ + S D  +  Y EL QAFK+IDRD+DG + + ELEALL+++GAEP
Sbjct  56   AGFRTPTSVLPQISGDWS-DMSTDFYFELTQAFKVIDRDNDGLVSRNELEALLTRLGAEP  114

Query  275  PSREELRLMLSEVDR  319
            PS EE+ +ML E D 
Sbjct  115  PSSEEMAVMLGERDH  129


 Score = 54.3 bits (129),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 36/51 (71%), Gaps = 5/51 (10%)
 Frame = +3

Query  333  ALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            ALASR    L SA   P+ D ELRDAF FFD+D DG+I+AEEL NV+K  G
Sbjct  134  ALASR----LGSA-CEPAGDDELRDAFVFFDSDRDGRITAEELLNVYKAFG  179


 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GR      L   K  GD +CTLEDC  MI  VD NGDGFVCFEDFCRMME Q
Sbjct  164  GRITAEELLNVYKAFGDEKCTLEDCAGMIAVVDKNGDGFVCFEDFCRMMELQ  215



>ref|XP_003521150.1| PREDICTED: probable calcium-binding protein CML36-like [Glycine 
max]
Length=219

 Score = 72.0 bits (175),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GR      L   K  GD RCTLE+CRRMI GVD NGDGFVCFEDF RMM+ Q
Sbjct  167  GRISAEELLRVFKAIGDERCTLEECRRMIEGVDRNGDGFVCFEDFSRMMDLQ  218


 Score = 61.2 bits (147),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = +2

Query  80   GYKKPGGESTPTSVLPALNDEISPDELSGL--YAELVQAFKLIDRDDDGKIRKEELEALL  253
             +K   G  TPTSVLP ++ E S    + +    +L QA +LIDRD+DG + +++LE+LL
Sbjct  49   NHKPSPGNQTPTSVLPDVSGEWSEVAAAAVDVRWDLAQALRLIDRDNDGVVTRQDLESLL  108

Query  254  SQVGAEPPSREELRLMLSEVDRDG  325
            +++GA  PS  ++ LML EVD DG
Sbjct  109  TRLGAS-PSPGDVALMLGEVDGDG  131


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGVQ  355
            EL +AF++ D D DG+I  EEL  +   +G E  + EE R M+  VDR+GDG +  E   
Sbjct  153  ELKEAFEVFDTDRDGRISAEELLRVFKAIGDERCTLEECRRMIEGVDRNGDGFVCFEDFS  212

Query  356  R  358
            R
Sbjct  213  R  213


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +3

Query  351  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
             S + S     S   EL++AF+ FDTD DG+ISAEEL  VFK IG
Sbjct  138  MSYVGSGLETGSDPDELKEAFEVFDTDRDGRISAEELLRVFKAIG  182



>ref|XP_002308908.1| Calmodulin-like family protein [Populus trichocarpa]
 gb|ABK96152.1| unknown [Populus trichocarpa]
 gb|EEE92431.1| Calmodulin-like family protein [Populus trichocarpa]
Length=213

 Score = 80.1 bits (196),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +2

Query  98   GESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP  277
            G  TPTS+LP ++ + + D  + LY EL QAFKLIDRD+DG + + ELEALL+++GAEPP
Sbjct  54   GFRTPTSILPQVSGDWT-DISADLYFELTQAFKLIDRDNDGLVSRNELEALLTRLGAEPP  112

Query  278  SREELRLMLSEVDR  319
            S EE+ ++L EVD 
Sbjct  113  SSEEMAVILGEVDH  126


 Score = 52.8 bits (125),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 5/51 (10%)
 Frame = +3

Query  333  ALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            ALASR    L +A   P+ D ELRDAF FFD+D DGKI+A+EL NV+K  G
Sbjct  131  ALASR----LGTA-CEPAGDDELRDAFVFFDSDRDGKITADELLNVYKAFG  176


 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  588
            G+      L   K  GD +CTLEDCRRMI  VD NGDGFVCFEDFCRMME
Sbjct  161  GKITADELLNVYKAFGDEKCTLEDCRRMIAVVDKNGDGFVCFEDFCRMME  210



>ref|XP_008790571.1| PREDICTED: probable calcium-binding protein CML17 [Phoenix dactylifera]
Length=216

 Score = 67.0 bits (162),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = +2

Query  191  FKLIDRDDDGKIRKEELEALLSQVG-AEPPSREELRLMLSEVDRDGDGCISLE  346
            F + DRD DGKI + EL+A+L ++G A+PP+ EE+  M++EVDRDGDGCISLE
Sbjct  82   FAVFDRDGDGKITRHELQAVLRRLGGADPPTEEEVASMVAEVDRDGDGCISLE  134


 Score = 65.5 bits (158),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            G+      L      GD  CTLEDCRRMI GVD +GDGFVCFEDF RMM+ Q
Sbjct  164  GKISAEELLGVFITLGDEGCTLEDCRRMIGGVDTDGDGFVCFEDFVRMMDGQ  215


 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +3

Query  348  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            EF  + SAF PP+  ++LR+AF  FD D DGKISAEEL  VF T+G
Sbjct  135  EFGAIGSAFGPPA-GADLREAFAVFDADGDGKISAEELLGVFITLG  179


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGV  352
            A+L +AF + D D DGKI  EEL  +   +G E  + E+ R M+  VD DGDG +  E  
Sbjct  149  ADLREAFAVFDADGDGKISAEELLGVFITLGDEGCTLEDCRRMIGGVDTDGDGFVCFEDF  208

Query  353  QR  358
             R
Sbjct  209  VR  210



>ref|XP_009412818.1| PREDICTED: probable calcium-binding protein CML18 [Musa acuminata 
subsp. malaccensis]
Length=225

 Score = 68.9 bits (167),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 58/89 (65%), Gaps = 9/89 (10%)
 Frame = +2

Query  92   PGGESTPTSVLPALNDE----ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  259
             G ++TP SVL A + +    + PDE+S     L+  F + D D DGKI K ELEA+L +
Sbjct  55   TGLQTTPRSVLQAAHGKTPLFLFPDEVS-----LLDLFNMFDCDGDGKITKRELEAVLRR  109

Query  260  VGAEPPSREELRLMLSEVDRDGDGCISLE  346
            +  + P+ EE+  M++E+DRDGDGCISL+
Sbjct  110  LVPDAPTAEEVASMVAEMDRDGDGCISLD  138


 Score = 63.5 bits (153),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQXR  600
            G+      L      GD  CTLEDCRRMI GVD +GDGFV FEDF RMM+ Q R
Sbjct  171  GKISAEELLGVFATLGDCGCTLEDCRRMIGGVDADGDGFVGFEDFVRMMDGQIR  224


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 32/48 (67%), Gaps = 2/48 (4%)
 Frame = +3

Query  348  EFSVLSSAFAPPSC--DSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            EF+ L  A A  +   +SELR+AF  FD D DGKISAEEL  VF T+G
Sbjct  139  EFAALGPALAASAGGGESELREAFAVFDADGDGKISAEELLGVFATLG  186



>ref|XP_010924236.1| PREDICTED: probable calcium-binding protein CML36 [Elaeis guineensis]
Length=218

 Score = 65.9 bits (159),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 53/89 (60%), Gaps = 8/89 (9%)
 Frame = +2

Query  104  STPTSVLPALNDEISPDE-------LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  262
            STP SVLP    +            LS   + +   F + DRD DGKI   ELEA+L ++
Sbjct  48   STPRSVLPPPAGKTPSSSGSDDLWLLSPASSSVSDLFAVFDRDGDGKITPHELEAVLRRL  107

Query  263  GA-EPPSREELRLMLSEVDRDGDGCISLE  346
            G  +PP+ EE+  M++EVDRDGDGCISLE
Sbjct  108  GGVDPPTEEEVASMVAEVDRDGDGCISLE  136


 Score = 62.8 bits (151),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  588
            G+      L      GD  CTLEDCRRMI GVD +GDGFVCF+DF RMM+
Sbjct  166  GKISAEELLGVFSTLGDEGCTLEDCRRMIGGVDTDGDGFVCFDDFVRMMD  215


 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +3

Query  348  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            EF  + +AF PP+  +ELR+AF  FD + DGKISAEEL  VF T+G
Sbjct  137  EFGAIGTAFGPPA-GAELREAFAVFDANGDGKISAEELLGVFSTLG  181


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (58%), Gaps = 0/62 (0%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGV  352
            AEL +AF + D + DGKI  EEL  + S +G E  + E+ R M+  VD DGDG +  +  
Sbjct  151  AELREAFAVFDANGDGKISAEELLGVFSTLGDEGCTLEDCRRMIGGVDTDGDGFVCFDDF  210

Query  353  QR  358
             R
Sbjct  211  VR  212



>ref|XP_011027298.1| PREDICTED: probable calcium-binding protein CML35 [Populus euphratica]
Length=208

 Score = 76.6 bits (187),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +2

Query  98   GESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP  277
            G  TPTS+LP ++ + + D  + LY EL QAFKLID D+DG + + ELEALL+++GAEPP
Sbjct  49   GFRTPTSILPQVSGDWT-DISNDLYFELTQAFKLIDGDNDGLVSRSELEALLTRLGAEPP  107

Query  278  SREELRLMLSEVDR  319
            S EE+ ++L EVD 
Sbjct  108  SSEEMAVILGEVDH  121


 Score = 51.6 bits (122),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 35/51 (69%), Gaps = 5/51 (10%)
 Frame = +3

Query  333  ALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            ALASR    L +A  P   D ELRDAF FFD+D DGKI+A+EL NV+K  G
Sbjct  126  ALASR----LGTACEPAGND-ELRDAFVFFDSDRDGKITADELLNVYKAFG  171


 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  588
            G+      L   K  GD +CTL+DCRRMI  VD NGDGFVCFEDFCRMME
Sbjct  156  GKITADELLNVYKAFGDEKCTLDDCRRMIAVVDKNGDGFVCFEDFCRMME  205



>ref|XP_009399974.1| PREDICTED: probable calcium-binding protein CML17 [Musa acuminata 
subsp. malaccensis]
Length=225

 Score = 67.8 bits (164),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 55/86 (64%), Gaps = 9/86 (10%)
 Frame = +2

Query  101  ESTPTSVLPALNDE----ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  268
            ++TP SVLP  + +      PDE     A  +  F + D D DGKI K ELEA+L ++  
Sbjct  59   QATPRSVLPPDHGKAPVVFLPDE-----AAWLDLFNVFDCDGDGKITKRELEAVLRRLVP  113

Query  269  EPPSREELRLMLSEVDRDGDGCISLE  346
            +PP+ EE+  M++EVDRDGDGCISL+
Sbjct  114  DPPTAEEVASMVAEVDRDGDGCISLD  139


 Score = 59.7 bits (143),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            G+      L      GD  CTL+DCRRMI GVD +GDGFV F+DF RMM+ Q
Sbjct  171  GKISAEELLGVFATLGDGGCTLDDCRRMIGGVDTDGDGFVGFDDFVRMMDGQ  222



>ref|XP_010938625.1| PREDICTED: calmodulin-like protein 3 [Elaeis guineensis]
Length=218

 Score = 66.2 bits (160),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 55/88 (63%), Gaps = 6/88 (7%)
 Frame = +2

Query  101  ESTPTSVLPA-----LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  265
             STP S+LPA     +        LS   + +   F + DRD DGKI ++ELEA+L  +G
Sbjct  49   HSTPRSILPAGKPPSVAGSGEFWLLSPASSSVSDLFAVFDRDRDGKITRQELEAVLRGLG  108

Query  266  -AEPPSREELRLMLSEVDRDGDGCISLE  346
             A+PP+ EE+  M++EVD DGDGCISLE
Sbjct  109  GADPPTEEEVASMVAEVDLDGDGCISLE  136


 Score = 60.1 bits (144),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            G+      L      GD   TLEDCRRMI  VD +GDGFVCFEDF RMM+ Q
Sbjct  166  GKISAEELLGVFVTLGDDGWTLEDCRRMIGEVDTDGDGFVCFEDFVRMMDGQ  217


 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 1/46 (2%)
 Frame = +3

Query  348  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            EF  + SAF PP+   +LR+AF  FD D DGKISAEEL  VF T+G
Sbjct  137  EFGAIGSAFGPPA-GGDLREAFAVFDADGDGKISAEELLGVFVTLG  181


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGV  352
             +L +AF + D D DGKI  EEL  +   +G +  + E+ R M+ EVD DGDG +  E  
Sbjct  151  GDLREAFAVFDADGDGKISAEELLGVFVTLGDDGWTLEDCRRMIGEVDTDGDGFVCFEDF  210

Query  353  QR  358
             R
Sbjct  211  VR  212



>ref|XP_010525531.1| PREDICTED: probable calcium-binding protein CML35 [Tarenaya hassleriana]
Length=211

 Score = 79.0 bits (193),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 56/79 (71%), Gaps = 2/79 (3%)
 Frame = +2

Query  86   KKPGGESTPTSVLPALNDEISPDEL--SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  259
             KPG  +TP SVLP ++ + S      S LY+ELVQAFKLIDRDDDG + + EL ALL++
Sbjct  51   HKPGPAATPISVLPEISGDWSQVSAGDSDLYSELVQAFKLIDRDDDGAVSRSELAALLTR  110

Query  260  VGAEPPSREELRLMLSEVD  316
            +  EPPS++E+ +ML E D
Sbjct  111  LSPEPPSQDEVSMMLREAD  129


 Score = 46.2 bits (108),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            ELR+ F+FFD D DG+ISAEEL  VF  IG
Sbjct  145  ELREVFEFFDADRDGRISAEELLRVFGVIG  174


 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GR      L      GD RCTLE+C RMI  VD NGDGFVCFEDF RMME Q
Sbjct  159  GRISAEELLRVFGVIGDDRCTLEECLRMIATVDVNGDGFVCFEDFSRMMELQ  210



>gb|KJB35924.1| hypothetical protein B456_006G133800 [Gossypium raimondii]
Length=229

 Score = 66.6 bits (161),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            + GD RCTLEDCRRMI  VD N DGFVCFEDF RMME Q
Sbjct  190  KIGDERCTLEDCRRMIASVDKNEDGFVCFEDFSRMMELQ  228


 Score = 55.1 bits (131),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFK  476
            G   + L +    V+  A   P+C+ ELR+ FD FDTDHDGKI+AEEL   FK
Sbjct  136  GDGYINLETLMNQVVGPACDEPACEPELRETFDIFDTDHDGKITAEELMAFFK  188


 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 65/96 (68%), Gaps = 5/96 (5%)
 Frame = +2

Query  80   GYKKP----GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEA  247
            G++ P     G  TPTSVLP  + + S D  +  Y EL QAFK++D+D+DG I + ELEA
Sbjct  52   GHQYPSAATAGFVTPTSVLPQTSGDWS-DFPANFYLELCQAFKMLDKDNDGVISRSELEA  110

Query  248  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGVQ  355
            LL +V  +PPSR E+ LMLSEVD DGDG I+LE + 
Sbjct  111  LLGKVARQPPSRIEVSLMLSEVDGDGDGYINLETLM  146



>ref|XP_010056433.1| PREDICTED: probable calcium-binding protein CML36 [Eucalyptus 
grandis]
 gb|KCW90088.1| hypothetical protein EUGRSUZ_A02286 [Eucalyptus grandis]
Length=224

 Score = 65.9 bits (159),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  588
            G+      L      GD RCTLE+CRRMI  VD NGDGFVCFEDF RMME
Sbjct  172  GKITAEELLGVFAAFGDERCTLEECRRMISEVDKNGDGFVCFEDFTRMME  221


 Score = 55.5 bits (132),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 50/81 (62%), Gaps = 7/81 (9%)
 Frame = +2

Query  98   GES-TPTSVLPALNDEISPDE--LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  268
            GES TPTSVL              +G   EL +AF LIDRD DG + ++ELEALLS++G 
Sbjct  56   GESLTPTSVLGRGGGGGGGGGGVWAGSNLELARAFGLIDRDGDGILSRKELEALLSRLG-  114

Query  269  EPPSREELRLMLSEVDRDGDG  331
               SR+E+ +MLSEV   G+G
Sbjct  115  ---SRDEVAVMLSEVGCHGEG  132


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGV  352
            AEL + F+  D D DGKI  EEL  + +  G E  + EE R M+SEVD++GDG +  E  
Sbjct  157  AELRETFEFFDADHDGKITAEELLGVFAAFGDERCTLEECRRMISEVDKNGDGFVCFEDF  216

Query  353  QR  358
             R
Sbjct  217  TR  218


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +3

Query  351  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
             S +  A  P   D+ELR+ F+FFD DHDGKI+AEEL  VF   G
Sbjct  143  LSRVGPACGPACDDAELRETFEFFDADHDGKITAEELLGVFAAFG  187



>gb|ABK24059.1| unknown [Picea sitchensis]
 gb|ABK24534.1| unknown [Picea sitchensis]
Length=260

 Score = 54.7 bits (130),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            GD+ CT++DCR+MI GVD NGDG+V F+DF  MM
Sbjct  223  GDAECTIDDCRQMIRGVDKNGDGYVDFQDFSTMM  256


 Score = 46.6 bits (109),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL + FK+ D D DGKI   EL  +L  +G +  S EEL LM+   D+DGDG I L+
Sbjct  112  ELREVFKVFDADGDGKITITELGCVLRSLG-DDLSEEELALMVQAADKDGDGSIDLD  167


 Score = 38.5 bits (88),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 24/35 (69%), Gaps = 1/35 (3%)
 Frame = +3

Query  381  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            P+ D +L DAF  FD D DGKISA+EL  V  ++G
Sbjct  190  PATD-DLHDAFRIFDADKDGKISAQELHRVLTSLG  223



>ref|XP_008381742.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
 ref|XP_008348739.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
Length=202

 Score = 57.0 bits (136),  Expect(3) = 3e-18, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            AEL Q FK  D + DGKI   EL A++S +G +P S EEL  M+SEVD DGDG I+ +
Sbjct  55   AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QPSSDEELNSMISEVDSDGDGFINFK  111


 Score = 43.1 bits (100),  Expect(3) = 3e-18, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RS    C++++CR+MI GVD++GDG + FE+F  MM
Sbjct  155  RSLGDECSIDECRQMIGGVDSDGDGMISFEEFKVMM  190


 Score = 38.1 bits (87),  Expect(3) = 3e-18, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G ISAEEL+ V +++G
Sbjct  130  LKDAFSVYDIDGNGSISAEELYEVLRSLG  158



>ref|XP_002970730.1| hypothetical protein SELMODRAFT_94292 [Selaginella moellendorffii]
 gb|EFJ28056.1| hypothetical protein SELMODRAFT_94292 [Selaginella moellendorffii]
Length=160

 Score = 51.2 bits (121),  Expect(3) = 4e-18, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            G+   T+EDC RMI GVD++GDGFV FE+F RMM
Sbjct  116  GEKGVTMEDCNRMIGGVDSDGDGFVNFEEFQRMM  149


 Score = 50.8 bits (120),  Expect(3) = 4e-18, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL  AF+  D + DGKI   EL  +L  +G E PS E+LR M+ EVD DGDG +  +
Sbjct  12   ELEHAFRYFDANGDGKISVAELGGVLKSLG-ENPSEEDLRTMVREVDADGDGFVDFD  67


 Score = 36.2 bits (82),  Expect(3) = 4e-18, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 26/47 (55%), Gaps = 2/47 (4%)
 Frame = +3

Query  357  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGRLAV  497
            +L  A A      EL+ AF  FDTD +G ISAEEL+ V   +G   V
Sbjct  76   ILGDALAASV--EELKAAFYVFDTDKNGYISAEELYKVMFNLGEKGV  120


 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 41/79 (52%), Gaps = 0/79 (0%)
 Frame = +2

Query  122  LPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLM  301
               LN EI  D L+    EL  AF + D D +G I  EEL  ++  +G +  + E+   M
Sbjct  69   FVHLNTEILGDALAASVEELKAAFYVFDTDKNGYISAEELYKVMFNLGEKGVTMEDCNRM  128

Query  302  LSEVDRDGDGCISLEGVQR  358
            +  VD DGDG ++ E  QR
Sbjct  129  IGGVDSDGDGFVNFEEFQR  147



>ref|XP_002969393.1| hypothetical protein SELMODRAFT_91501 [Selaginella moellendorffii]
 gb|EFJ29481.1| hypothetical protein SELMODRAFT_91501 [Selaginella moellendorffii]
Length=162

 Score = 50.4 bits (119),  Expect(3) = 6e-18, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL  AF+  D + DGKI   EL  +L  +G E PS E+LR M+ EVD DGDG +  +
Sbjct  12   ELEHAFRYFDANGDGKISVAELGGVLKSLG-ENPSEEDLRTMVREVDADGDGFVDFD  67


 Score = 50.4 bits (119),  Expect(3) = 6e-18, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            G+   T+EDC RMI GVD++GDGFV FE+F RMM
Sbjct  116  GEKGVTMEDCNRMIGGVDSDGDGFVNFEEFQRMM  149


 Score = 36.6 bits (83),  Expect(3) = 6e-18, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 26/48 (54%), Gaps = 2/48 (4%)
 Frame = +3

Query  354  SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGRLAV  497
             +L  A A      EL+ AF  FDTD +G ISAEEL+ V   +G   V
Sbjct  75   EILGDALAASV--EELKAAFYVFDTDKNGYISAEELYKVMFNLGEKGV  120


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 41/79 (52%), Gaps = 0/79 (0%)
 Frame = +2

Query  122  LPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLM  301
               LN EI  D L+    EL  AF + D D +G I  EEL  ++  +G +  + E+   M
Sbjct  69   FVHLNTEILGDALAASVEELKAAFYVFDTDKNGYISAEELYKVMFNLGEKGVTMEDCNRM  128

Query  302  LSEVDRDGDGCISLEGVQR  358
            +  VD DGDG ++ E  QR
Sbjct  129  IGGVDSDGDGFVNFEEFQR  147



>ref|XP_010062249.1| PREDICTED: calcium-binding protein CML24-like [Eucalyptus grandis]
Length=184

 Score = 52.0 bits (123),  Expect(3) = 1e-17, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            ++ Q F   D++ DGKI  +EL  +LS +G+ P +REE +  ++E+D+DGDG I L+
Sbjct  38   QVRQVFAQYDKNGDGKISCDELREVLSALGSSPTTREEAQAAMAEIDKDGDGFIDLD  94


 Score = 43.1 bits (100),  Expect(3) = 1e-17, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             +C+L DCR+MI  VD +GDG V FE+F +MM
Sbjct  144  QKCSLRDCRKMISSVDRDGDGNVNFEEFKKMM  175


 Score = 41.2 bits (95),  Expect(3) = 1e-17, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 26/45 (58%), Gaps = 1/45 (2%)
 Frame = +3

Query  357  VLSSAFAPPSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTIGR  488
            +L      P C + ELRDAFD +D D +G IS  EL  V K +G+
Sbjct  100  ILGGGDGGPECGAKELRDAFDLYDLDGNGVISVSELHAVMKKLGQ  144



>ref|XP_009351545.1| PREDICTED: probable calcium-binding protein CML25 [Pyrus x bretschneideri]
Length=197

 Score = 54.3 bits (129),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            AEL Q FK  D + DGKI   EL A++S +G +  S EEL  M+SEVD DGDG I+ +
Sbjct  50   AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QASSDEELNSMISEVDSDGDGFINFK  106


 Score = 43.5 bits (101),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RS    C++++CR+MI GVD++GDG + FE+F  MM
Sbjct  150  RSLGDECSIDECRKMIGGVDSDGDGMISFEEFKVMM  185


 Score = 38.1 bits (87),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G ISAEEL+ V +++G
Sbjct  125  LKDAFSVYDIDGNGSISAEELYEVLRSLG  153



>ref|XP_008389977.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
Length=269

 Score = 55.5 bits (132),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            AEL Q FK  D + DGKI   EL A++S +G +P S EEL  M+SEVD DGDG I+ +
Sbjct  122  AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QPASDEELNGMISEVDSDGDGFINFK  178


 Score = 43.1 bits (100),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RS    C++++CR+MI GVD++GDG + FE+F  MM
Sbjct  222  RSLGDECSMDECRKMIGGVDSDGDGMINFEEFKVMM  257


 Score = 37.4 bits (85),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
 Frame = +3

Query  345  REFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            +EF  L++    P      L+DAF  +D D +G IS EEL+ V +++G
Sbjct  178  KEFVELNTKGIDPDEALENLKDAFSVYDIDGNGSISVEELYKVLRSLG  225



>ref|XP_009606381.1| PREDICTED: probable calcium-binding protein CML23 [Nicotiana 
tomentosiformis]
Length=157

 Score = 46.6 bits (109),  Expect(3) = 4e-17, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQ  591
            +C+L+DCRRMI  VD++GDG V FE+F +MM +
Sbjct  124  KCSLKDCRRMISSVDDDGDGSVNFEEFKKMMSK  156


 Score = 45.4 bits (106),  Expect(3) = 4e-17, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 1/70 (1%)
 Frame = +2

Query  137  DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD  316
            D   P  L+    E+ + FK  D + DGKI   EL  +L+ +G +    E  R+ML EVD
Sbjct  7    DSSQPTSLTAEMEEVEKVFKKFDTNGDGKISLSELGGILNALGTKTTPDEAKRMML-EVD  65

Query  317  RDGDGCISLE  346
             DGDG I L+
Sbjct  66   TDGDGFIDLK  75


 Score = 42.7 bits (99),  Expect(3) = 4e-17, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  375  APPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            +P + + +LR+AF+ +D D +GKISA EL +V K IG
Sbjct  86   SPNTVNKDLREAFNLYDKDKNGKISAAELHSVMKGIG  122


 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGVQ  355
            +L +AF L D+D +GKI   EL +++  +G E  S ++ R M+S VD DGDG ++ E  +
Sbjct  93   DLREAFNLYDKDKNGKISAAELHSVMKGIG-EKCSLKDCRRMISSVDDDGDGSVNFEEFK  151

Query  356  R  358
            +
Sbjct  152  K  152



>gb|EYU30122.1| hypothetical protein MIMGU_mgv1a025962mg [Erythranthe guttata]
Length=187

 Score = 49.3 bits (116),  Expect(3) = 4e-17, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
            EL   FK  D + DGKI   EL +++  +G  P + EELR M+ EVD DGDG I L
Sbjct  40   ELEHVFKKFDVNGDGKICAAELGSIMGSLG-HPATEEELRTMIQEVDSDGDGFIDL  94


 Score = 43.9 bits (102),  Expect(3) = 4e-17, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = +3

Query  345  REFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            REF  L++           LRDAF+ FD D +G ISAEEL NV K++G
Sbjct  95   REFIELNTNGIGQDEVIENLRDAFEVFDMDKNGSISAEELHNVLKSLG  142


 Score = 41.6 bits (96),  Expect(3) = 4e-17, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            +S    CTL +CR+MI GVD +G+G +CF++F  MM
Sbjct  139  KSLGEECTLAECRKMISGVDADGNGTICFDEFKVMM  174



>ref|XP_006843397.1| hypothetical protein AMTR_s00053p00122010 [Amborella trichopoda]
 gb|ERN05072.1| hypothetical protein AMTR_s00053p00122010 [Amborella trichopoda]
Length=229

 Score = 57.0 bits (136),  Expect(3) = 6e-17, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            GD+ CT+ DC RMI G D++GDGFVCF+DF RMM
Sbjct  189  GDAECTVGDCHRMIRGFDSDGDGFVCFQDFARMM  222


 Score = 38.9 bits (89),  Expect(3) = 6e-17, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 4/61 (7%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGVQ  355
            E+    ++++   DGKI KE++  +   +G EPPS EELR     V  D +G ISLE + 
Sbjct  91   EIYDTCRILELVGDGKISKEDVGPVFRALGVEPPSYEELR----NVATDDEGRISLEDLA  146

Query  356  R  358
            R
Sbjct  147  R  147


 Score = 38.1 bits (87),  Expect(3) = 6e-17, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 25/40 (63%), Gaps = 3/40 (8%)
 Frame = +3

Query  375  APPSCD---SELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            AP S +   SEL +AF  FD D DG+ISAEEL  V   +G
Sbjct  150  APASAEEPVSELMEAFGVFDRDGDGRISAEELQGVLSALG  189



>ref|XP_008443339.1| PREDICTED: probable calcium-binding protein CML35 [Cucumis melo]
Length=233

 Score = 67.4 bits (163),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 39/69 (57%), Gaps = 4/69 (6%)
 Frame = +1

Query  394  PSCETPSTSSIRI----TTGRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVC  561
            P+C +    +  I      GR       +     GD  CTLEDCRRMI GVD NGDGFVC
Sbjct  162  PACHSELRDTFEIFDADHDGRITAEELFSVFTAMGDEGCTLEDCRRMIAGVDKNGDGFVC  221

Query  562  FEDFCRMME  588
            F+DF RMM+
Sbjct  222  FDDFARMMD  230


 Score = 46.6 bits (109),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  215  DGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCIS  340
            D  + ++EL+ALL  +GAEPPS EE+++M+ E+DR G  C S
Sbjct  125  DPTLSRKELKALLGLIGAEPPSEEEIKIMMGEMDRVGPACHS  166


 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  381  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            P+C SELRD F+ FD DHDG+I+AEELF+VF  +G
Sbjct  162  PACHSELRDTFEIFDADHDGRITAEELFSVFTAMG  196


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +2

Query  164  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
              ++EL   F++ D D DG+I  EEL ++ + +G E  + E+ R M++ VD++GDG +  
Sbjct  163  ACHSELRDTFEIFDADHDGRITAEELFSVFTAMGDEGCTLEDCRRMIAGVDKNGDGFVCF  222

Query  344  EGVQR  358
            +   R
Sbjct  223  DDFAR  227



>ref|XP_004241666.2| PREDICTED: calcium-binding allergen Ole e 8-like [Solanum lycopersicum]
Length=197

 Score = 51.2 bits (121),  Expect(3) = 7e-17, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
              CTL+DC RMI  VD NGDG+VCFE+F +MM
Sbjct  163  QNCTLQDCTRMITSVDANGDGYVCFEEFKKMM  194


 Score = 42.0 bits (97),  Expect(3) = 7e-17, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            E+ + F   D + DG I  +EL  +L  +G++  S EE+  M++E+D D DGCI+L+
Sbjct  60   EVKKVFARFDANGDGMISGDELSGVLKALGSDT-SPEEVARMMAEIDTDKDGCINLD  115


 Score = 40.8 bits (94),  Expect(3) = 7e-17, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIGR  488
            EL++AFD +D DH+G+ISA EL  +   +G+
Sbjct  133  ELKEAFDLYDQDHNGRISATELHQILNRLGQ  163



>ref|XP_004159632.1| PREDICTED: probable calcium-binding protein CML35-like [Cucumis 
sativus]
 gb|KGN59507.1| hypothetical protein Csa_3G823060 [Cucumis sativus]
Length=167

 Score = 65.1 bits (157),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 39/69 (57%), Gaps = 4/69 (6%)
 Frame = +1

Query  394  PSCETPSTSSIRI----TTGRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVC  561
            P+C +    +  I      GR       +     GD  CTLEDC+RMI GVD NGDGFVC
Sbjct  96   PTCHSELRDTFEIFDADHDGRITAEELFSVFAAMGDDGCTLEDCQRMIAGVDKNGDGFVC  155

Query  562  FEDFCRMME  588
            F+DF RMM+
Sbjct  156  FDDFVRMMD  164


 Score = 48.9 bits (115),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 21/78 (27%)
 Frame = +2

Query  107  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  286
            TPTSVLP+L+           +++            D  + ++EL+ALL  +GAEPPS E
Sbjct  44   TPTSVLPSLD-----------WSDF----------SDPTLSRKELKALLGLIGAEPPSEE  82

Query  287  ELRLMLSEVDRDGDGCIS  340
            E+++M+ E+DR G  C S
Sbjct  83   EIKIMMGEMDRVGPTCHS  100


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  381  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            P+C SELRD F+ FD DHDG+I+AEELF+VF  +G
Sbjct  96   PTCHSELRDTFEIFDADHDGRITAEELFSVFAAMG  130



>ref|XP_004136671.1| PREDICTED: probable calcium-binding protein CML35-like [Cucumis 
sativus]
Length=166

 Score = 65.1 bits (157),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 39/69 (57%), Gaps = 4/69 (6%)
 Frame = +1

Query  394  PSCETPSTSSIRI----TTGRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVC  561
            P+C +    +  I      GR       +     GD  CTLEDC+RMI GVD NGDGFVC
Sbjct  95   PTCHSELRDTFEIFDADHDGRITAEELFSVFAAMGDDGCTLEDCQRMIAGVDKNGDGFVC  154

Query  562  FEDFCRMME  588
            F+DF RMM+
Sbjct  155  FDDFVRMMD  163


 Score = 48.9 bits (115),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 21/78 (27%)
 Frame = +2

Query  107  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  286
            TPTSVLP+L+           +++            D  + ++EL+ALL  +GAEPPS E
Sbjct  43   TPTSVLPSLD-----------WSDF----------SDPTLSRKELKALLGLIGAEPPSEE  81

Query  287  ELRLMLSEVDRDGDGCIS  340
            E+++M+ E+DR G  C S
Sbjct  82   EIKIMMGEMDRVGPTCHS  99


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  381  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            P+C SELRD F+ FD DHDG+I+AEELF+VF  +G
Sbjct  95   PTCHSELRDTFEIFDADHDGRITAEELFSVFAAMG  129



>ref|XP_004503360.1| PREDICTED: probable calcium-binding protein CML25-like [Cicer 
arietinum]
Length=190

 Score = 57.0 bits (136),  Expect(3) = 8e-17, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 49/88 (56%), Gaps = 1/88 (1%)
 Frame = +2

Query  83   YKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  262
            + +P       S  P+ +  +S    + L  EL Q FK  D + DGKI   EL +++  +
Sbjct  7    FNRPKDMIPSASSTPSRSTSLSVHSRARLAGELEQVFKKFDVNGDGKISASELGSIMGSL  66

Query  263  GAEPPSREELRLMLSEVDRDGDGCISLE  346
            G +P + +EL  M+ EVD DGDGCISL+
Sbjct  67   G-QPATEQELDNMIREVDGDGDGCISLQ  93


 Score = 41.6 bits (96),  Expect(3) = 8e-17, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  463  LTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDF  573
            L    RS    C+L +CRRMI GVD++GDG + FE+F
Sbjct  132  LNTVMRSLGEECSLAECRRMIGGVDSDGDGMIDFEEF  168


 Score = 35.4 bits (80),  Expect(3) = 8e-17, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  FD D +G I+AEEL  V +++G
Sbjct  112  LKDAFAVFDMDGNGSITAEELNTVMRSLG  140



>ref|XP_010922185.1| PREDICTED: probable calcium-binding protein CML36 [Elaeis guineensis]
Length=209

 Score = 65.1 bits (157),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GD RCTLEDCRRMI  VD++GDGFVCFEDF RMM  Q
Sbjct  172  GDERCTLEDCRRMIGVVDSDGDGFVCFEDFVRMMHGQ  208


 Score = 48.5 bits (114),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 33/56 (59%), Gaps = 3/56 (5%)
 Frame = +3

Query  318  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            G  ++ L  +E   L SAF PP    EL+  F  FD D DGKISAEEL  +F T+G
Sbjct  120  GEGSIRL--QEIVALGSAFGPPVA-PELQQTFAVFDVDGDGKISAEELLAMFVTLG  172


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 34/61 (56%), Gaps = 0/61 (0%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGVQ  355
            EL Q F + D D DGKI  EEL A+   +G E  + E+ R M+  VD DGDG +  E   
Sbjct  143  ELQQTFAVFDVDGDGKISAEELLAMFVTLGDERCTLEDCRRMIGVVDSDGDGFVCFEDFV  202

Query  356  R  358
            R
Sbjct  203  R  203



>gb|EPS62655.1| hypothetical protein M569_12136 [Genlisea aurea]
Length=186

 Score = 48.9 bits (115),  Expect(3) = 1e-16, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
            EL Q FK  D + DGKI  EEL  +++ +G    + EE+R+M+ EVD DGDG I L
Sbjct  35   ELEQVFKKFDANGDGKISGEELGKIIASLG-HSVTDEEIRIMIQEVDSDGDGFIDL  89


 Score = 45.4 bits (106),  Expect(3) = 1e-16, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RS    CT+EDCR+MI GVD +G+G +CF++F  MM
Sbjct  134  RSLGEECTIEDCRKMISGVDADGNGTICFDEFQVMM  169


 Score = 38.5 bits (88),  Expect(3) = 1e-16, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
 Frame = +3

Query  345  REFSVLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            REF  L++A          LR AFD FD D +G ISAEEL  V +++G
Sbjct  90   REFIDLNTADVDNDEALENLRRAFDVFDIDRNGAISAEELRQVLRSLG  137



>ref|XP_011072994.1| PREDICTED: calcium-binding allergen Ole e 8-like [Sesamum indicum]
Length=166

 Score = 46.6 bits (109),  Expect(3) = 3e-16, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 35/54 (65%), Gaps = 5/54 (9%)
 Frame = +3

Query  345  REFSVLSSAFAPP--SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGRLAVH  500
            +EF+   SA A P  S + ELR+AF+ +D +HDGKISA EL    KT+ RL  H
Sbjct  75   QEFAAFCSAEADPYHSAEKELREAFELYDQNHDGKISAAEL---QKTLLRLGEH  125


 Score = 44.7 bits (104),  Expect(3) = 3e-16, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             C++EDC  MI  +D NGDG+V FE+F +MM
Sbjct  125  HCSIEDCAGMIKPIDANGDGYVSFEEFKKMM  155


 Score = 40.4 bits (93),  Expect(3) = 3e-16, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            AE+ + F   D ++DGKI   EL  +L  +G+E  S +E+  M+ E+D D DG I+L+
Sbjct  19   AEVQKVFDRFDTNNDGKISPGELGGVLKALGSE-SSPDEVARMMGEIDTDKDGNINLQ  75



>ref|XP_011070577.1| PREDICTED: probable calcium-binding protein CML25 [Sesamum indicum]
Length=195

 Score = 59.3 bits (142),  Expect(3) = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 52/87 (60%), Gaps = 5/87 (6%)
 Frame = +2

Query  98   GESTPTSV---LPALNDEISP-DELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  265
            G+++PT+     P +N   S  +  S L  EL Q FK  D + DGKI   EL ++L  VG
Sbjct  18   GDTSPTTAPVQAPMINSRSSSLNGRSRLEEELEQVFKKFDVNGDGKISASELGSILGSVG  77

Query  266  AEPPSREELRLMLSEVDRDGDGCISLE  346
             +P + EELR+M+ EVD DGDG I L+
Sbjct  78   -QPATEEELRIMIQEVDADGDGFIDLQ  103


 Score = 37.4 bits (85),  Expect(3) = 3e-16, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQXR  600
             CTL +C +MI GVD++G G + F++F  MM +  R
Sbjct  152  ECTLAECEKMISGVDSDGSGTINFDEFKVMMTKGFR  187


 Score = 35.4 bits (80),  Expect(3) = 3e-16, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  FD D +G I+AEEL +V +++G
Sbjct  122  LKDAFKVFDIDKNGYITAEELQDVLQSLG  150



>ref|XP_008786895.1| PREDICTED: probable calcium-binding protein CML36 [Phoenix dactylifera]
Length=205

 Score = 62.4 bits (150),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            G+      L      GD +CTLEDCRRMI  VD++GDGFVCF+DF RMM+ Q
Sbjct  153  GKISAEELLAMFVTLGDEQCTLEDCRRMIGVVDSDGDGFVCFQDFVRMMDGQ  204


 Score = 49.3 bits (116),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  101  ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  280
            + TP +VLP L         +   +     +   +R+ +G+I + ELE +L ++G +PP+
Sbjct  42   QCTPKTVLPRLPGCHLAAPAAKSASSSSTDYPSAEREGEGRITRRELEVVLRRLGPDPPT  101

Query  281  REELRLMLSEVDRDGDGCISLE  346
             EE+  ML+E DR GDG I LE
Sbjct  102  EEEVVAMLAEADRAGDGSIRLE  123



>ref|XP_004498255.1| PREDICTED: probable calcium-binding protein CML25-like [Cicer 
arietinum]
Length=200

 Score = 48.5 bits (114),  Expect(3) = 4e-16, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 45/86 (52%), Gaps = 6/86 (7%)
 Frame = +2

Query  104  STPT-----SVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  268
            S+PT     S   + N  +S         +L   F+  D + DGKI   EL +++  +G 
Sbjct  20   SSPTAAATNSTFFSRNPSVSSRSRLHFTEDLEHVFRKFDVNGDGKISSSELGSIMGSLG-  78

Query  269  EPPSREELRLMLSEVDRDGDGCISLE  346
            +P + EEL  M+ EVD DGDG I+LE
Sbjct  79   QPATEEELNNMIREVDADGDGHINLE  104


 Score = 44.3 bits (103),  Expect(3) = 4e-16, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            +C+L +C++MI GVD +GDG + FE+F RMM
Sbjct  153  KCSLAECKKMIRGVDKDGDGMIDFEEFKRMM  183


 Score = 38.5 bits (88),  Expect(3) = 4e-16, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = +3

Query  378  PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            P      L+DAF  FD D +G I+AEEL NV  +IG
Sbjct  116  PNEIIENLKDAFSIFDIDGNGSITAEELHNVMVSIG  151



>ref|XP_004169010.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis 
sativus]
 gb|KGN51467.1| Polcalcin Jun o [Cucumis sativus]
Length=182

 Score = 49.7 bits (117),  Expect(3) = 4e-16, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            AEL Q F   D + DGKI   EL +++  +G +P + EEL+ M+ EVD DGDG I L+
Sbjct  36   AELEQVFNKFDVNGDGKICSSELGSIMGSLG-QPATEEELQNMIKEVDADGDGYIDLD  92


 Score = 45.4 bits (106),  Expect(3) = 4e-16, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +1

Query  496  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            C+L DCR+MI GVD NGDG + F++F  MM
Sbjct  142  CSLADCRKMITGVDKNGDGMISFDEFKVMM  171


 Score = 36.2 bits (82),  Expect(3) = 4e-16, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G I+AEEL  V K++G
Sbjct  111  LKDAFSVYDIDGNGSITAEELHEVLKSLG  139



>ref|XP_007223528.1| hypothetical protein PRUPE_ppa012032mg [Prunus persica]
 gb|EMJ24727.1| hypothetical protein PRUPE_ppa012032mg [Prunus persica]
Length=186

 Score = 52.8 bits (125),  Expect(3) = 4e-16, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            AEL Q FK  D + DGKI   EL A++S +G +P + EEL  M+ EVD DGDG I  +
Sbjct  39   AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QPANEEELSHMILEVDSDGDGFIDFK  95


 Score = 39.7 bits (91),  Expect(3) = 4e-16, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RS    C++ +C++MI  VD++GDG + FE+F  MM
Sbjct  139  RSLGDECSIAECKKMISAVDSDGDGMINFEEFKVMM  174


 Score = 38.5 bits (88),  Expect(3) = 4e-16, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G ISAEEL+ V +++G
Sbjct  114  LKDAFSVYDIDGNGSISAEELYKVLRSLG  142



>ref|XP_008467096.1| PREDICTED: probable calcium-binding protein CML25 [Cucumis melo]
Length=182

 Score = 49.7 bits (117),  Expect(3) = 4e-16, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            AEL Q F   D + DGKI   EL +++  +G +P + EEL  M+ EVD DGDG I L+
Sbjct  36   AELEQVFNKFDVNGDGKICSSELGSIMGSLG-QPATEEELHNMIKEVDADGDGYIDLD  92


 Score = 45.4 bits (106),  Expect(3) = 4e-16, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +1

Query  496  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            C+L DCR+MI GVD NGDG + F++F  MM
Sbjct  142  CSLADCRKMITGVDKNGDGMISFDEFKVMM  171


 Score = 36.2 bits (82),  Expect(3) = 4e-16, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G I+AEEL  V K++G
Sbjct  111  LKDAFSVYDIDGNGSITAEELHEVLKSLG  139



>ref|XP_004233476.1| PREDICTED: probable calcium-binding protein CML18 [Solanum lycopersicum]
Length=145

 Score = 45.8 bits (107),  Expect(3) = 4e-16, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             +C+L+DCRRMI  VD++GDG V FE+F +MM
Sbjct  111  EKCSLKDCRRMISSVDDDGDGSVNFEEFKKMM  142


 Score = 43.1 bits (100),  Expect(3) = 4e-16, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            E+ + F+  D + DGKI   EL+ +L+ +G +    E  R+ML EVD DGDG I LE
Sbjct  10   EVEKVFRKYDTNGDGKISLSELDGVLNALGTKTTPDEAKRMML-EVDTDGDGFIDLE  65


 Score = 42.4 bits (98),  Expect(3) = 4e-16, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 28/43 (65%), Gaps = 3/43 (7%)
 Frame = +3

Query  366  SAFAPP---SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            +AF  P   S   +LRDAFD +D D +GKISA EL +V K IG
Sbjct  68   AAFHCPVEGSNSKDLRDAFDLYDKDKNGKISASELHSVMKGIG  110



>ref|XP_007033045.1| Calmodulin like 23, putative [Theobroma cacao]
 gb|EOY03971.1| Calmodulin like 23, putative [Theobroma cacao]
Length=152

 Score = 48.9 bits (115),  Expect(3) = 5e-16, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +2

Query  164  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
            G   E+ + F   D++ DGKI ++EL+++LS +G+ PPS +E+  ++S +D+DG+G + L
Sbjct  6    GSMEEMKEVFNKFDKNGDGKISRDELKSILSALGS-PPSSDEVDRIMSMMDKDGNGYVDL  64

Query  344  E  346
            +
Sbjct  65   D  65


 Score = 44.3 bits (103),  Expect(3) = 5e-16, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 1/37 (3%)
 Frame = +1

Query  475  KRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            KR G+ +C+L DCRRMI  VD +GDG V FE+F +MM
Sbjct  114  KRLGE-KCSLSDCRRMISQVDKDGDGNVNFEEFKKMM  149


 Score = 38.1 bits (87),  Expect(3) = 5e-16, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = +3

Query  390  DSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            + EL+DAFD +D D +G ISA EL  V K +G
Sbjct  86   NKELKDAFDMYDLDKNGLISANELHAVLKRLG  117



>ref|XP_010036330.1| PREDICTED: probable calcium-binding protein CML36 [Eucalyptus 
grandis]
Length=224

 Score = 64.7 bits (156),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 54/81 (67%), Gaps = 9/81 (11%)
 Frame = +2

Query  89   KPGGES-TPTSVLP-----ALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEAL  250
              GGE+ TPTSVLP       +D  S  E++G   ELV+AF  ID D+DG + +E+LEAL
Sbjct  45   HKGGEARTPTSVLPPQLSGEWSDVASSSEMNG---ELVRAFTYIDGDNDGVLSREDLEAL  101

Query  251  LSQVGAEPPSREELRLMLSEV  313
            LS++GAEP S +E  LML EV
Sbjct  102  LSRLGAEPLSADEKALMLREV  122


 Score = 46.2 bits (108),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  LASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L SR  S      A   CD E+R  F+FFD + DG+I+AEEL   F+ +G
Sbjct  138  LVSRVGSAGGDEEADAGCDVEMRRTFEFFDRNGDGRITAEELLGAFEAMG  187


 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GR      L   +  GD RCTL +CRRMI  VD NGDGFVCFEDF RMM+ Q
Sbjct  172  GRITAEELLGAFEAMGDGRCTLGECRRMIAEVDRNGDGFVCFEDFSRMMQLQ  223



>ref|XP_008221464.1| PREDICTED: probable calcium-binding protein CML25 [Prunus mume]
Length=186

 Score = 52.8 bits (125),  Expect(3) = 6e-16, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            AEL Q FK  D + DGKI   EL A++S +G +P + EEL  M+ EVD DGDG I  +
Sbjct  39   AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QPANEEELSHMILEVDSDGDGFIDFK  95


 Score = 40.0 bits (92),  Expect(3) = 6e-16, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RS    C++ +C++MI  VD++GDG + FE+F  MM
Sbjct  139  RSLGDECSIAECKKMISAVDSDGDGMINFEEFKVMM  174


 Score = 38.1 bits (87),  Expect(3) = 6e-16, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G ISAEEL+ V +++G
Sbjct  114  LKDAFSVYDIDGNGLISAEELYKVLRSLG  142



>gb|EPS63975.1| hypothetical protein M569_10810, partial [Genlisea aurea]
Length=170

 Score = 54.3 bits (129),  Expect(3) = 6e-16, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 45/87 (52%), Gaps = 6/87 (7%)
 Frame = +2

Query  86   KKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  265
            +K    S   +  P++N     +E      EL Q FK  D + DGKI   EL A+   +G
Sbjct  4    RKAKASSGAMNSTPSMNSRAQIEE------ELEQVFKKFDVNGDGKISGSELGAIFRSLG  57

Query  266  AEPPSREELRLMLSEVDRDGDGCISLE  346
             E  + EEL+ M+ EVD DGDG I L+
Sbjct  58   GEAMAEEELKSMIREVDSDGDGFIDLK  84


 Score = 40.0 bits (92),  Expect(3) = 6e-16, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             CTL +C +MI GVD++G+G + FE+F  MM
Sbjct  133  ECTLGECAKMIAGVDSDGNGMISFEEFKVMM  163


 Score = 36.2 bits (82),  Expect(3) = 6e-16, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  FD D DG IS EEL  V +++G
Sbjct  103  LKDAFQVFDIDGDGSISCEELRQVLESLG  131



>ref|XP_010104706.1| putative calcium-binding protein CML25 [Morus notabilis]
 gb|EXC48677.1| putative calcium-binding protein CML25 [Morus notabilis]
Length=193

 Score = 52.4 bits (124),  Expect(3) = 6e-16, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL Q FK  D + DGKI   EL A++  +G +P   EELR M+ EVD DGDG I L+
Sbjct  44   ELEQVFKKFDVNGDGKISSSELGAIMGSLG-QPSGEEELRKMIKEVDSDGDGFIDLK  99


 Score = 39.3 bits (90),  Expect(3) = 6e-16, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RS    C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  143  RSLGDECSIAECRKMISGVDCDGDGTISFEEFKVMM  178


 Score = 38.9 bits (89),  Expect(3) = 6e-16, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G ISAEEL+ V +++G
Sbjct  118  LKDAFSVYDIDKNGSISAEELYEVLRSLG  146



>ref|XP_006365410.1| PREDICTED: calcium-binding allergen Ole e 8-like [Solanum tuberosum]
Length=154

 Score = 49.3 bits (116),  Expect(3) = 7e-16, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
              CT++DC RMI  VD NGDG+VCFE+F +MM
Sbjct  120  QNCTIQDCTRMITSVDANGDGYVCFEEFKKMM  151


 Score = 40.8 bits (94),  Expect(3) = 7e-16, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            E+ + F   D + DG I  +EL  +L  +G++  S EE+  M++E+D D DGCI+++
Sbjct  17   EVKKVFARFDANGDGMISGDELSGVLKALGSDT-SPEEVARMMAEIDTDKDGCINID  72


 Score = 40.4 bits (93),  Expect(3) = 7e-16, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIGR  488
            EL++AFD +D DH+G+ISA EL  +   +G+
Sbjct  90   ELKEAFDLYDQDHNGRISATELHQILNRLGQ  120



>ref|XP_002882655.1| hypothetical protein ARALYDRAFT_897194 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58914.1| hypothetical protein ARALYDRAFT_897194 [Arabidopsis lyrata subsp. 
lyrata]
Length=206

 Score = 82.4 bits (202),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 58/84 (69%), Gaps = 7/84 (8%)
 Frame = +2

Query  95   GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  274
            GG  TPTS+LP +    S       Y E++QAFKLIDRD+DG + + +LE+LLS++G EP
Sbjct  47   GGSVTPTSILPEVPSPYS-------YIEILQAFKLIDRDNDGAVSRHDLESLLSRLGPEP  99

Query  275  PSREELRLMLSEVDRDGDGCISLE  346
             + EE+ +M+ EVD DGDG I LE
Sbjct  100  LTEEEINVMIKEVDGDGDGTIRLE  123


 Score = 59.7 bits (143),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GD RCTL+DC+RMI  VD +GDGFVCF +F RMM+ Q
Sbjct  169  GDERCTLDDCKRMIADVDEDGDGFVCFTEFSRMMDLQ  205


 Score = 44.7 bits (104),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 32/56 (57%), Gaps = 2/56 (4%)
 Frame = +3

Query  318  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            G  T+ L      V+S    P    +EL++ F+FFD D DG ISA+EL  VF TIG
Sbjct  116  GDGTIRLEELASRVVS--LDPARDSTELKETFEFFDADRDGLISADELLRVFSTIG  169



>ref|XP_010053891.1| PREDICTED: calmodulin-like protein 3 [Eucalyptus grandis]
Length=202

 Score = 50.8 bits (120),  Expect(3) = 1e-15, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 41/64 (64%), Gaps = 2/64 (3%)
 Frame = +2

Query  161  SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG--AEPPSREELRLMLSEVDRDGDGC  334
            S + A+L Q F+LID D DGKI   EL  +LS +G      + EE R+M+ E+DRDGDG 
Sbjct  61   SEVSAQLRQVFELIDADGDGKISPTELSRVLSGLGHVGAAAADEEARVMVKEIDRDGDGR  120

Query  335  ISLE  346
            + L+
Sbjct  121  VDLD  124


 Score = 46.6 bits (109),  Expect(3) = 1e-15, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +1

Query  496  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             ++EDCRRMI GVD +GDGFV FE+F  MM
Sbjct  168  ASIEDCRRMIRGVDTDGDGFVNFEEFRSMM  197


 Score = 32.3 bits (72),  Expect(3) = 1e-15, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 22/37 (59%), Gaps = 0/37 (0%)
 Frame = +3

Query  372  FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  482
             A  S D +L DAF  FD + DG ISA+EL  V + +
Sbjct  128  VAVLSGDDDLMDAFLIFDANKDGLISAKELQRVLQGV  164



>ref|XP_004150619.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis 
sativus]
Length=164

 Score = 49.3 bits (116),  Expect(3) = 1e-15, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            AEL Q F   D + DGKI   EL +++  +G +P + EEL+ M+ EVD DGDG I L+
Sbjct  18   AELEQVFNKFDVNGDGKICSSELGSIMGSLG-QPATEEELQNMIKEVDADGDGYIDLD  74


 Score = 44.7 bits (104),  Expect(3) = 1e-15, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 26/37 (70%), Gaps = 1/37 (3%)
 Frame = +1

Query  475  KRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            K  GD  C+L DCR+MI GVD NGDG + F++F  MM
Sbjct  118  KSLGDD-CSLADCRKMITGVDKNGDGMISFDEFKVMM  153


 Score = 36.2 bits (82),  Expect(3) = 1e-15, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G I+AEEL  V K++G
Sbjct  93   LKDAFSVYDIDGNGSITAEELHEVLKSLG  121



>ref|XP_008801290.1| PREDICTED: probable calcium-binding protein CML10 [Phoenix dactylifera]
Length=180

 Score = 50.1 bits (118),  Expect(3) = 1e-15, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 40/72 (56%), Gaps = 10/72 (14%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL----  343
            EL + F+L D + DGKI   EL  +++++G  P    EL +M+ E D DGDG I+L    
Sbjct  38   ELERVFRLYDTNGDGKISAAELRDMMAKLGRPPADDHELEMMMKEADADGDGFINLAEFK  97

Query  344  ------EGVQRA  361
                  EGVQ A
Sbjct  98   DINRAGEGVQEA  109


 Score = 42.4 bits (98),  Expect(3) = 1e-15, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +3

Query  390  DSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            +++LR+AF  FD DHDGKISA EL  V K +G
Sbjct  108  EADLREAFAVFDEDHDGKISASELRGVLKGLG  139


 Score = 37.4 bits (85),  Expect(3) = 1e-15, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 20/32 (63%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
               T   CR+MI GVD +GDG V F++F  MM
Sbjct  140  EEVTTAQCRKMIRGVDRDGDGMVSFQEFKVMM  171



>ref|XP_009775333.1| PREDICTED: probable calcium-binding protein CML23 [Nicotiana 
sylvestris]
Length=157

 Score = 43.9 bits (102),  Expect(3) = 1e-15, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 1/66 (2%)
 Frame = +2

Query  149  PDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGD  328
            P  L+    E+ + FK  D + DGKI   EL  +L+ +G +    E  R+M+ EVD DGD
Sbjct  11   PASLTAEMEEVKKVFKKFDTNGDGKISLSELGGILNALGTKTTPDEAKRMMI-EVDTDGD  69

Query  329  GCISLE  346
            G I L+
Sbjct  70   GFIDLK  75


 Score = 43.9 bits (102),  Expect(3) = 1e-15, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  375  APPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            +P + + +LRDAF+ +D D +GKISA EL +V K IG
Sbjct  86   SPNTVNKDLRDAFNLYDKDKNGKISAAELHSVMKGIG  122


 Score = 41.6 bits (96),  Expect(3) = 1e-15, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQ  591
            +C+L+DCRRMI  VD++ DG V FE+F +MM +
Sbjct  124  KCSLKDCRRMISSVDDDCDGSVNFEEFKKMMSK  156



>gb|KJB50384.1| hypothetical protein B456_008G168100 [Gossypium raimondii]
Length=195

 Score = 50.4 bits (119),  Expect(3) = 1e-15, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL   FK+ D + DGKI   EL +++  +G + PS EE++ M+ E D DGDG I+ E
Sbjct  50   ELEHIFKMFDANGDGKISSSELASIMGSLGQQ-PSDEEVQKMIKEFDADGDGFINFE  105


 Score = 41.6 bits (96),  Expect(3) = 1e-15, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +1

Query  496  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            C++ +CR+MI GVDN+G+G + FE+F  MM
Sbjct  155  CSITECRKMISGVDNDGNGMIDFEEFKVMM  184


 Score = 37.4 bits (85),  Expect(3) = 1e-15, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G ISAEEL  V K++G
Sbjct  124  LKDAFSVYDLDGNGSISAEELHKVLKSLG  152



>ref|XP_002534401.1| Calcium-binding allergen Ole e, putative [Ricinus communis]
 gb|EEF27979.1| Calcium-binding allergen Ole e, putative [Ricinus communis]
Length=211

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 61/83 (73%), Gaps = 5/83 (6%)
 Frame = +2

Query  107  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  286
            TP SVLP L+ + S D  S  ++ELVQAFKL+D D+DG + + +LE+LL ++GAE    E
Sbjct  53   TPPSVLPDLSGDWS-DVSSDFFSELVQAFKLMDNDNDGIVSRTQLESLLIRLGAE----E  107

Query  287  ELRLMLSEVDRDGDGCISLEGVQ  355
            E+  MLSEVDRDGDGCIS+E + 
Sbjct  108  EVATMLSEVDRDGDGCISVEALM  130


 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 47/91 (52%), Gaps = 8/91 (9%)
 Frame = +1

Query  346  GSSACSAPPSPHRLATPSCETPSTSSIRIT--------TGRYPRRSCLTCSKRSGDSRCT  501
            G    S      R+  P+CE      +R+          G+      +   K  GD RCT
Sbjct  120  GDGCISVEALMSRIGGPACEPAGDDELRVAFEFFDTDHDGKITAEELMGVYKAIGDERCT  179

Query  502  LEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            L+DCRRMI GVD NGDGFVCFEDF RMME Q
Sbjct  180  LDDCRRMIAGVDKNGDGFVCFEDFARMMELQ  210



>gb|KJB08532.1| hypothetical protein B456_001G087100 [Gossypium raimondii]
 gb|KJB08533.1| hypothetical protein B456_001G087100 [Gossypium raimondii]
Length=154

 Score = 48.1 bits (113),  Expect(3) = 2e-15, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = +2

Query  164  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
            G   E+ + F   D++ DGKI ++EL+++L+ +G+ P S E  R+M SE+D+DG+G + L
Sbjct  6    GSVEEMKKVFNKFDKNGDGKISRDELKSVLTALGSAPSSGEVDRIM-SEMDKDGNGYVDL  64

Query  344  E  346
            +
Sbjct  65   D  65


 Score = 43.1 bits (100),  Expect(3) = 2e-15, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 1/37 (3%)
 Frame = +1

Query  475  KRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            KR G+ +C+L DCRRMI  VD +GDG V F++F +MM
Sbjct  114  KRLGE-KCSLSDCRRMISQVDKDGDGNVNFDEFKKMM  149


 Score = 38.1 bits (87),  Expect(3) = 2e-15, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = +3

Query  390  DSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            + EL+DAFD +D D +G ISA EL  V K +G
Sbjct  86   NKELKDAFDMYDLDKNGLISANELHAVLKRLG  117



>ref|XP_006407598.1| hypothetical protein EUTSA_v10021512mg [Eutrema salsugineum]
 gb|ESQ49051.1| hypothetical protein EUTSA_v10021512mg [Eutrema salsugineum]
Length=211

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 60/84 (71%), Gaps = 4/84 (5%)
 Frame = +2

Query  95   GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  274
            GG  TPTS+LP ++ + SP      Y E++ AF+LIDRD+DG + + +L +LLS++G +P
Sbjct  49   GGSVTPTSILPEVSGDPSPYS----YVEILHAFQLIDRDNDGAVTRRDLSSLLSRLGPDP  104

Query  275  PSREELRLMLSEVDRDGDGCISLE  346
            PS EE+ +ML EVD DG+G I +E
Sbjct  105  PSEEEIDVMLREVDCDGEGTIRIE  128


 Score = 59.3 bits (142),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GD RCTLEDC+RMI  VD++G+GFVCF +F RMM+ +
Sbjct  174  GDERCTLEDCKRMIAAVDDDGNGFVCFSEFSRMMDLE  210


 Score = 42.4 bits (98),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 33/56 (59%), Gaps = 2/56 (4%)
 Frame = +3

Query  318  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            G  T+ +      V+SS  +  S  +EL++ F+FFD D DG ISAEEL  VF  IG
Sbjct  121  GEGTIRIEELASRVVSSDQSRDS--TELKETFEFFDADRDGFISAEELLRVFSAIG  174



>ref|XP_003544994.1| PREDICTED: probable calcium-binding protein CML18-like [Glycine 
max]
Length=141

 Score = 45.1 bits (105),  Expect(3) = 2e-15, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            E+ Q F   D++ DGKI   EL+ +LS +G++    EEL+ M+ E+D++GDG I L+
Sbjct  4    EVQQIFNKFDKNGDGKISMAELKDMLSALGSKTTD-EELKRMIEELDQNGDGFIDLK  59


 Score = 43.9 bits (102),  Expect(3) = 2e-15, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             +C+L DCRRMI  VD +GDG V FE+F +MM
Sbjct  107  EKCSLSDCRRMISNVDGDGDGNVNFEEFKKMM  138


 Score = 40.0 bits (92),  Expect(3) = 2e-15, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +3

Query  393  SELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
             ELRDAFD +D D +G ISA+EL +V + +G
Sbjct  76   KELRDAFDLYDVDKNGLISAKELHHVLRNLG  106



>gb|KCW78265.1| hypothetical protein EUGRSUZ_D02448, partial [Eucalyptus grandis]
Length=142

 Score = 50.4 bits (119),  Expect(3) = 2e-15, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 41/64 (64%), Gaps = 2/64 (3%)
 Frame = +2

Query  161  SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG--AEPPSREELRLMLSEVDRDGDGC  334
            S + A+L Q F+LID D DGKI   EL  +LS +G      + EE R+M+ E+DRDGDG 
Sbjct  1    SEVSAQLRQVFELIDADGDGKISPTELSRVLSGLGHVGAAAADEEARVMVKEIDRDGDGR  60

Query  335  ISLE  346
            + L+
Sbjct  61   VDLD  64


 Score = 45.8 bits (107),  Expect(3) = 2e-15, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
              ++EDCRRMI GVD +GDGFV FE+F  MM
Sbjct  107  EASIEDCRRMIRGVDTDGDGFVNFEEFRSMM  137


 Score = 32.7 bits (73),  Expect(3) = 2e-15, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 22/37 (59%), Gaps = 0/37 (0%)
 Frame = +3

Query  372  FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  482
             A  S D +L DAF  FD + DG ISA+EL  V + +
Sbjct  68   VAVLSGDDDLMDAFLIFDANKDGLISAKELQRVLQGV  104



>ref|XP_003637661.1| Calcium-binding pollen allergen [Medicago truncatula]
 gb|KEH40591.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=198

 Score = 46.6 bits (109),  Expect(3) = 2e-15, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            +L   F+  D + DGKI   EL +++  +G +P + EEL  M+ EVD DGDG I+LE
Sbjct  46   DLEHVFRKFDVNGDGKISSSELGSIMGSLG-QPATEEELDNMIREVDADGDGHINLE  101


 Score = 43.1 bits (100),  Expect(3) = 2e-15, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            +C+L +C++MI GVD++GDG + FE+F +MM
Sbjct  150  QCSLAECQKMIGGVDSDGDGMIDFEEFKKMM  180


 Score = 38.5 bits (88),  Expect(3) = 2e-15, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = +3

Query  378  PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            P      L+DAF  FD D +G ISAEEL NV  ++G
Sbjct  113  PNEILENLKDAFSVFDIDKNGSISAEELHNVMVSLG  148



>ref|XP_006346894.1| PREDICTED: probable calcium-binding protein CML18-like [Solanum 
tuberosum]
Length=145

 Score = 43.9 bits (102),  Expect(3) = 3e-15, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             +C+L+DCRRMI  VD +GDG V FE+F +MM
Sbjct  111  EKCSLKDCRRMISSVDVDGDGSVNFEEFKKMM  142


 Score = 42.4 bits (98),  Expect(3) = 3e-15, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 37/64 (58%), Gaps = 1/64 (2%)
 Frame = +2

Query  155  ELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGC  334
            +L+    E+ + F+  D + DGKI   EL+ +L  +G +    E  R+ML EVD DGDG 
Sbjct  3    KLTARMKEVEKVFRKFDTNGDGKISLLELDEVLKALGTKTTPDEAKRMML-EVDTDGDGF  61

Query  335  ISLE  346
            I LE
Sbjct  62   IDLE  65


 Score = 42.4 bits (98),  Expect(3) = 3e-15, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 28/43 (65%), Gaps = 3/43 (7%)
 Frame = +3

Query  366  SAFAPP---SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            +AF  P   S   +LRDAFD +D D +GKISA EL +V K IG
Sbjct  68   AAFHCPVEGSNSKDLRDAFDLYDKDKNGKISAAELHSVMKGIG  110



>ref|XP_009334418.1| PREDICTED: probable calcium-binding protein CML23 [Pyrus x bretschneideri]
Length=154

 Score = 49.7 bits (117),  Expect(3) = 3e-15, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +2

Query  131  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  310
            L+ + S D  +G   EL + F   D++ DG+I  EEL  +   +G+E  S EE++ +++E
Sbjct  6    LDSKGSGDGAAGSMEELKKVFDKFDKNGDGRISCEELRGVFGDLGSETASLEEVQRIMAE  65

Query  311  VDRDGDGCISL  343
             D+DGDG I +
Sbjct  66   FDKDGDGHIDI  76


 Score = 40.0 bits (92),  Expect(3) = 3e-15, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 1/37 (3%)
 Frame = +1

Query  475  KRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            KR G  +C+L+DC +MI  VD +GDG V F +F +MM
Sbjct  116  KRLG-QKCSLKDCAKMISSVDADGDGHVNFAEFKKMM  151


 Score = 38.5 bits (88),  Expect(3) = 3e-15, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIGR  488
            ELRDAFD +D D +G IS  EL  V K +G+
Sbjct  90   ELRDAFDLYDLDKNGLISTSELHEVLKRLGQ  120



>ref|XP_010043960.1| PREDICTED: probable calcium-binding protein CML25 [Eucalyptus 
grandis]
 gb|KCW85969.1| hypothetical protein EUGRSUZ_B02672 [Eucalyptus grandis]
Length=194

 Score = 48.1 bits (113),  Expect(3) = 3e-15, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL Q F+  D + DGKI   EL +++S +G  P + EEL  M+ EVD DGDG I  +
Sbjct  43   ELEQVFRKFDANGDGKISASELGSIMSSLG-HPETEEELAKMVREVDSDGDGFIDFD  98


 Score = 40.4 bits (93),  Expect(3) = 3e-15, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RS     +L +CR+MI GVD++GDG + FE+F  MM
Sbjct  142  RSLGEENSLAECRKMIGGVDSDGDGMISFEEFKVMM  177


 Score = 39.7 bits (91),  Expect(3) = 3e-15, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = +3

Query  378  PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            P      LRDAF  +D D DG I+AEEL  V +++G
Sbjct  110  PAEAMENLRDAFSVYDIDGDGSITAEELHKVMRSLG  145



>gb|EYU46532.1| hypothetical protein MIMGU_mgv1a021796mg [Erythranthe guttata]
Length=150

 Score = 51.6 bits (122),  Expect(3) = 3e-15, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            AE  +AF LID+D DG I  EEL AL  Q   E P+ EE++ M++E D DGDG +  E
Sbjct  11   AEFREAFSLIDKDSDGVITVEEL-ALAIQSLNEHPTSEEIQEMVNEADSDGDGTVDFE  67


 Score = 38.9 bits (89),  Expect(3) = 3e-15, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 27/48 (56%), Gaps = 0/48 (0%)
 Frame = +3

Query  345  REFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGR  488
             EF ++ S+    +   E++DAF  FD D DG ISA EL NV   +G 
Sbjct  67   EEFLIVMSSKMKENVVEEIKDAFKVFDRDQDGFISAIELRNVMINMGE  114


 Score = 37.7 bits (86),  Expect(3) = 3e-15, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             R T E+  +MI  VD +GDG V ++DF +MM
Sbjct  114  ERLTEEEAEQMINEVDLDGDGLVSYDDFVKMM  145



>ref|XP_009379268.1| PREDICTED: probable calcium-binding protein CML25 [Pyrus x bretschneideri]
 ref|XP_009347046.1| PREDICTED: probable calcium-binding protein CML25 [Pyrus x bretschneideri]
Length=205

 Score = 44.3 bits (103),  Expect(3) = 4e-15, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 40/64 (63%), Gaps = 1/64 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP-SREELRLMLSEVDRDGDGCISLEG  349
            ++  Q F+++D + DGKI   EL A+LS +G +   + EE   ++ E+DR+GDGCI L+ 
Sbjct  50   SQFRQVFEVMDANGDGKISPLELSAVLSCLGNKKSIAAEEAEGIVREMDRNGDGCIDLDE  109

Query  350  VQRA  361
               A
Sbjct  110  FMNA  113


 Score = 42.0 bits (97),  Expect(3) = 4e-15, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +3

Query  363  SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            S  F     DSEL DAF  FDTD +GKISA+EL  V  ++G
Sbjct  126  SVGFGNEEEDSELMDAFRIFDTDKNGKISAKELQRVLFSLG  166


 Score = 41.6 bits (96),  Expect(3) = 4e-15, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +1

Query  496  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            C+L +CR+MI GVD NGDG V FE+F  MM
Sbjct  170  CSLRECRQMIKGVDRNGDGAVDFEEFRLMM  199


 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            +EL+ AF++ D D +GKI  +EL+ +L  +G +  S  E R M+  VDR+GDG +  E
Sbjct  136  SELMDAFRIFDTDKNGKISAKELQRVLFSLGCKECSLRECRQMIKGVDRNGDGAVDFE  193



>ref|XP_008378130.1| PREDICTED: probable calcium-binding protein CML23 [Malus domestica]
Length=154

 Score = 50.1 bits (118),  Expect(3) = 4e-15, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = +2

Query  146  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDG  325
            S D  +G   EL + F   D++ DG+I  +EL  +   +G+E  S EE++ +++E D+DG
Sbjct  11   SGDGAAGSMEELKKVFDKFDKNGDGRISCDELRGVFGDLGSETASLEEVQRIMAEFDKDG  70

Query  326  DGCISLE  346
            DG I +E
Sbjct  71   DGHIDIE  77


 Score = 39.3 bits (90),  Expect(3) = 4e-15, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 1/37 (3%)
 Frame = +1

Query  475  KRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            KR G  +C+L+DC +MI  VD +GDG V F +F +MM
Sbjct  116  KRLG-QKCSLKDCAKMISSVDVDGDGHVNFAEFKKMM  151


 Score = 38.5 bits (88),  Expect(3) = 4e-15, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIGR  488
            ELRDAFD +D D +G IS  EL  V K +G+
Sbjct  90   ELRDAFDLYDLDKNGLISTSELHEVLKRLGQ  120



>ref|XP_006357771.1| PREDICTED: calcium-binding protein CML24-like [Solanum tuberosum]
Length=156

 Score = 43.1 bits (100),  Expect(3) = 4e-15, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  REFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            +EF+         S + ELR+AFD +D D +GKI+A EL +V K++G
Sbjct  75   KEFAAFYCPGGADSDNKELREAFDLYDKDKNGKITAAELHSVMKSLG  121


 Score = 42.7 bits (99),  Expect(3) = 4e-15, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            +C+L+DCRRMI  VD +GDG V FE+F +MM
Sbjct  123  KCSLKDCRRMISKVDVDGDGCVNFEEFKKMM  153


 Score = 42.0 bits (97),  Expect(3) = 4e-15, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            E+ + F+  D + DGKI   EL A+L+ +G++    E  R+ML EVD DGDG I L+
Sbjct  20   EVEKVFRKFDANGDGKISLSELGAILNALGSKTSPDEVKRIML-EVDTDGDGFIDLK  75


 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGVQ  355
            EL +AF L D+D +GKI   EL +++  +G E  S ++ R M+S+VD DGDGC++ E  +
Sbjct  92   ELREAFDLYDKDKNGKITAAELHSVMKSLG-EKCSLKDCRRMISKVDVDGDGCVNFEEFK  150

Query  356  R  358
            +
Sbjct  151  K  151



>ref|XP_009804163.1| PREDICTED: calcium-binding protein CML24-like [Nicotiana sylvestris]
Length=158

 Score = 43.5 bits (101),  Expect(3) = 5e-15, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            E+ + F+  D + DGKI   EL A+L+ +G+     E  R+ML EVD DGDG I L+
Sbjct  20   EVAKVFRKFDTNGDGKISLSELGAILNALGSTTSPDEVKRIML-EVDTDGDGFIDLK  75


 Score = 43.1 bits (100),  Expect(3) = 5e-15, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            +C+L+DCRRMI  VD +GDG V FE+F +MM
Sbjct  125  KCSLKDCRRMISSVDVDGDGCVNFEEFKKMM  155


 Score = 41.2 bits (95),  Expect(3) = 5e-15, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            ELR+AFD +D D +GKI+A EL +V K++G
Sbjct  94   ELREAFDLYDKDKNGKITAAELHSVMKSLG  123


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGVQ  355
            EL +AF L D+D +GKI   EL +++  +G E  S ++ R M+S VD DGDGC++ E  +
Sbjct  94   ELREAFDLYDKDKNGKITAAELHSVMKSLG-EKCSLKDCRRMISSVDVDGDGCVNFEEFK  152

Query  356  R  358
            +
Sbjct  153  K  153



>emb|CDP16307.1| unnamed protein product [Coffea canephora]
Length=189

 Score = 44.7 bits (104),  Expect(3) = 5e-15, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 34/57 (60%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL Q FK  D + DGKI   EL  ++  +G  P + EEL  +++E D DGDG I L+
Sbjct  42   ELEQVFKKFDVNGDGKISASELGQIMGSLGY-PTTDEELHKLMNEADSDGDGFIDLQ  97


 Score = 44.3 bits (103),  Expect(3) = 5e-15, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            +S    C+L +CR+MI GVD +GDG +CFE+F  MM
Sbjct  141  KSLGEECSLAECRKMICGVDADGDGMICFEEFKVMM  176


 Score = 38.9 bits (89),  Expect(3) = 5e-15, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  FD D +G ISA+EL NV K++G
Sbjct  116  LKDAFSVFDIDKNGSISADELQNVLKSLG  144



>ref|XP_008464718.1| PREDICTED: probable calcium-binding protein CML25 [Cucumis melo]
Length=185

 Score = 45.4 bits (106),  Expect(3) = 5e-15, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            AEL + FK  D + DGKI   EL ++++ +G    + EEL  M+ E D DGDG I+L 
Sbjct  41   AELEEVFKKFDVNGDGKISSAELGSIMTSLG-HNATEEELGKMIEEFDADGDGFINLH  97


 Score = 45.1 bits (105),  Expect(3) = 5e-15, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RS    C++ DCR+MI GVD+NGDG + FE+F  MM
Sbjct  141  RSLGDDCSVADCRQMISGVDSNGDGMISFEEFKVMM  176


 Score = 37.4 bits (85),  Expect(3) = 5e-15, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = +3

Query  378  PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            P      LR+AF  +D D +G ISAEEL  V +++G
Sbjct  109  PEELLENLREAFSVYDIDGNGSISAEELHKVLRSLG  144



>ref|XP_009628802.1| PREDICTED: probable calcium-binding protein CML18 [Nicotiana 
tomentosiformis]
Length=158

 Score = 43.1 bits (100),  Expect(3) = 6e-15, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            E+ + F+  D + DGKI   EL A+L+ +G+     E  R+ML EVD DGDG I L+
Sbjct  20   EVAKVFRKFDANGDGKISLSELGAILNALGSTTSPDEVKRIML-EVDTDGDGFIDLK  75


 Score = 43.1 bits (100),  Expect(3) = 6e-15, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            +C+L+DCRRMI  VD +GDG V FE+F +MM
Sbjct  125  KCSLKDCRRMISSVDVDGDGCVNFEEFKKMM  155


 Score = 41.2 bits (95),  Expect(3) = 6e-15, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            ELR+AFD +D D +GKI+A EL +V K++G
Sbjct  94   ELREAFDLYDKDKNGKITAAELHSVMKSLG  123


 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGVQ  355
            EL +AF L D+D +GKI   EL +++  +G E  S ++ R M+S VD DGDGC++ E  +
Sbjct  94   ELREAFDLYDKDKNGKITAAELHSVMKSLG-EKCSLKDCRRMISSVDVDGDGCVNFEEFK  152

Query  356  R  358
            +
Sbjct  153  K  153



>ref|XP_008343178.1| PREDICTED: probable calcium-binding protein CML18 [Malus domestica]
Length=205

 Score = 44.3 bits (103),  Expect(3) = 6e-15, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 40/64 (63%), Gaps = 1/64 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP-SREELRLMLSEVDRDGDGCISLEG  349
            ++  Q F+++D + DGKI   EL A+LS +G +   + EE   ++ E+DR+GDGCI L+ 
Sbjct  50   SQFRQVFEVMDANGDGKISPLELSAVLSCLGNKKSIAAEEAEGIVREMDRNGDGCIDLDE  109

Query  350  VQRA  361
               A
Sbjct  110  FMNA  113


 Score = 41.6 bits (96),  Expect(3) = 6e-15, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +3

Query  363  SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            S  F     D EL DAF  FDTD +GKISA+EL  V  ++G
Sbjct  126  SVGFGNEEEDCELMDAFRIFDTDKNGKISAKELQRVLVSLG  166


 Score = 41.6 bits (96),  Expect(3) = 6e-15, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +1

Query  496  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            C+L +CR+MI GVD NGDG V FE+F  MM
Sbjct  170  CSLRECRQMIKGVDRNGDGAVDFEEFRLMM  199


 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
             EL+ AF++ D D +GKI  +EL+ +L  +G +  S  E R M+  VDR+GDG +  E
Sbjct  136  CELMDAFRIFDTDKNGKISAKELQRVLVSLGCKECSLRECRQMIKGVDRNGDGAVDFE  193



>gb|AFK34900.1| unknown [Lotus japonicus]
Length=196

 Score = 45.8 bits (107),  Expect(3) = 6e-15, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL + F+  D + DGKI   EL +++  +G +  ++EEL  M+ EVD DGDG ISLE
Sbjct  51   ELEKVFEKFDVNRDGKISSSELGSIMGSLG-QSATKEELDNMIREVDSDGDGYISLE  106


 Score = 42.4 bits (98),  Expect(3) = 6e-15, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             C+LE+C++MI GVD++GDG + FE+F  MM
Sbjct  155  ECSLEECQKMIGGVDSDGDGMIDFEEFRTMM  185


 Score = 38.9 bits (89),  Expect(3) = 6e-15, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = +3

Query  378  PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            P      LRDAF  FD D +G I+AEEL NV  ++G
Sbjct  118  PNEILENLRDAFSVFDIDGNGSITAEELHNVMASLG  153



>gb|KFK38406.1| hypothetical protein AALP_AA3G109000 [Arabis alpina]
Length=196

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 58/79 (73%), Gaps = 6/79 (8%)
 Frame = +2

Query  110  PTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREE  289
            PTS+LP    EISP   S  Y E++++F LIDR++DG I K +LE+LLS++G EP + EE
Sbjct  41   PTSILP----EISPSPYS--YVEILKSFSLIDRNNDGAISKHDLESLLSKLGPEPLTEEE  94

Query  290  LRLMLSEVDRDGDGCISLE  346
            + +M+ EVDRDGDG I LE
Sbjct  95   IDVMIKEVDRDGDGTIRLE  113


 Score = 56.2 bits (134),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GD RCTL+DC+RMI  VD +G+GFVCF +F RMM+ Q
Sbjct  159  GDERCTLDDCKRMIADVDVDGNGFVCFTEFSRMMDLQ  195


 Score = 46.6 bits (109),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 33/56 (59%), Gaps = 2/56 (4%)
 Frame = +3

Query  318  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            G  T+ L      V+S    P    +EL++ F+FFD D DG ISAEEL  VF+TIG
Sbjct  106  GDGTIRLEELASRVVS--LDPCRDSTELKETFEFFDADRDGMISAEELLRVFETIG  159



>ref|XP_003519336.1| PREDICTED: probable calcium-binding protein CML18-like [Glycine 
max]
Length=141

 Score = 43.5 bits (101),  Expect(3) = 7e-15, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
             E+ Q F   D++ DGKI   EL+ +L+ +G++    EEL+ M+ E+D++GDG I L+
Sbjct  3    VEVRQIFNKFDKNGDGKISVTELKDMLAALGSKTTD-EELKRMMEELDQNGDGFIDLK  59


 Score = 43.5 bits (101),  Expect(3) = 7e-15, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             +C+L DCRRMI  VD +GDG V FE+F +MM
Sbjct  107  EKCSLSDCRRMISNVDADGDGNVNFEEFKKMM  138


 Score = 40.4 bits (93),  Expect(3) = 7e-15, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +3

Query  393  SELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
             ELRDAFD +D D +G ISA+EL +V + +G
Sbjct  76   KELRDAFDLYDVDKNGLISAKELHDVLRNLG  106



>ref|XP_007160425.1| hypothetical protein PHAVU_002G320800g [Phaseolus vulgaris]
 gb|ESW32419.1| hypothetical protein PHAVU_002G320800g [Phaseolus vulgaris]
Length=188

 Score = 50.1 bits (118),  Expect(3) = 7e-15, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = +2

Query  167  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            +  EL Q FK  D + DGKI   EL +++  +G E  + +E+  M+ EVD DGDGCISL+
Sbjct  32   MAGELEQVFKKFDVNGDGKISASELGSIMRSLGQEA-TEQEVDNMIREVDGDGDGCISLQ  90


 Score = 41.6 bits (96),  Expect(3) = 7e-15, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  463  LTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            L    RS    C+L +CRRMI GVD +GDG + FE+F  MM
Sbjct  129  LNTVMRSLGEECSLAECRRMIGGVDRDGDGTIDFEEFRVMM  169


 Score = 35.4 bits (80),  Expect(3) = 7e-15, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  FD D +G I+AEEL  V +++G
Sbjct  109  LKDAFSVFDMDGNGLITAEELNTVMRSLG  137



>ref|XP_008457589.1| PREDICTED: probable calcium-binding protein CML36 [Cucumis melo]
Length=192

 Score = 63.2 bits (152),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GR          +  GD +CTLEDCRRMI  VD NGDGFVCF +F RMME Q
Sbjct  140  GRITAEELHGVFRSIGDEQCTLEDCRRMIRDVDENGDGFVCFAEFVRMMELQ  191


 Score = 43.9 bits (102),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 4/47 (9%)
 Frame = +2

Query  206  RDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            R+++G + ++ELEA+LS++ +E    EE+ +MLSEVD  GDG I LE
Sbjct  68   RENEGVVTRKELEAILSRIASE----EEVAMMLSEVDSGGDGFIRLE  110



>ref|XP_006583713.1| PREDICTED: probable calcium-binding protein CML25-like [Glycine 
max]
Length=182

 Score = 47.8 bits (112),  Expect(3) = 8e-15, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            +L   FK  D + DGKI   EL +++  +G +P + EEL+ ++ EVD DGDG I+LE
Sbjct  42   DLEYVFKKFDANGDGKISASELGSMMKSLG-QPATEEELKKLIREVDSDGDGHINLE  97


 Score = 45.1 bits (105),  Expect(3) = 8e-15, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 1/34 (3%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            GD+ C++E+CR+MI GVD NGDG + F++F  MM
Sbjct  144  GDA-CSIEECRKMIAGVDGNGDGMINFDEFQIMM  176


 Score = 33.9 bits (76),  Expect(3) = 8e-15, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = +3

Query  345  REFSVLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
             EF+ L++    P      L+DAF  FD D +G I+AEEL  V  ++G
Sbjct  97   EEFTELNTKDVDPDEVLENLKDAFSIFDLDGNGSITAEELKMVMASLG  144



>ref|XP_007215081.1| hypothetical protein PRUPE_ppa012612mg [Prunus persica]
 gb|EMJ16280.1| hypothetical protein PRUPE_ppa012612mg [Prunus persica]
Length=161

 Score = 47.8 bits (112),  Expect(3) = 9e-15, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
            +L   F   D++ DGKI  +EL  +  ++G++  S EE+R +++E DRDGDG I +
Sbjct  28   QLETIFNKFDKNGDGKISCDELRGVFGELGSDTSSLEEVRSIMAEFDRDGDGHIDI  83


 Score = 40.4 bits (93),  Expect(3) = 9e-15, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            +C+L+DC +MI  VD +GDG V F++F +MM
Sbjct  128  KCSLQDCVKMIRNVDADGDGHVNFDEFKKMM  158


 Score = 38.1 bits (87),  Expect(3) = 9e-15, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = +3

Query  393  SELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
             ELRDAFD +D D +G IS  EL  V K +G
Sbjct  96   QELRDAFDLYDLDKNGLISVSELHEVMKRLG  126



>ref|XP_011084270.1| PREDICTED: calcium-binding allergen Ole e 8-like [Sesamum indicum]
Length=160

 Score = 44.3 bits (103),  Expect(3) = 1e-14, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 5/56 (9%)
 Frame = +3

Query  348  EFSVLSSAFAPPS----CDSELRDAFDFFDTDHDGKISAEELFNVFKTIG-RLAVH  500
            EF+V  SA + PS     + ELR+AFD +D DHDG+IS  EL  +   +G R +V+
Sbjct  76   EFAVFCSADSDPSGGGNSEKELREAFDLYDQDHDGQISKTELHLILTRLGERCSVN  131


 Score = 42.0 bits (97),  Expect(3) = 1e-14, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RC++ DC  MI  VD++GDGFV F++F +MM
Sbjct  127  RCSVNDCSEMIRSVDSDGDGFVSFDEFRKMM  157


 Score = 40.0 bits (92),  Expect(3) = 1e-14, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (60%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            E+ + F   D + DGKI  +EL  ++  +G+E  + E  R M+ E+D D DG ISLE
Sbjct  20   EVKRVFDRFDANGDGKISSDELGGVIEALGSETSADEVAR-MMEEIDTDKDGFISLE  75



>ref|XP_002279679.1| PREDICTED: probable calcium-binding protein CML23 [Vitis vinifera]
Length=204

 Score = 46.2 bits (108),  Expect(3) = 1e-14, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            +C+L++C+RMI GVD +GDGFV FE+F  MM
Sbjct  165  KCSLQECKRMIKGVDKDGDGFVDFEEFRSMM  195


 Score = 42.4 bits (98),  Expect(3) = 1e-14, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 36/64 (56%), Gaps = 1/64 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSR-EELRLMLSEVDRDGDGCISLEGV  352
            +L Q F+L+D + DGKI   EL  +L  +G E  +  EE   M+ EVD +GDG I L+  
Sbjct  55   QLKQVFRLLDTNGDGKISSFELSEVLLWLGQEKSTAVEEAEGMVREVDCNGDGFIDLDEF  114

Query  353  QRAQ  364
             R  
Sbjct  115  MRVM  118


 Score = 38.1 bits (87),  Expect(3) = 1e-14, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +3

Query  375  APPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            +  +CD  L DAF  FD+D +G ISAEEL  V  ++G
Sbjct  126  SSSTCDDGLMDAFLIFDSDKNGVISAEELQRVLISLG  162



>gb|AET05414.2| EF hand calcium-binding family protein [Medicago truncatula]
Length=190

 Score = 51.6 bits (122),  Expect(3) = 1e-14, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = +2

Query  167  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            L  EL + FK  D + DGKI   EL +++  +G +  S +EL  M+ EVD DGDGCISL+
Sbjct  33   LAGELEEVFKKFDVNGDGKISASELGSIMGSLG-QQTSEQELNNMIREVDGDGDGCISLQ  91


 Score = 39.3 bits (90),  Expect(3) = 1e-14, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  463  LTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDF  573
            L    RS    C+L +CR+MI GVD++GDG + FE+F
Sbjct  130  LNTVMRSLGEECSLAECRKMIGGVDSDGDGTIDFEEF  166


 Score = 35.0 bits (79),  Expect(3) = 1e-14, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  FD D +G I+AEEL  V +++G
Sbjct  110  LKDAFAVFDMDGNGSITAEELNTVMRSLG  138



>ref|XP_003630938.1| Calcium-binding pollen allergen [Medicago truncatula]
Length=188

 Score = 52.0 bits (123),  Expect(3) = 1e-14, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = +2

Query  167  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            L  EL + FK  D + DGKI   EL +++  +G +  S +EL  M+ EVD DGDGCISL+
Sbjct  31   LAGELEEVFKKFDVNGDGKISASELGSIMGSLG-QQTSEQELNNMIREVDGDGDGCISLQ  89


 Score = 38.9 bits (89),  Expect(3) = 1e-14, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  463  LTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDF  573
            L    RS    C+L +CR+MI GVD++GDG + FE+F
Sbjct  128  LNTVMRSLGEECSLAECRKMIGGVDSDGDGTIDFEEF  164


 Score = 35.0 bits (79),  Expect(3) = 1e-14, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  FD D +G I+AEEL  V +++G
Sbjct  108  LKDAFAVFDMDGNGSITAEELNTVMRSLG  136



>ref|XP_004971250.1| PREDICTED: probable calcium-binding protein CML10-like [Setaria 
italica]
Length=235

 Score = 47.0 bits (110),  Expect(3) = 1e-14, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            E+ + F+  D + DG+I + EL AL   +G    S +EL  M++E D DGDG ISL+
Sbjct  90   EMARVFRKFDANGDGRISRSELAALFESLG-HAASDDELARMMAEADADGDGFISLD  145


 Score = 42.7 bits (99),  Expect(3) = 1e-14, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +1

Query  496  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             ++  CRRMI GVD NGDG + FE+F  MM
Sbjct  196  ASVAQCRRMIEGVDQNGDGLISFEEFKVMM  225


 Score = 36.2 bits (82),  Expect(3) = 1e-14, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 28/48 (58%), Gaps = 2/48 (4%)
 Frame = +3

Query  348  EFSVLSSAFA--PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            EF+ L++  A    + + +LR AF  FD D +G ISA EL  V + +G
Sbjct  146  EFAALNATVAGDAAAVEEDLRHAFRVFDADGNGTISATELARVLRGLG  193



>gb|AAZ20284.1| calcium-binding pollen allergen [Arachis hypogaea]
Length=164

 Score = 47.0 bits (110),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +2

Query  167  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            + AEL Q F   D + DGKI   EL A++  +G +  + +EL  ML EVD DGDG ISL+
Sbjct  9    MAAELEQVFHKFDVNGDGKIDASELGAVMGSLG-QKATEQELINMLREVDGDGDGYISLQ  67


 Score = 45.1 bits (105),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  463  LTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            L    RS    CTL +CRRMI GVD++GDG + FE+F  MM
Sbjct  106  LNTVMRSLGEECTLAECRRMISGVDSDGDGMIDFEEFRVMM  146


 Score = 33.9 bits (76),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L++AF  FD D +G I+AEEL  V +++G
Sbjct  86   LKEAFSVFDIDGNGSITAEELNTVMRSLG  114



>ref|XP_003524362.1| PREDICTED: probable calcium-binding protein CML25-like [Glycine 
max]
Length=188

 Score = 49.3 bits (116),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
            EL Q F   D + DGKI   EL +++  +G +P +  EL  M+ EVD DGDGCISL
Sbjct  36   ELEQVFNKFDVNGDGKISASELGSIMGSLG-QPATELELDNMIREVDGDGDGCISL  90


 Score = 41.6 bits (96),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  463  LTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            L    RS    C+L +CRRMI GVD +GDG + FE+F  MM
Sbjct  130  LNTVMRSLGEDCSLAECRRMISGVDGDGDGTIDFEEFRVMM  170


 Score = 35.0 bits (79),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  FD D +G I+AEEL  V +++G
Sbjct  110  LKDAFAVFDIDGNGSITAEELNTVMRSLG  138



>ref|XP_009770094.1| PREDICTED: calmodulin-like [Nicotiana sylvestris]
Length=147

 Score = 56.2 bits (134),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 49/72 (68%), Gaps = 5/72 (7%)
 Frame = +2

Query  131  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  310
            + D +S D++S    EL +AF +ID+D DG IR EEL A++  +  E P++EE++ M++E
Sbjct  1    MADALSEDQIS----ELREAFWVIDKDCDGVIRMEELAAVIQSLN-EHPTKEEIQEMVNE  55

Query  311  VDRDGDGCISLE  346
            VD DGDG I  E
Sbjct  56   VDPDGDGTIDFE  67


 Score = 35.8 bits (81),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 21/34 (62%), Gaps = 0/34 (0%)
 Frame = +3

Query  384  SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            +   EL++AF  FD D DG ISA EL NV   +G
Sbjct  80   NVSEELKEAFKVFDRDQDGFISANELRNVMMNLG  113


 Score = 33.5 bits (75),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             R T E+ ++MI   D +GDG V +E+F ++M
Sbjct  114  ERLTDEEAQQMIREADLDGDGLVSYEEFVKIM  145



>ref|XP_004230637.1| PREDICTED: calmodulin-like [Solanum lycopersicum]
Length=147

 Score = 55.8 bits (133),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 48/72 (67%), Gaps = 5/72 (7%)
 Frame = +2

Query  131  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  310
            + D ++ D++S    E  QAF +ID+D DG IR EEL +++  +  E P+REE++ M++E
Sbjct  1    MADALTEDQIS----EFRQAFWVIDKDCDGVIRIEELASVIQSLH-ENPTREEMQEMMNE  55

Query  311  VDRDGDGCISLE  346
            VD DGDG I  E
Sbjct  56   VDPDGDGTIDFE  67


 Score = 35.8 bits (81),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = +3

Query  393  SELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
             EL++AF  FD D DG ISA EL NV   +G
Sbjct  83   EELKEAFKVFDRDQDGFISANELRNVMMNLG  113


 Score = 33.9 bits (76),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             R T E+ ++MI   D +GDG V +E+F ++M
Sbjct  114  ERLTEEEAQQMIREADLDGDGLVSYEEFVKIM  145



>ref|XP_004231987.1| PREDICTED: calcium-binding protein CML24 [Solanum lycopersicum]
Length=156

 Score = 42.7 bits (99),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            +C+L+DCRRMI  VD +GDG V FE+F +MM
Sbjct  123  KCSLKDCRRMISKVDVDGDGCVNFEEFKKMM  153


 Score = 42.0 bits (97),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  REFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            +EF+           + ELR+AFD +D D +GKI+A EL +V K++G
Sbjct  75   KEFAAFYCPRGADGDNKELREAFDLYDKDKNGKITAAELHSVMKSLG  121


 Score = 41.2 bits (95),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 40/68 (59%), Gaps = 5/68 (7%)
 Frame = +2

Query  143  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRD  322
            +S  E+ G+     + F+  D + DGKI   EL A+L+ +G++    E  R+ML EVD D
Sbjct  13   VSSAEMDGVE----KVFRKFDANGDGKISLSELGAILNALGSKTSPDEVNRIML-EVDTD  67

Query  323  GDGCISLE  346
            GDG I L+
Sbjct  68   GDGFIDLK  75


 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGVQ  355
            EL +AF L D+D +GKI   EL +++  +G E  S ++ R M+S+VD DGDGC++ E  +
Sbjct  92   ELREAFDLYDKDKNGKITAAELHSVMKSLG-EKCSLKDCRRMISKVDVDGDGCVNFEEFK  150

Query  356  R  358
            +
Sbjct  151  K  151



>emb|CDY40786.1| BnaAnng06490D [Brassica napus]
 emb|CDY03874.1| BnaC07g10990D [Brassica napus]
Length=184

 Score = 48.1 bits (113),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL   FK  D + DGKI  +EL A+++ +G E P  EEL+  ++E+D+ GDG I+LE
Sbjct  34   ELEAVFKKFDVNGDGKISSKELGAIMASLGHEVP-EEELQKAVAEIDKKGDGYINLE  89


 Score = 40.8 bits (94),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RS    C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  133  RSLGDECSIAECRKMISGVDKDGDGTIDFEEFKVMM  168


 Score = 36.6 bits (83),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G ISAEEL  V +++G
Sbjct  108  LKDAFSVYDIDGNGSISAEELHEVLRSLG  136



>ref|XP_003580040.2| PREDICTED: probable calcium-binding protein CML22 [Brachypodium 
distachyon]
Length=265

 Score = 54.3 bits (129),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  337
            AEL + F+L+DR+ DG+I +EELE  L ++G   P  +EL  M++ +D DGDGC+
Sbjct  105  AELSRVFQLLDRNGDGRITREELEDCLGKLGIPVPG-DELAAMIARIDADGDGCV  158


 Score = 37.7 bits (86),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  499  TLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            T E+CRRMI  VD +GDG V F +F +MM
Sbjct  228  TAEECRRMIGQVDRDGDGRVDFHEFLQMM  256


 Score = 33.5 bits (75),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = +3

Query  390  DSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            D ++R+AF  FD + DG I+ EEL  V  ++G
Sbjct  191  DEDMREAFRVFDANGDGYITVEELGAVLASLG  222



>gb|KHN40730.1| Putative calcium-binding protein CML25 [Glycine soja]
Length=143

 Score = 47.0 bits (110),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            +L   FK  D + DGKI   EL +++  +G +P + EEL+ ++ EVD DGDG I+LE
Sbjct  3    DLEYVFKKFDANGDGKISASELGSMMKSLG-QPATEEELKKLIREVDSDGDGHINLE  58


 Score = 44.3 bits (103),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 1/34 (3%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            GD+ C++E+CR+MI GVD NGDG + F++F  MM
Sbjct  105  GDA-CSIEECRKMIAGVDGNGDGMINFDEFQIMM  137


 Score = 33.9 bits (76),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = +3

Query  345  REFSVLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
             EF+ L++    P      L+DAF  FD D +G I+AEEL  V  ++G
Sbjct  58   EEFTELNTKDVDPDEVLENLKDAFSIFDLDGNGSITAEELKMVMASLG  105



>ref|NP_173866.1| putative calcium-binding protein CML25 [Arabidopsis thaliana]
 sp|Q9FYK2.1|CML25_ARATH RecName: Full=Probable calcium-binding protein CML25; AltName: 
Full=Calmodulin-like protein 25 [Arabidopsis thaliana]
 gb|AAF97973.1|AC000103_23 F21J9.28 [Arabidopsis thaliana]
 gb|ABE65653.1| polcalcin [Arabidopsis thaliana]
 gb|AEE30554.1| putative calcium-binding protein CML25 [Arabidopsis thaliana]
Length=186

 Score = 48.5 bits (114),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL   FK  D + DGKI  +EL A+++ +G E P  EEL   ++E+DR GDG I+ E
Sbjct  37   ELEAVFKKFDVNGDGKISSKELGAIMTSLGHEVP-EEELEKAITEIDRKGDGYINFE  92


 Score = 40.0 bits (92),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RS    C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  136  RSLGDECSIAECRKMIGGVDKDGDGTIDFEEFKIMM  171


 Score = 36.6 bits (83),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G ISAEEL  V +++G
Sbjct  111  LKDAFSVYDIDGNGSISAEELHEVLRSLG  139



>ref|XP_002459097.1| hypothetical protein SORBIDRAFT_03g045770 [Sorghum bicolor]
 gb|EES04217.1| hypothetical protein SORBIDRAFT_03g045770 [Sorghum bicolor]
Length=189

 Score = 45.8 bits (107),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            E+ + F+  D + DG+I + EL AL   +G    S +E+  M++E D DGDG ISL+
Sbjct  44   EMARVFRKFDANGDGRISRSELAALFESLG-HAASDDEVARMMAEADADGDGFISLD  99


 Score = 43.1 bits (100),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +1

Query  496  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             ++  CRRMI GVD NGDG + FE+F  MM
Sbjct  150  ASVAQCRRMIEGVDQNGDGLISFEEFKVMM  179


 Score = 35.8 bits (81),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (57%), Gaps = 2/51 (4%)
 Frame = +3

Query  348  EFSVLSSAFA--PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGRLA  494
            EF+ L++  A    + + +LR AF  FD D +G ISA EL  V + +G  A
Sbjct  100  EFAALNATVAGDAAAVEEDLRHAFRVFDADGNGTISAAELARVLRGLGESA  150



>ref|NP_187630.1| putative calcium-binding protein CML36 [Arabidopsis thaliana]
 sp|Q9SS31.1|CML36_ARATH RecName: Full=Probable calcium-binding protein CML36; AltName: 
Full=Calmodulin-like protein 36 [Arabidopsis thaliana]
 gb|AAF02827.1|AC009400_23 calmodulin-like protein [Arabidopsis thaliana]
 gb|AAO24546.1| At3g10190 [Arabidopsis thaliana]
 dbj|BAF00087.1| calmodulin like protein [Arabidopsis thaliana]
 gb|AEE74869.1| putative calcium-binding protein CML36 [Arabidopsis thaliana]
Length=209

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 7/80 (9%)
 Frame = +2

Query  107  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  286
            TPTS+LP +    S       Y E++QAFKLIDRD+DG + + +LE+LLS++G +P + E
Sbjct  54   TPTSILPEVPSPYS-------YVEILQAFKLIDRDNDGAVSRHDLESLLSRLGPDPLTEE  106

Query  287  ELRLMLSEVDRDGDGCISLE  346
            E+ +ML EVD DGDG I LE
Sbjct  107  EINVMLKEVDCDGDGTIRLE  126


 Score = 59.7 bits (143),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GD RCTL+DC+RMI  VD +GDGFVCF +F RMM+ Q
Sbjct  172  GDERCTLDDCKRMIADVDEDGDGFVCFTEFSRMMDLQ  208


 Score = 44.3 bits (103),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 32/56 (57%), Gaps = 2/56 (4%)
 Frame = +3

Query  318  GTATVALASREFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            G  T+ L      V+S    P    +EL++ F+FFD D DG ISA+EL  VF TIG
Sbjct  119  GDGTIRLEELASRVVS--LDPARDSTELKETFEFFDADRDGLISADELLRVFSTIG  172



>ref|XP_008229213.1| PREDICTED: probable calcium-binding protein CML23 [Prunus mume]
Length=161

 Score = 47.0 bits (110),  Expect(3) = 3e-14, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
            +L   F   D++ DGKI  +EL  +  ++G++  S EE+R +++E DRDGDG I +
Sbjct  28   QLETIFNKFDKNGDGKISCDELRDVFGELGSDTSSLEEVRSIMAEFDRDGDGHIDI  83


 Score = 39.7 bits (91),  Expect(3) = 3e-14, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIGRLAVH  500
            ELRDAFD +D D +G ISA EL  V K +G    H
Sbjct  97   ELRDAFDLYDLDKNGLISASELHEVMKRLGLKCSH  131


 Score = 38.1 bits (87),  Expect(3) = 3e-14, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            +C+ +DC +MI  VD +GDG V F++F +MM
Sbjct  128  KCSHQDCVKMIRNVDADGDGHVNFDEFKKMM  158



>ref|XP_006852110.1| hypothetical protein AMTR_s00049p00017460 [Amborella trichopoda]
 gb|ERN13577.1| hypothetical protein AMTR_s00049p00017460 [Amborella trichopoda]
Length=839

 Score = 49.7 bits (117),  Expect(3) = 4e-14, Method: Composition-based stats.
 Identities = 22/58 (38%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            AEL + F++ DR+ DG+I K+EL   L  +G   P + +L  M+ ++D +GDGC+ ++
Sbjct  8    AELKRVFQMFDRNGDGRITKKELSDSLENLGIYIPDK-DLITMIEKIDANGDGCVDMD  64


 Score = 42.0 bits (97),  Expect(3) = 4e-14, Method: Composition-based stats.
 Identities = 17/29 (59%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +1

Query  499  TLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            T++DCRRMI  VD +GDG V F++F +MM
Sbjct  117  TVDDCRRMIRKVDKDGDGMVDFKEFKQMM  145


 Score = 32.7 bits (73),  Expect(3) = 4e-14, Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 28/47 (60%), Gaps = 1/47 (2%)
 Frame = +3

Query  348  EFSVL-SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            EFS L  S       + ++R+AF+ FD + DG I+ EEL +V  ++G
Sbjct  65   EFSSLYQSIMNEKDEEEDMREAFNVFDQNGDGFITVEELRSVLGSLG  111



>ref|XP_010271345.1| PREDICTED: probable calcium-binding protein CML25 [Nelumbo nucifera]
Length=190

 Score = 45.8 bits (107),  Expect(3) = 4e-14, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            GD +C++ DC++MI GVD +GDG + FE+F  MM
Sbjct  146  GDDKCSIADCKKMIRGVDCDGDGLISFEEFKNMM  179


 Score = 42.7 bits (99),  Expect(3) = 4e-14, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 34/60 (57%), Gaps = 1/60 (2%)
 Frame = +2

Query  167  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            L  EL   FK  D + DGKI   EL +++  +G  P + EEL+ M+  VD DG+G I L 
Sbjct  41   LVEELGAVFKKFDMNGDGKISWSELGSIMENLG-NPVTEEELQKMVKVVDLDGNGFIDLN  99


 Score = 36.2 bits (82),  Expect(3) = 4e-14, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            +LR AF  FDTD +G IS EEL  VF+++G
Sbjct  117  DLRHAFMIFDTDGNGSISPEELQAVFRSLG  146



>ref|XP_004960644.1| PREDICTED: probable calcium-binding protein CML18-like [Setaria 
italica]
Length=179

 Score = 45.1 bits (105),  Expect(3) = 4e-14, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
            AE+ Q F+  D + DGKI  EEL ++L  +GA PP   E+R M+ E+D D DG + L
Sbjct  30   AEVEQVFRRYDANGDGKISAEELASVLRALGA-PPGPGEVRRMMDEMDADRDGFVDL  85


 Score = 40.8 bits (94),  Expect(3) = 4e-14, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +3

Query  384  SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            + ++ELR+AF  +D DH+G ISA EL  V + +G
Sbjct  108  ATEAELREAFRMYDADHNGLISARELHRVLRQLG  141


 Score = 38.5 bits (88),  Expect(3) = 4e-14, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            +C++ DC RMI  VD +GDG V F++F +MM
Sbjct  143  KCSVADCSRMIRSVDADGDGSVNFDEFKKMM  173



>ref|XP_002890700.1| hypothetical protein ARALYDRAFT_335836 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66959.1| hypothetical protein ARALYDRAFT_335836 [Arabidopsis lyrata subsp. 
lyrata]
Length=192

 Score = 48.1 bits (113),  Expect(3) = 4e-14, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL   FK  D + DGKI  +EL A+++ +G E P  EEL   ++E+DR GDG I+ E
Sbjct  37   ELEAVFKKFDVNGDGKISSKELGAIMASLGHEVP-EEELEKAITEIDRKGDGYINFE  92


 Score = 40.0 bits (92),  Expect(3) = 4e-14, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RS    C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  136  RSLGDECSIAECRKMIGGVDKDGDGTIDFEEFKIMM  171


 Score = 36.2 bits (82),  Expect(3) = 4e-14, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G ISAEEL  V +++G
Sbjct  111  LKDAFSVYDIDGNGSISAEELHEVLRSLG  139



>ref|XP_001768532.1| predicted protein [Physcomitrella patens]
 gb|EDQ66683.1| predicted protein [Physcomitrella patens]
Length=176

 Score = 45.8 bits (107),  Expect(3) = 4e-14, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            GD   +LEDCR+MI  VD +GDG+V FE+F  +M
Sbjct  140  GDKGHSLEDCRQMINNVDKDGDGYVDFEEFQELM  173


 Score = 43.5 bits (101),  Expect(3) = 4e-14, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
            EL + FK+ D D DGKI   EL A+L+ +G      E ++LM  ++D + DG ISL
Sbjct  32   ELARVFKVYDADHDGKISLVELRAVLTTLGGAISEEEGVQLM-KDIDTNNDGFISL  86


 Score = 35.4 bits (80),  Expect(3) = 4e-14, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +3

Query  384  SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            S D  LRDAF  FD D D +ISA++L +V  ++G
Sbjct  107  SVDDPLRDAFQVFDKDGDKRISADDLQSVLVSLG  140



>ref|XP_006415824.1| hypothetical protein EUTSA_v10008816mg [Eutrema salsugineum]
 gb|ESQ34177.1| hypothetical protein EUTSA_v10008816mg [Eutrema salsugineum]
Length=198

 Score = 48.9 bits (115),  Expect(3) = 4e-14, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL   FK  D + DGKI  +EL A+++ +G E P  EEL+  ++E+DR GDG I+ E
Sbjct  50   ELEAVFKKFDVNGDGKISSKELGAIMANLGHEVPE-EELQKAITEIDRKGDGYINFE  105


 Score = 39.7 bits (91),  Expect(3) = 4e-14, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RS    C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  149  RSLGDDCSIAECRKMIGGVDKDGDGTIDFEEFKVMM  184


 Score = 35.8 bits (81),  Expect(3) = 4e-14, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G ISAEEL  V +++G
Sbjct  124  LKDAFSVYDIDGNGSISAEELHEVLRSLG  152



>ref|XP_007141898.1| hypothetical protein PHAVU_008G235100g [Phaseolus vulgaris]
 gb|ESW13892.1| hypothetical protein PHAVU_008G235100g [Phaseolus vulgaris]
Length=140

 Score = 43.9 bits (102),  Expect(3) = 5e-14, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             +C+L DCRRMI  VD +GDG V FE+F +MM
Sbjct  106  EKCSLSDCRRMISNVDADGDGSVNFEEFKKMM  137


 Score = 42.0 bits (97),  Expect(3) = 5e-14, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            E+ Q F   D++ DGKI   EL  +L  +G+   ++EEL+ ++ E+D++GDG I L+
Sbjct  4    EVRQIFNKFDKNGDGKISITELRDMLGTLGS-KTTKEELKRIMEELDQNGDGYIDLK  59


 Score = 38.9 bits (89),  Expect(3) = 5e-14, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +3

Query  393  SELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
             ELRDAFD +D D +G ISA+EL +V   +G
Sbjct  75   KELRDAFDLYDVDKNGLISAKELHDVLSKLG  105



>ref|XP_002312460.2| hypothetical protein POPTR_0008s13390g [Populus trichocarpa]
 gb|EEE89827.2| hypothetical protein POPTR_0008s13390g [Populus trichocarpa]
Length=172

 Score = 48.9 bits (115),  Expect(3) = 5e-14, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL Q FK  D + DGKI   EL++   ++G E  S EEL+ M++E D DGDG I L+
Sbjct  21   ELEQVFKKFDVNGDGKISSAELDSFWKKLGHEA-SEEELQRMITEFDADGDGFIDLQ  76


 Score = 40.0 bits (92),  Expect(3) = 5e-14, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +1

Query  496  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  126  CSMAECRKMISGVDRDGDGMIDFEEFKVMM  155


 Score = 35.0 bits (79),  Expect(3) = 5e-14, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G ISAEEL  V  ++G
Sbjct  95   LKDAFSVYDIDGNGSISAEELHKVMASLG  123


 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +2

Query  179  LVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            L  AF + D D +G I  EEL  +++ +G EP S  E R M+S VDRDGDG I  E
Sbjct  95   LKDAFSVYDIDGNGSISAEELHKVMASLG-EPCSMAECRKMISGVDRDGDGMIDFE  149



>ref|XP_010526084.1| PREDICTED: calmodulin-like protein 4 [Tarenaya hassleriana]
Length=208

 Score = 47.8 bits (112),  Expect(3) = 5e-14, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
             EL + F++ D++ DG+I KEEL   L  +G   P R EL  M+ ++D +GDGC+ ++
Sbjct  66   VELKRVFQMFDKNGDGRITKEELNDSLENLGLFLPDR-ELAQMIQKIDANGDGCVDMD  122


 Score = 39.3 bits (90),  Expect(3) = 5e-14, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  499  TLEDCRRMILGVDNNGDGFVCFEDFCRMME  588
            TLEDC++MI+ VD +GDG V +++F +MM+
Sbjct  175  TLEDCKKMIMQVDVDGDGRVNYKEFLQMMK  204


 Score = 37.0 bits (84),  Expect(3) = 5e-14, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 0/44 (0%)
 Frame = +3

Query  354  SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            S+  S       D ++RDAFD FD D DG I+ EEL +V  ++G
Sbjct  126  SLYKSIVDQSDKDDDMRDAFDVFDQDGDGFITVEELKSVMGSLG  169



>ref|XP_009103045.1| PREDICTED: probable calcium-binding protein CML25 [Brassica rapa]
Length=184

 Score = 46.6 bits (109),  Expect(3) = 5e-14, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL   FK  D + DGKI  +EL ++++ +G E P  EEL+  ++E+D+ GDG I+LE
Sbjct  34   ELEAVFKKFDVNGDGKISSKELGSIMASLGHEVP-EEELQKAVAEIDKKGDGYINLE  89


 Score = 40.8 bits (94),  Expect(3) = 5e-14, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RS    C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  133  RSLGDECSIAECRKMISGVDKDGDGTIDFEEFKVMM  168


 Score = 36.6 bits (83),  Expect(3) = 5e-14, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G ISAEEL  V +++G
Sbjct  108  LKDAFSVYDIDGNGSISAEELHEVLRSLG  136



>gb|KJB15360.1| hypothetical protein B456_002G172400 [Gossypium raimondii]
Length=197

 Score = 45.8 bits (107),  Expect(3) = 5e-14, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
            E+ + FK  D + DGKI   EL +++  +G + PS EEL  M+ E D DGDG I+ 
Sbjct  46   EIEEVFKKFDANGDGKISASELGSIMKSLG-QQPSDEELHNMIKEFDADGDGFINF  100


 Score = 41.6 bits (96),  Expect(3) = 5e-14, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             C++ +CR+MI GVDN+G+G + FE+F  MM
Sbjct  150  ECSIAECRKMISGVDNDGNGMIDFEEFKVMM  180


 Score = 36.2 bits (82),  Expect(3) = 5e-14, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G ISAEEL  V K++G
Sbjct  120  LKDAFSVYDIDGNGWISAEELHEVLKSLG  148



>ref|XP_002525994.1| Polcalcin Jun o, putative [Ricinus communis]
 gb|EEF36418.1| Polcalcin Jun o, putative [Ricinus communis]
Length=190

 Score = 44.3 bits (103),  Expect(3) = 6e-14, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 34/57 (60%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL Q FK  D + DGKI   EL +++S +G E  + EE+  M+ E D DGDG I  +
Sbjct  45   ELEQVFKKFDVNGDGKISSLELGSIMSSLGHE-ANEEEVMKMIKEFDADGDGFIDFK  100


 Score = 41.6 bits (96),  Expect(3) = 6e-14, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +1

Query  496  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            C++ +CR+MI GVD++GDG + FE+F  MM
Sbjct  150  CSIAECRKMISGVDSDGDGMIDFEEFKVMM  179


 Score = 38.1 bits (87),  Expect(3) = 6e-14, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAFD +D D +G ISAEEL  V  +IG
Sbjct  119  LKDAFDVYDIDGNGSISAEELHKVMGSIG  147



>ref|XP_004142374.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis 
sativus]
 gb|KGN52351.1| hypothetical protein Csa_5G627080 [Cucumis sativus]
Length=185

 Score = 45.1 bits (105),  Expect(3) = 6e-14, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +1

Query  496  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            C++ DCR+MI GVD+NGDG + FE+F  MM
Sbjct  147  CSVADCRQMISGVDSNGDGMISFEEFKVMM  176


 Score = 42.4 bits (98),  Expect(3) = 6e-14, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (57%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
             EL + FK  D + DGKI   EL +++  +G    + EEL  M+ E D DGDG I+L 
Sbjct  41   TELEEVFKKFDVNGDGKISSAELGSIMRSLG-HNATEEELGKMIDEFDADGDGFINLH  97


 Score = 36.6 bits (83),  Expect(3) = 6e-14, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = +3

Query  378  PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            P      LR+AF  +D D +G ISAEEL  V +++G
Sbjct  109  PEELLENLREAFSVYDIDGNGSISAEELHKVLQSLG  144



>ref|NP_001045400.1| Os01g0949500 [Oryza sativa Japonica Group]
 sp|Q8RZB5.1|CML10_ORYSJ RecName: Full=Probable calcium-binding protein CML10; AltName: 
Full=Calmodulin-like protein 10 [Oryza sativa Japonica Group]
 dbj|BAB86193.1| putative pollen allergen Jun o 4 [Oryza sativa Japonica Group]
 dbj|BAF07314.1| Os01g0949500 [Oryza sativa Japonica Group]
 dbj|BAG96408.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96462.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92083.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72159.1| hypothetical protein OsI_05196 [Oryza sativa Indica Group]
 gb|EEE56004.1| hypothetical protein OsJ_04761 [Oryza sativa Japonica Group]
Length=185

 Score = 46.6 bits (109),  Expect(3) = 6e-14, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            + T++ CRRMI GVD NGDG + FE+F  MM
Sbjct  145  KATVQQCRRMIEGVDQNGDGLISFEEFKVMM  175


 Score = 44.7 bits (104),  Expect(3) = 6e-14, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            E+ + F+  D + DG+I + EL AL   +G    + +EL  M++E D DGDG ISL+
Sbjct  40   EMERVFRKFDANGDGRISRSELGALFESLG-HAATDDELARMMAEADADGDGFISLD  95


 Score = 32.7 bits (73),  Expect(3) = 6e-14, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 28/52 (54%), Gaps = 2/52 (4%)
 Frame = +3

Query  348  EFSVLSSAFA--PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGRLAV  497
            EF+ L++  +    + + +LR AF  FD D +G ISA EL  V   +G  A 
Sbjct  96   EFAALNATASGDAAAVEEDLRHAFRVFDADGNGTISAAELARVLHGLGEKAT  147



>ref|XP_003616365.1| Polcalcin Nic t [Medicago truncatula]
 gb|AES99323.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=139

 Score = 44.3 bits (103),  Expect(3) = 6e-14, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            E+ + F   D++ DGKI + EL+ +L  +G+E  S EE++ M+ E+D++GDG I L+
Sbjct  4    EVRKIFSKFDKNGDGKISRSELKEMLLTLGSETTS-EEVKRMMEELDQNGDGFIDLK  59


 Score = 41.2 bits (95),  Expect(3) = 6e-14, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             +C+L DC++MI  VD +GDG V FE+F +MM
Sbjct  106  EKCSLNDCKKMISNVDVDGDGNVNFEEFKKMM  137


 Score = 38.1 bits (87),  Expect(3) = 6e-14, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = +3

Query  393  SELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            SELRDAFD +D D +G ISA EL  V   +G
Sbjct  75   SELRDAFDLYDLDKNGLISANELHAVLMKLG  105



>ref|XP_006304603.1| hypothetical protein CARUB_v10011672mg [Capsella rubella]
 gb|EOA37501.1| hypothetical protein CARUB_v10011672mg [Capsella rubella]
Length=184

 Score = 47.8 bits (112),  Expect(3) = 7e-14, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL   FK  D + DGKI  +EL A++  +G E P  EEL   ++E+DR GDG I+ E
Sbjct  34   ELEAVFKKFDVNGDGKISSKELGAIMKSLGHEVP-EEELEKAITEIDRKGDGYINFE  89


 Score = 39.3 bits (90),  Expect(3) = 7e-14, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RS    C++ +C++MI GVD +GDG + FE+F  MM
Sbjct  133  RSLGDECSIAECKKMIGGVDKDGDGTIDFEEFKIMM  168


 Score = 36.6 bits (83),  Expect(3) = 7e-14, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G ISAEEL  V +++G
Sbjct  108  LKDAFSVYDIDGNGSISAEELHEVLRSLG  136



>ref|XP_011024051.1| PREDICTED: probable calcium-binding protein CML25 [Populus euphratica]
Length=195

 Score = 48.9 bits (115),  Expect(3) = 7e-14, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 44/80 (55%), Gaps = 2/80 (3%)
 Frame = +2

Query  110  PTSVLPALNDEISPD-ELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  286
            P+ +  ++N   SP   L     EL Q FK  D + DGKI   EL++   ++G E  S E
Sbjct  21   PSGMATSINGSKSPSVRLRLQVEELEQVFKKFDVNGDGKISSAELDSFWKKLGHEA-SEE  79

Query  287  ELRLMLSEVDRDGDGCISLE  346
            EL  M++E D DGDG I L+
Sbjct  80   ELLRMITEFDADGDGFIDLQ  99


 Score = 39.7 bits (91),  Expect(3) = 7e-14, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +1

Query  496  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  149  CSMAECRKMISGVDRDGDGMIDFEEFKVMM  178


 Score = 34.7 bits (78),  Expect(3) = 7e-14, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G ISAEEL  V  ++G
Sbjct  118  LKDAFSVYDIDGNGSISAEELHKVMASLG  146


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 42/76 (55%), Gaps = 5/76 (7%)
 Frame = +2

Query  122  LPALNDE-ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRL  298
              ALN + +  DE+      L  AF + D D +G I  EEL  +++ +G EP S  E R 
Sbjct  101  FVALNTQGVDTDEV---MENLKDAFSVYDIDGNGSISAEELHKVMASLG-EPCSMAECRK  156

Query  299  MLSEVDRDGDGCISLE  346
            M+S VDRDGDG I  E
Sbjct  157  MISGVDRDGDGMIDFE  172



>ref|XP_011082591.1| PREDICTED: calmodulin-like [Sesamum indicum]
Length=150

 Score = 53.5 bits (127),  Expect(3) = 9e-14, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            AE  +AF +ID+D DG I  EEL +++  +  E P++EE+R M+ EVD DGDG +  E
Sbjct  11   AEFREAFCVIDKDSDGVITVEELASVIQSLN-EHPTKEEIREMMHEVDADGDGTVDFE  67


 Score = 35.8 bits (81),  Expect(3) = 9e-14, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 0/46 (0%)
 Frame = +3

Query  348  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            EF  + +     +   EL++AF  FD D DG ISA EL NV   +G
Sbjct  68   EFLSIMARKMKENVAEELKEAFKVFDRDQDGFISAIELRNVMMNLG  113


 Score = 33.9 bits (76),  Expect(3) = 9e-14, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 20/32 (63%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             R + E+  +MI   D +GDG V +E+F RMM
Sbjct  114  ERLSDEEAEQMIREADLDGDGVVSYEEFVRMM  145



>ref|XP_010477987.1| PREDICTED: probable calcium-binding protein CML25 [Camelina sativa]
Length=187

 Score = 47.0 bits (110),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL   FK  D + DGKI  +EL A++  +G E P  EEL   ++E+DR GDG I+ E
Sbjct  37   ELEAVFKKFDVNGDGKISSKELGAIMKSLGHEVP-EEELEKAINEIDRKGDGYINFE  92


 Score = 40.0 bits (92),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RS    C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  136  RSLGDECSIAECRKMIGGVDKDGDGTIDFEEFKIMM  171


 Score = 36.2 bits (82),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G ISAEEL  V +++G
Sbjct  111  LKDAFSVYDIDGNGSISAEELHEVLRSLG  139



>ref|XP_011079925.1| PREDICTED: calmodulin-like [Sesamum indicum]
Length=150

 Score = 53.9 bits (128),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            AE  +AF LID+D DG I  EEL +++  +  E P+ EE++ M+SEVD DGDG +  E
Sbjct  11   AEFREAFSLIDKDSDGVITVEELTSVMQSLN-EHPTMEEIQEMVSEVDGDGDGTVDFE  67


 Score = 34.7 bits (78),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 0/46 (0%)
 Frame = +3

Query  348  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            EF  + +     +   EL++AF  FD D DG ISA EL NV   +G
Sbjct  68   EFLGIMARKMKENVGEELKEAFKVFDRDQDGFISAIELKNVMINLG  113


 Score = 34.7 bits (78),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 20/32 (63%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             R + E+  +MI   D +GDG V +E+F RMM
Sbjct  114  ERVSDEEAEQMIREADVDGDGVVSYEEFVRMM  145



>ref|XP_010924246.1| PREDICTED: probable calcium-binding protein CML35 [Elaeis guineensis]
Length=320

 Score = 64.7 bits (156),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 51/89 (57%), Gaps = 8/89 (9%)
 Frame = +2

Query  104  STPTSVLPALNDEISPDE-------LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  262
            STP SVLP    +            LS   + +   F + +RD DGKI   ELEA+L  +
Sbjct  67   STPCSVLPPPTGKTPSSSRSDDLWLLSPASSSISNLFIIFNRDGDGKIMPHELEAILCHL  126

Query  263  -GAEPPSREELRLMLSEVDRDGDGCISLE  346
             GA PP++EEL  M+ EV+RD +GCISLE
Sbjct  127  HGANPPTKEELASMVVEVNRDDNGCISLE  155


 Score = 37.4 bits (85),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +3

Query  393  SELRDAFDFFDTDHDGKISAEELFNVFKTI  482
            +EL +AF  FD ++DGKIS EEL  +F T+
Sbjct  169  AELWEAFAIFDANNDGKISIEELLRMFNTL  198


 Score = 21.2 bits (43),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 8/10 (80%), Positives = 8/10 (80%), Gaps = 0/10 (0%)
 Frame = +1

Query  487  DSRCTLEDCR  516
            D  CTLEDCR
Sbjct  200  DEGCTLEDCR  209



>ref|XP_009617304.1| PREDICTED: calmodulin-like [Nicotiana tomentosiformis]
Length=147

 Score = 53.5 bits (127),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 48/72 (67%), Gaps = 5/72 (7%)
 Frame = +2

Query  131  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  310
            + D +S +++S    E  +AF +ID+D DG IR EEL A++  +  E P++EE++ M++E
Sbjct  1    MADALSEEQIS----EFREAFWVIDKDCDGVIRMEELAAVIQSLN-EHPTKEEIQEMVNE  55

Query  311  VDRDGDGCISLE  346
            VD DGDG I  E
Sbjct  56   VDPDGDGTIDFE  67


 Score = 35.8 bits (81),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 21/34 (62%), Gaps = 0/34 (0%)
 Frame = +3

Query  384  SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            +   EL++AF  FD D DG ISA EL NV   +G
Sbjct  80   NVSEELKEAFKVFDRDQDGFISANELRNVMMNLG  113


 Score = 33.5 bits (75),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             R T E+ ++MI   D +GDG V +E+F ++M
Sbjct  114  ERLTDEEAQQMIREADLDGDGLVSYEEFVKIM  145



>ref|XP_010672963.1| PREDICTED: probable calcium-binding protein CML35 [Beta vulgaris 
subsp. vulgaris]
Length=209

 Score = 62.8 bits (151),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            GD RCTLE+CRRMI GVD N DGFVCF+DF RMM
Sbjct  172  GDERCTLEECRRMIEGVDKNKDGFVCFQDFSRMM  205


 Score = 40.4 bits (93),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 31/57 (54%), Gaps = 3/57 (5%)
 Frame = +3

Query  318  GTATVALASREFSVLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            G   ++L   E   + SA  P   D + L+DAF FFD + DGKIS EEL   F  +G
Sbjct  118  GDGCISLE--ELEAVGSALDPTGADEDDLKDAFGFFDVNKDGKISPEELHAGFVALG  172


 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = +2

Query  185  QAFKLIDRDDDGKIRKEELEALLSQVGAEPP--SREELRLMLSEVDRDGDGCISLE  346
            +AFK++D D DGKI + EL +L  +V    P  S EE+  M+ ++D DGDGCISLE
Sbjct  70   EAFKMMDLDGDGKITRVELHSLFKRVRVNAPSLSEEEVAEMIKDIDTDGDGCISLE  125



>ref|XP_010499149.1| PREDICTED: probable calcium-binding protein CML25 [Camelina sativa]
 ref|XP_010460422.1| PREDICTED: probable calcium-binding protein CML25 [Camelina sativa]
Length=187

 Score = 47.0 bits (110),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL   FK  D + DGKI  +EL A++  +G E P  EEL   ++E+DR GDG I+ E
Sbjct  37   ELEAVFKKFDVNGDGKISSKELGAIMKSLGHEVPE-EELEKAINEIDRKGDGYINFE  92


 Score = 40.0 bits (92),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RS    C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  136  RSLGDECSIAECRKMIGGVDKDGDGTIDFEEFKIMM  171


 Score = 36.2 bits (82),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G ISAEEL  V +++G
Sbjct  111  LKDAFSVYDIDGNGSISAEELHEVLRSLG  139



>ref|XP_004159084.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis 
sativus]
Length=185

 Score = 45.1 bits (105),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +1

Query  496  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            C++ DCR+MI GVD+NGDG + FE+F  MM
Sbjct  147  CSVADCRQMISGVDSNGDGMISFEEFKVMM  176


 Score = 41.2 bits (95),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
             EL + FK  D + DGKI   EL + +  +G    + EEL  M+ E D DGDG I+L 
Sbjct  41   TELEEVFKKFDVNGDGKISSAELGSTMRSLG-HNATEEELGKMIDEFDADGDGFINLH  97


 Score = 36.6 bits (83),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = +3

Query  378  PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            P      LR+AF  +D D +G ISAEEL  V +++G
Sbjct  109  PEELLENLREAFSVYDIDGNGSISAEELHKVLQSLG  144



>emb|CDM86427.1| unnamed protein product [Triticum aestivum]
Length=190

 Score = 45.8 bits (107),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            E+ + F+  D + DG+I + EL AL   +G    + +EL  M++E D DGDG ISLE
Sbjct  49   EMERVFRKFDANGDGRISRPELAALFESLG-HAATEDELTRMMAEADADGDGFISLE  104


 Score = 44.7 bits (104),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            + T++ CRRMI GVD NGDG + F++F  MM
Sbjct  151  KATVQQCRRMIEGVDKNGDGLISFDEFKVMM  181


 Score = 32.0 bits (71),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
 Frame = +3

Query  348  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGRLAV  497
            EF+ L+ A A    + +LR AF  FD D  G ISA EL +V   +G  A 
Sbjct  105  EFAALN-ATAAGDDEEDLRLAFKVFDADGSGDISAAELASVLHGLGEKAT  153



>ref|XP_011075365.1| PREDICTED: probable calcium-binding protein CML25 [Sesamum indicum]
Length=197

 Score = 45.4 bits (106),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 34/57 (60%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL Q FK  D + DGKI   EL +++  +G    + EELR M+  VD DGDG I L+
Sbjct  47   ELEQVFKKFDVNGDGKISALELGSIMGSLG-HSATEEELRTMIQGVDSDGDGHIDLQ  102


 Score = 40.0 bits (92),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             CTL +CR+MI GVD +G+G + F++F  MM
Sbjct  151  ECTLAECRKMISGVDTDGNGAISFDEFKVMM  181


 Score = 37.0 bits (84),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  FD D +G ISAEEL +V + +G
Sbjct  121  LKDAFQVFDIDKNGSISAEELQDVLQNLG  149



>ref|XP_006430624.1| hypothetical protein CICLE_v10013012mg [Citrus clementina]
 gb|ESR43864.1| hypothetical protein CICLE_v10013012mg [Citrus clementina]
 gb|KDO63083.1| hypothetical protein CISIN_1g031791mg [Citrus sinensis]
Length=153

 Score = 43.1 bits (100),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 26/47 (55%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  REFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            +EFS    A        EL+DAFD +D D +G ISA EL  V K +G
Sbjct  72   KEFSTFHLAGGSTDGTKELKDAFDLYDMDQNGLISANELHAVLKKLG  118


 Score = 41.2 bits (95),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            E+ + F   D++ DGKI  +EL+ +L  +G++  S EE++ ++ E+D DGDG I  +
Sbjct  17   EVRKVFNKFDKNGDGKISADELKDVLRSLGSKT-SPEEVKRVMDEIDTDGDGYIDFK  72


 Score = 38.5 bits (88),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            + +L+DC  MI  VD +GDG V FE+F +MM
Sbjct  120  KSSLKDCVNMIKKVDADGDGHVNFEEFKKMM  150



>emb|CDM86445.1| unnamed protein product [Triticum aestivum]
Length=190

 Score = 45.8 bits (107),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            E+ + F+  D + DG+I + EL AL   +G    + +EL  M++E D DGDG ISLE
Sbjct  49   EMERVFRKFDANGDGRISRPELAALFESLG-HAATEDELTRMMAEADADGDGFISLE  104


 Score = 44.7 bits (104),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            + T++ CRRMI GVD NGDG + F++F  MM
Sbjct  151  KATVQQCRRMIEGVDKNGDGLISFDEFKVMM  181


 Score = 31.6 bits (70),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 1/50 (2%)
 Frame = +3

Query  348  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGRLAV  497
            EF+ L+ A A    + +LR AF  FD D  G ISA EL  V   +G  A 
Sbjct  105  EFAALN-ATAAGDDEEDLRLAFKVFDADGSGDISAAELARVLHGLGEKAT  153



>ref|XP_004151276.1| PREDICTED: probable calcium-binding protein CML36-like [Cucumis 
sativus]
 ref|XP_004172820.1| PREDICTED: probable calcium-binding protein CML36-like [Cucumis 
sativus]
 gb|KGN54524.1| hypothetical protein Csa_4G355130 [Cucumis sativus]
Length=192

 Score = 61.6 bits (148),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GR          +  GD RCTLEDC RMI  VD NGDGFVCF +F RMME Q
Sbjct  140  GRITAEELHGVFRSIGDERCTLEDCGRMIRDVDENGDGFVCFAEFVRMMELQ  191


 Score = 40.8 bits (94),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 4/47 (9%)
 Frame = +2

Query  206  RDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            R ++G + ++ELEA+LS++ +E    EE+ +ML EVD  GDG I LE
Sbjct  68   RGNEGVVSRKELEAILSRIASE----EEVAMMLREVDSGGDGFIRLE  110



>ref|XP_009797345.1| PREDICTED: probable calcium-binding protein CML25 [Nicotiana 
sylvestris]
Length=189

 Score = 45.1 bits (105),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 46/87 (53%), Gaps = 1/87 (1%)
 Frame = +2

Query  86   KKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  265
            KK   ++      P ++   S +  + +  EL Q FK  D + DGKI   EL ++++ +G
Sbjct  11   KKRVAKANNNDPTPVISSSSSINARARIEEELEQVFKKFDVNGDGKICSSELGSIMASLG  70

Query  266  AEPPSREELRLMLSEVDRDGDGCISLE  346
                + EEL  M+ EVD DGDG I L+
Sbjct  71   -NAATEEELLNMIREVDADGDGFIDLQ  96


 Score = 39.7 bits (91),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RS    C+L +CR+MI GVD +GDG + FE+F  MM
Sbjct  140  RSLGEDCSLAECRKMISGVDCDGDGMINFEEFKVMM  175


 Score = 37.4 bits (85),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  FD D +G ISAEEL  V +++G
Sbjct  115  LKDAFSVFDMDKNGSISAEELQTVLRSLG  143



>dbj|BAJ92507.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=183

 Score = 60.8 bits (146),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            GD RC++EDCRRMI GVD++GDGFVCF++F RMM
Sbjct  146  GDERCSVEDCRRMIGGVDSDGDGFVCFDEFTRMM  179


 Score = 41.6 bits (96),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = +3

Query  390  DSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            + ELRD F  FD D DG+ISAEEL  V  T+G
Sbjct  115  EGELRDTFAVFDADGDGRISAEELRAVLATLG  146


 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGVQ  355
            EL   F + D D DG+I  EEL A+L+ +G E  S E+ R M+  VD DGDG +  +   
Sbjct  117  ELRDTFAVFDADGDGRISAEELRAVLATLGDERCSVEDCRRMIGGVDSDGDGFVCFDEFT  176

Query  356  R  358
            R
Sbjct  177  R  177



>ref|NP_001152603.1| polcalcin Jun o 2 [Zea mays]
 gb|ACG48452.1| polcalcin Jun o 2 [Zea mays]
Length=194

 Score = 45.1 bits (105),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
            E+ + F+  D + DG+I + EL AL   +G    S +E+  M++E D DGDG ISL
Sbjct  48   EMARVFRKFDANGDGRISRSELAALFESLG-HGASDDEVARMMAEADADGDGFISL  102


 Score = 40.8 bits (94),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +1

Query  496  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             ++  CRRMI GVD NGDG + F++F  MM
Sbjct  154  ASVAQCRRMIEGVDQNGDGLISFDEFKVMM  183


 Score = 35.8 bits (81),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 28/48 (58%), Gaps = 2/48 (4%)
 Frame = +3

Query  348  EFSVLSSAFA--PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            EF+ L++  A    + + +LR AF  FD D  G ISA EL  V +++G
Sbjct  104  EFAALNATVAGDAAAVEEDLRHAFRVFDADGSGAISAAELARVLRSLG  151



>ref|XP_010663678.1| PREDICTED: calcium-binding allergen Ole e 8 [Vitis vinifera]
 emb|CAN60554.1| hypothetical protein VITISV_014971 [Vitis vinifera]
Length=163

 Score = 45.8 bits (107),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL + F   D + DGKI   EL  +L  +G+E  S EE+  ++ E+D D DGCI+LE
Sbjct  21   ELQKVFNRFDANGDGKISSSELANVLRALGSE-SSPEEMSRVMKEIDTDDDGCINLE  76


 Score = 38.1 bits (87),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            +C+++DC++MI   D++GDG + F++F  MM
Sbjct  123  KCSVQDCQKMIGSFDSDGDGNISFDEFKEMM  153


 Score = 37.7 bits (86),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 20/30 (67%), Gaps = 0/30 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            ELRDAF  +D D +G ISA EL  V K +G
Sbjct  92   ELRDAFQLYDGDKNGLISAVELHQVLKQLG  121



>ref|NP_001053179.1| Os04g0492800 [Oryza sativa Japonica Group]
 sp|Q0JC44.1|CML22_ORYSJ RecName: Full=Probable calcium-binding protein CML22; AltName: 
Full=Calmodulin-like protein 22 [Oryza sativa Japonica Group]
 dbj|BAF15093.1| Os04g0492800 [Oryza sativa Japonica Group]
Length=250

 Score = 52.4 bits (124),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            AEL + F+L DR+ DG+I +EELE  L ++G   P+ +EL  +++ +D +GDGC+ +E
Sbjct  91   AELARVFELFDRNGDGRITREELEDSLGKLGIPVPA-DELAAVIARIDANGDGCVDVE  147


 Score = 37.4 bits (85),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  499  TLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            T E+CRRMI  VD +GDG V F +F +MM
Sbjct  213  TAEECRRMIGQVDRDGDGRVDFHEFLQMM  241


 Score = 32.0 bits (71),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = +3

Query  390  DSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            D ++R+AF  FD + DG I+ +EL  V  ++G
Sbjct  176  DGDMREAFRVFDANGDGYITVDELGAVLASLG  207



>gb|ACG44451.1| polcalcin Jun o 2 [Zea mays]
Length=194

 Score = 45.1 bits (105),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
            E+ + F+  D + DG+I + EL AL   +G    S +E+  M++E D DGDG ISL
Sbjct  48   EMARVFRKFDANGDGRISRSELAALFESLG-HGASDDEVARMMAEADADGDGFISL  102


 Score = 40.8 bits (94),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +1

Query  496  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             ++  CRRMI GVD NGDG + F++F  MM
Sbjct  154  ASVAQCRRMIEGVDQNGDGLISFDEFKVMM  183


 Score = 35.8 bits (81),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 28/48 (58%), Gaps = 2/48 (4%)
 Frame = +3

Query  348  EFSVLSSAFA--PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            EF+ L++  A    + + +LR AF  FD D  G ISA EL  V +++G
Sbjct  104  EFAALNATVAGDAAAVEEDLRHAFRVFDADGSGAISAAELARVLRSLG  151



>ref|XP_008673034.1| PREDICTED: polcalcin Jun o 2 isoform X1 [Zea mays]
 tpg|DAA55826.1| TPA: polcalcin Jun o 2 [Zea mays]
Length=194

 Score = 45.1 bits (105),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
            E+ + F+  D + DG+I + EL AL   +G    S +E+  M++E D DGDG ISL
Sbjct  48   EMARVFRKFDANGDGRISRSELAALFESLG-HGASDDEVARMMAEADADGDGFISL  102


 Score = 40.8 bits (94),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +1

Query  496  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             ++  CRRMI GVD NGDG + F++F  MM
Sbjct  154  ASVAQCRRMIEGVDQNGDGLISFDEFKVMM  183


 Score = 35.8 bits (81),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 28/48 (58%), Gaps = 2/48 (4%)
 Frame = +3

Query  348  EFSVLSSAFA--PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            EF+ L++  A    + + +LR AF  FD D  G ISA EL  V +++G
Sbjct  104  EFAALNATVAGDAAAVEEDLRHAFRVFDADGSGAISAAELARVLRSLG  151



>emb|CDY24421.1| BnaCnng04880D [Brassica napus]
Length=271

 Score = 45.1 bits (105),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL   FK  D + DGKI  +EL A+++ +G E P  E L+  ++++DR GDG I+ E
Sbjct  122  ELEAVFKKFDVNGDGKISSKELGAIMTSLGHEVP-EEVLQKAITDIDRKGDGYINFE  177


 Score = 40.4 bits (93),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RS    C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  221  RSLGDECSIAECRKMIGGVDKDGDGTIDFEEFKIMM  256


 Score = 36.2 bits (82),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G ISAEEL  V +++G
Sbjct  196  LKDAFSVYDIDGNGSISAEELHEVLRSLG  224



>ref|XP_006469245.1| PREDICTED: probable calcium-binding protein CML25-like [Citrus 
sinensis]
Length=212

 Score = 45.4 bits (106),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (60%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL Q F   D + DGKI   EL ++L+ +G    + EEL+ M+ E+D DGDG +  +
Sbjct  60   ELRQVFNKFDANGDGKISASELGSILTSLG-HAATEEELQKMVKEIDADGDGFVDFD  115


 Score = 40.8 bits (94),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RS    CTL +CRRMI GVD +GDG + FE+F  MM
Sbjct  159  RSLGDDCTLAECRRMIRGVDCDGDGTIDFEEFKVMM  194


 Score = 35.8 bits (81),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G I+AEEL  V +++G
Sbjct  134  LKDAFSVYDIDGNGSITAEELHQVLRSLG  162



>ref|XP_009109853.1| PREDICTED: probable calcium-binding protein CML25 [Brassica rapa]
 emb|CDY36129.1| BnaA08g19190D [Brassica napus]
Length=187

 Score = 45.1 bits (105),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL   FK  D + DGKI  +EL A+++ +G E P  E L+  ++++DR GDG I+ E
Sbjct  38   ELEAVFKKFDVNGDGKISSKELGAIMTSLGHEVP-EEVLQKAITDIDRKGDGYINFE  93


 Score = 40.0 bits (92),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RS    C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  137  RSLGDECSIAECRKMIGGVDKDGDGTIDFEEFKIMM  172


 Score = 36.6 bits (83),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G ISAEEL  V +++G
Sbjct  112  LKDAFSVYDIDGNGSISAEELHEVLRSLG  140



>ref|XP_010033692.1| PREDICTED: probable calcium-binding protein CML27 [Eucalyptus 
grandis]
 gb|KCW84060.1| hypothetical protein EUGRSUZ_B00943 [Eucalyptus grandis]
Length=171

 Score = 41.2 bits (95),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 3/57 (5%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVG-AEPPSREELRLMLSEVDRDGDGCISL  343
            EL + F   D + DGKI   EL  +L+ +G A PP  E+L   ++E+D DGDG ISL
Sbjct  33   ELRKVFDQFDANGDGKISASELSQVLAAMGSAVPP--EDLDRAMAEIDADGDGFISL  87


 Score = 41.2 bits (95),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +1

Query  496  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            C++EDC RMI  VD +GDG V FE+F +MM
Sbjct  135  CSVEDCARMIKSVDGDGDGNVNFEEFRKMM  164


 Score = 38.9 bits (89),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +3

Query  381  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  482
            PS D++LRDAFD +D D +G ISA EL  V   +
Sbjct  98   PSPDADLRDAFDLYDQDRNGLISAAELHLVLNRL  131



>ref|XP_009608299.1| PREDICTED: probable calcium-binding protein CML25 [Nicotiana 
tomentosiformis]
Length=189

 Score = 44.3 bits (103),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL Q FK  D + DGKI   EL ++++ +G    + EEL  M+ EVD DGDG I L+
Sbjct  41   ELEQVFKKFDVNGDGKICSSELGSIMASLG-NAATEEELLNMIREVDADGDGFIDLQ  96


 Score = 40.0 bits (92),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQXR  600
            RS    C+L +CR+MI GVD +GDG + FE+F  MM +  R
Sbjct  140  RSLGEDCSLAECRKMISGVDCDGDGMINFEEFKVMMVKGSR  180


 Score = 37.0 bits (84),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  FD D +G ISAEEL  V +++G
Sbjct  115  LKDAFSVFDMDKNGSISAEELQTVLRSLG  143



>ref|XP_010109033.1| putative calcium-binding protein CML23 [Morus notabilis]
 gb|EXC20673.1| putative calcium-binding protein CML23 [Morus notabilis]
Length=151

 Score = 42.0 bits (97),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RS   +C+L DC RMI  VD +GDG V FE+F +MM
Sbjct  112  RSLGEKCSLSDCSRMIRSVDADGDGSVNFEEFKKMM  147


 Score = 40.0 bits (92),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +2

Query  164  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
            G   E+ + F   D++ DGKI + EL  +L  +G+   S +E++ +++E+D DGDG I  
Sbjct  7    GSMEEVQKIFNKFDKNRDGKISRSELRDVLGALGS-KTSDDEVKRVMAEIDADGDGYIDF  65

Query  344  E  346
            +
Sbjct  66   D  66


 Score = 39.3 bits (90),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +3

Query  390  DSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            + ELRDAFD +D D +G IS+ EL +V +++G
Sbjct  84   EKELRDAFDLYDLDKNGVISSRELHSVLRSLG  115



>gb|AHA51383.1| EF-hand_1 domain-containing protein, partial [Hormiphora californensis]
Length=166

 Score = 45.1 bits (105),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
            +E  +AF L D+D DG I  +EL  ++  +G + P+  +L+ M++EVD DG+G I  
Sbjct  27   SEFKEAFSLFDKDSDGTITTQELGTVMKSLG-QNPTDGDLQDMINEVDADGNGTIDF  82


 Score = 41.2 bits (95),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (59%), Gaps = 0/46 (0%)
 Frame = +3

Query  351  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGR  488
             ++++        D ELR+AF  FD D +GKIS+EEL  V + +G 
Sbjct  86   LTMMTKHMKESDNDQELREAFKVFDKDGNGKISSEELKIVMQNLGE  131


 Score = 35.0 bits (79),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            + T E+   MI   DN+GDG V +E+F +MM
Sbjct  132  KLTDEEINEMIREADNDGDGEVDYEEFVKMM  162


 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL +AFK+ D+D +GKI  EEL+ ++  +G E  + EE+  M+ E D DGDG +  E
Sbjct  101  ELREAFKVFDKDGNGKISSEELKIVMQNLG-EKLTDEEINEMIREADNDGDGEVDYE  156



>emb|CDX84967.1| BnaC05g20880D [Brassica napus]
Length=189

 Score = 45.4 bits (106),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL   FK  D + DGKI  +EL A+++ +G E P  E L   ++E+DR GDG I+ E
Sbjct  39   ELEAVFKKFDVNGDGKISSKELGAIMASLGNEVP-EEVLEKAITEIDRKGDGYINFE  94


 Score = 39.7 bits (91),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RS    C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  138  RSLGDECSIGECRKMIGGVDKDGDGTIDFEEFKIMM  173


 Score = 36.6 bits (83),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G ISAEEL  V +++G
Sbjct  113  LKDAFSVYDIDGNGSISAEELHEVLRSLG  141



>gb|KHM99973.1| Putative calcium-binding protein CML25 [Glycine soja]
Length=152

 Score = 45.1 bits (105),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
            +L   FK  D + DGKI   EL +++  +G +P + EE++ M+ EVD +GDG I+L
Sbjct  8    DLEYVFKKFDANGDGKISSSELGSIMKSLG-QPATEEEVKRMIQEVDANGDGHINL  62


 Score = 43.5 bits (101),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 27/34 (79%), Gaps = 1/34 (3%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            GD+ C++++C++MI GVD NGDG + FE+F  MM
Sbjct  110  GDA-CSIDECQKMIAGVDGNGDGMINFEEFQLMM  142


 Score = 32.7 bits (73),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 21/36 (58%), Gaps = 0/36 (0%)
 Frame = +3

Query  378  PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            P      L+DAF  FD D +G I+A+EL  V  ++G
Sbjct  75   PDEVLENLKDAFSIFDVDGNGLITAQELNMVMASLG  110



>gb|KDP38112.1| hypothetical protein JCGZ_04755 [Jatropha curcas]
Length=195

 Score = 43.5 bits (101),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL   F   D + DGKI   EL ++++ +G    + EELR M+ E D DGDG I  +
Sbjct  47   ELQHVFNKFDANGDGKISSAELGSIMASLG-HKATDEELRKMIMEFDADGDGFIDFQ  102


 Score = 41.6 bits (96),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +1

Query  496  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            C++ +CRRMI GVD +GDG + FE+F  MM
Sbjct  152  CSIAECRRMISGVDGDGDGMIDFEEFKVMM  181


 Score = 36.2 bits (82),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            LRDAF  +D D +G ISAEEL  V  ++G
Sbjct  121  LRDAFSVYDIDGNGSISAEELHRVMGSLG  149



>gb|KEH26932.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=174

 Score = 45.4 bits (106),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 38/66 (58%), Gaps = 0/66 (0%)
 Frame = +2

Query  146  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDG  325
            +P  L G   EL + F   D + DGKI   ELE +L  + ++ P +EELR ++ E+  D 
Sbjct  16   TPSPLLGDMDELKKVFNNFDANGDGKISVNELETVLRTLRSDVPQQEELRRVMEELSTDR  75

Query  326  DGCISL  343
            DG I+L
Sbjct  76   DGFINL  81


 Score = 39.3 bits (90),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQXR  600
            +C++E+C+ MI  VD++GDG V F++F +MM  + +
Sbjct  130  KCSVEECQDMIKSVDSDGDGSVNFDEFKKMMTAKVK  165


 Score = 36.6 bits (83),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 0/46 (0%)
 Frame = +3

Query  348  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            EF+    +      DS LRDAFD +D D +G IS EEL      +G
Sbjct  83   EFAAFCRSDTTDGGDSALRDAFDLYDKDKNGLISTEELHLALDRLG  128



>gb|EMS57491.1| putative calcium-binding protein CML18 [Triticum urartu]
Length=238

 Score = 43.9 bits (102),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            AEL Q F+  D + DGKI  +EL ++L  +GA PP   E++ M+ E+D D DG + L 
Sbjct  21   AELEQVFRRYDANGDGKISADELASVLRALGA-PPGPGEVQSMMEEMDADRDGFVDLH  77


 Score = 40.8 bits (94),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            +C++ DC RMI  VD +GDG V FE+F +MM
Sbjct  136  KCSVADCSRMIRSVDADGDGSVNFEEFKKMM  166


 Score = 36.6 bits (83),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = +3

Query  390  DSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            ++EL++AF  +D D +G ISA EL  V + +G
Sbjct  103  EAELKEAFRMYDADRNGLISARELHRVLRQLG  134



>ref|XP_009113828.1| PREDICTED: probable calcium-binding protein CML25 [Brassica rapa]
 emb|CDY27574.1| BnaA09g28330D [Brassica napus]
Length=191

 Score = 45.1 bits (105),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL   FK  D + DGKI  +EL A+++ +G E P  E L   ++E+DR GDG I+ E
Sbjct  39   ELEAVFKKFDVNGDGKISSKELGAIMASLGNEVP-EEVLEKAITEIDRKGDGYINFE  94


 Score = 39.7 bits (91),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RS    C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  138  RSLGDECSIGECRKMIGGVDKDGDGTIDFEEFKIMM  173


 Score = 36.6 bits (83),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G ISAEEL  V +++G
Sbjct  113  LKDAFSVYDIDGNGSISAEELHEVLRSLG  141



>emb|CDP19328.1| unnamed protein product [Coffea canephora]
Length=152

 Score = 51.2 bits (121),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            AE  +AF LIDRD DG I   EL A++  +  E P++EE++ M+ EVD DG+G I  E
Sbjct  11   AEFREAFCLIDRDSDGFITIAELAAVIQSLH-ERPTKEEIQEMVHEVDADGNGSIDFE  67


 Score = 35.8 bits (81),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 20/32 (63%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             R T E+  +MI   D NGDG V +++F RMM
Sbjct  114  ERLTDEEAEQMIREADLNGDGVVSYDEFVRMM  145


 Score = 34.3 bits (77),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 19/30 (63%), Gaps = 0/30 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            EL +AF  FD D DG ISA EL NV   +G
Sbjct  84   ELNEAFKVFDRDQDGFISANELRNVMINLG  113



>gb|ABK26821.1| unknown [Picea sitchensis]
Length=194

 Score = 44.7 bits (104),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 32/57 (56%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL   FK  D + DGKI   EL  +L  +G     RE L LM+ E D DGDG ISLE
Sbjct  51   ELEDVFKRFDANGDGKISSSELGDILRSMGCRVGPRE-LGLMMKEADADGDGFISLE  106


 Score = 39.3 bits (90),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +3

Query  378  PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
              +C  +L++AF  FD D +G ISA+EL+ V K +G
Sbjct  118  KAACLEDLKNAFKIFDLDRNGSISADELYQVLKGMG  153


 Score = 37.4 bits (85),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +1

Query  505  EDCRRMILGVDNNGDGFVCFEDF  573
            EDC+ MI GVD NGDG + FE+F
Sbjct  159  EDCQNMITGVDRNGDGLINFEEF  181



>ref|XP_009370750.1| PREDICTED: calmodulin-like protein 11 [Pyrus x bretschneideri]
Length=148

 Score = 48.5 bits (114),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  164  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
            G  +E  +AF LID+D DG IR EEL  ++  +  + P++EE++ M+SE+  DG+G I  
Sbjct  8    GQISEFQEAFCLIDKDSDGLIRLEELATVIQSLD-QRPTKEEIQDMISEIGADGNGTIDF  66

Query  344  E  346
            E
Sbjct  67   E  67


 Score = 37.0 bits (84),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 20/32 (63%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             R T E+  +MI   D +GDG V +E+F RMM
Sbjct  114  ERLTDEEAEQMIKEADLDGDGLVSYEEFARMM  145


 Score = 35.8 bits (81),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 0/46 (0%)
 Frame = +3

Query  348  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            EF  + S     +   EL++AF  FD D DG ISA EL  V   +G
Sbjct  68   EFLNIMSRKMKENVAEELKEAFKVFDRDQDGYISASELRQVMINLG  113



>gb|EYU44572.1| hypothetical protein MIMGU_mgv1a015576mg [Erythranthe guttata]
Length=152

 Score = 48.1 bits (113),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +2

Query  191  FKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  337
            F + D++ DGKI + EL A+LS +G+   + +  RLM SE+D+DGDG I
Sbjct  21   FNMFDKNGDGKISRTELGAILSSLGSSTSAADAARLM-SELDKDGDGFI  68


 Score = 37.0 bits (84),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            ++C+++DCR+MI   D +GDG + F++F +MM
Sbjct  117  TKCSVKDCRKMIASFDVDGDGCMNFDEFKKMM  148


 Score = 36.2 bits (82),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            EL++AF  +D D +GKISA EL +V  ++G
Sbjct  87   ELKEAFALYDKDKNGKISATELHSVLTSLG  116


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGVQ  355
            EL +AF L D+D +GKI   EL ++L+ +G    S ++ R M++  D DGDGC++ +  +
Sbjct  87   ELKEAFALYDKDKNGKISATELHSVLTSLGT-KCSVKDCRKMIASFDVDGDGCMNFDEFK  145

Query  356  R  358
            +
Sbjct  146  K  146



>gb|KDO60746.1| hypothetical protein CISIN_1g029304mg [Citrus sinensis]
Length=195

 Score = 44.7 bits (104),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (60%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL Q F   D + DGKI   EL ++L+ +G    + EEL+ M+ E+D DGDG +  +
Sbjct  43   ELRQVFNKFDANGDGKISASELGSILTSLG-HAATEEELQKMVREIDADGDGFVDFD  98


 Score = 40.8 bits (94),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RS    CTL +CRRMI GVD +GDG + FE+F  MM
Sbjct  142  RSLGDDCTLAECRRMIRGVDCDGDGTIDFEEFKVMM  177


 Score = 35.8 bits (81),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G I+AEEL  V +++G
Sbjct  117  LKDAFSVYDIDGNGSITAEELHQVLRSLG  145



>ref|XP_009595960.1| PREDICTED: calcium-binding allergen Ole e 8-like [Nicotiana tomentosiformis]
Length=157

 Score = 42.0 bits (97),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
              CT++DC RMI  VD +GDG V FE+F +MM
Sbjct  120  QNCTVQDCTRMITSVDADGDGNVSFEEFKQMM  151


 Score = 40.4 bits (93),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            E+ + F   D + DG I  +EL  +L  +G++  S +E+  M++E+D D DGCI+L+
Sbjct  17   EVKKVFARFDANGDGMISGDELSGVLKALGSDT-SPDEVERMMAEIDTDRDGCINLQ  72


 Score = 38.9 bits (89),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIGR  488
            EL++AFD +D DH+G ISA EL  +   +G+
Sbjct  90   ELKEAFDLYDQDHNGLISAAELHQILNRLGQ  120



>gb|KDO48936.1| hypothetical protein CISIN_1g031616mg [Citrus sinensis]
Length=156

 Score = 47.8 bits (112),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
            AE  +AF ++D+D DG I  EEL + +  +  + P+ EELR M++EVD DG+G I  
Sbjct  17   AEFQEAFSMLDKDGDGCITFEELASAIKSLD-QNPTEEELRNMINEVDLDGNGTIEF  72


 Score = 37.7 bits (86),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             + T E+  +MIL  D++GDG V +E+F RMM
Sbjct  121  EKLTDEELEQMILEADSDGDGQVNYEEFARMM  152


 Score = 35.8 bits (81),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 15/46 (33%), Positives = 23/46 (50%), Gaps = 0/46 (0%)
 Frame = +3

Query  351  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGR  488
              ++++         EL++AF  FD D DG IS  EL +V   +G 
Sbjct  76   LKLMATKMKENEAQEELKEAFKVFDKDQDGYISPNELRHVMMNLGE  121



>ref|XP_009411743.1| PREDICTED: probable calcium-binding protein CML36 [Musa acuminata 
subsp. malaccensis]
Length=202

 Score = 60.8 bits (146),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  GRYPRRSCLTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMMEQQ  594
            GR      L      GD  CTLEDCR MI GVD +GDGFVCF+DF RMM+ Q
Sbjct  150  GRISAEELLGVFVTLGDDGCTLEDCRCMIQGVDTDGDGFVCFDDFARMMDGQ  201


 Score = 40.4 bits (93),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 15/82 (18%)
 Frame = +2

Query  101  ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  280
             ++P SVLP      S  +L          F ++DRD DGKI   ELEA+L ++G +P +
Sbjct  50   HASPRSVLP-----FSVHDL----------FGVLDRDGDGKIVVRELEAVLRRLGPDPLT  94

Query  281  REELRLMLSEVDRDGDGCISLE  346
             EE   + +EV   GDGCI++E
Sbjct  95   AEEAASVAAEVGLAGDGCITVE  116



>gb|ABK26031.1| unknown [Picea sitchensis]
Length=194

 Score = 44.7 bits (104),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 32/57 (56%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL   FK  D + DGKI   EL  +L  +G     RE L LM+ E D DGDG ISLE
Sbjct  51   ELEDVFKRFDANGDGKISSSELGDILRSMGCRVGPRE-LGLMMKEADADGDGFISLE  106


 Score = 38.9 bits (89),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +3

Query  378  PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
              +C  +L++AF  FD D +G ISA+EL+ V K +G
Sbjct  118  KAACLEDLKNAFKVFDLDRNGSISADELYQVLKGMG  153


 Score = 37.4 bits (85),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +1

Query  505  EDCRRMILGVDNNGDGFVCFEDF  573
            EDC+ MI GVD NGDG + FE+F
Sbjct  159  EDCQNMITGVDRNGDGLINFEEF  181



>ref|XP_003565059.1| PREDICTED: probable calcium-binding protein CML10 [Brachypodium 
distachyon]
Length=195

 Score = 46.2 bits (108),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  588
            + T++ CRRMI GVD NGDG + FE+F  MM+
Sbjct  155  KATVQQCRRMIEGVDKNGDGLISFEEFKVMMD  186


 Score = 42.7 bits (99),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
            E+ + F+  D + DG+I + EL AL   +G    + +EL  M++E D DGDG ISL
Sbjct  52   EMERVFRKFDANGDGRISRPELAALFESLG-HAATDDELARMMAEADADGDGFISL  106


 Score = 31.6 bits (70),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 20/40 (50%), Gaps = 0/40 (0%)
 Frame = +3

Query  378  PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGRLAV  497
            P   + +LR AF  FD D  G ISA EL  V   +G  A 
Sbjct  118  PGDAEEDLRLAFGVFDADGSGAISAAELARVLHGLGEKAT  157



>ref|XP_009782225.1| PREDICTED: calcium-binding allergen Ole e 8-like [Nicotiana sylvestris]
Length=154

 Score = 42.0 bits (97),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
              CT++DC RMI  VD +GDG V FE+F +MM
Sbjct  117  QNCTIQDCTRMITSVDADGDGNVSFEEFKQMM  148


 Score = 40.0 bits (92),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            E+ + F   D + DG I  +EL  +L  +G++  S +E+  M++E+D D DGCI+L+
Sbjct  14   EVKKVFARFDANGDGMISGDELSGVLKALGSDT-SPDEVERMMAEIDTDRDGCINLQ  69


 Score = 38.5 bits (88),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIGR  488
            EL++AFD +D DH+G ISA EL  +   +G+
Sbjct  87   ELKEAFDLYDQDHNGLISAAELHQILNRLGQ  117



>ref|XP_006471667.1| PREDICTED: calmodulin-like protein 11-like [Citrus sinensis]
Length=156

 Score = 47.8 bits (112),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
            AE  +AF L+D+D DG I  EEL + +  +  + P+ EE+R M++EVD DG+G I  
Sbjct  17   AEFQEAFSLLDKDGDGCITFEELASAIKSLD-QNPTEEEIRNMINEVDLDGNGTIEF  72


 Score = 37.7 bits (86),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             + T E+  +MIL  D++GDG V +E+F RMM
Sbjct  121  EKLTDEELEQMILEADSDGDGQVNYEEFARMM  152


 Score = 35.4 bits (80),  Expect(3) = 4e-13, Method: Compositional matrix adjust.
 Identities = 15/46 (33%), Positives = 23/46 (50%), Gaps = 0/46 (0%)
 Frame = +3

Query  351  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGR  488
              ++++         EL++AF  FD D DG IS  EL +V   +G 
Sbjct  76   LKLMATKMKENEAQEELKEAFKVFDKDQDGYISPNELRHVMMNLGE  121



>gb|KJB60897.1| hypothetical protein B456_009G330300 [Gossypium raimondii]
Length=185

 Score = 44.3 bits (103),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 28/37 (76%), Gaps = 1/37 (3%)
 Frame = +1

Query  475  KRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            K  GD  C++E+CR+MI GVDN+G+G + F++F  MM
Sbjct  136  KSLGD-ECSIEECRKMISGVDNDGNGMIDFQEFKVMM  171


 Score = 41.2 bits (95),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 45/88 (51%), Gaps = 5/88 (6%)
 Frame = +2

Query  86   KKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  265
            K+    +TPTS         S  +L     EL Q F  +D + DGKI   EL +++  + 
Sbjct  12   KQNSTSNTPTSTASPSTRSSSQTQLQ----ELEQIFNKLDVNGDGKISLSELGSIMGSLA  67

Query  266  AEPPSREELRLMLSEVDRD-GDGCISLE  346
             +  S+EEL+ M+ E + D GDG ++ +
Sbjct  68   QKHQSKEELQKMMKEFNADYGDGFMNFD  95


 Score = 35.4 bits (80),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D + +G ISAEEL  V K++G
Sbjct  111  LKDAFSVYDRNGNGWISAEELQEVLKSLG  139



>ref|XP_006574101.1| PREDICTED: probable calcium-binding protein CML25-like [Glycine 
max]
Length=195

 Score = 44.7 bits (104),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
            +L   FK  D + DGKI   EL +++  +G +P + EE++ M+ EVD +GDG I+L
Sbjct  51   DLEYVFKKFDANGDGKISSSELGSIMKSLG-QPATEEEVKRMIQEVDANGDGHINL  105


 Score = 43.5 bits (101),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 27/34 (79%), Gaps = 1/34 (3%)
 Frame = +1

Query  484  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            GD+ C++++C++MI GVD NGDG + FE+F  MM
Sbjct  153  GDA-CSIDECQKMIAGVDGNGDGMINFEEFQLMM  185


 Score = 32.7 bits (73),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 21/36 (58%), Gaps = 0/36 (0%)
 Frame = +3

Query  378  PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            P      L+DAF  FD D +G I+A+EL  V  ++G
Sbjct  118  PDEVLENLKDAFSIFDVDGNGLITAQELNMVMASLG  153



>gb|KFK44513.1| hypothetical protein AALP_AA1G266400 [Arabis alpina]
Length=194

 Score = 43.5 bits (101),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            EL   FK  D + DGKI  +E+ A+++ +G E P  E L+  ++E+D+ GDG I+ E
Sbjct  40   ELEAVFKKFDVNGDGKISSKEIGAIMTSLGHEVP-EELLQKAITEIDQKGDGYINFE  95


 Score = 40.4 bits (93),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  478  RSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            RS    C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  139  RSLGDECSIAECRKMIGGVDKDGDGTIDFEEFKIMM  174


 Score = 36.6 bits (83),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            L+DAF  +D D +G ISAEEL  V +++G
Sbjct  114  LKDAFSVYDIDGNGSISAEELHQVLRSLG  142



>ref|XP_006443961.1| hypothetical protein CICLE_v10022698mg [Citrus clementina]
 ref|XP_006479630.1| PREDICTED: calmodulin-like [Citrus sinensis]
 gb|ESR57201.1| hypothetical protein CICLE_v10022698mg [Citrus clementina]
 gb|KDO68611.1| hypothetical protein CISIN_1g032008mg [Citrus sinensis]
Length=149

 Score = 48.5 bits (114),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 43/71 (61%), Gaps = 4/71 (6%)
 Frame = +2

Query  131  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  310
            + D ++ D++    AE  +AF +ID+D DG I  ++L  ++     E P +EE++ M+SE
Sbjct  1    MADALTEDQI----AEFQEAFCMIDKDSDGLITMKDLATVIQSAQDEHPRKEEVQEMISE  56

Query  311  VDRDGDGCISL  343
            VD DG+G I  
Sbjct  57   VDFDGNGSIDF  67


 Score = 37.4 bits (85),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 0/46 (0%)
 Frame = +3

Query  348  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            EF  +       +   EL++AF  FD D DG ISA EL NV   +G
Sbjct  69   EFLTIMGRKMKENVSEELKEAFKVFDRDQDGFISAAELRNVMMNLG  114


 Score = 35.0 bits (79),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 20/32 (63%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             R + E+  +MI   D +GDG V FE+F RMM
Sbjct  115  ERLSDEETEQMIREADLDGDGLVSFEEFARMM  146


 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 35/61 (57%), Gaps = 1/61 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGVQ  355
            EL +AFK+ DRD DG I   EL  ++  +G E  S EE   M+ E D DGDG +S E   
Sbjct  85   ELKEAFKVFDRDQDGFISAAELRNVMMNLG-ERLSDEETEQMIREADLDGDGLVSFEEFA  143

Query  356  R  358
            R
Sbjct  144  R  144



>gb|EPS69688.1| hypothetical protein M569_05080, partial [Genlisea aurea]
Length=139

 Score = 42.7 bits (99),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  463  LTCSKRSGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            L  + RS   +C+++DCR+MI  VD +GDG V FE+F RMM
Sbjct  98   LHSTLRSLGEKCSMKDCRKMISSVDVDGDGCVNFEEFKRMM  138


 Score = 40.0 bits (92),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 33/54 (61%), Gaps = 1/54 (2%)
 Frame = +2

Query  185  QAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            Q FK  D D DGKI   +L A+L  +G+   S+ +   ++SE+D DGDG I L+
Sbjct  9    QVFKKFDADGDGKISVSDLSAILKSLGS-TASKCDAASVMSELDVDGDGFIDLK  61


 Score = 38.1 bits (87),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            EL++AFD +D D +GKISA EL +  +++G
Sbjct  77   ELKEAFDLYDKDKNGKISAAELHSTLRSLG  106


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEGVQ  355
            EL +AF L D+D +GKI   EL + L  +G E  S ++ R M+S VD DGDGC++ E  +
Sbjct  77   ELKEAFDLYDKDKNGKISAAELHSTLRSLG-EKCSMKDCRKMISSVDVDGDGCVNFEEFK  135

Query  356  R  358
            R
Sbjct  136  R  136



>ref|XP_004235822.1| PREDICTED: calcium-binding allergen Ole e 8-like [Solanum lycopersicum]
Length=164

 Score = 43.1 bits (100),  Expect(3) = 6e-13, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             C+++DC +MI  VD++GDG+V FE+F +MM
Sbjct  130  NCSVQDCTKMINSVDSDGDGYVSFEEFKKMM  160


 Score = 41.6 bits (96),  Expect(3) = 6e-13, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            E+ + F+  D + DG I  EEL  ++S +G+   S EE+  M++E+D D DG ISL+
Sbjct  24   EVQKVFQRFDTNGDGMISGEELSGVISALGS-GTSPEEVSRMMNEIDSDRDGFISLQ  79


 Score = 35.8 bits (81),  Expect(3) = 6e-13, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (67%), Gaps = 0/30 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            ELR+AFD +D D +G ISA EL  +   +G
Sbjct  99   ELREAFDLYDQDSNGLISAAELHQILTRLG  128



>ref|XP_002440821.1| hypothetical protein SORBIDRAFT_09g007360 [Sorghum bicolor]
 gb|EES19251.1| hypothetical protein SORBIDRAFT_09g007360 [Sorghum bicolor]
Length=179

 Score = 45.8 bits (107),  Expect(3) = 7e-13, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
            AE+ Q F+  D + DGKI  EEL ++L  +GA PP   E+R M+ E+D D DG + L
Sbjct  25   AEVEQVFRRYDANGDGKISAEELASVLRALGA-PPGPGEVRRMMDEMDSDRDGFVDL  80


 Score = 38.5 bits (88),  Expect(3) = 7e-13, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            +C++ DC RMI  VD +GDG V F++F +MM
Sbjct  141  KCSVADCSRMIRSVDADGDGSVNFDEFKKMM  171


 Score = 36.2 bits (82),  Expect(3) = 7e-13, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +3

Query  384  SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            + +++LR+AF  +D D +G ISA EL  V + +G
Sbjct  106  ATEADLREAFRMYDADRNGLISARELHRVLRQLG  139



>ref|XP_007219711.1| hypothetical protein PRUPE_ppa025855mg [Prunus persica]
 gb|EMJ20910.1| hypothetical protein PRUPE_ppa025855mg [Prunus persica]
Length=193

 Score = 43.9 bits (102),  Expect(3) = 7e-13, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             RC+L +CR+MI GVD NGDG V FE+F  MM
Sbjct  156  QRCSLRECRQMIKGVDKNGDGAVDFEEFRLMM  187


 Score = 42.0 bits (97),  Expect(3) = 7e-13, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +3

Query  390  DSELRDAFDFFDTDHDGKISAEELFNVFKTIGRLAVHVR  506
            DSEL DAF  FDTD +GKISA+EL  V  ++G     +R
Sbjct  123  DSELMDAFLIFDTDKNGKISAKELQRVLVSLGCQRCSLR  161


 Score = 34.3 bits (77),  Expect(3) = 7e-13, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 36/63 (57%), Gaps = 1/63 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP-SREELRLMLSEVDRDGDGCISLEGV  352
            +  Q F+++D + DGKI   EL  +LS +G +   + +E   ++ E+D +GDG I LE  
Sbjct  48   QFKQVFEVMDSNGDGKISPLELSEVLSCLGYKKSIATKEAEGIVREMDCNGDGFIDLEEF  107

Query  353  QRA  361
              A
Sbjct  108  MNA  110


 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            +EL+ AF + D D +GKI  +EL+ +L  +G +  S  E R M+  VD++GDG +  E
Sbjct  124  SELMDAFLIFDTDKNGKISAKELQRVLVSLGCQRCSLRECRQMIKGVDKNGDGAVDFE  181



>gb|KDP33161.1| hypothetical protein JCGZ_13426 [Jatropha curcas]
Length=159

 Score = 42.0 bits (97),  Expect(3) = 7e-13, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 1/65 (2%)
 Frame = +2

Query  152  DELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDG  331
            + L G   E+   F   D++ DGKI  EE+   L ++G +  S EE++ M+ E D+DGDG
Sbjct  8    NSLVGSMDEIRGIFNKFDKNGDGKISSEEVIQSLGELGTKI-SPEEVQCMMQEFDKDGDG  66

Query  332  CISLE  346
             I L+
Sbjct  67   YIDLD  71


 Score = 39.7 bits (91),  Expect(3) = 7e-13, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            R TL DC +MI  VD +GDG V FE+F +MM
Sbjct  124  RSTLNDCMKMIRQVDEDGDGNVNFEEFKKMM  154


 Score = 38.9 bits (89),  Expect(3) = 7e-13, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = +3

Query  390  DSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            + EL+DAFD +D D +G ISA EL  V K +G
Sbjct  91   NKELKDAFDLYDIDKNGLISASELHKVMKMLG  122



>ref|XP_010549761.1| PREDICTED: probable calcium-binding protein CML32 [Tarenaya hassleriana]
Length=210

 Score = 44.7 bits (104),  Expect(3) = 7e-13, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             +CT++DCRRMI  VD +GDG V FE+F +MM
Sbjct  175  EKCTVDDCRRMIRAVDVDGDGHVDFEEFKKMM  206


 Score = 38.9 bits (89),  Expect(3) = 7e-13, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 32/54 (59%), Gaps = 1/54 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  337
            EL+Q F+  D++ DGKI  EE  ++  +  +   S EEL  M+ E D DGDG I
Sbjct  60   ELMQMFEQFDKNGDGKISGEEFRSVF-RAFSPSLSAEELDKMMEEFDVDGDGYI  112


 Score = 36.6 bits (83),  Expect(3) = 7e-13, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            +LR+AF+ +D D DGKISA EL  V + +G
Sbjct  145  DLREAFEMYDADGDGKISAMELHVVLRRLG  174



>ref|XP_006652455.1| PREDICTED: probable calcium-binding protein CML22-like [Oryza 
brachyantha]
Length=264

 Score = 52.0 bits (123),  Expect(3) = 7e-13, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            AEL + F+L DR+ DG+I +EELE  L ++G   P+ +EL   ++ +D +GDGC+ +E
Sbjct  106  AELARVFELFDRNGDGRITREELEDSLGKLGIPVPA-DELAATIARIDANGDGCVDVE  162


 Score = 38.1 bits (87),  Expect(3) = 7e-13, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  499  TLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            T E+CRRMI  VD +GDG V F +F +MM
Sbjct  227  TAEECRRMIGQVDRDGDGRVDFHEFLQMM  255


 Score = 30.4 bits (67),  Expect(3) = 7e-13, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +3

Query  399  LRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            +R+AF  FD + DG I+ +EL  V  ++G
Sbjct  193  MREAFRVFDANGDGYITVDELGAVLASLG  221



>dbj|BAK01430.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=172

 Score = 43.9 bits (102),  Expect(3) = 8e-13, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 41/69 (59%), Gaps = 4/69 (6%)
 Frame = +2

Query  149  PDELSGL---YAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDR  319
            P+  +GL    AEL Q F+  D + DGKI  +E+ ++L  +GA PP   E++ M+ E+D 
Sbjct  10   PEICAGLGMPMAELEQVFRRYDANGDGKISADEMASVLCALGA-PPGPGEVQSMMEEMDA  68

Query  320  DGDGCISLE  346
            D DG + L 
Sbjct  69   DRDGFVDLH  77


 Score = 39.7 bits (91),  Expect(3) = 8e-13, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            +C++ DC RMI  VD +GDG V FE+F +MM
Sbjct  136  KCSVSDCSRMIRSVDADGDGSVNFEEFKKMM  166


 Score = 36.2 bits (82),  Expect(3) = 8e-13, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = +3

Query  390  DSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            ++EL++AF  +D D +G ISA EL  V + +G
Sbjct  103  EAELKEAFRMYDADRNGLISARELHRVLRQLG  134



>emb|CAH67730.1| H0522A01.1 [Oryza sativa Indica Group]
 emb|CAH67538.1| H0425E08.6 [Oryza sativa Indica Group]
 gb|EAY94662.1| hypothetical protein OsI_16440 [Oryza sativa Indica Group]
Length=197

 Score = 51.6 bits (122),  Expect(3) = 8e-13, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            AEL + F+L DR+ DG+I +EELE  L ++G   P+ +EL  +++ +D +GDGC+ +E
Sbjct  38   AELARVFELFDRNGDGRITREELEDSLGKLGIPVPA-DELAAVIARIDANGDGCVDVE  94


 Score = 37.0 bits (84),  Expect(3) = 8e-13, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  499  TLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            T E+CRRMI  VD +GDG V F +F +MM
Sbjct  160  TAEECRRMIGQVDRDGDGRVDFHEFLQMM  188


 Score = 31.2 bits (69),  Expect(3) = 8e-13, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = +3

Query  390  DSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            D ++R+AF  FD + DG I+ +EL  V  ++G
Sbjct  123  DGDMREAFRVFDANGDGYITVDELGAVLASLG  154



>emb|CAD41532.1| OSJNBb0091E11.1 [Oryza sativa Japonica Group]
 emb|CAE02048.2| OJ990528_30.6 [Oryza sativa Japonica Group]
Length=196

 Score = 51.6 bits (122),  Expect(3) = 8e-13, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            AEL + F+L DR+ DG+I +EELE  L ++G   P+ +EL  +++ +D +GDGC+ +E
Sbjct  37   AELARVFELFDRNGDGRITREELEDSLGKLGIPVPA-DELAAVIARIDANGDGCVDVE  93


 Score = 37.0 bits (84),  Expect(3) = 8e-13, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  499  TLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            T E+CRRMI  VD +GDG V F +F +MM
Sbjct  159  TAEECRRMIGQVDRDGDGRVDFHEFLQMM  187


 Score = 31.2 bits (69),  Expect(3) = 8e-13, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = +3

Query  390  DSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            D ++R+AF  FD + DG I+ +EL  V  ++G
Sbjct  122  DGDMREAFRVFDANGDGYITVDELGAVLASLG  153



>dbj|BAJ88405.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07786.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=191

 Score = 44.7 bits (104),  Expect(3) = 9e-13, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  493  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            + T++ CRRMI GVD NGDG + F++F  MM
Sbjct  152  KATVQQCRRMIEGVDKNGDGLISFDEFKVMM  182


 Score = 43.5 bits (101),  Expect(3) = 9e-13, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
            E+ + F+  D + DG+I + EL AL   +G    + +EL  M++E D DGDG ISL
Sbjct  50   EMERVFRKFDANGDGRISRPELAALFESLG-HAATDDELSRMMAEADADGDGFISL  104


 Score = 31.6 bits (70),  Expect(3) = 9e-13, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 1/50 (2%)
 Frame = +3

Query  348  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGRLAV  497
            EF+ L+ A A    + +LR AF  FD D  G ISA EL  V   +G  A 
Sbjct  106  EFAALN-ATAAGDDEEDLRLAFKVFDADGSGAISAAELARVLHGLGEKAT  154



>ref|XP_003554273.1| PREDICTED: calmodulin-3-like [Glycine max]
 gb|KHN02547.1| Calmodulin [Glycine soja]
Length=148

 Score = 50.1 bits (118),  Expect(3) = 9e-13, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            AE  +AF LID+D DG I  +EL  ++  +    P++EE++ M+SEVD DG+G I  E
Sbjct  11   AEFHEAFSLIDKDSDGFITVDELTTIIRSLEG-NPTKEEIQNMISEVDIDGNGSIDFE  67


 Score = 36.2 bits (82),  Expect(3) = 9e-13, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             R T E+  +MI+  D +GDG V FE+F R+M
Sbjct  114  ERLTGEEAEQMIMEADLDGDGQVSFEEFARIM  145


 Score = 33.5 bits (75),  Expect(3) = 9e-13, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 24/46 (52%), Gaps = 0/46 (0%)
 Frame = +3

Query  348  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            EF  +       +   EL++AF  FD D +G ISA EL +V   +G
Sbjct  68   EFLNIMGRKMKETLAEELKEAFKVFDRDQNGYISATELRHVMTNLG  113



>ref|XP_009604908.1| PREDICTED: probable calcium-binding protein CML18 [Nicotiana 
tomentosiformis]
 ref|XP_009604909.1| PREDICTED: probable calcium-binding protein CML18 [Nicotiana 
tomentosiformis]
Length=202

 Score = 43.9 bits (102),  Expect(3) = 1e-12, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  496  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
            C++++CRRMI GVD +GDGFV F++F  MM
Sbjct  167  CSVKECRRMIKGVDKDGDGFVNFDEFKEMM  196


 Score = 41.6 bits (96),  Expect(3) = 1e-12, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = +2

Query  167  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP-PSREEL-RLMLSEVDRDGDGCIS  340
            +Y++L   FK ID + DGKI   EL  +L  +G E   + EEL  +M+ E+D DGDG + 
Sbjct  50   IYSQLKLVFKFIDANGDGKISPLELTEILLSLGHEELKAAEELAEIMVKEMDCDGDGFVD  109

Query  341  LE  346
            L+
Sbjct  110  LD  111


 Score = 34.3 bits (77),  Expect(3) = 1e-12, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +3

Query  396  ELRDAFDFFDTDHDGKISAEELFNVFKTIGRLAVHVR  506
            ELR+AF  FD D +G ISA+EL  V  ++G +   V+
Sbjct  134  ELREAFLVFDADKNGVISAKELRRVLISLGCVNCSVK  170



>ref|XP_002520954.1| calmodulin, putative [Ricinus communis]
 gb|EEF41371.1| calmodulin, putative [Ricinus communis]
Length=148

 Score = 51.6 bits (122),  Expect(3) = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 45/72 (63%), Gaps = 5/72 (7%)
 Frame = +2

Query  131  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  310
            + D ++ D++    AE  +AF LID+D DG I  EEL  ++  +    P++EE+R M+SE
Sbjct  1    MADALTEDQI----AEFHEAFCLIDKDSDGFITMEELATVIQSLDG-HPTKEEIRDMISE  55

Query  311  VDRDGDGCISLE  346
            VD DG+G I  +
Sbjct  56   VDFDGNGTIDFQ  67


 Score = 35.8 bits (81),  Expect(3) = 1e-12, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 20/32 (63%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             R T E+  +MI   D +GDG V +E+F RMM
Sbjct  114  ERLTEEEAEQMIREADLDGDGLVSYEEFARMM  145


 Score = 32.0 bits (71),  Expect(3) = 1e-12, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  REFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            +EF  +       +   EL++AF  FD + DG ISA EL  V   +G
Sbjct  67   QEFLNIMGRKMKENVVEELKEAFKVFDRNQDGFISANELRQVMINLG  113



>ref|XP_010935758.1| PREDICTED: neo-calmodulin-like [Elaeis guineensis]
 ref|XP_010935767.1| PREDICTED: neo-calmodulin-like [Elaeis guineensis]
Length=148

 Score = 48.9 bits (115),  Expect(3) = 1e-12, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
            +E  +AF L D+D DG I  EELE ++  +G + P+ +EL  M+ E+D DG+G I  
Sbjct  10   SEFQEAFSLFDKDGDGCITLEELETVIKSLG-QNPTEDELHEMIKEIDADGNGTIEF  65


 Score = 38.1 bits (87),  Expect(3) = 1e-12, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 26/46 (57%), Gaps = 0/46 (0%)
 Frame = +3

Query  351  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGR  488
             S+++        + E+++AF  FD D +G ISA EL NV  ++G 
Sbjct  69   LSLMARKMKETDAEEEIKEAFKVFDKDQNGYISASELKNVMISLGE  114


 Score = 32.7 bits (73),  Expect(3) = 1e-12, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 20/32 (63%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             + T E+  +MI   D +GDG V +E+F RMM
Sbjct  114  EKLTDEEVDQMIKEADLDGDGQVNYEEFVRMM  145



>ref|XP_006014812.1| PREDICTED: calmodulin [Alligator sinensis]
Length=200

 Score = 53.9 bits (128),  Expect(3) = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 53/88 (60%), Gaps = 11/88 (13%)
 Frame = +2

Query  80   GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  259
            G+KKP  ++T ++      D+++ +++    AE  +AF L D+D DG I  +EL  ++  
Sbjct  41   GFKKPKSQATWSA------DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRS  90

Query  260  VGAEPPSREELRLMLSEVDRDGDGCISL  343
            +G + P+  EL+ M++EVD DG+G I  
Sbjct  91   LG-QNPTEAELQDMINEVDADGNGTIDF  117


 Score = 34.7 bits (78),  Expect(3) = 1e-12, Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (56%), Gaps = 0/45 (0%)
 Frame = +3

Query  351  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
             ++++        + E+R+AF  FD D +G ISA EL +V   +G
Sbjct  121  LTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLG  165


 Score = 30.8 bits (68),  Expect(3) = 1e-12, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             + T E+   MI   D +GDG V +E+F +MM
Sbjct  166  EKLTDEEVDEMIREADIDGDGQVNYEEFVQMM  197



>ref|XP_008808019.1| PREDICTED: calmodulin-like [Phoenix dactylifera]
Length=148

 Score = 48.5 bits (114),  Expect(3) = 1e-12, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
            +E  +AF L D+D DG+I  EEL  ++  +G + P+ EEL+ M+SEVD +G+G I  
Sbjct  10   SEFQEAFCLFDKDGDGRITLEELATVIRSLG-QNPTEEELQDMISEVDANGNGTIEF  65


 Score = 38.1 bits (87),  Expect(3) = 1e-12, Method: Compositional matrix adjust.
 Identities = 16/45 (36%), Positives = 24/45 (53%), Gaps = 0/45 (0%)
 Frame = +3

Query  351  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
              +++        + EL++AF  FD D +G ISA EL NV   +G
Sbjct  69   LGLMARKMKETDAEEELKEAFKVFDKDQNGYISANELRNVMINLG  113


 Score = 32.3 bits (72),  Expect(3) = 1e-12, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 20/32 (63%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             + T E+  +MI   D +GDG V +E+F RMM
Sbjct  114  EKLTDEEVEQMIREADIDGDGQVNYEEFVRMM  145



>gb|KEH41232.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=142

 Score = 43.9 bits (102),  Expect(3) = 1e-12, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            E+ + F   D++ DG+I   ELE +LS +G++  + +EL+ M+  +D++GDG I L+
Sbjct  4    EVRKIFNKFDKNGDGRISVTELEQMLSSLGSKWTT-DELKTMMEHIDKNGDGYIDLK  59


 Score = 39.7 bits (91),  Expect(3) = 1e-12, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             +C+L DC+RMI  VD +GDG V F++F +MM
Sbjct  109  EKCSLGDCQRMISNVDADGDGKVNFDEFKKMM  140


 Score = 35.4 bits (80),  Expect(3) = 1e-12, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 20/32 (63%), Gaps = 0/32 (0%)
 Frame = +3

Query  390  DSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            D ELRDAF+ +D D DG IS  EL  V   +G
Sbjct  77   DEELRDAFNLYDLDKDGVISPTELHIVLNKLG  108



>gb|ABK21927.1| unknown [Picea sitchensis]
Length=149

 Score = 48.5 bits (114),  Expect(3) = 2e-12, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  343
            AE  +AF L DRD DG I  +EL  ++  +G + P+  E++ M++EVD DG+G I  
Sbjct  11   AEFREAFSLFDRDGDGSITTKELSTVIRSLG-QNPTEAEIQDMINEVDTDGNGTIDF  66


 Score = 37.0 bits (84),  Expect(3) = 2e-12, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = +3

Query  345  REF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            REF  +++        D ELR+AF  FD D +G ISA EL +V   +G
Sbjct  67   REFLDLMAHKIKDLDSDEELREAFKVFDKDQNGYISAAELRHVMINLG  114


 Score = 33.5 bits (75),  Expect(3) = 2e-12, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             + T E+   MI   D +GDG V +E+F RMM
Sbjct  115  EKLTEEEVELMIKEADTDGDGQVNYEEFVRMM  146



>ref|XP_008368689.1| PREDICTED: calmodulin-like protein 11 [Malus domestica]
 ref|XP_008363651.1| PREDICTED: calmodulin-like protein 11 [Malus domestica]
Length=148

 Score = 46.6 bits (109),  Expect(3) = 2e-12, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  346
            AE  +AF LID+D DG I  EEL  ++  +  + P++EE++ M+SE+  DG+G I  E
Sbjct  11   AEFQEAFCLIDKDSDGLISLEELATVIQSLD-QRPTKEEIQDMISEIXADGNGTIDFE  67


 Score = 36.6 bits (83),  Expect(3) = 2e-12, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 20/32 (63%), Gaps = 0/32 (0%)
 Frame = +1

Query  490  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  585
             R T E+  +MI   D +GDG V +E+F RMM
Sbjct  114  ERLTDEEAEQMIREADLDGDGLVSYEEFARMM  145


 Score = 35.8 bits (81),  Expect(3) = 2e-12, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 0/46 (0%)
 Frame = +3

Query  348  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  485
            EF  + S     +   EL++AF  FD D DG ISA EL  V   +G
Sbjct  68   EFLNIMSRKMKENVAEELKEAFKVFDRDQDGYISASELRQVMINLG  113



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520