BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF008N11

Length=576
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009612279.1|  PREDICTED: oxygen-evolving enhancer protein ...    297   3e-97   Nicotiana tomentosiformis
ref|XP_009768511.1|  PREDICTED: oxygen-evolving enhancer protein ...    294   6e-96   Nicotiana sylvestris
gb|KDP31833.1|  hypothetical protein JCGZ_12294                         293   1e-95   Jatropha curcas
ref|XP_009604683.1|  PREDICTED: oxygen-evolving enhancer protein ...    293   1e-95   Nicotiana tomentosiformis
ref|XP_011004600.1|  PREDICTED: oxygen-evolving enhancer protein ...    293   2e-95   Populus euphratica
gb|AAX53163.1|  chloroplast photosynthetic oxygen-evolving protei...    292   2e-95   Nicotiana benthamiana
ref|XP_009759927.1|  PREDICTED: oxygen-evolving enhancer protein ...    292   3e-95   Nicotiana sylvestris
gb|AFH58000.1|  chloroplast PsbO4 precursor                             292   3e-95   Nicotiana benthamiana
ref|XP_002307234.1|  O2 evolving complex 33kD family protein            291   4e-95   Populus trichocarpa [western balsam poplar]
ref|XP_011099252.1|  PREDICTED: oxygen-evolving enhancer protein ...    291   5e-95   Sesamum indicum [beniseed]
gb|AFH57998.1|  chloroplast PsbO2 precursor                             291   1e-94   Nicotiana benthamiana
gb|ABK96748.1|  unknown                                                 290   1e-94   Populus trichocarpa x Populus deltoides
gb|ADZ75466.1|  oxygen evolving enhancer protein 1                      290   2e-94   Litchi chinensis [litchi]
gb|AFH57997.1|  chloroplast PsbO1 precursor                             290   2e-94   Nicotiana benthamiana
ref|XP_009379152.1|  PREDICTED: oxygen-evolving enhancer protein ...    290   3e-94   Pyrus x bretschneideri [bai li]
ref|XP_008338186.1|  PREDICTED: oxygen-evolving enhancer protein ...    290   3e-94   Malus domestica [apple tree]
gb|AFH57999.1|  chloroplast PsbO3 precursor                             289   5e-94   Nicotiana benthamiana
ref|XP_011085527.1|  PREDICTED: oxygen-evolving enhancer protein ...    289   5e-94   Sesamum indicum [beniseed]
ref|XP_007047093.1|  Photosystem II subunit O-2                         288   7e-94   
ref|XP_009376463.1|  PREDICTED: oxygen-evolving enhancer protein ...    288   1e-93   Pyrus x bretschneideri [bai li]
ref|XP_009341905.1|  PREDICTED: oxygen-evolving enhancer protein ...    287   3e-93   Pyrus x bretschneideri [bai li]
ref|XP_008241598.1|  PREDICTED: oxygen-evolving enhancer protein ...    286   9e-93   Prunus mume [ume]
gb|AEO21912.1|  chloroplast oxygen-evolving enhancer protein 1          285   2e-92   Dimocarpus longan [longan]
gb|AAS55410.1|  photosystem II protein                                  281   2e-92   Brassica rapa
ref|XP_006344816.1|  PREDICTED: oxygen-evolving enhancer protein ...    285   3e-92   Solanum tuberosum [potatoes]
ref|XP_004233415.1|  PREDICTED: oxygen-evolving enhancer protein ...    284   3e-92   
ref|XP_002274796.1|  PREDICTED: oxygen-evolving enhancer protein ...    284   4e-92   Vitis vinifera
ref|XP_002522386.1|  Oxygen-evolving enhancer protein 1, chloropl...    284   5e-92   Ricinus communis
ref|XP_007202212.1|  hypothetical protein PRUPE_ppa008420mg             283   7e-92   Prunus persica
ref|XP_009412420.1|  PREDICTED: LOW QUALITY PROTEIN: oxygen-evolv...    283   9e-92   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001239736.1|  uncharacterized protein LOC100798485               282   2e-91   Glycine max [soybeans]
ref|XP_010255017.1|  PREDICTED: oxygen-evolving enhancer protein ...    282   2e-91   Nelumbo nucifera [Indian lotus]
sp|P26320.1|PSBO_SOLTU  RecName: Full=Oxygen-evolving enhancer pr...    281   5e-91   Solanum tuberosum [potatoes]
ref|XP_011025676.1|  PREDICTED: oxygen-evolving enhancer protein ...    281   8e-91   Populus euphratica
ref|XP_002310188.1|  O2 evolving complex 33kD family protein            281   9e-91   Populus trichocarpa [western balsam poplar]
dbj|BAA96365.3|  oxygen evolving enhancer protein 1 precursor           281   9e-91   Bruguiera gymnorhiza [Burma mangrove]
gb|KJB43586.1|  hypothetical protein B456_007G208000                    280   2e-90   Gossypium raimondii
ref|XP_010924166.1|  PREDICTED: oxygen-evolving enhancer protein ...    280   2e-90   Elaeis guineensis
emb|CDP02430.1|  unnamed protein product                                279   5e-90   Coffea canephora [robusta coffee]
emb|CAA35601.1|  33kDa precursor protein of oxygen-evolving complex     279   5e-90   Solanum tuberosum [potatoes]
gb|KDO79409.1|  hypothetical protein CISIN_1g019870mg                   278   6e-90   Citrus sinensis [apfelsine]
gb|KHG13438.1|  Oxygen-evolving enhancer 1, chloroplastic               278   7e-90   Gossypium arboreum [tree cotton]
ref|XP_006856169.1|  hypothetical protein AMTR_s00059p00176390          278   8e-90   Amborella trichopoda
ref|XP_006338257.1|  PREDICTED: chloroplast manganese stabilizing...    278   8e-90   Solanum tuberosum [potatoes]
ref|XP_006425778.1|  hypothetical protein CICLE_v10026034mg             278   2e-89   Citrus clementina [clementine]
ref|XP_004300575.1|  PREDICTED: oxygen-evolving enhancer protein ...    277   2e-89   Fragaria vesca subsp. vesca
ref|XP_004232077.1|  PREDICTED: oxygen-evolving enhancer protein ...    277   2e-89   
ref|XP_009103510.1|  PREDICTED: oxygen-evolving enhancer protein ...    276   8e-89   Brassica rapa
ref|XP_010263833.1|  PREDICTED: oxygen-evolving enhancer protein ...    276   9e-89   Nelumbo nucifera [Indian lotus]
ref|XP_009758248.1|  PREDICTED: oxygen-evolving enhancer protein ...    275   1e-88   Nicotiana sylvestris
ref|XP_006280785.1|  hypothetical protein CARUB_v10026754mg             275   1e-88   Capsella rubella
ref|XP_007156865.1|  hypothetical protein PHAVU_002G024000g             275   1e-88   Phaseolus vulgaris [French bean]
gb|KFK34331.1|  hypothetical protein AALP_AA5G131000                    275   1e-88   Arabis alpina [alpine rockcress]
gb|EYU44326.1|  hypothetical protein MIMGU_mgv1a009768mg                275   2e-88   Erythranthe guttata [common monkey flower]
gb|ADR71223.1|  chloroplast manganese stabilizing protein               273   4e-88   Solanum tuberosum [potatoes]
ref|XP_008800919.1|  PREDICTED: oxygen-evolving enhancer protein ...    273   5e-88   Phoenix dactylifera
emb|CBI19622.3|  unnamed protein product                                271   6e-88   Vitis vinifera
ref|XP_009130561.1|  PREDICTED: oxygen-evolving enhancer protein ...    273   6e-88   Brassica rapa
ref|XP_006393852.1|  hypothetical protein EUTSA_v10004563mg             273   7e-88   Eutrema salsugineum [saltwater cress]
gb|AAD38521.1|AF139818_1  33 kDa oxygen evolving protein of photo...    271   7e-88   Brassica napus [oilseed rape]
ref|XP_010444775.1|  PREDICTED: oxygen-evolving enhancer protein ...    273   8e-88   Camelina sativa [gold-of-pleasure]
ref|XP_002877774.1|  photosystem II subunit O-2                         273   1e-87   Arabidopsis lyrata subsp. lyrata
gb|AAT65501.1|  photosystem II protein                                  273   1e-87   Brassica oleracea
emb|CDY30764.1|  BnaC07g16640D                                          272   1e-87   Brassica napus [oilseed rape]
ref|XP_002866754.1|  oxygen-evolving enhancer 33                        272   2e-87   Arabidopsis lyrata subsp. lyrata
ref|XP_003637254.1|  Oxygen-evolving enhancer protein                   269   2e-87   
ref|XP_010028333.1|  PREDICTED: oxygen-evolving enhancer protein ...    272   2e-87   Eucalyptus grandis [rose gum]
ref|XP_006291313.1|  hypothetical protein CARUB_v10017447mg             273   3e-87   
gb|AGV54778.1|  oxygen-evolving enhancer protein 1                      271   3e-87   Phaseolus vulgaris [French bean]
ref|XP_009112310.1|  PREDICTED: oxygen-evolving enhancer protein ...    271   3e-87   Brassica rapa
ref|XP_010550399.1|  PREDICTED: oxygen-evolving enhancer protein ...    271   3e-87   Tarenaya hassleriana [spider flower]
ref|NP_190651.1|  oxygen-evolving enhancer protein 1-2                  271   4e-87   Arabidopsis thaliana [mouse-ear cress]
emb|CDX81388.1|  BnaC09g07990D                                          271   4e-87   
ref|XP_010103689.1|  Oxygen-evolving enhancer protein 1                 271   4e-87   Morus notabilis
ref|XP_010484624.1|  PREDICTED: oxygen-evolving enhancer protein ...    271   4e-87   Camelina sativa [gold-of-pleasure]
emb|CAN79166.1|  hypothetical protein VITISV_019248                     271   6e-87   Vitis vinifera
ref|XP_002283699.1|  PREDICTED: oxygen-evolving enhancer protein ...    271   6e-87   Vitis vinifera
emb|CDY50981.1|  BnaC02g48890D                                          270   1e-86   Brassica napus [oilseed rape]
ref|XP_006403995.1|  hypothetical protein EUTSA_v10010535mg             270   1e-86   Eutrema salsugineum [saltwater cress]
gb|ABG25041.1|  33kDa precursor protein of oxygen-evolving complex      264   2e-86   Nicotiana tabacum [American tobacco]
gb|KFK28330.1|  hypothetical protein AALP_AA8G502100                    270   2e-86   Arabis alpina [alpine rockcress]
ref|XP_003636084.1|  Oxygen-evolving enhancer protein                   270   2e-86   
ref|NP_001241522.1|  uncharacterized protein LOC100820458               269   2e-86   Glycine max [soybeans]
gb|AAM65169.1|  33 kDa polypeptide of oxygen-evolving complex (OE...    269   3e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007155994.1|  hypothetical protein PHAVU_003G249800g             269   3e-86   Phaseolus vulgaris [French bean]
ref|NP_201458.1|  PS II oxygen-evolving complex 1                       268   9e-86   Arabidopsis thaliana [mouse-ear cress]
gb|AAK49614.1|AF372898_1  AT5g66570/K1F13_25                            268   9e-86   Arabidopsis thaliana [mouse-ear cress]
gb|AAK96774.1|  33 kDa polypeptide of oxygen-evolving complex           268   1e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003548008.1|  PREDICTED: oxygen-evolving enhancer protein ...    267   2e-85   Glycine max [soybeans]
gb|AAM96957.1|  33 kDa polypeptide of oxygen-evolving complex (OE...    267   2e-85   Arabidopsis thaliana [mouse-ear cress]
gb|AAL08257.1|  AT5g66570/K1F13_25                                      266   3e-85   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001043134.1|  Os01g0501800                                       266   4e-85   
ref|NP_001240871.1|  uncharacterized protein LOC100811386               265   8e-85   Glycine max [soybeans]
gb|ACS34663.1|  chloroplast manganese stabilizing protein-II            263   1e-84   Solanum tuberosum [potatoes]
ref|XP_010465252.1|  PREDICTED: oxygen-evolving enhancer protein ...    265   2e-84   Camelina sativa [gold-of-pleasure]
ref|XP_010924332.1|  PREDICTED: LOW QUALITY PROTEIN: oxygen-evolv...    265   2e-84   Elaeis guineensis
gb|EEC70714.1|  hypothetical protein OsI_02088                          265   2e-84   Oryza sativa Indica Group [Indian rice]
gb|AFW90569.1|  chloroplast manganese stabilizing protein-II            263   3e-84   Solanum tuberosum [potatoes]
sp|P14226.1|PSBO_PEA  RecName: Full=Oxygen-evolving enhancer prot...    264   3e-84   Pisum sativum [garden pea]
ref|XP_010424899.1|  PREDICTED: oxygen-evolving enhancer protein ...    263   4e-84   Camelina sativa [gold-of-pleasure]
gb|ABG25040.1|  33kDa precursor protein of oxygen-evolving complex      257   1e-83   Solanum lycopersicum
ref|XP_008440181.1|  PREDICTED: oxygen-evolving enhancer protein ...    263   1e-83   Cucumis melo [Oriental melon]
ref|XP_009149414.1|  PREDICTED: oxygen-evolving enhancer protein ...    262   1e-83   Brassica rapa
emb|CAA36675.1|  33 kDa oxygen-evolving protein                         262   1e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008787656.1|  PREDICTED: oxygen-evolving enhancer protein ...    262   2e-83   Phoenix dactylifera
ref|XP_010503753.1|  PREDICTED: oxygen-evolving enhancer protein ...    262   2e-83   Camelina sativa [gold-of-pleasure]
ref|XP_003611860.1|  Oxygen evolving enhancer protein                   261   2e-83   Medicago truncatula
ref|XP_004968772.1|  PREDICTED: oxygen-evolving enhancer protein ...    262   2e-83   Setaria italica
ref|XP_004509219.1|  PREDICTED: oxygen-evolving enhancer protein ...    261   3e-83   
ref|XP_010673597.1|  PREDICTED: oxygen-evolving enhancer protein ...    261   3e-83   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004141946.1|  PREDICTED: oxygen-evolving enhancer protein ...    261   6e-83   Cucumis sativus [cucumbers]
emb|CDY33308.1|  BnaA01g19750D                                          262   7e-83   Brassica napus [oilseed rape]
ref|XP_006644206.1|  PREDICTED: oxygen-evolving enhancer protein ...    260   1e-82   Oryza brachyantha
emb|CDY26519.1|  BnaC01g23800D                                          261   1e-82   Brassica napus [oilseed rape]
ref|XP_010515458.1|  PREDICTED: oxygen-evolving enhancer protein ...    259   4e-82   Camelina sativa [gold-of-pleasure]
gb|EPS61846.1|  oxygen-evolving enhancer protein 1, chloroplastic       258   6e-82   Genlisea aurea
ref|XP_009616099.1|  PREDICTED: oxygen-evolving enhancer protein ...    257   9e-82   
gb|AEN02470.1|  oxygen-evolving enhancer protein                        256   2e-81   Camellia sinensis [black tea]
gb|ADB07372.1|  chloroplast managanese stabilizing protein              255   2e-81   Capsicum annuum
gb|AFW69213.1|  oxygen-evolving enhancer protein 1                      258   3e-81   
ref|NP_001130585.1|  uncharacterized protein LOC100191684               256   5e-81   Zea mays [maize]
ref|XP_009387680.1|  PREDICTED: oxygen-evolving enhancer protein ...    250   5e-81   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS63035.1|  Oxygen-evolving enhancer protein 1, chloroplastic       254   1e-80   Triticum urartu
ref|XP_002866983.1|  hypothetical protein ARALYDRAFT_328078             254   2e-80   Arabidopsis lyrata subsp. lyrata
dbj|BAJ89638.1|  predicted protein                                      254   3e-80   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|P27665.1|PSBO_WHEAT  RecName: Full=Oxygen-evolving enhancer pr...    253   3e-80   Triticum aestivum [Canadian hard winter wheat]
sp|O49079.1|PSBO_FRIAG  RecName: Full=Oxygen-evolving enhancer pr...    253   3e-80   Fritillaria agrestis
gb|ABQ52657.1|  chloroplast oxygen-evolving enhancer protein 1          253   8e-80   Leymus chinensis
ref|XP_010557854.1|  PREDICTED: oxygen-evolving enhancer protein ...    251   3e-79   Tarenaya hassleriana [spider flower]
gb|AFH40666.1|  chloroplast oxygen-evolving enhancer protein 1          251   4e-79   Saccharum hybrid cultivar [sugarcane]
ref|XP_008647514.1|  PREDICTED: hypothetical protein isoform X1         250   7e-79   
ref|XP_010432121.1|  PREDICTED: oxygen-evolving enhancer protein ...    250   8e-79   
gb|AFK43771.1|  unknown                                                 250   9e-79   Lotus japonicus
ref|XP_010446730.1|  PREDICTED: oxygen-evolving enhancer protein ...    250   9e-79   Camelina sativa [gold-of-pleasure]
ref|XP_010432119.1|  PREDICTED: oxygen-evolving enhancer protein ...    249   1e-78   Camelina sativa [gold-of-pleasure]
ref|XP_010446731.1|  PREDICTED: oxygen-evolving enhancer protein ...    249   1e-78   
dbj|BAG70021.1|  33 kDa precursor protein of the oxygen-evolving ...    248   5e-78   Salicornia europaea [chicken-claws]
sp|P85194.1|PSBO_HELAN  RecName: Full=Oxygen-evolving enhancer pr...    248   6e-78   Helianthus annuus
emb|CAA29062.1|  unnamed protein product                                245   7e-77   Spinacia oleracea
sp|P12359.1|PSBO_SPIOL  RecName: Full=Oxygen-evolving enhancer pr...    245   8e-77   Spinacia oleracea
ref|XP_003557544.1|  PREDICTED: oxygen-evolving enhancer protein ...    244   1e-76   Brachypodium distachyon [annual false brome]
gb|KJB43585.1|  hypothetical protein B456_007G208000                    241   2e-75   Gossypium raimondii
ref|XP_006411950.1|  hypothetical protein EUTSA_v10025711mg             239   8e-75   Eutrema salsugineum [saltwater cress]
emb|CAN61828.1|  hypothetical protein VITISV_027630                     238   3e-74   Vitis vinifera
gb|ABS29557.1|  chloroplast photosynthetic water oxidation comple...    234   1e-73   Morus nigra
ref|XP_009138459.1|  PREDICTED: oxygen-evolving enhancer protein ...    226   1e-69   
emb|CDX72613.1|  BnaC07g46350D                                          225   4e-69   
gb|AEH95324.1|  33 kDa manganese stabilizing chloroplast protein        219   5e-68   Allium cepa
emb|CDY42709.1|  BnaA03g53620D                                          219   8e-67   Brassica napus [oilseed rape]
gb|KJB43587.1|  hypothetical protein B456_007G208000                    216   3e-66   Gossypium raimondii
gb|AJG36442.1|  oxygen-evolving enhancer protein 1                      216   2e-65   Pinus sylvestris [Scotch pine]
gb|ABK23365.1|  unknown                                                 209   1e-62   Picea sitchensis
gb|ACN40581.1|  unknown                                                 209   1e-62   Picea sitchensis
gb|ABR17376.1|  unknown                                                 208   1e-62   Picea sitchensis
gb|ABK24541.1|  unknown                                                 208   2e-62   Picea sitchensis
gb|KDO79410.1|  hypothetical protein CISIN_1g019870mg                   194   7e-58   Citrus sinensis [apfelsine]
gb|KCW55052.1|  hypothetical protein EUGRSUZ_I01025                     192   2e-57   Eucalyptus grandis [rose gum]
gb|AIS72812.1|  oxygen evolving activity                                186   2e-56   Rhizophora apiculata
ref|XP_007155995.1|  hypothetical protein PHAVU_003G249800g             188   1e-55   Phaseolus vulgaris [French bean]
gb|ACE98011.1|  putative protein                                        185   2e-55   Populus tremula [European aspen]
prf||2002393A  oxygen-evolving complex protein 1                        181   4e-53
ref|XP_001756893.1|  predicted protein                                  176   5e-50   
prf||1204192A  photosystem II protein 33kD                              170   1e-48
ref|XP_004243178.1|  PREDICTED: oxygen-evolving enhancer protein ...    157   1e-44   Solanum lycopersicum
ref|XP_001763258.1|  predicted protein                                  159   2e-43   
ref|XP_001781590.1|  predicted protein                                  157   4e-43   
ref|WP_039310940.1|  Photosystem II manganese-stabilizing polypep...    154   8e-43   
gb|ABV57472.1|  chloroplast PsbO                                        151   2e-42   Phyllostachys edulis [kikko-chiku]
ref|XP_010531775.1|  PREDICTED: oxygen-evolving enhancer protein ...    150   2e-41   Tarenaya hassleriana [spider flower]
dbj|BAF94220.1|  33kDa oxygen evolving protein of photosystem II        145   1e-38   Closterium peracerosum-strigosum-littorale complex
ref|XP_002992987.1|  hypothetical protein SELMODRAFT_187141             145   2e-38   Selaginella moellendorffii
dbj|BAF94218.1|  33kDa oxygen evolving protein of photosystem II        145   4e-38   Chara braunii
ref|XP_002991827.1|  hypothetical protein SELMODRAFT_272235             142   2e-37   
ref|NP_001140815.1|  hypothetical protein                               139   4e-37   
ref|XP_002994513.1|  hypothetical protein SELMODRAFT_138743             137   3e-36   
gb|ACT83791.1|  putative photosystem II oxygen evolving system 33...    132   3e-35   Lemna minor
ref|XP_001784751.1|  predicted protein                                  135   3e-35   
ref|XP_005644574.1|  33kDa oxygen evolving protein of photosystem II    117   5e-28   Coccomyxa subellipsoidea C-169
ref|XP_005843863.1|  hypothetical protein CHLNCDRAFT_32868              116   7e-28   Chlorella variabilis
gb|ADC54897.1|  oxygen-evolving enhancer protein                        114   2e-27   Cladophora coelothrix
ref|XP_010550781.1|  PREDICTED: oxygen-evolving enhancer protein ...    111   1e-26   Tarenaya hassleriana [spider flower]
emb|CEG01950.1|  Photosystem II PsbO, manganese-stabilising             114   1e-26   Ostreococcus tauri
ref|XP_003082811.1|  photosystem II oxygen-evolving complex prote...    110   2e-26   
ref|XP_001422458.1|  psbO, PSII-O, OEE1, photosystem II polypepti...    112   3e-26   Ostreococcus lucimarinus CCE9901
gb|ABA01139.1|  chloroplast oxygen-evolving enhancer protein 1          108   5e-25   Chlamydomonas incerta
gb|AFK37254.1|  unknown                                                 103   5e-25   Medicago truncatula
gb|ACU65446.1|  putative oxygen-evolving enhancer                       103   6e-25   Tragopogon dubius [yellow salsify]
sp|P12853.1|PSBO_CHLRE  RecName: Full=Oxygen-evolving enhancer pr...    108   8e-25   Chlamydomonas reinhardtii
ref|XP_001694699.1|  oxygen-evolving enhancer protein 1 of photos...    108   8e-25   Chlamydomonas reinhardtii
dbj|BAF94214.1|  33kDa oxygen evolving protein of photosystem II        108   9e-25   Oedogonium obesum
dbj|BAF94213.1|  33kDa oxygen evolving protein of photosystem II        107   2e-24   Hafniomonas montana
dbj|BAF94215.1|  33kDa oxygen evolving protein of photosystem II        107   2e-24   Pyramimonas parkeae
ref|XP_003063851.1|  photosystem II manganese-stabilizing polypep...    107   3e-24   Micromonas pusilla CCMP1545
gb|ACU65447.1|  putative oxygen-evolving enhancer                       101   4e-24   Tragopogon pratensis [Jack-go-to-bed-at-noon]
ref|XP_011400268.1|  Oxygen-evolving enhancer protein 1, chloropl...    104   2e-23   Auxenochlorella protothecoides
gb|ADC54902.1|  oxygen-evolving enhancer protein                      98.6    2e-22   Klebsormidium flaccidum
gb|KIY97139.1|  Oxygen-evolving enhancer protein 1                      101   3e-22   Monoraphidium neglectum
gb|KIY92168.1|  Oxygen-evolving enhancer protein 1,chloroplastic      98.6    3e-22   Monoraphidium neglectum
ref|XP_002954867.1|  subunit of oxygen evolving complex of photos...    100   4e-22   Volvox carteri f. nagariensis
sp|Q9SBN6.1|PSBO_VOLCA  RecName: Full=Oxygen-evolving enhancer pr...    100   4e-22   Volvox carteri
dbj|BAF94217.1|  33kDa oxygen evolving protein of photosystem II      99.8    7e-22   Nephroselmis olivacea
gb|ADC54900.1|  oxygen-evolving enhancer protein                      97.4    8e-22   Entransia fimbriata
ref|XP_007513615.1|  predicted protein                                  100   1e-21   Bathycoccus prasinos
ref|XP_002505809.1|  photosystem II manganese-stabilizing polypep...  99.4    2e-21   Micromonas commoda
emb|CCC15104.1|  33kDa oxygen evolving protein of photosystem II      98.2    6e-21   Lepidodinium chlorophorum
gb|ABR26062.1|  oxygen-evolving enhancer protein 1                    96.3    7e-21   Oryza sativa Indica Group [Indian rice]
gb|AFK26084.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  96.3    1e-20   Euglena stellata
gb|AGI15739.1|  collinsiaXIII-like protein                            94.7    1e-20   Collinsia rattanii
gb|AFK26083.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  96.3    1e-20   Euglena pseudostellata
dbj|BAF94212.1|  33kDa oxygen evolving protein of photosystem II      97.1    1e-20   Chlorarachnion reptans
dbj|BAF94216.1|  33kDa oxygen evolving protein of photosystem II      96.7    1e-20   Tetraselmis cordiformis
gb|ADC54906.1|  oxygen-evolving enhancer protein                      93.6    2e-20   Phyllodictyon orientale
gb|AFK26079.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  95.1    2e-20   Cryptoglena skujai
gb|AFK26085.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  95.1    3e-20   Monomorphina pyrum
dbj|BAF94219.1|  33kDa oxygen evolving protein of photosystem II      95.5    3e-20   Bryopsis plumosa
gb|ADC54893.1|  oxygen-evolving enhancer protein                      92.4    5e-20   Boodlea composita
gb|AGI15740.1|  collinsiaXIII-like protein                            92.8    5e-20   Collinsia rattanii
gb|AGI15756.1|  collinsiaXIII-like protein                            92.8    5e-20   Collinsia linearis
gb|AGI15761.1|  collinsiaXIII-like protein                            92.8    5e-20   Collinsia linearis
gb|AGI15742.1|  collinsiaXIII-like protein                            92.8    6e-20   Collinsia rattanii
gb|ADC54913.1|  oxygen-evolving enhancer protein                      91.7    1e-19   Valonia utricularis
gb|ADC54905.1|  oxygen-evolving enhancer protein                      91.7    1e-19   Ostreococcus tauri
gb|ACF24544.1|  photosystem II oxygen evolving enhancer protein 1     94.4    1e-19   Gymnochlora stellata
gb|AFB34200.1|  hypothetical protein CL304Contig1_01                  89.4    2e-19   Abies alba [abete-blanco]
dbj|BAA03529.2|  oxygen-evolving enhancer protein 1 precursor         93.6    3e-19   Euglena gracilis
gb|AFK26080.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  92.0    4e-19   Discoplastis spathirhyncha
sp|P46483.2|PSBO_EUGGR  RecName: Full=Oxygen-evolving enhancer pr...  92.8    4e-19   Euglena gracilis
emb|CCI69514.1|  oxygen-evolving enhancer protein                     90.1    6e-19   Scotinosphaera sp. CAUP H5307
gb|AEW08532.1|  hypothetical protein CL304Contig1_01                  87.8    6e-19   Pinus radiata
gb|ADC54908.1|  oxygen-evolving enhancer protein                      89.4    7e-19   Siphonocladus tropicus
gb|AFK26081.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  90.9    1e-18   Euglena archaeoplastidiata
gb|AAP79149.1|  photosystem II protein PsbO                           91.3    1e-18   Bigelowiella natans
gb|ADC54894.1|  oxygen-evolving enhancer protein                      88.6    1e-18   Bornetella sphaerica
gb|ADE06500.1|  oxygen-evolving enhancer                              86.3    2e-18   Tragopogon porrifolius [oyster plant]
emb|CAH04962.1|  oxygen-evolving enhancer protein 1                   90.5    2e-18   Cyanophora paradoxa
emb|CCI69513.1|  oxygen-evolving enhancer protein                     87.4    4e-18   Chlorochytrium lemnae
gb|ADC54901.1|  oxygen-evolving enhancer protein                      85.5    2e-17   Ignatius tetrasporus
gb|ADC54904.1|  oxygen-evolving enhancer protein                      85.1    3e-17   Nephroselmis olivacea
gb|AFK26082.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  86.7    3e-17   Euglena granulata
ref|XP_005652213.1|  33kDa oxygen evolving protein of photosystem II  86.3    6e-17   Coccomyxa subellipsoidea C-169
gb|ADC54898.1|  oxygen-evolving enhancer protein                      84.0    9e-17   Codium sp. HEC 15711
gb|ADC54912.1|  oxygen-evolving enhancer protein                      83.6    1e-16   Ulva intestinalis
dbj|BAF94211.1|  33kDa oxygen evolving protein of photosystem II      85.5    2e-16   Eutreptiella gymnastica
gb|ADC54890.1|  oxygen-evolving enhancer protein                      82.4    2e-16   Acetabularia acetabulum
gb|ADC54891.1|  oxygen-evolving enhancer protein                      79.3    3e-15   Ulvella repens
gb|ADC54903.1|  oxygen-evolving enhancer protein                      79.0    5e-15   Mesostigma viride
gb|AGI15762.1|  collinsiaXIII-like protein                            78.6    7e-15   Collinsia linearis
gb|ADC54899.1|  oxygen-evolving enhancer protein                      77.8    1e-14   Derbesia sp. 2773-1
gb|ADC54895.1|  oxygen-evolving enhancer protein                      77.4    2e-14   Bryopsis sp. EE4
gb|ADC54907.1|  oxygen-evolving enhancer protein                      75.1    9e-14   Tetradesmus obliquus
ref|XP_005847917.1|  hypothetical protein CHLNCDRAFT_22722            74.3    7e-13   Chlorella variabilis
gb|ADC54896.1|  oxygen-evolving enhancer protein                      72.4    1e-12   Parachlorella kessleri
dbj|BAJ61711.1|  oxygen-evolving enhancer protein                     74.3    1e-12   Pyrenomonas helgolandii
ref|XP_005761454.1|  oxygen-evolving enhancer protein 1 of photos...  73.6    2e-12   Emiliania huxleyi CCMP1516
gb|ABD51936.1|  chloroplast photosystem II 33 kDa oxygen evolving...  72.8    3e-12   Guillardia theta
dbj|BAJ61709.1|  oxygen-evolving enhancer protein                     73.2    4e-12   Chroomonas caudata
ref|XP_005824851.1|  hypothetical protein GUITHDRAFT_97111            72.8    5e-12   Guillardia theta CCMP2712
dbj|BAJ61702.1|  oxygen-evolving enhancer protein                     72.8    5e-12   Vaucheria frigida
ref|XP_002894679.1|  predicted protein                                68.9    6e-12   
dbj|BAJ61701.1|  oxygen-evolving enhancer protein                     72.0    7e-12   Botrydium granulatum
dbj|BAJ61705.1|  oxygen-evolving enhancer protein                     71.6    8e-12   Porphyridium purpureum
gb|ABF59672.1|  photosystem II extrinsic protein O                    71.6    1e-11   Vaucheria litorea
emb|CAH25340.1|  oxygen-evolving enhancer                             70.9    1e-11   Guillardia theta
ref|WP_027404713.1|  Photosystem II manganese-stabilizing polypep...  69.7    3e-11   Aphanizomenon flos-aquae
ref|WP_039205072.1|  Photosystem II manganese-stabilizing polypep...  69.7    3e-11   Nostocales
gb|ADC54892.1|  oxygen-evolving enhancer protein                      67.8    4e-11   Blastophysa rhizopus
ref|WP_017322486.1|  Photosystem II manganese-stabilizing polypep...  68.9    5e-11   cyanobacterium PCC 7702
sp|P83504.1|PSBO_BRACM  RecName: Full=Oxygen-evolving enhancer pr...  64.7    6e-11   Brassica rapa
gb|ADJ93800.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  67.4    8e-11   Euglena gracilis
gb|EWM24380.1|  oxygen-evolving enhancer protein                      68.2    8e-11   Nannochloropsis gaditana
gb|ADC54909.1|  oxygen-evolving enhancer protein                      66.6    9e-11   Tetraselmis striata
gb|ADC54911.1|  oxygen-evolving enhancer protein                      66.6    1e-10   Ulva sp. EE2
gb|ACN35184.1|  unknown                                               66.6    2e-10   Zea mays [maize]
ref|WP_015125988.1|  Manganese-stabilising protein / photosystem ...  67.4    2e-10   Synechococcus sp. PCC 6312
ref|XP_005853586.1|  photosystem II oxygen-evolving enhancer prot...  67.8    2e-10   Nannochloropsis gaditana CCMP526
gb|KIE10612.1|  Photosystem II manganese-stabilizing polypeptide      67.4    2e-10   Tolypothrix bouteillei VB521301
dbj|BAJ61707.1|  oxygen-evolving enhancer protein                     68.2    2e-10   Neorhodella cyanea
gb|AAW33888.1|  plastid oxygen-evolving enhancer 1 precursor          67.8    2e-10   Pyropia yezoensis
ref|XP_005713751.1|  Plastid oxygen-evolving enhancer 1               66.6    3e-10   Chondrus crispus [carageen]
gb|EWM24379.1|  oxygen-evolving enhancer protein                      67.8    3e-10   
ref|WP_012625990.1|  photosystem II manganese-stabilizing protein...  66.6    4e-10   
ref|WP_016872421.1|  Photosystem II manganese-stabilizing polypep...  66.6    4e-10   
ref|WP_017745622.1|  Photosystem II manganese-stabilizing polypep...  66.2    5e-10   
ref|WP_015081475.1|  photosystem II manganese-stabilizing protein...  66.2    5e-10   
ref|WP_016860504.1|  Photosystem II manganese-stabilizing polypep...  65.9    8e-10   
dbj|BAJ61710.1|  oxygen-evolving enhancer protein                     66.2    1e-09   
ref|XP_005706438.1|  photosystem II PsbO protein                      66.2    1e-09   
ref|WP_028090302.1|  Photosystem II manganese-stabilizing polypep...  65.5    1e-09   
ref|WP_036530244.1|  Photosystem II manganese-stabilizing polypep...  65.1    1e-09   
ref|WP_016865127.1|  Photosystem II manganese-stabilizing polypep...  64.7    2e-09   
ref|WP_015115272.1|  photosystem II manganese-stabilizing protein...  64.7    2e-09   
ref|WP_009456798.1|  MULTISPECIES: photosystem II manganese-stabi...  64.7    2e-09   
ref|WP_017310215.1|  Photosystem II manganese-stabilizing polypep...  64.7    2e-09   
ref|WP_026721744.1|  Photosystem II manganese-stabilizing polypep...  64.3    3e-09   
gb|KEI69285.1|  PsbO                                                  64.3    3e-09   
ref|WP_026787255.1|  MULTISPECIES: Photosystem II manganese-stabi...  64.3    3e-09   
ref|WP_042156912.1|  Photosystem II manganese-stabilizing polypep...  64.3    3e-09   
gb|ABO47876.1|  plastid oxygen-evolving enhancer 1-2 precursor        64.3    3e-09   
ref|WP_028082855.1|  Photosystem II manganese-stabilizing polypep...  64.3    3e-09   
ref|WP_009631953.1|  Manganese-stabilising protein / photosystem ...  64.3    3e-09   
ref|WP_015204171.1|  photosystem II manganese-stabilizing protein...  63.9    3e-09   
ref|WP_039715746.1|  Photosystem II manganese-stabilizing polypep...  63.9    4e-09   
ref|WP_015153476.1|  photosystem II manganese-stabilizing protein...  63.9    4e-09   
ref|XP_005536430.1|  manganese-stabilzing protein precursor           64.3    4e-09   
ref|WP_016949009.1|  Photosystem II manganese-stabilizing polypep...  63.5    5e-09   
dbj|BAF94210.1|  33kDa oxygen evolving protein of photosystem II      63.9    5e-09   
dbj|BAJ61706.1|  oxygen-evolving enhancer protein                     63.9    5e-09   
ref|WP_026733494.1|  Photosystem II manganese-stabilizing polypep...  63.2    6e-09   
ref|WP_016922728.1|  hypothetical protein                             63.2    7e-09   
ref|WP_015167227.1|  Manganese-stabilising protein / photosystem ...  63.2    7e-09   
ref|WP_017656098.1|  Photosystem II manganese-stabilizing polypep...  62.8    9e-09   
ref|WP_017720228.1|  Photosystem II manganese-stabilizing polypep...  62.8    1e-08   
ref|WP_019500685.1|  hypothetical protein                             62.8    1e-08   
gb|AAM77466.1|  oxygen evolving enhancer 1 precursor                  62.8    1e-08   
gb|AGL79736.1|  chloroplast oxygen-evolving enhancer                  63.2    1e-08   
gb|AGL79735.1|  chloroplast oxygen-evolving enhancer                  63.2    1e-08   
gb|AAW33887.1|  plastid oxygen-evolving enhancer 1-2 precursor        63.2    1e-08   
gb|ADC54910.1|  oxygen-evolving enhancer protein                      60.5    1e-08   
dbj|BAG85210.1|  extrinsic protein in photosystem II                  62.8    1e-08   
dbj|BAJ61704.1|  oxygen-evolving enhancer protein                     62.8    1e-08   
gb|AAN11311.1|  oxygen-evolving enhancer 1                            62.4    2e-08   
ref|WP_009768009.1|  Manganese-stabilising protein / photosystem ...  61.6    2e-08   
gb|AAO43192.1|  oxygen-evolving enhancer protein 1 precursor          62.0    2e-08   
ref|XP_002180309.1|  oxygen-evolving enhancer protein 1 precursor     62.0    2e-08   
ref|WP_017286598.1|  hypothetical protein                             61.6    3e-08   
ref|WP_015127963.1|  photosystem II manganese-stabilizing protein...  61.6    3e-08   
ref|WP_012411115.1|  photosystem II manganese-stabilizing protein...  61.6    3e-08   
ref|WP_009342897.1|  Photosystem II manganese-stabilizing protein...  61.6    3e-08   
ref|WP_015212390.1|  photosystem II manganese-stabilizing protein...  61.2    3e-08   
gb|AAM77465.1|  oxygen evolving enhancer 1 precursor                  61.6    3e-08   
ref|WP_035997199.1|  Photosystem II manganese-stabilizing polypep...  61.2    3e-08   
pdb|2AXT|O  Chain O, Crystal Structure Of Photosystem Ii From The...  60.8    4e-08   
pdb|1S5L|O  Chain O, Architecture Of The Photosynthetic Oxygen Ev...  60.8    4e-08   
sp|D0VWR2.2|PSBO_THEVL  RecName: Full=Photosystem II manganese-st...  60.8    4e-08   
ref|WP_011056297.1|  photosystem II manganese-stabilizing polypep...  60.8    4e-08   
ref|WP_013191007.1|  photosystem II manganese-stabilizing protein...  60.8    4e-08   
ref|WP_015187373.1|  photosystem II manganese-stabilizing protein...  60.8    4e-08   
ref|XP_009033884.1|  hypothetical protein AURANDRAFT_69678            61.2    5e-08   
ref|WP_017314485.1|  Photosystem II manganese-stabilizing polypep...  60.8    5e-08   
ref|WP_015209602.1|  Manganese-stabilising protein / photosystem ...  60.8    5e-08   
ref|WP_011318645.1|  photosystem II manganese-stabilizing protein...  60.5    6e-08   
ref|WP_024125094.1|  photosystem II manganese-stabilizing protein...  60.5    6e-08   
gb|ACF28695.1|  oxygen evolving complex protein variant               58.5    6e-08   
emb|CBN78902.1|  manganese stabilising protein                        60.8    7e-08   
gb|ACF28689.1|  oxygen evolving complex protein variant               58.5    7e-08   
emb|CAA33560.1|  manganese-stabilzing protein (MSP) precursor         60.5    7e-08   
ref|WP_010478151.1|  photosystem II manganese-stabilizing protein     60.1    8e-08   
ref|WP_010997995.1|  manganese-stabilzing protein                     60.1    8e-08   
ref|WP_012161181.1|  photosystem II manganese-stabilizing protein...  60.1    8e-08   
ref|WP_015139796.1|  Manganese-stabilising protein / photosystem ...  60.1    9e-08   
dbj|BAJ61708.1|  oxygen-evolving enhancer protein                     58.5    9e-08   
gb|ACF28693.1|  oxygen evolving complex protein variant               58.2    1e-07   
gb|ACF28701.1|  oxygen evolving complex protein variant               57.8    1e-07   
gb|ACF28690.1|  oxygen evolving complex protein variant               57.8    1e-07   
pdb|3A0B|O  Chain O, Crystal Structure Of Br-Substituted Photosys...  59.3    1e-07   
pdb|4PBU|O  Chain O, Serial Time-resolved Crystallography Of Phot...  59.3    1e-07   
ref|WP_010311944.1|  photosystem II manganese-stabilizing protein     58.9    2e-07   
ref|WP_015196540.1|  photosystem II manganese-stabilizing protein...  58.9    2e-07   
ref|WP_015117115.1|  Manganese-stabilising protein / photosystem ...  58.5    3e-07   
ref|WP_041036292.1|  Photosystem II manganese-stabilizing polypep...  58.5    4e-07   
ref|WP_007354116.1|  MULTISPECIES: photosystem II manganese-stabi...  58.5    4e-07   
gb|ACF28700.1|  oxygen evolving complex protein variant               57.4    4e-07   
gb|KIJ84318.1|  Photosystem II manganese-stabilizing polypeptide      58.2    4e-07   
ref|WP_006042289.1|  photosystem II manganese-stabilizing polypep...  58.2    4e-07   
ref|WP_006278712.1|  Photosystem II manganese-stabilizing protein...  58.2    5e-07   
ref|WP_006630984.1|  photosystem II manganese-stabilizing protein...  57.8    5e-07   
ref|WP_039748810.1|  Photosystem II manganese-stabilizing polypep...  57.8    6e-07   
ref|WP_022609298.1|  manganese-stabilising protein / photosystem ...  57.8    6e-07   
dbj|BAJ61703.1|  oxygen-evolving enhancer protein                     57.8    7e-07   
ref|WP_006518063.1|  Manganese-stabilising protein / photosystem ...  57.4    8e-07   
ref|WP_006197397.1|  Photosystem II manganese-stabilizing protein...  57.4    9e-07   
ref|WP_019494816.1|  Photosystem II manganese-stabilizing polypep...  57.4    9e-07   
emb|CCQ62588.1|  Photosystem II manganese-stabilizing protein (PsbO)  57.0    1e-06   
ref|WP_007304841.1|  Manganese-stabilizing protein/photosystem II...  56.6    1e-06   
ref|WP_015180190.1|  Manganese-stabilising protein / photosystem ...  56.6    1e-06   
ref|WP_017662186.1|  hypothetical protein                             56.6    2e-06   
ref|WP_029636438.1|  Photosystem II manganese-stabilizing polypep...  56.6    2e-06   
ref|WP_036486652.1|  Photosystem II manganese-stabilizing polypep...  56.6    2e-06   
gb|ABF73017.1|  oxygen-enhancer 1 protein precursor                   56.6    2e-06   
ref|WP_031292620.1|  Photosystem II manganese-stabilizing polypep...  56.2    2e-06   
ref|WP_015165708.1|  photosystem II manganese-stabilizing protein...  56.2    2e-06   
gb|AAM77464.1|  oxygen evolving enhancer 1 precursor                  56.2    2e-06   
gb|ESA36696.1|  photosystem ii manganese-stabilizing protein          55.8    2e-06   
ref|WP_015175499.1|  photosystem II manganese-stabilizing protein...  56.2    2e-06   
gb|ACF28688.1|  oxygen evolving complex protein variant               53.5    4e-06   
ref|WP_015161225.1|  Manganese-stabilising protein / photosystem ...  55.1    5e-06   
gb|AAF13997.1|  photosystem II manganese stabilizing protein          55.1    6e-06   
ref|WP_009544738.1|  MULTISPECIES: photosystem II manganese-stabi...  55.1    6e-06   
ref|WP_009628648.1|  photosystem II manganese-stabilizing protein...  55.1    6e-06   
gb|EAZ89921.1|  photosystem II manganese-stabilizing polypeptide      55.1    6e-06   
ref|WP_035799930.1|  Photosystem II manganese-stabilizing polypep...  54.7    6e-06   
ref|WP_035156929.1|  Photosystem II manganese-stabilizing polypep...  54.7    7e-06   
gb|ABR26133.1|  oxygen-evolving enhancer protein 1                    53.1    8e-06   
gb|ACF28697.1|  oxygen evolving complex protein variant               52.4    1e-05   
gb|ACF28692.1|  oxygen evolving complex protein variant               52.4    1e-05   
ref|WP_015142403.1|  Manganese-stabilising protein / photosystem ...  53.9    1e-05   
gb|ACF28698.1|  oxygen evolving complex protein variant               52.0    1e-05   
ref|WP_037222014.1|  Photosystem II manganese-stabilizing protein...  53.9    1e-05   
ref|WP_019506429.1|  hypothetical protein                             53.9    1e-05   
ref|WP_028946996.1|  Photosystem II manganese-stabilizing polypep...  53.5    2e-05   
gb|AIE75688.1|  Photosystem II manganese-stabilizing protein (PsbO)   53.5    2e-05   
ref|WP_040939353.1|  Photosystem II manganese-stabilizing polypep...  53.5    2e-05   
ref|WP_040929652.1|  Photosystem II manganese-stabilizing polypep...  53.5    2e-05   
ref|WP_007099801.1|  photosystem II manganese-stabilizing polypep...  53.5    2e-05   
gb|EJK75097.1|  hypothetical protein THAOC_03193                      53.1    2e-05   
gb|ACF28691.1|  oxygen evolving complex protein variant               51.2    2e-05   
ref|WP_044204234.1|  Photosystem II manganese-stabilizing polypep...  53.1    3e-05   
gb|EDX78335.1|  Manganese-stabilizing protein / photosystem II po...  53.1    3e-05   
ref|XP_002291225.1|  oxygen-evolving enhancer protein 1 precursor     53.1    3e-05   
gb|ACF28699.1|  oxygen evolving complex protein variant               51.2    3e-05   
gb|AFZ44849.1|  photosystem II manganese-stabilizing protein PsbO     53.1    3e-05   
ref|WP_041596665.1|  Photosystem II manganese-stabilizing polypep...  52.8    3e-05   
ref|WP_006909436.1|  photosystem II manganese-stabilizing protein     52.8    3e-05   
ref|WP_027841041.1|  Photosystem II manganese-stabilizing polypep...  52.8    4e-05   
ref|WP_009783095.1|  Photosystem II manganese-stabilizing protein...  52.4    4e-05   
ref|WP_018399127.1|  hypothetical protein                             52.4    5e-05   
ref|WP_006616815.1|  MULTISPECIES: photosystem II manganese-stabi...  52.0    6e-05   
gb|EKD06931.1|  photosystem II manganese-stabilizing protein PsbO     52.0    6e-05   
ref|WP_015956866.1|  photosystem II manganese-stabilizing protein...  52.0    7e-05   
ref|WP_015230300.1|  Manganese-stabilising protein / photosystem ...  52.0    7e-05   
ref|WP_007100705.1|  photosystem II manganese-stabilizing polypep...  51.6    8e-05   
ref|WP_008233010.1|  Photosystem II manganese-stabilizing protein...  51.2    1e-04   
ref|WP_023065168.1|  photosystem II manganese-stabilizing polypep...  51.2    1e-04   
ref|WP_006172331.1|  photosystem II manganese-stabilizing polypep...  51.2    1e-04   
ref|WP_011613279.1|  photosystem II manganese-stabilizing protein...  50.8    2e-04   
ref|WP_015170887.1|  photosystem II manganese-stabilizing protein...  50.8    2e-04   
ref|WP_011932278.1|  photosystem II manganese-stabilizing protein...  50.8    2e-04   
ref|WP_039726071.1|  MULTISPECIES: Photosystem II manganese-stabi...  50.8    2e-04   
ref|WP_038542990.1|  Photosystem II manganese-stabilizing polypep...  50.4    2e-04   
ref|WP_011243530.1|  MULTISPECIES: photosystem II PsbO protein        50.4    2e-04   
ref|WP_008313000.1|  Manganese-stabilising protein / photosystem ...  50.4    2e-04   
ref|WP_010873097.1|  photosystem II manganese-stabilizing polypep...  50.4    2e-04   
ref|WP_010314562.1|  photosystem II manganese-stabilizing protein     50.4    2e-04   
ref|WP_035832498.1|  Photosystem II manganese-stabilizing polypep...  50.1    3e-04   
ref|WP_006456861.1|  Manganese-stabilizing protein / photosystem ...  50.1    3e-04   
ref|WP_013323533.1|  photosystem II manganese-stabilizing protein...  50.1    3e-04   
ref|WP_015785306.1|  MULTISPECIES: photosystem II manganese-stabi...  50.1    3e-04   
ref|WP_015109468.1|  Manganese-stabilising protein / photosystem ...  50.1    3e-04   
ref|WP_011618325.1|  photosystem II manganese-stabilizing protein     49.7    3e-04   
ref|WP_025782239.1|  Photosystem II manganese-stabilizing polypep...  49.7    4e-04   
ref|WP_015192867.1|  photosystem II manganese-stabilizing protein...  49.3    5e-04   
ref|WP_024544659.1|  Photosystem II manganese-stabilizing polypep...  49.3    5e-04   
ref|WP_043737375.1|  Photosystem II manganese-stabilizing polypep...  49.3    6e-04   
emb|CAK29098.1|  Photosystem II manganese-stabilizing protein PsbO    49.3    6e-04   
ref|WP_015133089.1|  photosystem II manganese-stabilizing protein...  49.3    6e-04   
gb|EDX87597.1|  Manganese-stabilizing protein / photosystem II po...  48.9    7e-04   
ref|WP_038016162.1|  Photosystem II manganese-stabilizing polypep...  48.9    8e-04   
ref|WP_026072511.1|  Photosystem II manganese-stabilizing protein...  48.9    8e-04   
ref|WP_015219672.1|  photosystem II manganese-stabilizing protein...  48.9    8e-04   
ref|WP_006853634.1|  photosystem II manganese-stabilizing protein...  48.9    9e-04   
ref|WP_006510630.1|  Manganese-stabilising protein / photosystem ...  48.5    9e-04   
gb|AHJ27766.1|  Photosystem II manganese-stabilizing protein (PsbO)   48.5    9e-04   



>ref|XP_009612279.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana tomentosiformis]
 sp|Q40459.1|PSBO_TOBAC RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA45701.1| 33 kDa polypeptide of water-oxidizing complex of photosystem 
II [Nicotiana tabacum]
Length=332

 Score =   297 bits (760),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 162/179 (91%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ AATLMQPTKVGV P       RS Q+V KA GV+P+ AR+TCSLQ+++K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVAPARNNLQLRSAQSVSKAFGVEPAAARLTCSLQTELKDLAQ  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
             F+DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KFTDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            V +FAFKPGKY+AKKFCLEPTSFTVKAESV+KNAPP+FQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  VASFAFKPGKYNAKKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFE  179



>ref|XP_009768511.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana sylvestris]
 gb|AAP03871.1| oxygen evolving complex 33 kDa photosystem II protein [Nicotiana 
tabacum]
Length=332

 Score =   294 bits (752),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 161/179 (90%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ AATLMQPTKVGV P       RS Q+V KA GV+P+ AR+TCSLQ+++K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVAPARNNLQLRSAQSVSKAFGVEPAAARLTCSLQTELKDLAQ  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCTDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            V +FAFKPGKY+AKKFCLEPTSFTVKAESV+KNAPP+FQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  VASFAFKPGKYNAKKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFE  179



>gb|KDP31833.1| hypothetical protein JCGZ_12294 [Jatropha curcas]
Length=332

 Score =   293 bits (751),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 157/178 (88%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MAASLQ AATLMQPTKVGV  RI    RS Q V KA G++PS ARI+CSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRISLQLRSSQNVSKAFGLEPSTARISCSLQSDLKDLAQK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
              DA K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGGV
Sbjct  61   CVDATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGV  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            + FA KPGKY+AKKFCLEPTSFTVKAE VSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  DKFAIKPGKYNAKKFCLEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  178



>ref|XP_009604683.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=332

 Score =   293 bits (750),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 160/179 (89%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ AATLMQPTKVGV         RS Q+V KA GV+P+ A++TCSLQS +K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVVSARNNLQLRSSQSVSKAFGVEPAAAKLTCSLQSDLKDLAQ  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              +DAAK+AGFALATSAL++SGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAAKIAGFALATSALVISGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            VE+FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  VESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFE  179



>ref|XP_011004600.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Populus euphratica]
Length=331

 Score =   293 bits (749),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 160/178 (90%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MAASLQ AATLMQPTKVGV  R     RS Q+V KA G++P+ ARI+CSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGLEPASARISCSLQSDLKDLAQK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
              DA+K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKGSGTANQCPT++GG 
Sbjct  61   CVDASKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGSGTANQCPTLDGGA  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            E+FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  ESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  178



>gb|AAX53163.1| chloroplast photosynthetic oxygen-evolving protein 33 kDa subunit 
[Nicotiana benthamiana]
Length=332

 Score =   292 bits (748),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 160/179 (89%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ AATLMQPTKVGV P       RS Q+V KA GV+P+ AR+TCSLQ+++K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVAPARNNLQLRSAQSVSKAFGVEPAAARLTCSLQTELKDLAQ  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCTDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            V +FAFKPGKY+A KFCLEPTSFTVKAESV+KNAPP+FQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  VASFAFKPGKYNANKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFE  179



>ref|XP_009759927.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=333

 Score =   292 bits (748),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 160/179 (89%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ AATLMQPTKVGV         RS Q++ KA GV+P+ AR+TCSLQS +K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVVSARNNLQLRSSQSLSKAFGVEPAAARLTCSLQSDLKDLAQ  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              +DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            V++FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  VDSFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFE  179



>gb|AFH58000.1| chloroplast PsbO4 precursor [Nicotiana benthamiana]
Length=333

 Score =   292 bits (747),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 159/179 (89%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ AATLMQPTKVGV         R  Q+V KA GV+P+ AR+TCSLQS +K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVVSARNNLQLRLSQSVSKAFGVEPAAARLTCSLQSDLKDLAQ  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              +DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            VE+FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  VESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFE  179



>ref|XP_002307234.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
 gb|ABK95762.1| unknown [Populus trichocarpa]
 gb|ABK96188.1| unknown [Populus trichocarpa]
 gb|EEE94230.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
Length=331

 Score =   291 bits (746),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 159/178 (89%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MAASLQ AATLMQPTKVGV  R     RS Q+V KA G +P+ ARI+CSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGFEPASARISCSLQSDLKDLARK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
              DA+K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKGSGTANQCPT++GG 
Sbjct  61   CVDASKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGSGTANQCPTLDGGA  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            E+FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  ESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  178



>ref|XP_011099252.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Sesamum indicum]
Length=331

 Score =   291 bits (746),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 161/178 (90%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MA SLQ AATLMQPTKVGV+ R     RS Q+VGK+ GV+P+ AR++CSLQ+ +K+LA  
Sbjct  1    MATSLQAAATLMQPTKVGVSARSSLQLRSVQSVGKSFGVEPASARLSCSLQADLKDLAQK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
             +DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTIEGGV
Sbjct  61   CTDAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIEGGV  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            ++FAFKPGKY+AKKFCLEPTSFTVKAE V+KNAPPEFQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  DSFAFKPGKYNAKKFCLEPTSFTVKAEGVNKNAPPEFQKTKLMTRLTYTLDEIEGPFE  178



>gb|AFH57998.1| chloroplast PsbO2 precursor [Nicotiana benthamiana]
Length=332

 Score =   291 bits (744),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 159/179 (89%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MA SLQ AATLMQPTKVGV P       RS Q+V KA GV+P+ AR+TCSLQ+++K+LA 
Sbjct  1    MATSLQAAATLMQPTKVGVAPARNNLQLRSAQSVSKAFGVEPAAARLTCSLQTELKDLAQ  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCTDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            V +FAFKPGKY+A KFCLEPTSFTVKAESV+KNAPP+FQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  VASFAFKPGKYNANKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFE  179



>gb|ABK96748.1| unknown [Populus trichocarpa x Populus deltoides]
Length=331

 Score =   290 bits (743),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 158/178 (89%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MAASLQ AATLMQPTKVGV  R     RS Q+V KA G +P+ ARI+CSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGFEPASARISCSLQSDLKDLAQK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
              DA+K+AGFALATSAL+ SGA+AEGVPKRLT+DEIQSKTYMEVKGSGTANQCPT++GG 
Sbjct  61   CVDASKIAGFALATSALIASGASAEGVPKRLTYDEIQSKTYMEVKGSGTANQCPTLDGGA  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            E+FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  ESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  178



>gb|ADZ75466.1| oxygen evolving enhancer protein 1 [Litchi chinensis]
Length=333

 Score =   290 bits (742),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 156/179 (87%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ AATLMQPTKVGV+P       RS Q+V KA GVD +  RITCSLQS  K++A 
Sbjct  1    MAASLQAAATLMQPTKVGVSPARSTVQLRSSQSVSKAFGVDSAGGRITCSLQSDFKDMAQ  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
               DA K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            V++FAFKPGKY AKK CLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  VDSFAFKPGKYQAKKLCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  179



>gb|AFH57997.1| chloroplast PsbO1 precursor [Nicotiana benthamiana]
Length=332

 Score =   290 bits (741),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 159/179 (89%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MA SLQ AATLMQPTKVGV P       RS Q+V KA GV+P+ AR+TCSLQ+++K+LA 
Sbjct  1    MAVSLQAAATLMQPTKVGVAPARNNLQLRSAQSVCKAFGVEPAAARLTCSLQTELKDLAQ  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              +DAAK+AGFALATSAL+VSGANAEG PKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCTDAAKVAGFALATSALVVSGANAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            V +FAFKPGKY+AKKFCLEPTSFTVKAESV+KNAPP+FQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  VASFAFKPGKYNAKKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFE  179



>ref|XP_009379152.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Pyrus x bretschneideri]
Length=332

 Score =   290 bits (741),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 159/179 (89%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  219
            MAASLQ AATLMQPTKVGV+ R     RS Q+V KA G++PS  AR+TCSLQS +K+LAH
Sbjct  1    MAASLQAAATLMQPTKVGVSARTSVQLRSSQSVSKAFGLEPSASARLTCSLQSDLKDLAH  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
               DA+K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61   KCLDASKIAGFALATSALVVSGAGAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             E FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SEAFAFKPGKYTAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  179



>ref|XP_008338186.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Malus domestica]
Length=332

 Score =   290 bits (741),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 159/179 (89%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  219
            MAASLQ AATLMQPTKVGV+ R     RS Q+V KA G++PS  AR+TCSLQS +K+LAH
Sbjct  1    MAASLQAAATLMQPTKVGVSARTSVQLRSSQSVSKAFGLEPSASARLTCSLQSDLKDLAH  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
               DA+K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61   KCLDASKIAGFALATSALVVSGAGAEGSPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             E FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  TEAFAFKPGKYTAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  179



>gb|AFH57999.1| chloroplast PsbO3 precursor [Nicotiana benthamiana]
Length=333

 Score =   289 bits (739),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 156/179 (87%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ AATLMQPTKVGV         RS Q V KA GV+P+ AR+ CS QS +K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVVSARNNLQLRSSQCVSKAFGVEPAAARLNCSFQSDLKDLAQ  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              +DA K+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAVKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            VE+FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  VESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFE  179



>ref|XP_011085527.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Sesamum indicum]
Length=330

 Score =   289 bits (739),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = +1

Query  58   ASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  237
            +SLQ AATLMQPTKVG T    RS QT+GKA GV+P+ AR+TCSLQ+ +K+LAH  +DAA
Sbjct  4    SSLQAAATLMQPTKVGRTSLQLRSVQTLGKAFGVEPAGARMTCSLQADLKDLAHKLTDAA  63

Query  238  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  417
            K+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTIEGGV++FAF
Sbjct  64   KIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIEGGVDSFAF  123

Query  418  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPF  573
            K GKY+AKKFCLEPTSFTVKAE V+KNAPPEFQ TKLMTRLTYTLDEIEGPF
Sbjct  124  KAGKYNAKKFCLEPTSFTVKAEGVNKNAPPEFQKTKLMTRLTYTLDEIEGPF  175



>ref|XP_007047093.1| Photosystem II subunit O-2 [Theobroma cacao]
 gb|EOX91250.1| Photosystem II subunit O-2 [Theobroma cacao]
Length=332

 Score =   288 bits (738),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 156/178 (88%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MAASLQ AATLMQPTKVGV  R     RS Q+V KA G++P  AR+TCSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRTSVQLRSSQSVSKAFGLEPVGARLTCSLQSDLKDLAQK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
              DA K+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CVDATKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            ++FAFKPGKY AKKFCLEPTSFTVKAE VSKNAPPEFQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  DSFAFKPGKYYAKKFCLEPTSFTVKAEGVSKNAPPEFQRTKLMTRLTYTLDEIEGPFE  178



>ref|XP_009376463.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Pyrus x bretschneideri]
Length=332

 Score =   288 bits (737),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 159/179 (89%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  219
            MAASLQ AATLMQPTKVGV+ R     RS Q+V KA G++PS  AR+TCSLQS +K+LAH
Sbjct  1    MAASLQAAATLMQPTKVGVSARTSVQLRSSQSVSKAFGLEPSASARLTCSLQSDLKDLAH  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
               DA+K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61   KCLDASKIAGFALATSALVVSGAGAEGSPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             E FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SEAFAFKPGKYTAKKFCLEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  179



>ref|XP_009341905.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009341920.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=332

 Score =   287 bits (734),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 159/179 (89%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  219
            MAASLQ AATLMQPTKVGV+ R     RS Q+V KA G++PS  AR+TCSLQS +K+LAH
Sbjct  1    MAASLQAAATLMQPTKVGVSARTSVQLRSSQSVSKAFGLEPSASARLTCSLQSDLKDLAH  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
               DA+K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61   KCLDASKIAGFALATSALVVSGAGAEGSPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             E FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLD+IEGPFE
Sbjct  121  SEAFAFKPGKYTAKKFCLEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDQIEGPFE  179



>ref|XP_008241598.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Prunus mume]
Length=332

 Score =   286 bits (731),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 157/179 (88%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  219
            MAASLQ AATLMQPTKVG   R     RS Q V KA G++PS  AR+TCSLQS +K+ AH
Sbjct  1    MAASLQAAATLMQPTKVGAPARTSLLLRSSQNVSKAFGLEPSASARLTCSLQSDLKDFAH  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
               DA+K+AGFALATSAL+VSGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61   KCVDASKIAGFALATSALVVSGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            +E FAFKPGKY+AKKFCLEPTSFTVKAESV+KNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  LEAFAFKPGKYTAKKFCLEPTSFTVKAESVNKNAPPEFQNTKLMTRLTYTLDEIEGPFE  179



>gb|AEO21912.1| chloroplast oxygen-evolving enhancer protein 1 [Dimocarpus longan]
Length=333

 Score =   285 bits (729),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 154/179 (86%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ AATLMQPTKVGV+P       RS+Q+V KA G D +  RITCSLQ   K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVSPARSTVQLRSFQSVSKAFGADSAGGRITCSLQPDFKDLAQ  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              +DA K+AGFALAT AL+VSGA AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCADATKIAGFALATPALVVSGAGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            V++FAFKPGKY AKKFCLEPTSFTVKAE V+KN+PPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  VDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNSPPEFQNTKLMTRLTYTLDEIEGPFE  179



>gb|AAS55410.1| photosystem II protein [Brassica rapa]
Length=233

 Score =   281 bits (720),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 157/192 (82%), Gaps = 4/192 (2%)
 Frame = +1

Query  13   REREELTLLSDPTMAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARI  180
            R++ EL+      MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+
Sbjct  3    RKKLELSERHSVAMAASLQSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARL  62

Query  181  TCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKG  360
            TCS QS IK+ A   SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG
Sbjct  63   TCSFQSDIKDFAGKCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKG  122

Query  361  SGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRL  540
            +GTANQCPTI+GG E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRL
Sbjct  123  TGTANQCPTIDGGSETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRL  182

Query  541  TYTLDEIEGPFE  576
            TYTLDEIEGPFE
Sbjct  183  TYTLDEIEGPFE  194



>ref|XP_006344816.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum tuberosum]
Length=329

 Score =   285 bits (728),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 156/176 (89%), Gaps = 1/176 (1%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  228
            MAASLQ AATLMQPTKVG    +  RS Q+V KA GV+   AR+TCSLQ++IKELA   +
Sbjct  1    MAASLQAAATLMQPTKVGARNNLQLRSVQSVSKAFGVEQGSARLTCSLQTEIKELAQKCT  60

Query  229  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  408
            DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV +
Sbjct  61   DAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGS  120

Query  409  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            FAFKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  FAFKPGKYTAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFE  176



>ref|XP_004233415.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum lycopersicum]
 sp|P23322.2|PSBO_SOLLC RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Solanum lycopersicum]
 emb|CAA78043.1| 33kDa precursor protein of oxygen-evolving complex [Solanum lycopersicum]
 prf||2001459A O2 evolving protein complex:SUBUNIT=33kD
Length=329

 Score =   284 bits (727),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 156/176 (89%), Gaps = 1/176 (1%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  228
            MAASLQ AATLMQPTKVGV   +  RS Q+V KA GV+    R+TCSLQ++IKELA   +
Sbjct  1    MAASLQAAATLMQPTKVGVRNNLQLRSAQSVSKAFGVEQGSGRLTCSLQTEIKELAQKCT  60

Query  229  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  408
            DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV +
Sbjct  61   DAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGS  120

Query  409  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            FAFKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  FAFKPGKYTAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFE  176



>ref|XP_002274796.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Vitis vinifera]
Length=332

 Score =   284 bits (727),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 155/178 (87%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MAASLQ AATLMQPTKVGV  R     RS Q+V KA G++P+ AR TCSLQ+ +K+LAH 
Sbjct  1    MAASLQAAATLMQPTKVGVPTRTSLQLRSSQSVCKAFGLEPAGARFTCSLQADLKDLAHK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
              DA K+AGFALATSALLVSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CVDATKIAGFALATSALLVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            ++FAFK GKY  KKFCLEPTSFTVKAE VSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  DSFAFKSGKYQLKKFCLEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  178



>ref|XP_002522386.1| Oxygen-evolving enhancer protein 1, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF40070.1| Oxygen-evolving enhancer protein 1, chloroplast precursor, putative 
[Ricinus communis]
Length=334

 Score =   284 bits (726),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 157/180 (87%), Gaps = 5/180 (3%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG-----RSYQTVGKALGVDPSPARITCSLQSQIKELA  216
            MAASLQ AATLMQPTKVG  P        RS Q+V KA G++P+ ARITCSLQS +K+LA
Sbjct  1    MAASLQAAATLMQPTKVGGVPSSRATLQLRSSQSVSKAFGLEPASARITCSLQSDLKDLA  60

Query  217  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  396
                DA K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   QKCVDATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  397  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            G++ F+FK GKY+AKKFCLEPTSFTVKAESV+KNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  GLDKFSFKAGKYNAKKFCLEPTSFTVKAESVNKNAPPEFQNTKLMTRLTYTLDEIEGPFE  180



>ref|XP_007202212.1| hypothetical protein PRUPE_ppa008420mg [Prunus persica]
 gb|EMJ03411.1| hypothetical protein PRUPE_ppa008420mg [Prunus persica]
Length=332

 Score =   283 bits (725),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 156/179 (87%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  219
            MAASLQ AATLMQPTKVG   R     R  Q V KA G++PS  AR+TCSLQS +K+ AH
Sbjct  1    MAASLQAAATLMQPTKVGAPARTSLQLRPSQNVSKAFGLEPSASARLTCSLQSDLKDFAH  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
               DA+K+AGFALATSAL+VSGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61   KCVDASKIAGFALATSALVVSGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            +E FAFKPGKY+AKKFCLEPTSFTVKAESV+KNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  LEAFAFKPGKYTAKKFCLEPTSFTVKAESVNKNAPPEFQNTKLMTRLTYTLDEIEGPFE  179



>ref|XP_009412420.1| PREDICTED: LOW QUALITY PROTEIN: oxygen-evolving enhancer protein 
1, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=340

 Score =   283 bits (725),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 159/180 (88%), Gaps = 5/180 (3%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPR-IG----RSYQTVGKALGVDPSPARITCSLQSQIKELA  216
            MAASLQ AATLMQP+KVGV  R IG    RS   + +A G +P+ AR+TCSLQS +++LA
Sbjct  1    MAASLQAAATLMQPSKVGVASRSIGGQQLRSGSHLSRAFGFEPTTARLTCSLQSDLRDLA  60

Query  217  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  396
            H  SDAAKLAGFALATSAL+V+GA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   HKCSDAAKLAGFALATSALVVAGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  397  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            GV++FAFKPGKY+AKKFCLEPTSFTVKAE VSKNAP EFQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  GVDSFAFKPGKYNAKKFCLEPTSFTVKAEGVSKNAPAEFQRTKLMTRLTYTLDEIEGPFE  180



>ref|NP_001239736.1| uncharacterized protein LOC100798485 [Glycine max]
 gb|ACU19444.1| unknown [Glycine max]
 gb|KHN42036.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=329

 Score =   282 bits (722),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 154/175 (88%), Gaps = 0/175 (0%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  231
            MAASLQ AAT MQPTKVG+  R  +S Q + KA G++P+ A++TCSLQ  +KE A    D
Sbjct  1    MAASLQAAATFMQPTKVGIASRNLKSTQCISKAFGLEPAAAKLTCSLQPDLKEFAQKCVD  60

Query  232  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  411
            A K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTIEGGV++F
Sbjct  61   ATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIEGGVDSF  120

Query  412  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            AFKPGKY+A+K CLEPTSFTVKAE V+KNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  AFKPGKYNAQKLCLEPTSFTVKAEGVAKNAPPEFQNTKLMTRLTYTLDEIEGPFE  175



>ref|XP_010255017.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nelumbo nucifera]
Length=332

 Score =   282 bits (722),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 155/178 (87%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MAASLQ AATLMQPTKVGV+ R G   RS Q+V KA G + S AR+TCSLQS +K+ A  
Sbjct  1    MAASLQAAATLMQPTKVGVSSRSGQQLRSSQSVCKAFGFETSGARLTCSLQSDLKDFAQK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
              DA+K+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGG+
Sbjct  61   CVDASKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGI  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            ++F FK GKY+ KKFCLEPTSFTVKAE VSKN+PPEFQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  DSFGFKSGKYNMKKFCLEPTSFTVKAEGVSKNSPPEFQKTKLMTRLTYTLDEIEGPFE  178



>sp|P26320.1|PSBO_SOLTU RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Solanum tuberosum]
Length=333

 Score =   281 bits (719),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 159/179 (89%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ AATLMQPTKVG V+ R     RS Q+V KA G++PS +R++CSLQ+ +K+ A 
Sbjct  1    MAASLQAAATLMQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQ  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            V++FAFKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  VDSFAFKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFE  179



>ref|XP_011025676.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Populus euphratica]
Length=332

 Score =   281 bits (718),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 158/178 (89%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MAASLQ AATLMQPTKVGV  R     RS Q+V KA G++P+ ARI+CSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGLEPASARISCSLQSDLKDLAQK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
              DA+K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKGSGTANQCPTI+GG+
Sbjct  61   CVDASKIAGFALATSALVVSGASAEGVPKRLTYEEIQSKTYMEVKGSGTANQCPTIDGGL  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            ++FAFKPGKY+AKK CLEPTSFTVKAE ++KN+PP+FQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  DSFAFKPGKYNAKKICLEPTSFTVKAEGINKNSPPDFQKTKLMTRLTYTLDEIEGPFE  178



>ref|XP_002310188.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
 gb|ABK95579.1| unknown [Populus trichocarpa]
 gb|ABK96112.1| unknown [Populus trichocarpa]
 gb|ABK96443.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE90638.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
Length=332

 Score =   281 bits (718),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 158/178 (89%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MAASLQ AATLMQPTKVGV  R     RS Q+V KA G++P+ ARI+CSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGLEPASARISCSLQSDLKDLAQK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
              DA+K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKGSGTANQCPTI+GG+
Sbjct  61   CVDASKIAGFALATSALVVSGASAEGVPKRLTYEEIQSKTYMEVKGSGTANQCPTIDGGL  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            ++FAFKPGKY+AKK CLEPTSFTVKAE ++KN+PP+FQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  DSFAFKPGKYNAKKICLEPTSFTVKAEGINKNSPPDFQKTKLMTRLTYTLDEIEGPFE  178



>dbj|BAA96365.3| oxygen evolving enhancer protein 1 precursor [Bruguiera gymnorhiza]
Length=332

 Score =   281 bits (718),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 153/178 (86%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MAASLQ AATLMQP KVGV  R G   RS Q V +A G++P+ ARITCS Q+  K+LA  
Sbjct  1    MAASLQAAATLMQPAKVGVPSRTGLQLRSSQIVSRAFGLEPAAARITCSSQTDFKDLAQK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
              DA K+AGFALATSAL+VSGA AEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTIEGGV
Sbjct  61   CVDATKIAGFALATSALVVSGAGAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIEGGV  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            ++FAFKPGKY+ KK CLEPTSFTVKAE V+KNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  DSFAFKPGKYNVKKLCLEPTSFTVKAEGVNKNAPPEFQNTKLMTRLTYTLDEIEGPFE  178



>gb|KJB43586.1| hypothetical protein B456_007G208000 [Gossypium raimondii]
Length=332

 Score =   280 bits (716),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 153/178 (86%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MA SLQ AATLMQP KV    R     RS Q+V KA G++P  AR+TCSLQ+ +K+LA  
Sbjct  1    MAVSLQAAATLMQPIKVAAPSRTNVLLRSSQSVSKAFGLEPVGARLTCSLQTDLKDLAQK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
              DA KLAGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CVDATKLAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            ++FAFKPGKY AKKFCLEPTSFTVKAE V+KNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  DSFAFKPGKYYAKKFCLEPTSFTVKAEGVNKNAPPEFQNTKLMTRLTYTLDEIEGPFE  178



>ref|XP_010924166.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Elaeis guineensis]
Length=334

 Score =   280 bits (716),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 155/180 (86%), Gaps = 5/180 (3%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRI--GRSYQT---VGKALGVDPSPARITCSLQSQIKELA  216
            MAASLQ AATLMQP KVG T R   G+  +T   + KA G +P+ AR+TCSLQS +++LA
Sbjct  1    MAASLQAAATLMQPAKVGATGRTLAGQQLRTSSHLSKAFGFEPAGARLTCSLQSDLRDLA  60

Query  217  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  396
            H  +DA KLAGFALATSAL+V+GANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEG
Sbjct  61   HKCADATKLAGFALATSALVVAGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEG  120

Query  397  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            GV++FAFKPGKY  KK CLEPTSFTVKAE VSKNAPPEFQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  GVDSFAFKPGKYQMKKLCLEPTSFTVKAEGVSKNAPPEFQKTKLMTRLTYTLDEIEGPFE  180



>emb|CDP02430.1| unnamed protein product [Coffea canephora]
Length=331

 Score =   279 bits (713),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 154/178 (87%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPR---IGRSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MAASLQ AATLMQP KVGV PR   + RS   + KA GV+ S AR+TCSLQ+ +K+LA  
Sbjct  1    MAASLQAAATLMQPAKVGVAPRNNVLLRSSPNLSKAFGVEQSSARLTCSLQADLKDLAQK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
             +DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTI+GGV
Sbjct  61   CTDAAKVAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIDGGV  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            + FAFKPGKY AKK CLEPTSFTVKAE  +KN+PPEFQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  DKFAFKPGKYDAKKLCLEPTSFTVKAEGPNKNSPPEFQKTKLMTRLTYTLDEIEGPFE  178



>emb|CAA35601.1| 33kDa precursor protein of oxygen-evolving complex [Solanum tuberosum]
Length=332

 Score =   279 bits (713),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 158/178 (89%), Gaps = 4/178 (2%)
 Frame = +1

Query  55   AASLQTAATLMQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            AASLQ AATLMQPTKVG V+ R     RS Q+V KA G++PS +R++CSLQ+ +K+ A  
Sbjct  1    AASLQAAATLMQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
             +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CTDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            ++FAFKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  DSFAFKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFE  178



>gb|KDO79409.1| hypothetical protein CISIN_1g019870mg [Citrus sinensis]
Length=334

 Score =   278 bits (712),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 157/180 (87%), Gaps = 5/180 (3%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPARITCSLQSQIKELA  216
            MAASLQ AATLMQPTKVGV P        RS Q+V KA GVD + ARI+CSL + +K+LA
Sbjct  1    MAASLQAAATLMQPTKVGVVPARSSSLQLRSSQSVSKAFGVDSAGARISCSLNNDLKDLA  60

Query  217  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  396
                DA K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   QKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  397  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            GV++FAFKPGKY AKKFCLEPTSFTVKAESV+KNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  GVDSFAFKPGKYQAKKFCLEPTSFTVKAESVNKNAPPDFQNTKLMTRLTYTLDEIEGPFE  180



>gb|KHG13438.1| Oxygen-evolving enhancer 1, chloroplastic [Gossypium arboreum]
Length=332

 Score =   278 bits (712),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 153/178 (86%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MA SLQ AATLMQP KV    R     RS Q+V KA G++P  AR+TCSLQ+ +K+LA  
Sbjct  1    MAVSLQAAATLMQPIKVAAPSRTNVPLRSSQSVSKAFGLEPVGARLTCSLQTDLKDLALK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
              DA KLAGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CVDATKLAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            ++FAFKPGKY AKKFCLEPTSFTVKAE V+KNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  DSFAFKPGKYYAKKFCLEPTSFTVKAEGVNKNAPPEFQNTKLMTRLTYTLDEIEGPFE  178



>ref|XP_006856169.1| hypothetical protein AMTR_s00059p00176390 [Amborella trichopoda]
 gb|ERN17636.1| hypothetical protein AMTR_s00059p00176390 [Amborella trichopoda]
Length=331

 Score =   278 bits (711),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 153/178 (86%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MAASLQ AATLMQPTK+G + R G   RS   + KA G +PS AR+TCS+Q  ++ELAH 
Sbjct  1    MAASLQAAATLMQPTKLGGSSRNGLQLRSSSQICKAFGFEPSSARLTCSIQEDLRELAHK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
              DA KLAGFALATSAL+V+GANAEGVPKRLT+DEIQSKTY EVKG+GTANQCP I+GGV
Sbjct  61   CVDATKLAGFALATSALVVAGANAEGVPKRLTYDEIQSKTYTEVKGTGTANQCPAIDGGV  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            + FAFKPGKY+ KKFCLEPTSFTVKAES++KNAPPEFQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  DKFAFKPGKYNMKKFCLEPTSFTVKAESINKNAPPEFQKTKLMTRLTYTLDEIEGPFE  178



>ref|XP_006338257.1| PREDICTED: chloroplast manganese stabilizing protein-II [Solanum 
tuberosum]
Length=333

 Score =   278 bits (712),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 158/179 (88%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ AATLMQPTKVG V+ R     RS Q+V KA G++PS +R++CSLQ+ +K+ A 
Sbjct  1    MAASLQAAATLMQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQ  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            V++FAFK GKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  VDSFAFKSGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFE  179



>ref|XP_006425778.1| hypothetical protein CICLE_v10026034mg [Citrus clementina]
 ref|XP_006466690.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Citrus sinensis]
 gb|ESR39018.1| hypothetical protein CICLE_v10026034mg [Citrus clementina]
Length=334

 Score =   278 bits (710),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 157/180 (87%), Gaps = 5/180 (3%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPARITCSLQSQIKELA  216
            MAASLQ AATLMQPTKVGV P        RS Q+V KA GVD + ARI+C+L + +K+LA
Sbjct  1    MAASLQAAATLMQPTKVGVVPARSSSLQLRSSQSVSKAFGVDSAGARISCTLNNDLKDLA  60

Query  217  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  396
                DA K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   QKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  397  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            GV++FAFKPGKY AKKFCLEPTSFTVKAESV+KNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  GVDSFAFKPGKYQAKKFCLEPTSFTVKAESVNKNAPPDFQNTKLMTRLTYTLDEIEGPFE  180



>ref|XP_004300575.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=331

 Score =   277 bits (709),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 153/178 (86%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIGRSYQT--VGKALGVDPSPA-RITCSLQSQIKELAHN  222
            MAAS+Q AATLMQPTK+GV  R     ++  V KA G++P+ + R+TCSLQ+ +KE AH 
Sbjct  1    MAASMQAAATLMQPTKLGVPSRTSLQLRSSNVSKAFGLEPAASSRLTCSLQTDLKEFAHK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
              DA K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG 
Sbjct  61   CVDATKIAGFALATSALVVSGAGAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGS  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            E FAFKPGKY AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  EAFAFKPGKYVAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  178



>ref|XP_004232077.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum lycopersicum]
Length=333

 Score =   277 bits (708),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 159/179 (89%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ AATLMQPTKVG V+ R     RS Q++ KA G++PS ++++CSLQ+ +K+ A 
Sbjct  1    MAASLQAAATLMQPTKVGGVSARNNLPLRSAQSLSKAFGLEPSASKLSCSLQADLKDFAQ  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            V++F+FKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  VDSFSFKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFE  179



>ref|XP_009103510.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Brassica rapa]
 emb|CDY45242.1| BnaA07g12480D [Brassica napus]
Length=332

 Score =   276 bits (705),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 151/179 (84%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS IK+ A 
Sbjct  1    MAASLQSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDIKDFAG  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  179



>ref|XP_010263833.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nelumbo nucifera]
Length=332

 Score =   276 bits (705),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 152/178 (85%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MAASLQ AATL QPTKVGV  + G   RS  TV K  G DPS AR+TCSLQS +KELA  
Sbjct  1    MAASLQAAATLRQPTKVGVPVKGGLQLRSTPTVCKNFGFDPSCARLTCSLQSDLKELAQK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
              DA K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV
Sbjct  61   CVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGV  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            ++FAFK GKY+ KK CLEPTSFTVKAE VSKNAPPEFQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  DSFAFKTGKYNLKKLCLEPTSFTVKAEGVSKNAPPEFQKTKLMTRLTYTLDEIEGPFE  178



>ref|XP_009758248.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=328

 Score =   275 bits (704),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 151/179 (84%), Gaps = 9/179 (5%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ AATL     +GV P       RS   V KA GV+PS AR+TCSLQ+  K+LA 
Sbjct  1    MAASLQAAATL-----IGVIPSRNNLQFRSSHCVSKAFGVEPSSARLTCSLQADFKDLAQ  55

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              SDAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  56   KCSDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  115

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            VE FAFKPGKY+AKKFCLEPTSFTVKAE V+KN+PPEFQ TKLMTRLTYTLDEIEGPFE
Sbjct  116  VETFAFKPGKYNAKKFCLEPTSFTVKAEGVNKNSPPEFQKTKLMTRLTYTLDEIEGPFE  174



>ref|XP_006280785.1| hypothetical protein CARUB_v10026754mg [Capsella rubella]
 gb|EOA13683.1| hypothetical protein CARUB_v10026754mg [Capsella rubella]
Length=332

 Score =   275 bits (704),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 151/179 (84%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+LA 
Sbjct  1    MAASLQSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDLAG  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  179



>ref|XP_007156865.1| hypothetical protein PHAVU_002G024000g [Phaseolus vulgaris]
 gb|AGV54484.1| oxygen-evolving enhancer protein 1 [Phaseolus vulgaris]
 gb|ESW28859.1| hypothetical protein PHAVU_002G024000g [Phaseolus vulgaris]
Length=329

 Score =   275 bits (703),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 152/175 (87%), Gaps = 0/175 (0%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  231
            MA+SLQ AAT MQPTKV +  R  +S Q + KA G++PS  ++TCSL S +K+LA    D
Sbjct  1    MASSLQAAATFMQPTKVPLNSRNLKSTQCISKAFGLEPSAPKLTCSLHSDLKDLAQKCLD  60

Query  232  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  411
            A KLAGFALATSALLVSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGVE+F
Sbjct  61   ATKLAGFALATSALLVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVESF  120

Query  412  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            AFKPGKY+AKK CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  AFKPGKYNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFE  175



>gb|KFK34331.1| hypothetical protein AALP_AA5G131000 [Arabis alpina]
Length=331

 Score =   275 bits (703),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 150/178 (84%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MA SLQ AAT +QP K+  +P      RS QTVGK+ G+D SPAR+TCSL S  K+    
Sbjct  1    MATSLQAAATFLQPAKIAASPSRNVHLRSNQTVGKSFGLDSSPARLTCSLHSDFKDFVGK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
             SDAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG 
Sbjct  61   CSDAAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGS  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  EAFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  178



>gb|EYU44326.1| hypothetical protein MIMGU_mgv1a009768mg [Erythranthe guttata]
Length=332

 Score =   275 bits (702),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 154/178 (87%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MA SLQ AATLMQPTKVGV+ R     RS Q V ++ G +P+ +R+TCSLQS +K+LA  
Sbjct  1    MATSLQAAATLMQPTKVGVSARSSLQLRSAQNVSRSFGFEPAGSRLTCSLQSDLKDLAQK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
             +DAAK+AGFALATSAL+ SGA+AEGVPKRLTFDEIQSKTYMEVKG+GTANQCPT++GG 
Sbjct  61   CTDAAKIAGFALATSALVASGASAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTLDGGS  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            ++FAFK GKY+AKKFCLEPTSFTVKAE VSKN+P EFQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  DSFAFKSGKYTAKKFCLEPTSFTVKAEGVSKNSPAEFQKTKLMTRLTYTLDEIEGPFE  178



>gb|ADR71223.1| chloroplast manganese stabilizing protein [Solanum tuberosum]
Length=321

 Score =   273 bits (699),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 150/169 (89%), Gaps = 1/169 (1%)
 Frame = +1

Query  73   AATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAG  249
            AATLMQPTKVG    +  RS Q+V KA GV+   AR+TCSLQ++IKELA   +DAAK+AG
Sbjct  2    AATLMQPTKVGARNNLQLRSVQSVSKAFGVEQGSARLTCSLQTEIKELAQKCTDAAKIAG  61

Query  250  FALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGK  429
            FALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV +FAFKPGK
Sbjct  62   FALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGSFAFKPGK  121

Query  430  YSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            Y+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFE
Sbjct  122  YTAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFE  170



>ref|XP_008800919.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Phoenix dactylifera]
Length=334

 Score =   273 bits (699),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 152/180 (84%), Gaps = 5/180 (3%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPR--IGRSYQT---VGKALGVDPSPARITCSLQSQIKELA  216
            MAASLQ AATLMQP KV  T R   G+  +T   + KA G +P+ AR+TCSLQS +++LA
Sbjct  1    MAASLQAAATLMQPAKVAATGRNLAGQQLRTGSHLSKAFGFEPAGARLTCSLQSDLRDLA  60

Query  217  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  396
               +DA KLAGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEG
Sbjct  61   QKCADATKLAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEG  120

Query  397  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            GV+ FAFKPGKY  KK CLEPTSFTVKAE VSKN+PPEFQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  GVDEFAFKPGKYQMKKLCLEPTSFTVKAEGVSKNSPPEFQKTKLMTRLTYTLDEIEGPFE  180



>emb|CBI19622.3| unnamed protein product [Vitis vinifera]
Length=273

 Score =   271 bits (694),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 151/178 (85%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MAASL  AATL QPTK G+  + G   +S  +V KA G DP+ AR+TCSLQ+ +K+LA  
Sbjct  1    MAASLHVAATLRQPTKAGLPAKTGLQLKSSPSVCKAFGYDPAGARLTCSLQTHVKDLAQK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
             +DAAK+AGFALATSA LVSGA AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CADAAKIAGFALATSAFLVSGAGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            ++FAFK G Y+ KKFCLEPTSFTVKAE VSKNAP EFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  DSFAFKTGSYNMKKFCLEPTSFTVKAEGVSKNAPAEFQNTKLMTRLTYTLDEIEGPFE  178



>ref|XP_009130561.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Brassica rapa]
 emb|CDY55088.1| BnaA02g34760D [Brassica napus]
Length=332

 Score =   273 bits (699),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 151/179 (84%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ+A+T +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+LA 
Sbjct  1    MAASLQSASTFLQAAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDLAG  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  179



>ref|XP_006393852.1| hypothetical protein EUTSA_v10004563mg [Eutrema salsugineum]
 gb|ESQ31138.1| hypothetical protein EUTSA_v10004563mg [Eutrema salsugineum]
Length=332

 Score =   273 bits (698),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 151/179 (84%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+LA 
Sbjct  1    MAASLQSAATFLQSAKIATAPSRGGSHLRSTQTVGKSFGLETSSARLTCSFQSDFKDLAG  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SEIFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  179



>gb|AAD38521.1|AF139818_1 33 kDa oxygen evolving protein of photosystem II [Brassica napus]
Length=274

 Score =   271 bits (693),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 149/179 (83%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ+A T +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSATTFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  179



>ref|XP_010444775.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Camelina sativa]
Length=332

 Score =   273 bits (698),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 150/179 (84%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ+AAT +Q  K+  TP  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSAATFLQSAKISTTPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             E F+ KPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SETFSIKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  179



>ref|XP_002877774.1| photosystem II subunit O-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54033.1| photosystem II subunit O-2 [Arabidopsis lyrata subsp. lyrata]
Length=331

 Score =   273 bits (697),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 151/178 (85%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MA SLQ AAT +QP K+  +P      RS QTVGK+ G+D S AR+TCSL S +K+ A  
Sbjct  1    MATSLQAAATFLQPAKIAASPSRNVHLRSNQTVGKSFGLDSSQARLTCSLHSDLKDFAGK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
             S+AAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG 
Sbjct  61   CSEAAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGS  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  ETFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  178



>gb|AAT65501.1| photosystem II protein [Brassica oleracea]
Length=347

 Score =   273 bits (698),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 155/192 (81%), Gaps = 4/192 (2%)
 Frame = +1

Query  13   REREELTLLSDPTMAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARI  180
            R++ EL+      MAASLQ+AAT  Q  K+   P  G    RS QTVGK+ G++ S AR+
Sbjct  3    RKKLELSERHSVAMAASLQSAATFFQSAKISTAPSRGSAHLRSAQTVGKSFGLETSSARL  62

Query  181  TCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKG  360
            TCS QS IK+ A   SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG
Sbjct  63   TCSYQSDIKDFAGKCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKG  122

Query  361  SGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRL  540
            +GTANQCPTI+GG E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRL
Sbjct  123  TGTANQCPTIDGGSETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRL  182

Query  541  TYTLDEIEGPFE  576
            T TLDEIEGPFE
Sbjct  183  TCTLDEIEGPFE  194



>emb|CDY30764.1| BnaC07g16640D [Brassica napus]
Length=332

 Score =   272 bits (696),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 150/179 (84%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ+AAT +   K+   P  G    RS QTVGK+ G++ S AR+TCS QS IK+ A 
Sbjct  1    MAASLQSAATFLLSAKISAAPSRGSAHLRSTQTVGKSFGLESSSARLTCSYQSDIKDFAG  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  179



>ref|XP_002866754.1| oxygen-evolving enhancer 33 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43013.1| oxygen-evolving enhancer 33 [Arabidopsis lyrata subsp. lyrata]
Length=332

 Score =   272 bits (696),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 149/179 (83%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ+ AT +Q  K+   P  G    RS Q+VGK+ G+D S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSAHLRSTQSVGKSFGLDTSSARLTCSFQSDFKDFAG  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  179



>ref|XP_003637254.1| Oxygen-evolving enhancer protein, partial [Medicago truncatula]
Length=255

 Score =   269 bits (688),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 151/175 (86%), Gaps = 0/175 (0%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  231
            MAASLQ AATLMQPTK+       +S Q+V KA G++   A++TCSLQS  KEL H F +
Sbjct  1    MAASLQAAATLMQPTKLRSNSLQLKSTQSVSKAFGLEHYGAKVTCSLQSDFKELTHKFVE  60

Query  232  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  411
            A+K+AGFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++F
Sbjct  61   ASKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSF  120

Query  412  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            +FKPGKY+AKKFCLEPTSFTVKAE V+KN P  FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SFKPGKYNAKKFCLEPTSFTVKAEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFE  175



>ref|XP_010028333.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55051.1| hypothetical protein EUGRSUZ_I01025 [Eucalyptus grandis]
Length=331

 Score =   272 bits (695),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 155/177 (88%), Gaps = 2/177 (1%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVG-VTPRIGRSYQTVGKALGVD-PSPARITCSLQSQIKELAHNF  225
            MAASLQ AATLMQPTKVG ++    RS Q V K  G++  + +R+TCSLQ+ +K+LA   
Sbjct  1    MAASLQAAATLMQPTKVGRISSSQLRSSQNVSKTFGLECGAGSRVTCSLQADLKDLAQKC  60

Query  226  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  405
            +DA K+AGFALATSAL+VSGA AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG++
Sbjct  61   ADATKIAGFALATSALVVSGAGAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGLD  120

Query  406  NFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            +FAFKPGKY+AKK CLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SFAFKPGKYNAKKICLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  177



>ref|XP_006291313.1| hypothetical protein CARUB_v10017447mg, partial [Capsella rubella]
 gb|EOA24211.1| hypothetical protein CARUB_v10017447mg, partial [Capsella rubella]
Length=376

 Score =   273 bits (699),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 155/197 (79%), Gaps = 5/197 (3%)
 Frame = +1

Query  1    IGTHREREELTLLSDPTMAASLQTAATLMQPTKVGVTPRIGR-----SYQTVGKALGVDP  165
            + T  +   L L+    MA SL  AAT +QP K+  +    R     S QTVGK+ G++ 
Sbjct  27   LSTQHKHRHLRLVCLVVMATSLHAAATFLQPAKIAASSSPSRNVYLRSNQTVGKSFGLES  86

Query  166  SPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTY  345
            S AR+TCSLQS +K+ A   SDAAK+AGFALATSAL+VSGA AEG PKRLT+DEIQSKTY
Sbjct  87   SSARLTCSLQSDLKDFAGKCSDAAKIAGFALATSALVVSGAGAEGAPKRLTYDEIQSKTY  146

Query  346  MEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTK  525
            MEVKG+GTANQCPTI+GG E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTK
Sbjct  147  MEVKGTGTANQCPTIDGGSETFSFKPGKYTGKKFCFEPTSFTVKAESVSKNAPPDFQNTK  206

Query  526  LMTRLTYTLDEIEGPFE  576
            LMTRLTYTLDEIEGPFE
Sbjct  207  LMTRLTYTLDEIEGPFE  223



>gb|AGV54778.1| oxygen-evolving enhancer protein 1 [Phaseolus vulgaris]
Length=329

 Score =   271 bits (694),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 152/175 (87%), Gaps = 0/175 (0%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  231
            MA+SLQ AAT MQPTKV +  R  +S Q + KA G++PS  ++TCSL S +K+LA    D
Sbjct  1    MASSLQAAATFMQPTKVPLNSRNLKSTQCISKAFGLEPSAPKLTCSLHSDLKDLAQKCLD  60

Query  232  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  411
            A KLAGFALATSALLVSGA+AEGVPKRLTFDEI+SKTY+EVKG+GTANQCPTI+GG+E+F
Sbjct  61   ATKLAGFALATSALLVSGASAEGVPKRLTFDEIRSKTYLEVKGTGTANQCPTIDGGLESF  120

Query  412  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            AFKPGKY+AKK CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  AFKPGKYNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFE  175



>ref|XP_009112310.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Brassica rapa]
 emb|CDY18611.1| BnaA09g07840D [Brassica napus]
Length=332

 Score =   271 bits (694),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 149/179 (83%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ+A T +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSATTFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  179



>ref|XP_010550399.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Tarenaya hassleriana]
Length=331

 Score =   271 bits (694),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 151/178 (85%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKV-GVTPRIG--RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MAASL +AAT +QPTK+   T R G  RS  +V K  G++ S AR+TCS+QS +++ A  
Sbjct  1    MAASLHSAATFLQPTKISAATSRYGHLRSSPSVAKTFGLESSSARLTCSIQSDLRDFAGK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
             +DAAK+AGFALATSAL+ SGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG 
Sbjct  61   CTDAAKIAGFALATSALVSSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGS  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            + FAFKPGKYS KKFC EPTSFTVKAE VSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  DEFAFKPGKYSGKKFCFEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  178



>ref|NP_190651.1| oxygen-evolving enhancer protein 1-2 [Arabidopsis thaliana]
 sp|Q9S841.1|PSBO2_ARATH RecName: Full=Oxygen-evolving enhancer protein 1-2, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=Manganese-stabilizing protein 
2; Short=MSP-2; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB42911.1| putative protein 1 photosystem II oxygen-evolving complex [Arabidopsis 
thaliana]
 emb|CAB53092.1| precursor of the 33 kDa subunit of the oxygen evolving complex 
[Arabidopsis thaliana]
 gb|AAK91379.1| AT3g50820/F18B3_100 [Arabidopsis thaliana]
 gb|AAM51568.1| AT3g50820/F18B3_100 [Arabidopsis thaliana]
 gb|AAM67110.1| putative protein 1 photosystem II oxygen-evolving complex [Arabidopsis 
thaliana]
 gb|AEE78714.1| oxygen-evolving enhancer protein 1-2 [Arabidopsis thaliana]
Length=331

 Score =   271 bits (694),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 149/178 (84%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MA SLQ AAT +QP K+  +P      RS QTVGK+ G+D S AR+TCSL S +K+ A  
Sbjct  1    MATSLQAAATFLQPAKIAASPSRNVHLRSNQTVGKSFGLDSSQARLTCSLHSDLKDFAGK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
             SDAAK+AGFALATSAL+VSGA AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG 
Sbjct  61   CSDAAKIAGFALATSALVVSGAGAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGS  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            E F+FK GKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  ETFSFKAGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  178



>emb|CDX81388.1| BnaC09g07990D [Brassica napus]
Length=332

 Score =   271 bits (694),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 149/179 (83%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ+A T +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSATTFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  179



>ref|XP_010103689.1| Oxygen-evolving enhancer protein 1 [Morus notabilis]
 gb|EXB96701.1| Oxygen-evolving enhancer protein 1 [Morus notabilis]
Length=333

 Score =   271 bits (694),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 154/181 (85%), Gaps = 8/181 (4%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG------RSYQTVGKALGVDPSPARITCSLQSQIKEL  213
            MAASLQTAATL   TKVG+  R G      RS Q V KA GV+P+ AR+TCSLQS  K+L
Sbjct  1    MAASLQTAATLT--TKVGMPARGGGGSLQLRSAQAVSKAFGVEPAGARLTCSLQSDFKDL  58

Query  214  AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  393
            A    DA K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTI+
Sbjct  59   AQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTID  118

Query  394  GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPF  573
            GGV++FAFK GKY+ KK CLEPTSFTVKAESV+KNAPPEFQNTKLMTRLTYTLDEIEGPF
Sbjct  119  GGVDSFAFKAGKYNVKKLCLEPTSFTVKAESVNKNAPPEFQNTKLMTRLTYTLDEIEGPF  178

Query  574  E  576
            E
Sbjct  179  E  179



>ref|XP_010484624.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Camelina sativa]
Length=332

 Score =   271 bits (693),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 149/179 (83%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             E F+ KPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SETFSIKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  179



>emb|CAN79166.1| hypothetical protein VITISV_019248 [Vitis vinifera]
Length=331

 Score =   271 bits (692),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 151/178 (85%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MAASL  AATL QPTK G+  + G   +S  +V KA G DP+ AR+TCSLQ+ +K+LA  
Sbjct  1    MAASLHVAATLRQPTKAGLPAKTGLQLKSSPSVCKAFGYDPAGARLTCSLQTHVKDLAQK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
             +DAAK+AGFALATSA LVSGA AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CADAAKIAGFALATSAFLVSGAGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            ++FAFK G Y+ KKFCLEPTSFTVKAE VSKNAP EFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  DSFAFKTGSYNMKKFCLEPTSFTVKAEGVSKNAPAEFQNTKLMTRLTYTLDEIEGPFE  178



>ref|XP_002283699.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Vitis vinifera]
Length=331

 Score =   271 bits (692),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 151/178 (85%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MAASL  AATL QPTK G+  + G   +S  +V KA G DP+ AR+TCSLQ+ +K+LA  
Sbjct  1    MAASLHVAATLRQPTKAGLPAKTGLQLKSSPSVCKAFGYDPAGARLTCSLQTHVKDLAQK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
             +DAAK+AGFALATSA LVSGA AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CADAAKIAGFALATSAFLVSGAGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            ++FAFK G Y+ KKFCLEPTSFTVKAE VSKNAP EFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  DSFAFKTGSYNMKKFCLEPTSFTVKAEGVSKNAPAEFQNTKLMTRLTYTLDEIEGPFE  178



>emb|CDY50981.1| BnaC02g48890D [Brassica napus]
Length=332

 Score =   270 bits (691),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 150/179 (84%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ+A+T +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSASTFLQSAKIITAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  179



>ref|XP_006403995.1| hypothetical protein EUTSA_v10010535mg [Eutrema salsugineum]
 dbj|BAJ34028.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45448.1| hypothetical protein EUTSA_v10010535mg [Eutrema salsugineum]
Length=331

 Score =   270 bits (690),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 149/178 (84%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MA SLQ A T +QP K+  +P      RS QTV K+ G++ SPAR+TCSL S  K+ A  
Sbjct  1    MATSLQAATTFLQPAKIAASPSRSVHLRSNQTVAKSFGLESSPARLTCSLHSDFKDFAGK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
             SDAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG 
Sbjct  61   CSDAAKVAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGS  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  EAFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  178



>gb|ABG25041.1| 33kDa precursor protein of oxygen-evolving complex [Nicotiana 
tabacum]
Length=179

 Score =   264 bits (675),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +1

Query  124  RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGV  303
            RS Q+V KA GV+P+ AR+TCS Q+++K+LA  F+DAAK+AGFALATSAL+VSGANAEGV
Sbjct  3    RSAQSVSKAFGVEPAAARLTCSSQTELKDLAQKFTDAAKVAGFALATSALVVSGANAEGV  62

Query  304  PKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAE  483
            PKRLTFDEIQSKTYMEVKG+GTANQCPTIEGGV +FAFKPGKY+AKKFCLEPTSFTVKA 
Sbjct  63   PKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGVASFAFKPGKYNAKKFCLEPTSFTVKAG  122

Query  484  SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            SV+KNAPP+FQ TKLMTRLTYTLDEIEGPFE
Sbjct  123  SVNKNAPPDFQKTKLMTRLTYTLDEIEGPFE  153



>gb|KFK28330.1| hypothetical protein AALP_AA8G502100 [Arabis alpina]
Length=332

 Score =   270 bits (689),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 148/179 (83%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSAATFIQSAKIATAPSRGGASLRSSQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              SDA K+AGFALATSAL+ SGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCSDAVKIAGFALATSALVASGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             E F+FK GKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SETFSFKAGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  179



>ref|XP_003636084.1| Oxygen-evolving enhancer protein [Medicago truncatula]
 gb|KEH20462.1| photosystem II oxygen-evolving enhancer protein [Medicago truncatula]
Length=329

 Score =   270 bits (689),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 151/175 (86%), Gaps = 0/175 (0%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  231
            MAASLQ AATLMQPTK+       +S Q+V KA G++   A++TCSLQS  KEL H F +
Sbjct  1    MAASLQAAATLMQPTKLRSNSLQLKSTQSVSKAFGLEHYGAKVTCSLQSDFKELTHKFVE  60

Query  232  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  411
            A+K+AGFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++F
Sbjct  61   ASKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSF  120

Query  412  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            +FKPGKY+AKKFCLEPTSFTVKAE V+KN P  FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SFKPGKYNAKKFCLEPTSFTVKAEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFE  175



>ref|NP_001241522.1| uncharacterized protein LOC100820458 [Glycine max]
 gb|ACU23458.1| unknown [Glycine max]
 gb|KHN36175.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=329

 Score =   269 bits (688),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 150/175 (86%), Gaps = 0/175 (0%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  231
            MAASLQ AAT MQPTKVG+  R  +S Q + KA G++P+ A++ CSL+  +K+ A    D
Sbjct  1    MAASLQAAATFMQPTKVGMATRNLKSTQCISKAFGLEPAAAKLICSLKPDLKDFAQKCVD  60

Query  232  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  411
            A K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTIEGGV++F
Sbjct  61   ATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIEGGVDSF  120

Query  412  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            AFK GKY A+K CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  AFKAGKYKAQKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFE  175



>gb|AAM65169.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
Length=332

 Score =   269 bits (688),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 147/179 (82%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             E F+FKPGKYS KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SETFSFKPGKYSGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  179



>ref|XP_007155994.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
 gb|ESW27988.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
Length=330

 Score =   269 bits (687),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 154/176 (88%), Gaps = 1/176 (1%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  228
            MAASLQ AAT MQPTK+G T  +  +S Q++ KA G++P+ A+I+CSL + +K+ A    
Sbjct  1    MAASLQAAATFMQPTKLGRTNTLQLKSPQSISKAFGLEPAGAKISCSLHADLKDFAQKCV  60

Query  229  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  408
            DA K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++
Sbjct  61   DATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDS  120

Query  409  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            FAFKPGKY+AKK CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  FAFKPGKYNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFE  176



>ref|NP_201458.1| PS II oxygen-evolving complex 1 [Arabidopsis thaliana]
 sp|P23321.2|PSBO1_ARATH RecName: Full=Oxygen-evolving enhancer protein 1-1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=Manganese-stabilizing protein 
1; Short=MSP-1; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL11619.1|AF424626_1 AT5g66570/K1F13_25 [Arabidopsis thaliana]
 emb|CAA75629.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
 dbj|BAB10933.1| 33 kDa polypeptide of oxygen-evolving complex [Arabidopsis thaliana]
 gb|AAK96492.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
 gb|AAL31251.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
 gb|AED98230.1| PS II oxygen-evolving complex 1 [Arabidopsis thaliana]
Length=332

 Score =   268 bits (684),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 147/179 (82%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  179



>gb|AAK49614.1|AF372898_1 AT5g66570/K1F13_25 [Arabidopsis thaliana]
Length=332

 Score =   268 bits (684),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 147/179 (82%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  179



>gb|AAK96774.1| 33 kDa polypeptide of oxygen-evolving complex [Arabidopsis thaliana]
Length=332

 Score =   268 bits (684),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 147/179 (82%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  179



>ref|XP_003548008.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Glycine max]
 gb|KHN13352.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=331

 Score =   267 bits (682),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 155/177 (88%), Gaps = 2/177 (1%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPAR-ITCSLQSQIKELAHNF  225
            MAASLQ AAT MQPTK+  +  +  +S Q++ KA G++P  A+ +TCSLQ+ +K+LAH  
Sbjct  1    MAASLQAAATFMQPTKLSRSNTLQQKSTQSISKAFGLEPVGAKKVTCSLQADLKDLAHKC  60

Query  226  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  405
             DA K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG++
Sbjct  61   VDATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGLD  120

Query  406  NFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            +FAFKPGKY+AKK CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SFAFKPGKYNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFE  177



>gb|AAM96957.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
 gb|AAN15726.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
Length=332

 Score =   267 bits (682),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 146/179 (82%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K    
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKNFTG  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  179



>gb|AAL08257.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
Length=332

 Score =   266 bits (681),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 147/179 (82%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              SDA K+AGFALA+SAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALASSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  179



>ref|NP_001043134.1| Os01g0501800 [Oryza sativa Japonica Group]
 dbj|BAB64069.1| putative 33kDa oxygen evolving protein of photosystem II [Oryza 
sativa Japonica Group]
 dbj|BAF05048.1| Os01g0501800 [Oryza sativa Japonica Group]
 gb|EAZ12041.1| hypothetical protein OsJ_01921 [Oryza sativa Japonica Group]
 dbj|BAG96401.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96320.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96862.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96934.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99571.1| unnamed protein product [Oryza sativa Japonica Group]
Length=333

 Score =   266 bits (680),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 150/180 (83%), Gaps = 5/180 (3%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPA-RITCSLQSQIKELA  216
            MAASLQ AATLMQP K+G          R    V +A GVD   A RITCSLQS I+E+A
Sbjct  1    MAASLQAAATLMQPAKLGGRASSAALPSRPSSHVARAFGVDTGAAGRITCSLQSDIREVA  60

Query  217  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  396
            +  +DAAKLAGFALATSALLVSGA+AEGVP+RLTFDEIQSKTYMEVKG+GTANQCPT+EG
Sbjct  61   NKCADAAKLAGFALATSALLVSGASAEGVPRRLTFDEIQSKTYMEVKGTGTANQCPTVEG  120

Query  397  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            GV++FAFK GKY+ KKFCLEPTSFTVKAE V+KNAPPEFQ TKLMTRLTYTLDEIEGP E
Sbjct  121  GVDSFAFKAGKYNMKKFCLEPTSFTVKAEGVAKNAPPEFQKTKLMTRLTYTLDEIEGPLE  180



>ref|NP_001240871.1| uncharacterized protein LOC100811386 [Glycine max]
 gb|ACU17834.1| unknown [Glycine max]
 gb|KHN00579.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=326

 Score =   265 bits (678),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 152/176 (86%), Gaps = 5/176 (3%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPA-RITCSLQSQIKELAHNFS  228
            MA+SLQ AAT MQPTK        +S Q + KA G++P+   ++TCSLQ+ +K+LAH   
Sbjct  1    MASSLQAAATFMQPTKFLQL----KSTQAISKAFGLEPAGVNKVTCSLQADLKDLAHKCV  56

Query  229  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  408
            DA K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG+E+
Sbjct  57   DATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGLES  116

Query  409  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            FAFK GKY+AKKFCLEPTSFTVKAE V+KNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  117  FAFKQGKYNAKKFCLEPTSFTVKAEGVAKNAPPEFQNTKLMTRLTYTLDEIEGPFE  172



>gb|ACS34663.1| chloroplast manganese stabilizing protein-II [Solanum tuberosum]
Length=294

 Score =   263 bits (673),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 149/168 (89%), Gaps = 4/168 (2%)
 Frame = +1

Query  85   MQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGF  252
            MQPTKVG V+ R     RS Q+V KA G++PS +R++CSLQ+ +K+ A   +DAAK+AGF
Sbjct  1    MQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQKCTDAAKIAGF  60

Query  253  ALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKY  432
            ALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++FAFKPGKY
Sbjct  61   ALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKY  120

Query  433  SAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            +AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  NAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFE  168



>ref|XP_010465252.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Camelina sativa]
Length=331

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 148/179 (83%), Gaps = 5/179 (3%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              SDA K+AGFALATSAL+VSGA+AE  PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAE-APKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  119

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             E F+ KPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  120  SETFSIKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  178



>ref|XP_010924332.1| PREDICTED: LOW QUALITY PROTEIN: oxygen-evolving enhancer protein 
1, chloroplastic-like [Elaeis guineensis]
Length=334

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 150/180 (83%), Gaps = 5/180 (3%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPR--IGRSYQT---VGKALGVDPSPARITCSLQSQIKELA  216
            MAASLQ AATLMQP+ VG T R   G+  +T   + K  G +P+ AR+TCSLQ+ +++L 
Sbjct  1    MAASLQAAATLMQPSTVGATRRSLAGQQLRTSSHLSKTFGFEPAGARLTCSLQTDLRDLV  60

Query  217  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  396
               +DA KLAGFALATSALLV+GANAEGVP RLT+DEIQSKTYMEVKG GTANQCPTIEG
Sbjct  61   QKCADATKLAGFALATSALLVAGANAEGVPSRLTYDEIQSKTYMEVKGIGTANQCPTIEG  120

Query  397  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            GV++FAFKPGKY  KKFCLEPTSFTVKAESV+KNAPPEFQ TKLMT LTYTLDEIEGP E
Sbjct  121  GVDSFAFKPGKYQMKKFCLEPTSFTVKAESVNKNAPPEFQKTKLMTCLTYTLDEIEGPLE  180



>gb|EEC70714.1| hypothetical protein OsI_02088 [Oryza sativa Indica Group]
Length=333

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 149/180 (83%), Gaps = 5/180 (3%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPA-RITCSLQSQIKELA  216
            MAASLQ AATLMQP K+G          R    V +A GVD   A RITCSLQS I+E+A
Sbjct  1    MAASLQAAATLMQPAKLGGRASSAALPSRPSSHVARAFGVDTGAAGRITCSLQSDIREVA  60

Query  217  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  396
            +  +DAAKL GFALATSALLVSGA+AEGVP+RLTFDEIQSKTYMEVKG+GTANQCPT+EG
Sbjct  61   NKCADAAKLTGFALATSALLVSGASAEGVPRRLTFDEIQSKTYMEVKGTGTANQCPTVEG  120

Query  397  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            GV++FAFK GKY+ KKFCLEPTSFTVKAE V+KNAPPEFQ TKLMTRLTYTLDEIEGP E
Sbjct  121  GVDSFAFKAGKYNMKKFCLEPTSFTVKAEGVAKNAPPEFQKTKLMTRLTYTLDEIEGPLE  180



>gb|AFW90569.1| chloroplast manganese stabilizing protein-II [Solanum tuberosum]
Length=293

 Score =   263 bits (671),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 149/168 (89%), Gaps = 4/168 (2%)
 Frame = +1

Query  85   MQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGF  252
            MQPTKVG V+ R     RS Q+V KA G++PS +R++CSLQ+ +K+ A   +DAAK+AGF
Sbjct  1    MQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQKCTDAAKIAGF  60

Query  253  ALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKY  432
            ALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++FAFKPGKY
Sbjct  61   ALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKY  120

Query  433  SAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            +AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  NAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFE  168



>sp|P14226.1|PSBO_PEA RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Pisum sativum]
 emb|CAA33408.1| unnamed protein product [Pisum sativum]
 dbj|BAA02554.1| precursor for 33-kDa protein of photosystem II [Pisum sativum]
 prf||1611461A O2 evolving complex 33kD protein
Length=329

 Score =   264 bits (674),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 150/175 (86%), Gaps = 0/175 (0%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  231
            MAASLQ AATLMQPTK+       +S Q+V KA G++   A++TCSLQS  KELAH   +
Sbjct  1    MAASLQAAATLMQPTKLRSNTLQLKSNQSVSKAFGLEHYGAKVTCSLQSDFKELAHKCVE  60

Query  232  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  411
            A+K+AGFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++F
Sbjct  61   ASKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSF  120

Query  412  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            +FKPGKY+AKK CLEPTSFTVK+E V+KN P  FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SFKPGKYNAKKLCLEPTSFTVKSEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFE  175



>ref|XP_010424899.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Camelina sativa]
Length=334

 Score =   263 bits (673),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 149/181 (82%), Gaps = 6/181 (3%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG------RSYQTVGKALGVDPSPARITCSLQSQIKEL  213
            MA SLQ AAT +QP K+  +          RS QT+GK+ G++ S AR+TCSL S +K+ 
Sbjct  1    MATSLQAAATFLQPAKIAASSSPPSRSVHLRSNQTIGKSFGLESSSARLTCSLHSDLKDF  60

Query  214  AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  393
            A   S+ AK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+
Sbjct  61   AGKCSEVAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTID  120

Query  394  GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPF  573
            GG E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPF
Sbjct  121  GGSETFSFKPGKYTGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPF  180

Query  574  E  576
            E
Sbjct  181  E  181



>gb|ABG25040.1| 33kDa precursor protein of oxygen-evolving complex [Solanum lycopersicum]
Length=179

 Score =   257 bits (657),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +1

Query  124  RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGV  303
            RS Q+V KA GV+    R+TCSLQ++IKELA   +DAAK+AGFALATSAL+VSGANAEGV
Sbjct  3    RSAQSVSKAFGVEQGSGRLTCSLQTEIKELAQKCTDAAKIAGFALATSALVVSGANAEGV  62

Query  304  PKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAE  483
            PKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV +FAFKPGKY+AKKFCLEPTSFTVKAE
Sbjct  63   PKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGSFAFKPGKYTAKKFCLEPTSFTVKAE  122

Query  484  SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             VSKN+ P+FQ TKLMTRLTYTLDEIEGPFE
Sbjct  123  GVSKNSAPDFQKTKLMTRLTYTLDEIEGPFE  153



>ref|XP_008440181.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Cucumis melo]
Length=332

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 155/178 (87%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQ-TAATLMQPTKVG--VTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MAAS+  TAATLMQP+K+    T    RS Q++ KA G++ + AR+TCSL S +K+++  
Sbjct  1    MAASVHATAATLMQPSKLASRTTTSQLRSSQSLSKAFGLESAGARLTCSLHSDLKDVSRK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
            F+DAAK+AGFALATSAL+VSGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTIEGGV
Sbjct  61   FADAAKIAGFALATSALVVSGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIEGGV  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            ++FAFK GKY AKKFCLEPTSFTVKAE VSKN+PPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  DSFAFKAGKYQAKKFCLEPTSFTVKAEGVSKNSPPEFQNTKLMTRLTYTLDEIEGPFE  178



>ref|XP_009149414.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Brassica rapa]
Length=333

 Score =   262 bits (670),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 150/180 (83%), Gaps = 5/180 (3%)
 Frame = +1

Query  52   MAASLQ-TAATLMQPTKVGVT-PRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELA  216
            MA SL+ T AT +QP K+  + P      RS QTVGK+ G++ SPAR+TCS+ S  K+  
Sbjct  1    MATSLKATTATFLQPAKIATSSPSRNVHLRSNQTVGKSFGLESSPARLTCSIHSDFKDFV  60

Query  217  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  396
               SDAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   GKCSDAAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  397  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            G E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  GSETFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  180



>emb|CAA36675.1| 33 kDa oxygen-evolving protein [Arabidopsis thaliana]
Length=332

 Score =   262 bits (670),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 145/179 (81%), Gaps = 4/179 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTAN  PTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANHSPTIDGG  120

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  179



>ref|XP_008787656.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Phoenix dactylifera]
Length=334

 Score =   262 bits (670),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 151/180 (84%), Gaps = 5/180 (3%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPR--IG---RSYQTVGKALGVDPSPARITCSLQSQIKELA  216
            MAASLQ AA LMQP K+G T R   G   R++  + KA G +P+ A +TCSLQ+ +++LA
Sbjct  1    MAASLQAAAMLMQPAKIGATGRSLAGQQLRTFSHLSKAFGFEPAGAGLTCSLQTDLRDLA  60

Query  217  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  396
               +DA KLAGFA ATSAL+V+GANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEG
Sbjct  61   LKCADATKLAGFAHATSALVVAGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEG  120

Query  397  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            GV++FAFKPGKY  K+FCLEPTSFTVKAE ++KN+P EFQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  GVDSFAFKPGKYQMKRFCLEPTSFTVKAEGINKNSPAEFQKTKLMTRLTYTLDEIEGPFE  180



>ref|XP_010503753.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Camelina sativa]
Length=336

 Score =   262 bits (670),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/183 (71%), Positives = 148/183 (81%), Gaps = 8/183 (4%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG--------RSYQTVGKALGVDPSPARITCSLQSQIK  207
            MA SLQ AAT +QP K+  +            RS QTV K+ G++ S AR TCSLQS +K
Sbjct  1    MATSLQAAATFLQPAKIAASSSSSSPSRNVHLRSNQTVAKSFGLESSSARRTCSLQSDLK  60

Query  208  ELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPT  387
            + A   S+AAK+AGF LATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPT
Sbjct  61   DFAGKCSEAAKIAGFTLATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPT  120

Query  388  IEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEG  567
            I+GG E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEG
Sbjct  121  IDGGSETFSFKPGKYTGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEG  180

Query  568  PFE  576
            PFE
Sbjct  181  PFE  183



>ref|XP_003611860.1| Oxygen evolving enhancer protein [Medicago truncatula]
 gb|AES94818.1| photosystem II oxygen-evolving enhancer protein [Medicago truncatula]
Length=329

 Score =   261 bits (668),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 154/179 (86%), Gaps = 8/179 (4%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MA SLQ AATLMQPTK+G+  R      +S Q++ KA G++ + A++TCSLQ    ++AH
Sbjct  1    MAVSLQAAATLMQPTKIGINNRSTTLHLKSTQSISKAFGLEHNGAKLTCSLQ----DIAH  56

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
             F+D+AK+AGFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTIEGG
Sbjct  57   RFADSAKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIEGG  116

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             ++F+FK GKY+AKKFCLEPTSFTVK+E ++KN+P +FQNTKLMTRLTYTLDEIEGPFE
Sbjct  117  SDSFSFKSGKYNAKKFCLEPTSFTVKSEGITKNSPLDFQNTKLMTRLTYTLDEIEGPFE  175



>ref|XP_004968772.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Setaria italica]
Length=333

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 144/178 (81%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MAASLQ AATLMQP K+G         R    V +A GVD    RI+CSLQS ++E+A  
Sbjct  1    MAASLQAAATLMQPAKIGGRASASLPSRQASHVARAFGVDAGAGRISCSLQSDVREVASK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
              DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CIDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            ++F FK GKY  KKFCLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIEGP E
Sbjct  121  DSFPFKAGKYQMKKFCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIEGPLE  178



>ref|XP_004509219.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Cicer arietinum]
Length=329

 Score =   261 bits (668),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 150/175 (86%), Gaps = 0/175 (0%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  231
            MAASLQ AATLMQPTK+       +S Q++ KA G++ S +++TCSLQ+  K+LAH   +
Sbjct  1    MAASLQAAATLMQPTKLRSNSFQLKSTQSISKAFGLEHSGSKVTCSLQTDFKDLAHKCVE  60

Query  232  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  411
            A K+AGFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG+++F
Sbjct  61   ATKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGLDSF  120

Query  412  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            AFK GKY+AKKFCLEPTSFTVKAE V+KN P  FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  AFKAGKYNAKKFCLEPTSFTVKAEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFE  175



>ref|XP_010673597.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=330

 Score =   261 bits (667),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 145/176 (82%), Gaps = 1/176 (1%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  228
            MAASLQ + T +QPTKV     +  RS   V KA GV+P+  R+  SLQS +KELA+   
Sbjct  1    MAASLQASTTFLQPTKVASRNTLQLRSTPNVCKAFGVEPASGRLCLSLQSDLKELANKCV  60

Query  229  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  408
            DA KLAG ALATSAL+ SGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGGV+ 
Sbjct  61   DATKLAGLALATSALIASGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGVDT  120

Query  409  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            FAFK GKY+AKKFCLEPT F VKAE VSKNAPP+FQNTKLMTRLTYTLDE+EGPFE
Sbjct  121  FAFKAGKYNAKKFCLEPTKFAVKAEGVSKNAPPDFQNTKLMTRLTYTLDEMEGPFE  176



>ref|XP_004141946.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004160493.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Cucumis sativus]
 gb|KGN48464.1| Oxygen-evolving enhancer protein 1 [Cucumis sativus]
Length=332

 Score =   261 bits (666),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 146/168 (87%), Gaps = 2/168 (1%)
 Frame = +1

Query  79   TLMQPTKVG--VTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGF  252
            TLMQP+K+    T    RS Q++ KA G++ S  R+TCSL S +K+++  F+DAAK+AGF
Sbjct  11   TLMQPSKLASRTTTSHLRSSQSLSKAFGLESSGPRLTCSLHSDLKDVSRKFADAAKIAGF  70

Query  253  ALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKY  432
            ALATSAL+VSGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++FAFK GKY
Sbjct  71   ALATSALVVSGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSFAFKAGKY  130

Query  433  SAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             AKKFCLEPTSFTVKAE VSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  131  QAKKFCLEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  178



>emb|CDY33308.1| BnaA01g19750D [Brassica napus]
Length=381

 Score =   262 bits (670),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 150/180 (83%), Gaps = 5/180 (3%)
 Frame = +1

Query  52   MAASLQ-TAATLMQPTKVGVT-PRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELA  216
            MA SL+ T AT +QP K+  + P      RS QTVGK+ G++ SPAR+TCS+ S  K+  
Sbjct  1    MATSLKATTATFLQPAKIATSSPSRNVHLRSNQTVGKSFGLESSPARLTCSIHSDFKDFV  60

Query  217  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  396
               SDAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   GKCSDAAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  397  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            G E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  GSETFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  180



>ref|XP_006644206.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Oryza brachyantha]
Length=334

 Score =   260 bits (664),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 147/180 (82%), Gaps = 6/180 (3%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG-----RSYQTVGKALGVDPSPARITCSLQSQIKELA  216
            MAASLQ AATLMQP K+G  P        R    V +A GVD +  R++CSLQS I+E+A
Sbjct  1    MAASLQAAATLMQPAKLGGRPASSAALPSRPSSHVARAFGVD-AGCRVSCSLQSDIREVA  59

Query  217  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  396
               +DAAKLAGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPT++G
Sbjct  60   SKCADAAKLAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTVDG  119

Query  397  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            GV+ F FK GKY+ KKFCLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIEGP E
Sbjct  120  GVDTFPFKSGKYNVKKFCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIEGPLE  179



>emb|CDY26519.1| BnaC01g23800D [Brassica napus]
Length=373

 Score =   261 bits (667),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 150/180 (83%), Gaps = 5/180 (3%)
 Frame = +1

Query  52   MAASLQ-TAATLMQPTKVGVT-PRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELA  216
            MA SL+ T AT +QP K+  + P      RS QTVGK+ G++ SPAR+TCS+ S  K+  
Sbjct  1    MATSLKATTATFLQPAKIATSSPSRNVHLRSNQTVGKSSGLESSPARLTCSIHSDFKDFV  60

Query  217  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  396
               SDAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   GKCSDAAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  397  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            G E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  GSETFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  180



>ref|XP_010515458.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Camelina sativa]
Length=333

 Score =   259 bits (661),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 147/180 (82%), Gaps = 5/180 (3%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIGR-----SYQTVGKALGVDPSPARITCSLQSQIKELA  216
            MA SL  AAT +QP K+  +    R     S QTVGK+ G++ S  R+TCSL S +KE A
Sbjct  1    MATSLHAAATFLQPAKIAASSSPSRNVHFRSNQTVGKSFGLESSSPRLTCSLHSDLKEFA  60

Query  217  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  396
               S++AK+A FALATSAL+VSGA+AEG P+RLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   GKCSESAKIACFALATSALVVSGASAEGAPRRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  397  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            G E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  GSETFSFKPGKYTGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  180



>gb|EPS61846.1| oxygen-evolving enhancer protein 1, chloroplastic [Genlisea aurea]
Length=330

 Score =   258 bits (659),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 146/176 (83%), Gaps = 1/176 (1%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  228
            MA S+Q  ATLMQP ++  T  +  RS    GK+LG++    R TCSL + +K+LA   +
Sbjct  1    MATSMQAVATLMQPARLRSTASVPIRSVPAAGKSLGIESGAGRFTCSLNTDLKQLAVKLA  60

Query  229  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  408
            DAAK+AGFALATSAL+ SGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++
Sbjct  61   DAAKIAGFALATSALVASGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDS  120

Query  409  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            FAFK GKY+AKK CLEPTSFTVKAE V+KNAPP+FQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  FAFKAGKYNAKKLCLEPTSFTVKAEGVNKNAPPDFQKTKLMTRLTYTLDEIEGPFE  176



>ref|XP_009616099.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana tomentosiformis]
Length=326

 Score =   257 bits (657),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 145/179 (81%), Gaps = 11/179 (6%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  219
            MAASLQ AATL     +GV P       RS Q+V KA GV+P+  R+TCSLQ   K+LA 
Sbjct  1    MAASLQAAATL-----IGVIPSRNNLQFRSSQSVSKAFGVEPATVRLTCSLQVDFKDLAQ  55

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              SDAAK+AGFA ATSAL+  GANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  56   KCSDAAKVAGFAFATSALV--GANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  113

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             E FAFKPGKY+AKKFCLEPTSFTVKAE V+KN+PP FQ TKLMTRLTYTLDEIEGP E
Sbjct  114  FETFAFKPGKYNAKKFCLEPTSFTVKAEGVNKNSPPAFQKTKLMTRLTYTLDEIEGPLE  172



>gb|AEN02470.1| oxygen-evolving enhancer protein [Camellia sinensis]
Length=333

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 152/181 (84%), Gaps = 7/181 (4%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPR-----IGRSYQTVGKALGVDPS-PARITCSLQSQIKEL  213
            MAASLQ AAT+MQPTKVGV  R     + RS Q+V K  GV+ +  AR+TCS+ +  K+L
Sbjct  1    MAASLQAAATMMQPTKVGVQGRSTNVQLLRSSQSVCKVFGVEQTGSARLTCSV-TDAKDL  59

Query  214  AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  393
            A   + AAK+AGFALATSAL+VSGA+AEG PKRLTFDEI+SKTY+EVKG+GTANQCPTIE
Sbjct  60   AQKCAVAAKVAGFALATSALVVSGASAEGPPKRLTFDEIRSKTYLEVKGTGTANQCPTIE  119

Query  394  GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPF  573
            GGV+ FAFKPGKY  KKFCLEPTSFTVKA+SVSKNA PEFQ TKLMTRLTYTLDEIEGPF
Sbjct  120  GGVDKFAFKPGKYQMKKFCLEPTSFTVKADSVSKNASPEFQRTKLMTRLTYTLDEIEGPF  179

Query  574  E  576
            E
Sbjct  180  E  180



>gb|ADB07372.1| chloroplast managanese stabilizing protein [Capsicum annuum]
Length=281

 Score =   255 bits (651),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 144/168 (86%), Gaps = 4/168 (2%)
 Frame = +1

Query  85   MQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGF  252
            MQPTK+G V+ R     RS Q+V K  GV+   AR+TCSLQ  +K+ A   +DAAK+AGF
Sbjct  1    MQPTKIGGVSARNNLQLRSSQSVNKTFGVEQGAARLTCSLQCDLKDFAQKCTDAAKIAGF  60

Query  253  ALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKY  432
            ALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPT++GGV++FAFKPGKY
Sbjct  61   ALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTVDGGVDSFAFKPGKY  120

Query  433  SAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            +AKK CLEPTSFTVKAE V+KN+ PEFQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  NAKKLCLEPTSFTVKAEGVNKNSAPEFQKTKLMTRLTYTLDEIEGPFE  168



>gb|AFW69213.1| oxygen-evolving enhancer protein 1 [Zea mays]
Length=373

 Score =   258 bits (658),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/183 (71%), Positives = 147/183 (80%), Gaps = 7/183 (4%)
 Frame = +1

Query  49   TMAASLQT--AATLMQPTKVG-----VTPRIGRSYQTVGKALGVDPSPARITCSLQSQIK  207
            TMAASLQ   AATLMQP K+G      +    R    + +A GVD   ARITCSLQS ++
Sbjct  38   TMAASLQVQAAATLMQPAKIGGRAPSASLPSSRPSSQLARAFGVDAGAARITCSLQSDVR  97

Query  208  ELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPT  387
            ++A    DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTY+EVKG+GTANQCPT
Sbjct  98   DVASKCVDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYLEVKGTGTANQCPT  157

Query  388  IEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEG  567
            I+GGV++F FKPGKY  KK CLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIEG
Sbjct  158  IDGGVDSFPFKPGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIEG  217

Query  568  PFE  576
            P E
Sbjct  218  PLE  220



>ref|NP_001130585.1| uncharacterized protein LOC100191684 [Zea mays]
 gb|ACF78862.1| unknown [Zea mays]
 gb|ACF88206.1| unknown [Zea mays]
 gb|ACG31799.1| oxygen-evolving enhancer protein 1 [Zea mays]
 gb|ACN29302.1| unknown [Zea mays]
 gb|ACN33484.1| unknown [Zea mays]
Length=335

 Score =   256 bits (653),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 146/182 (80%), Gaps = 7/182 (4%)
 Frame = +1

Query  52   MAASLQT--AATLMQPTKVG-----VTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKE  210
            MAASLQ   AATLMQP K+G      +    R    + +A GVD   ARITCSLQS +++
Sbjct  1    MAASLQVQAAATLMQPAKIGGRAPSASLPSSRPSSQLARAFGVDAGAARITCSLQSDVRD  60

Query  211  LAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTI  390
            +A    DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTY+EVKG+GTANQCPTI
Sbjct  61   VASKCVDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYLEVKGTGTANQCPTI  120

Query  391  EGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGP  570
            +GGV++F FKPGKY  KK CLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIEGP
Sbjct  121  DGGVDSFPFKPGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIEGP  180

Query  571  FE  576
             E
Sbjct  181  LE  182



>ref|XP_009387680.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like, 
partial [Musa acuminata subsp. malaccensis]
Length=170

 Score =   250 bits (638),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 142/170 (84%), Gaps = 6/170 (4%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG-----RSYQTVGKALGVDPSP-ARITCSLQSQIKEL  213
            MAASLQ AATLMQP KVG T R       RS   + KA G++P+  AR+TCSLQS ++E+
Sbjct  1    MAASLQAAATLMQPAKVGATSRTAAGVQLRSSSHLTKAFGLEPAASARLTCSLQSDVREM  60

Query  214  AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  393
            A   +D  KLAGFALA SAL+V+GA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+
Sbjct  61   AQKCADGVKLAGFALAASALVVTGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTID  120

Query  394  GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLT  543
            GGVE+FAFKPGKY+ KK CLEPTSFTVKAE+VSKNAPPEFQ TKLMTRLT
Sbjct  121  GGVESFAFKPGKYNTKKLCLEPTSFTVKAEAVSKNAPPEFQKTKLMTRLT  170



>gb|EMS63035.1| Oxygen-evolving enhancer protein 1, chloroplastic [Triticum urartu]
 gb|EMT33794.1| Oxygen-evolving enhancer protein 1, chloroplastic [Aegilops tauschii]
Length=328

 Score =   254 bits (650),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 143/175 (82%), Gaps = 2/175 (1%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  231
            MAASLQ AATLM P K+G      R    V +A GVD + ARITCSLQS I+E+A   +D
Sbjct  1    MAASLQAAATLM-PAKIGGRASSARPSSHVARAFGVD-AGARITCSLQSDIREVASKCAD  58

Query  232  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  411
            AAK+AGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++F
Sbjct  59   AAKMAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSF  118

Query  412  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             FK GKY  KKFCLEPTSFTVKAE + KN PP FQ TKLMTRLTYTLDE+EGP E
Sbjct  119  PFKAGKYEMKKFCLEPTSFTVKAEGIQKNEPPAFQKTKLMTRLTYTLDEMEGPLE  173



>ref|XP_002866983.1| hypothetical protein ARALYDRAFT_328078 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43242.1| hypothetical protein ARALYDRAFT_328078 [Arabidopsis lyrata subsp. 
lyrata]
Length=328

 Score =   254 bits (649),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 141/176 (80%), Gaps = 1/176 (1%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIGRSYQT-VGKALGVDPSPARITCSLQSQIKELAHNFS  228
            MAA LQ A T +QP +V   PR     +  V K  GV+P  +R++CSL   +K L   F 
Sbjct  1    MAAFLQAAVTTVQPARVDPPPRAAAKLRMCVSKYFGVEPVASRVSCSLHDDLKNLTLKFV  60

Query  229  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  408
            D  K+AGF+LA SAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG+E+
Sbjct  61   DTTKIAGFSLAASALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGLES  120

Query  409  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            FA KPGKY AKKFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  FAIKPGKYYAKKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPFE  176



>dbj|BAJ89638.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85472.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=328

 Score =   254 bits (648),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 143/175 (82%), Gaps = 2/175 (1%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  231
            MAASLQ AATLM P K+G      R    V +A GVD + ARITCSLQS I+E+A   +D
Sbjct  1    MAASLQAAATLM-PAKIGGRASSVRPSSHVARAFGVDAA-ARITCSLQSDIREVASKCAD  58

Query  232  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  411
            AAK+AGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++F
Sbjct  59   AAKMAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSF  118

Query  412  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             FK GKY  KKFCLEPTSFTVKAE + KN PP FQ TKLMTRLTYTLDE+EGP E
Sbjct  119  PFKAGKYEMKKFCLEPTSFTVKAEGIQKNEPPAFQKTKLMTRLTYTLDEMEGPLE  173



>sp|P27665.1|PSBO_WHEAT RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Triticum aestivum]
 pir||S16260 photosystem II oxygen-evolving complex protein 1 - common wheat 
x Sanduri wheat
 emb|CAA40670.1| 33kDa oxygen evolving protein of photosystem II [Triticum aestivum]
Length=325

 Score =   253 bits (647),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 142/175 (81%), Gaps = 2/175 (1%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  231
            MAASLQ AAT+M P K+G      R    V +A GVD + ARITCSLQS I+E+A   +D
Sbjct  1    MAASLQAAATVM-PAKIGGRASSARPSSHVARAFGVD-AGARITCSLQSDIREVASKCAD  58

Query  232  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  411
            AAK+AGFALATSALLVSGA AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++F
Sbjct  59   AAKMAGFALATSALLVSGATAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSF  118

Query  412  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             FK GKY  KKFCLEPTSFTVKAE + KN PP FQ TKLMTRLTYTLDE+EGP E
Sbjct  119  PFKAGKYEMKKFCLEPTSFTVKAEGIQKNEPPRFQKTKLMTRLTYTLDEMEGPLE  173



>sp|O49079.1|PSBO_FRIAG RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Fritillaria agrestis]
 gb|AAC04808.1| photosystem II oxygen evolving complex protein 1 precursor [Fritillaria 
agrestis]
Length=329

 Score =   253 bits (647),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 147/177 (83%), Gaps = 3/177 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPA-RITCSLQSQIKELAHNF  225
            MA+SLQ AATL+ P KVG   R   RS   + KA G D S A R+TCS+ S ++++A   
Sbjct  1    MASSLQAAATLI-PAKVGAPARTHLRSNSHLSKAFGFDNSTAGRLTCSINSDLRDIAQKC  59

Query  226  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  405
            +DAAKLAGFALATSAL++SGA+AEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG E
Sbjct  60   TDAAKLAGFALATSALVISGASAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGTE  119

Query  406  NFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            +F +K GKY+ KK CLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIEGPFE
Sbjct  120  SFGYKTGKYTLKKLCLEPTSFTVKAEGINKNAPPEFQKTKLMTRLTYTLDEIEGPFE  176



>gb|ABQ52657.1| chloroplast oxygen-evolving enhancer protein 1 [Leymus chinensis]
Length=328

 Score =   253 bits (645),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 143/175 (82%), Gaps = 2/175 (1%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  231
            MAASLQ AATLM P K+G      R    V +A GVD + ARITCSLQS I+E+A   ++
Sbjct  1    MAASLQAAATLM-PAKIGGRASSARPSSHVARAFGVD-AGARITCSLQSDIREVASKCAE  58

Query  232  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  411
            AAK+AGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++F
Sbjct  59   AAKMAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSF  118

Query  412  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             FK GKY  KKFCLEPTSFTVKAE + KN PP FQ TKLMTRLTYTLDE+EGP E
Sbjct  119  PFKAGKYEMKKFCLEPTSFTVKAEGIQKNEPPAFQKTKLMTRLTYTLDEMEGPLE  173



>ref|XP_010557854.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Tarenaya hassleriana]
Length=317

 Score =   251 bits (640),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 139/175 (79%), Gaps = 11/175 (6%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  231
            MAASLQ AAT +  +K+   P  G   ++           +RITCS+QS +K+ A   SD
Sbjct  1    MAASLQAAATFLHQSKISAAPSRGGHLRS-----------SRITCSIQSDLKDFAGKCSD  49

Query  232  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  411
             AK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG E F
Sbjct  50   TAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGSETF  109

Query  412  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             FK G+YS KKFC EPTSFTVKAE +SKNAPPEFQNTKLMTRLTYTLDEIEGPF+
Sbjct  110  EFKAGQYSGKKFCFEPTSFTVKAEGISKNAPPEFQNTKLMTRLTYTLDEIEGPFD  164



>gb|AFH40666.1| chloroplast oxygen-evolving enhancer protein 1, partial [Saccharum 
hybrid cultivar]
Length=332

 Score =   251 bits (640),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 142/184 (77%), Gaps = 14/184 (8%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIGRS---------YQTVGKALGVDPSPARITCSLQSQI  204
            MAASLQ AATLMQP K+G     GR+            + +A GVD   ARITCSLQS  
Sbjct  1    MAASLQAAATLMQPAKIG-----GRAPSASLPSRSSSHLARAFGVDAGAARITCSLQSDF  55

Query  205  KELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCP  384
            + +A    DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTY+EVKG+GTANQCP
Sbjct  56   RGVASKCVDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYLEVKGTGTANQCP  115

Query  385  TIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIE  564
            T +GGVE F FK GKY  KK CLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIE
Sbjct  116  TTDGGVEAFPFKAGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIE  175

Query  565  GPFE  576
            GP E
Sbjct  176  GPLE  179



>ref|XP_008647514.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACG31595.1| oxygen-evolving enhancer protein 1 [Zea mays]
 gb|ACN32168.1| unknown [Zea mays]
 gb|AFW75930.1| oxygen-evolving enhancer protein 1 [Zea mays]
Length=329

 Score =   250 bits (639),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 143/185 (77%), Gaps = 19/185 (10%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIGR----------SYQTVGKALGVDPSPARITCSLQSQ  201
            MAASLQ AATLMQP K+G     GR          S Q   +A GVD   ARITCSLQ  
Sbjct  1    MAASLQAAATLMQPAKIG-----GRAPFASLPSRPSSQLACRAFGVDAGAARITCSLQ--  53

Query  202  IKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQC  381
              ++A    DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQC
Sbjct  54   --DVASRCVDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYMEVKGTGTANQC  111

Query  382  PTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEI  561
            PTI+GGVE+F FK GKY  KK CLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEI
Sbjct  112  PTIDGGVESFPFKAGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEI  171

Query  562  EGPFE  576
            EGP E
Sbjct  172  EGPLE  176



>ref|XP_010432121.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=324

 Score =   250 bits (638),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 148/180 (82%), Gaps = 6/180 (3%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPARITCSLQSQIKELA  216
            MAA LQ A T +Q T++ VTP     ++  S Q+V K  GV+   +R++CSL + +K L+
Sbjct  1    MAAFLQAAVTPVQSTRL-VTPTSSAAKLRTSSQSVSKCFGVNTVASRVSCSLHNDLKNLS  59

Query  217  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  396
             +  DA K+AGFALATSALLVSGANAEGVPKRLT+ EIQSKTYMEVKG+GTANQCPTIEG
Sbjct  60   QSCVDATKIAGFALATSALLVSGANAEGVPKRLTYKEIQSKTYMEVKGTGTANQCPTIEG  119

Query  397  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            GV++F+ KPGKY A+KFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  120  GVDSFSIKPGKYYARKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPFE  179



>gb|AFK43771.1| unknown [Lotus japonicus]
Length=332

 Score =   250 bits (638),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 148/182 (81%), Gaps = 11/182 (6%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIGRSY-------QTVGKALGVDPSPARITCSLQSQIKE  210
            MA SLQ AATLMQPTKV        S        Q++ KA G++ + A++TC+LQ    +
Sbjct  1    MATSLQAAATLMQPTKVAAITSTRSSSTLQLKPTQSISKAFGLESTGAKLTCNLQ----D  56

Query  211  LAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTI  390
             A+  ++ AK+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI
Sbjct  57   FANKCAETAKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTI  116

Query  391  EGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGP  570
            EGGV++FAFK GKYSAKK CLEPTSFTVKAE V+KN+P +FQNTKLMTRLTYTLDEIEGP
Sbjct  117  EGGVDSFAFKAGKYSAKKICLEPTSFTVKAEGVTKNSPLDFQNTKLMTRLTYTLDEIEGP  176

Query  571  FE  576
            FE
Sbjct  177  FE  178



>ref|XP_010446730.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=332

 Score =   250 bits (638),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 149/181 (82%), Gaps = 7/181 (4%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPA-RITCSLQSQIKEL  213
            MAA LQ A T MQ T+V VTP     ++  S Q+V K  G +P+ A R++CSL + +K L
Sbjct  1    MAAFLQAAVTPMQSTRV-VTPTSAAAKLRTSSQSVSKCFGFEPAVASRVSCSLHNDLKNL  59

Query  214  AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  393
              +  DA K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKG+GTANQCPTIE
Sbjct  60   IQSCVDATKIAGFALATSALIVSGASAEGVPKRLTYEEIQSKTYMEVKGTGTANQCPTIE  119

Query  394  GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPF  573
            GGV++FA KPGKY AKKFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLDEIEGPF
Sbjct  120  GGVDSFAIKPGKYYAKKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPF  179

Query  574  E  576
            E
Sbjct  180  E  180



>ref|XP_010432119.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=331

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 148/180 (82%), Gaps = 6/180 (3%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPARITCSLQSQIKELA  216
            MAA LQ A T +Q T++ VTP     ++  S Q+V K  GV+   +R++CSL + +K L+
Sbjct  1    MAAFLQAAVTPVQSTRL-VTPTSSAAKLRTSSQSVSKCFGVNTVASRVSCSLHNDLKNLS  59

Query  217  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  396
             +  DA K+AGFALATSALLVSGANAEGVPKRLT+ EIQSKTYMEVKG+GTANQCPTIEG
Sbjct  60   QSCVDATKIAGFALATSALLVSGANAEGVPKRLTYKEIQSKTYMEVKGTGTANQCPTIEG  119

Query  397  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            GV++F+ KPGKY A+KFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  120  GVDSFSIKPGKYYARKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPFE  179



>ref|XP_010446731.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=329

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 149/181 (82%), Gaps = 7/181 (4%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPA-RITCSLQSQIKEL  213
            MAA LQ A T MQ T+V VTP     ++  S Q+V K  G +P+ A R++CSL + +K L
Sbjct  1    MAAFLQAAVTPMQSTRV-VTPTSAAAKLRTSSQSVSKCFGFEPAVASRVSCSLHNDLKNL  59

Query  214  AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  393
              +  DA K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKG+GTANQCPTIE
Sbjct  60   IQSCVDATKIAGFALATSALIVSGASAEGVPKRLTYEEIQSKTYMEVKGTGTANQCPTIE  119

Query  394  GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPF  573
            GGV++FA KPGKY AKKFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLDEIEGPF
Sbjct  120  GGVDSFAIKPGKYYAKKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPF  179

Query  574  E  576
            E
Sbjct  180  E  180



>dbj|BAG70021.1| 33 kDa precursor protein of the oxygen-evolving complex [Salicornia 
europaea]
Length=330

 Score =   248 bits (633),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 143/176 (81%), Gaps = 1/176 (1%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  228
            MA SLQ + T +QPTKV     +  RS   V KA GVDP+  R++ SLQS +K+LA    
Sbjct  1    MATSLQASTTFLQPTKVASRNSLQLRSSPNVCKAFGVDPTAGRVSLSLQSDLKDLASKCV  60

Query  229  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  408
            DA KLAG ALATSAL+ SGA+A+G  KRLT+DEIQSKTY+EVKG+GTANQCPTIEGG+E+
Sbjct  61   DATKLAGLALATSALIASGASADGGTKRLTYDEIQSKTYLEVKGTGTANQCPTIEGGLES  120

Query  409  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            F FK GKY+AKKFCLEPT FTVKAE +SKNAPP+FQ+TKLMTRLTYTLDE+EGPFE
Sbjct  121  FGFKAGKYTAKKFCLEPTKFTVKAEGISKNAPPDFQDTKLMTRLTYTLDEMEGPFE  176



>sp|P85194.1|PSBO_HELAN RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Helianthus annuus]
Length=324

 Score =   248 bits (632),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 146/176 (83%), Gaps = 6/176 (3%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  228
            MAASLQ AAT M PT      R+  +S  ++ KA G++ + ++++CSLQ+ +K+ A   +
Sbjct  1    MAASLQAAATFMTPTS-----RVQLKSSPSICKAFGIESTGSKVSCSLQADLKDFAQKCT  55

Query  229  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  408
            DAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV  
Sbjct  56   DAAKIAGFALATSALVVSGASAEGSPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVNG  115

Query  409  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            FA KPGKY+A+KFCLEPTSFTVKAE +SKN+ PEFQ TKLMTRLTYTLDEIEGP E
Sbjct  116  FAVKPGKYNAQKFCLEPTSFTVKAEGISKNSAPEFQKTKLMTRLTYTLDEIEGPLE  171



>emb|CAA29062.1| unnamed protein product [Spinacia oleracea]
 prf||1404364A protein 33kD
Length=331

 Score =   245 bits (625),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 145/178 (81%), Gaps = 4/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDP--SPARITCSLQSQIKELAHN  222
            MAASLQ + T +QPTKV     +  RS Q V KA GV+   S  R++ SLQS +KELA+ 
Sbjct  1    MAASLQASTTFLQPTKVASRNTLQLRSTQNVCKAFGVESASSGGRLSLSLQSDLKELANK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
              DA KLAG ALATSAL+ SGANAEG  KRLT+DEIQSKTY+EVKG+GTANQCPT+EGGV
Sbjct  61   CVDATKLAGLALATSALIASGANAEG-GKRLTYDEIQSKTYLEVKGTGTANQCPTVEGGV  119

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            ++FAFKPGKY+AKKFCLEPT F VKAE +SKN+ P+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  120  DSFAFKPGKYTAKKFCLEPTKFAVKAEGISKNSGPDFQNTKLMTRLTYTLDEIEGPFE  177



>sp|P12359.1|PSBO_SPIOL RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Spinacia oleracea]
Length=332

 Score =   245 bits (625),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 145/178 (81%), Gaps = 4/178 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDP--SPARITCSLQSQIKELAHN  222
            MAASLQ + T +QPTKV     +  RS Q V KA GV+   S  R++ SLQS +KELA+ 
Sbjct  1    MAASLQASTTFLQPTKVASRNTLQLRSTQNVCKAFGVESASSGGRLSLSLQSDLKELANK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
              DA KLAG ALATSAL+ SGANAEG  KRLT+DEIQSKTY+EVKG+GTANQCPT+EGGV
Sbjct  61   CVDATKLAGLALATSALIASGANAEG-GKRLTYDEIQSKTYLEVKGTGTANQCPTVEGGV  119

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            ++FAFKPGKY+AKKFCLEPT F VKAE +SKN+ P+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  120  DSFAFKPGKYTAKKFCLEPTKFAVKAEGISKNSGPDFQNTKLMTRLTYTLDEIEGPFE  177



>ref|XP_003557544.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Brachypodium distachyon]
Length=330

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/183 (71%), Positives = 143/183 (78%), Gaps = 16/183 (9%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPAR--------ITCSLQSQIK  207
            MAASLQ AATLMQP K+G   R   S   V     + PS AR        I+CSL S ++
Sbjct  1    MAASLQAAATLMQPAKMG---RSASSSSAV-----LLPSSARPSSHAARTISCSLTSDLR  52

Query  208  ELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPT  387
            E+A   +DAAKLAGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPT
Sbjct  53   EVATKCADAAKLAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPT  112

Query  388  IEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEG  567
            I+GGV+ F FK GKY  KKFCLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIEG
Sbjct  113  IDGGVDAFPFKAGKYEMKKFCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIEG  172

Query  568  PFE  576
            P E
Sbjct  173  PLE  175



>gb|KJB43585.1| hypothetical protein B456_007G208000 [Gossypium raimondii]
Length=316

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 138/178 (78%), Gaps = 19/178 (11%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MA SLQ AATLMQP KV    R     RS Q+V KA G++P  AR+TCSLQ+ +K+LA  
Sbjct  1    MAVSLQAAATLMQPIKVAAPSRTNVLLRSSQSVSKAFGLEPVGARLTCSLQTDLKDLAQK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
              DA KLAGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CVDATKLAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            ++FAFKPGKY AKKFCLEPTSFTV                KLMTRLTYTLDEIEGPFE
Sbjct  121  DSFAFKPGKYYAKKFCLEPTSFTV----------------KLMTRLTYTLDEIEGPFE  162



>ref|XP_006411950.1| hypothetical protein EUTSA_v10025711mg [Eutrema salsugineum]
 gb|ESQ53403.1| hypothetical protein EUTSA_v10025711mg [Eutrema salsugineum]
Length=325

 Score =   239 bits (611),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 139/176 (79%), Gaps = 3/176 (2%)
 Frame = +1

Query  52   MAASLQTAATLMQ-PTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  228
            M ASLQ A T +  P++     R    +Q V K+ GV+   +R+ CSL   +K LA    
Sbjct  1    MVASLQAAVTTVALPSRAAANLR--PPFQCVSKSFGVEQVTSRVYCSLHDDLKSLALKCV  58

Query  229  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  408
            +  K+AG ALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG+++
Sbjct  59   ETTKIAGLALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGLDS  118

Query  409  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            FA KPGKY AKKFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  119  FAIKPGKYYAKKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPFE  174



>emb|CAN61828.1| hypothetical protein VITISV_027630 [Vitis vinifera]
Length=312

 Score =   238 bits (606),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 135/178 (76%), Gaps = 23/178 (13%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MAASLQ AATLMQPTKVGV  R     RS Q+V KA G++P+ AR TCSLQ+ +K L   
Sbjct  1    MAASLQAAATLMQPTKVGVPTRTSLQLRSSQSVCKAFGLEPAGARFTCSLQADLKGLGSQ  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
                                GA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   --------------------GASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  100

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            ++FAFK GKY  KKFCLEPTSFTVKAE VSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  101  DSFAFKSGKYQLKKFCLEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  158



>gb|ABS29557.1| chloroplast photosynthetic water oxidation complex 33kDa subunit 
precursor [Morus nigra]
Length=265

 Score =   234 bits (598),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  ARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYME  351
            AR+TCSLQS  K+LA    DA K+AG ALATSAL+VSGA+AEGVPKRLT+DEIQSKTY+E
Sbjct  8    ARLTCSLQSDFKDLAQKCVDATKIAGIALATSALVVSGASAEGVPKRLTYDEIQSKTYLE  67

Query  352  VKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  531
            VKG+GTANQCPTIEGGV++FAFK GKY+ KK CLEPTSFTVKAESV+KN+PPEFQNTKLM
Sbjct  68   VKGTGTANQCPTIEGGVDSFAFKAGKYNVKKLCLEPTSFTVKAESVNKNSPPEFQNTKLM  127

Query  532  TRLTYTLDEIEGPFE  576
            TRLTYTLDEIEGPFE
Sbjct  128  TRLTYTLDEIEGPFE  142



>ref|XP_009138459.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Brassica rapa]
Length=314

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 126/151 (83%), Gaps = 2/151 (1%)
 Frame = +1

Query  124  RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGV  303
            RS Q+V K+    P   R++CSL   +K L  N  +A K+AGFALATSAL+VSGA+AEGV
Sbjct  14   RSSQSVSKSF--KPVTRRVSCSLHDDLKNLTLNCVEATKIAGFALATSALVVSGASAEGV  71

Query  304  PKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAE  483
            PKRLT+ EIQSKTYMEVKG+GTANQCPTIEGG+E+FA KPGKY AKK CLEPTSFTVKAE
Sbjct  72   PKRLTYKEIQSKTYMEVKGTGTANQCPTIEGGLESFAIKPGKYYAKKVCLEPTSFTVKAE  131

Query  484  SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             VS+NA P FQNTKLMTRLTYTLDEIEGPFE
Sbjct  132  DVSRNATPVFQNTKLMTRLTYTLDEIEGPFE  162



>emb|CDX72613.1| BnaC07g46350D [Brassica napus]
Length=319

 Score =   225 bits (573),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 135/176 (77%), Gaps = 14/176 (8%)
 Frame = +1

Query  49   TMAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  228
            T+A    TAA L  P+            Q+V K+    P   R++CSL   +K L+ N  
Sbjct  6    TVALQSLTAAKLHPPS------------QSVSKSF--KPVTRRVSCSLHDDLKNLSLNCV  51

Query  229  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  408
            +A K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKG+GTANQCPTIEGG+E+
Sbjct  52   EATKIAGFALATSALVVSGASAEGVPKRLTYEEIQSKTYMEVKGTGTANQCPTIEGGLES  111

Query  409  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            FA KPGKY AKK CLEPTSFTVKAE VSKNA P FQNTKLMTRLTYTLDEIEGPF+
Sbjct  112  FAIKPGKYYAKKVCLEPTSFTVKAEGVSKNAKPVFQNTKLMTRLTYTLDEIEGPFD  167



>gb|AEH95324.1| 33 kDa manganese stabilizing chloroplast protein [Allium cepa]
Length=238

 Score =   219 bits (558),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +1

Query  226  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  405
            +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV+
Sbjct  2    TDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVD  61

Query  406  NFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            +FAFKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYT+DEIEGPFE
Sbjct  62   SFAFKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTMDEIEGPFE  118



>emb|CDY42709.1| BnaA03g53620D [Brassica napus]
Length=319

 Score =   219 bits (557),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 123/148 (83%), Gaps = 2/148 (1%)
 Frame = +1

Query  133  QTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKR  312
            Q+V K+    P   R++CSL   +K L  N  +A K+AGFALATSAL+VSGA+AEGVPKR
Sbjct  22   QSVSKSF--KPVTRRVSCSLHDDLKNLTLNCVEATKIAGFALATSALVVSGASAEGVPKR  79

Query  313  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  492
            LT+ +IQSKTYMEVKG+GTANQCPTIEGG+E+FA KPGKY AKK CLEPTSFTVKAE VS
Sbjct  80   LTYKDIQSKTYMEVKGTGTANQCPTIEGGLESFAIKPGKYYAKKVCLEPTSFTVKAEGVS  139

Query  493  KNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            +NA P F NTKLMTRLTYTLDEIEGPFE
Sbjct  140  RNATPFFLNTKLMTRLTYTLDEIEGPFE  167



>gb|KJB43587.1| hypothetical protein B456_007G208000 [Gossypium raimondii]
Length=262

 Score =   216 bits (549),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 126/157 (80%), Gaps = 4/157 (3%)
 Frame = +1

Query  52   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  222
            MA SLQ AATLMQP KV    R     RS Q+V KA G++P  AR+TCSLQ+ +K+LA  
Sbjct  1    MAVSLQAAATLMQPIKVAAPSRTNVLLRSSQSVSKAFGLEPVGARLTCSLQTDLKDLAQK  60

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
              DA KLAGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CVDATKLAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEF  513
            ++FAFKPGKY AKKFCLEPTSFTVK + V+   P  F
Sbjct  121  DSFAFKPGKYYAKKFCLEPTSFTVK-QLVASGKPDSF  156



>gb|AJG36442.1| oxygen-evolving enhancer protein 1 [Pinus sylvestris]
Length=340

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 133/178 (75%), Gaps = 4/178 (2%)
 Frame = +1

Query  55   AASLQTAATLMQPTKVGVTPRIGRSYQTVGK---ALGVDPS-PARITCSLQSQIKELAHN  222
             ++LQ AATL+QPTK+ VT    R   +      A G +P+  AR++CSLQ  +KE A  
Sbjct  8    GSALQAAATLLQPTKLSVTRSSSRLSSSSSHVSRAFGFEPATSARVSCSLQDDVKEFAEK  67

Query  223  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  402
             + A K+A   LA SAL+ SGA AEG PKRLT+DEIQS+TY+EVKGSGTANQCPTI+GGV
Sbjct  68   CAGATKIAAVTLAASALVASGAGAEGPPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGGV  127

Query  403  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            E F FK GKY  KK C+EPTSFTVKAES +KN PP+FQ T+LMTRLTYTLDEIEGP E
Sbjct  128  EGFPFKAGKYEMKKLCMEPTSFTVKAESTNKNLPPDFQKTRLMTRLTYTLDEIEGPLE  185



>gb|ABK23365.1| unknown [Picea sitchensis]
 gb|ABK26094.1| unknown [Picea sitchensis]
 gb|ABR16830.1| unknown [Picea sitchensis]
 gb|ACN39793.1| unknown [Picea sitchensis]
Length=341

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 138/179 (77%), Gaps = 5/179 (3%)
 Frame = +1

Query  55   AASLQTAATLMQPTKVGVT----PRIGRSYQTVGKALGVDP-SPARITCSLQSQIKELAH  219
             ++LQ AATL+QPTK+ VT     R+  S   + +A G +P + AR++CSLQ  +KE A 
Sbjct  8    GSALQAAATLLQPTKLSVTRTSSSRLSSSSSNLSRAFGFEPATSARVSCSLQDDVKEFAE  67

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              + A K+A  ALA S+L+ SGA AEGVPKRLT+DEIQS+TY+EVKGSGTANQCPTI+GG
Sbjct  68   KCAGATKIAALALAASSLVASGAGAEGVPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGG  127

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            VE F FKPGKY  KK C+EPTSFTVKAE  +KN PP+FQ T+LMTRLTYTLDEIEGP E
Sbjct  128  VEAFPFKPGKYEMKKLCMEPTSFTVKAEGTNKNQPPDFQKTRLMTRLTYTLDEIEGPLE  186



>gb|ACN40581.1| unknown [Picea sitchensis]
Length=341

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 138/179 (77%), Gaps = 5/179 (3%)
 Frame = +1

Query  55   AASLQTAATLMQPTKVGVT----PRIGRSYQTVGKALGVDP-SPARITCSLQSQIKELAH  219
             ++LQ AATL+QPTK+ VT     R+  S   + +A G +P + AR++CSLQ  +KE A 
Sbjct  8    GSALQAAATLLQPTKLSVTRTSSSRLSSSSSNLSRAFGFEPATSARVSCSLQDDVKEFAE  67

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              + A K+A  ALA S+L+ SGA AEGVPKRLT+DEIQS+TY+EVKGSGTANQCPTI+GG
Sbjct  68   KCAGATKIAALALAASSLVASGAGAEGVPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGG  127

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            VE F FKPGKY  KK C+EPTSFTVKAE  +KN PP+FQ T+LMTRLTYTLDEIEGP E
Sbjct  128  VEAFPFKPGKYEMKKLCMEPTSFTVKAEGTNKNQPPDFQKTRLMTRLTYTLDEIEGPLE  186



>gb|ABR17376.1| unknown [Picea sitchensis]
Length=327

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 138/179 (77%), Gaps = 5/179 (3%)
 Frame = +1

Query  55   AASLQTAATLMQPTKVGVT----PRIGRSYQTVGKALGVDPS-PARITCSLQSQIKELAH  219
             ++LQ AATL+QPTK+ VT     R+  S   + +A G +P+  AR++CSLQ  +KE A 
Sbjct  8    GSALQAAATLLQPTKLSVTRTSSSRLSSSSSNLSRAFGFEPATSARVSCSLQDDVKEFAE  67

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              + A K+A  ALA S+L+ SGA AEGVPKRLT+DEIQS+TY+EVKGSGTANQCPTI+GG
Sbjct  68   KCAGATKIAALALAASSLVASGAGAEGVPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGG  127

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            VE F FKPGKY  KK C+EPTSFTVKAE  +KN PP+FQ T+LMTRLTYTLDEIEGP E
Sbjct  128  VEAFPFKPGKYEMKKLCMEPTSFTVKAEGTNKNQPPDFQKTRLMTRLTYTLDEIEGPLE  186



>gb|ABK24541.1| unknown [Picea sitchensis]
 gb|ABK26154.1| unknown [Picea sitchensis]
 gb|ACN39762.1| unknown [Picea sitchensis]
 gb|ACN40363.1| unknown [Picea sitchensis]
 gb|ACN40484.1| unknown [Picea sitchensis]
Length=341

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 138/179 (77%), Gaps = 5/179 (3%)
 Frame = +1

Query  55   AASLQTAATLMQPTKVGVT----PRIGRSYQTVGKALGVDP-SPARITCSLQSQIKELAH  219
             ++LQ AATL+QPTK+ VT     R+  S   + +A G +P + AR++CSLQ  +KE A 
Sbjct  8    GSALQAAATLLQPTKLSVTRTSSSRLSSSSSNLSRAFGFEPATSARVSCSLQDDVKEFAE  67

Query  220  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  399
              + A K+A  ALA S+L+ SGA AEGVPKRLT+DEIQS+TY+EVKGSGTANQCPTI+GG
Sbjct  68   KCAGATKIAALALAASSLVASGAGAEGVPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGG  127

Query  400  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            VE F FKPGKY  KK C+EPTSFTVKAE  +KN PP+FQ T+LMTRLTYTLDEIEGP E
Sbjct  128  VEAFPFKPGKYEMKKLCMEPTSFTVKAEGTNKNQPPDFQKTRLMTRLTYTLDEIEGPLE  186



>gb|KDO79410.1| hypothetical protein CISIN_1g019870mg [Citrus sinensis]
Length=271

 Score =   194 bits (494),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 98/99 (99%), Gaps = 0/99 (0%)
 Frame = +1

Query  280  SGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEP  459
            SGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV++FAFKPGKY AKKFCLEP
Sbjct  19   SGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEP  78

Query  460  TSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            TSFTVKAESV+KNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  79   TSFTVKAESVNKNAPPDFQNTKLMTRLTYTLDEIEGPFE  117



>gb|KCW55052.1| hypothetical protein EUGRSUZ_I01025 [Eucalyptus grandis]
Length=247

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  274  LVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCL  453
            L  GA AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG+++FAFKPGKY+AKK CL
Sbjct  9    LSQGAGAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGLDSFAFKPGKYNAKKICL  68

Query  454  EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  69   EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  109



>gb|AIS72812.1| oxygen evolving activity, partial [Rhizophora apiculata]
Length=147

 Score =   186 bits (473),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +1

Query  286  ANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTS  465
            A AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV++FAFKPGKY+ KK CLEPTS
Sbjct  1    AGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVDSFAFKPGKYNVKKLCLEPTS  60

Query  466  FTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            FTVKAE V+KNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  61   FTVKAEGVNKNAPPEFQNTKLMTRLTYTLDEIEGPFE  97



>ref|XP_007155995.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
 gb|ESW27989.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
Length=264

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 101/109 (93%), Gaps = 2/109 (2%)
 Frame = +1

Query  256  LATSALLVS--GANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGK  429
            + T +L+V   GA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++FAFKPGK
Sbjct  2    VVTYSLIVKFKGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSFAFKPGK  61

Query  430  YSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            Y+AKK CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLDEIEGPFE
Sbjct  62   YNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFE  110



>gb|ACE98011.1| putative protein, partial [Populus tremula]
 gb|ACE98012.1| putative protein, partial [Populus tremula]
 gb|ACE98013.1| putative protein, partial [Populus tremula]
 gb|ACE98014.1| putative protein, partial [Populus tremula]
 gb|ACE98015.1| putative protein, partial [Populus tremula]
 gb|ACE98016.1| putative protein, partial [Populus tremula]
 gb|ACE98017.1| putative protein, partial [Populus tremula]
 gb|ACE98018.1| putative protein, partial [Populus tremula]
 gb|ACE98019.1| putative protein, partial [Populus tremula]
 gb|ACE98020.1| putative protein, partial [Populus tremula]
 gb|ACE98021.1| putative protein, partial [Populus tremula]
 gb|ACE98022.1| putative protein, partial [Populus tremula]
 gb|ACE98023.1| putative protein, partial [Populus tremula]
 gb|ACE98024.1| putative protein, partial [Populus tremula]
 gb|ACE98025.1| putative protein, partial [Populus tremula]
 gb|ACE98026.1| putative protein, partial [Populus tremula]
 gb|ACE98027.1| putative protein, partial [Populus tremula]
 gb|ACE98028.1| putative protein, partial [Populus tremula]
 gb|ACE98029.1| putative protein, partial [Populus tremula]
 gb|ACE98030.1| putative protein, partial [Populus tremula]
 gb|ACE98031.1| putative protein, partial [Populus tremula]
 gb|ACE98032.1| putative protein, partial [Populus tremula]
 gb|ACE98033.1| putative protein, partial [Populus tremula]
 gb|ACE98034.1| putative protein, partial [Populus tremula]
 gb|ACE98035.1| putative protein, partial [Populus tremula]
 gb|ACE98036.1| putative protein, partial [Populus tremula]
 gb|ACE98037.1| putative protein, partial [Populus tremula]
 gb|ACE98038.1| putative protein, partial [Populus tremula]
 gb|ACE98039.1| putative protein, partial [Populus tremula]
 gb|ACE98040.1| putative protein, partial [Populus tremula]
 gb|ACE98041.1| putative protein, partial [Populus tremula]
 gb|ACE98042.1| putative protein, partial [Populus tremula]
 gb|ACE98043.1| putative protein, partial [Populus tremula]
 gb|ACE98044.1| putative protein, partial [Populus tremula]
 gb|ACE98045.1| putative protein, partial [Populus tremula]
 gb|ACE98046.1| putative protein, partial [Populus tremula]
Length=170

 Score =   185 bits (469),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  295  EGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTV  474
            EGVPKRLT+DEIQSKTYMEVKGSGTANQCPT++GG E+FAFK GKY+AKKFCLEPTSFTV
Sbjct  1    EGVPKRLTYDEIQSKTYMEVKGSGTANQCPTLDGGAESFAFKAGKYNAKKFCLEPTSFTV  60

Query  475  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  61   KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  94



>prf||2002393A oxygen-evolving complex protein 1
Length=247

 Score =   181 bits (460),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +1

Query  295  EGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTV  474
            EGVP+RLTFDEIQSKTYMEVKG+GTANQCPT+EGGV++FAFKPGKY+ KKFCLEPTSFTV
Sbjct  1    EGVPRRLTFDEIQSKTYMEVKGTGTANQCPTVEGGVDSFAFKPGKYNMKKFCLEPTSFTV  60

Query  475  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            KAE V+KNAPPEFQ TKLMTRLTYTLDEIEGP E
Sbjct  61   KAEGVAKNAPPEFQKTKLMTRLTYTLDEIEGPLE  94



>ref|XP_001756893.1| predicted protein [Physcomitrella patens]
 gb|EDQ78124.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   176 bits (445),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 106/146 (73%), Gaps = 4/146 (3%)
 Frame = +1

Query  136  TVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRL  315
            ++  A G+ P+ AR++C+L+  +K +  N    AK A   LA+SAL+   A AEGVP+RL
Sbjct  32   SMSNAFGLKPAVARVSCNLEENVKSIVDN----AKAAAIVLASSALVAGAAFAEGVPQRL  87

Query  316  TFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSK  495
            TFDE+ ++TYM+VKGSGTANQCP +  G + FAFK G Y+ +KFCLEPTSFTVKAES  K
Sbjct  88   TFDEVNAQTYMDVKGSGTANQCPIVAEGSDKFAFKDGNYTMRKFCLEPTSFTVKAESQFK  147

Query  496  NAPPEFQNTKLMTRLTYTLDEIEGPF  573
                 FQ TKLMTRLTYTLDEIEGP 
Sbjct  148  GGNEGFQPTKLMTRLTYTLDEIEGPL  173



>prf||1204192A photosystem II protein 33kD
Length=248

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +1

Query  307  KRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAES  486
            KRLT+DEIQSKTY+EVKG+GTANQCPT+EGGV++FAFKPGKY+AKKFCLEPT F VKAE 
Sbjct  4    KRLTYDEIQSKTYLEVKGTGTANQCPTVEGGVDSFAFKPGKYTAKKFCLEPTKFAVKAEG  63

Query  487  VSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            +SKN+ P+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  64   ISKNSGPDFQNTKLMTRLTYTLDEIEGPFE  93



>ref|XP_004243178.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Solanum lycopersicum]
Length=177

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +1

Query  172  ARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYME  351
            +R++ SL++ +K+ +H   D + +AGF+LATS+L+VSGANAE VPKRLT DEIQ+KTYME
Sbjct  64   SRLSFSLEADLKDFSHKCIDTSMIAGFSLATSSLVVSGANAERVPKRLTLDEIQTKTYME  123

Query  352  VKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEF  513
            VKG+ TANQCPTI+GGV NFAFK GKY+AKKF LE T F VK E VSKN+  EF
Sbjct  124  VKGTVTANQCPTIDGGVNNFAFKLGKYNAKKFYLETTPFIVKEEGVSKNSALEF  177



>ref|XP_001763258.1| predicted protein [Physcomitrella patens]
 gb|EDQ71788.1| predicted protein [Physcomitrella patens]
Length=327

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 105/145 (72%), Gaps = 4/145 (3%)
 Frame = +1

Query  139  VGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLT  318
            V  A G+ P+ +R++CS++  ++ +     D AK A   LA+SAL+   A AEG P+RLT
Sbjct  33   VNSAFGLKPAASRVSCSVEETVRRVV----DGAKAAALVLASSALVAGAALAEGTPQRLT  88

Query  319  FDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKN  498
            FDEI ++TYM+VKGSGTANQCP +  G + F+FK GKY+ KK C+EPTSFTVKAES  K 
Sbjct  89   FDEINAQTYMDVKGSGTANQCPIVPEGSDKFSFKDGKYTMKKLCMEPTSFTVKAESPFKG  148

Query  499  APPEFQNTKLMTRLTYTLDEIEGPF  573
                FQNTKLMTRLTYTLDEIEGP 
Sbjct  149  GSEGFQNTKLMTRLTYTLDEIEGPL  173



>ref|XP_001781590.1| predicted protein [Physcomitrella patens]
 gb|EDQ53641.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   157 bits (398),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 117/173 (68%), Gaps = 6/173 (3%)
 Frame = +1

Query  55   AASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  234
            +AS +T+  L   +K+     I  +  ++  A G+ P+ AR++C+L+  ++ +     D 
Sbjct  7    SASCKTSVALASNSKLEKVQTIKSA--SLSSAFGLTPAAARVSCNLEENVRSVV----DG  60

Query  235  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  414
            AK A   LA+SAL+   A AEGVP+RLTFDEI ++TYM+VKGSGTANQCP +  G   F+
Sbjct  61   AKAAALVLASSALMAGAALAEGVPQRLTFDEINAQTYMDVKGSGTANQCPIVAEGSGQFS  120

Query  415  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPF  573
            FK G+Y+ +K CLEPTSFTVKAES  K     +Q TKLMTRLTYTLDEIEGP 
Sbjct  121  FKDGEYTMRKLCLEPTSFTVKAESPFKGGSEGYQQTKLMTRLTYTLDEIEGPL  173



>ref|WP_039310940.1| Photosystem II manganese-stabilizing polypeptide, partial [Paenibacillus 
sp. IHB B 3415]
Length=232

 Score =   154 bits (390),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  340  TYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQN  519
            TY+EVKG+GTANQCPTIEGGV+ FAFKPGKY  KKFCLEPTSFTVKA+SVSKNAPPEFQ 
Sbjct  1    TYLEVKGTGTANQCPTIEGGVDKFAFKPGKYQMKKFCLEPTSFTVKADSVSKNAPPEFQR  60

Query  520  TKLMTRLTYTLDEIEGPFE  576
            TKLMTRLTYTLDEIEGPFE
Sbjct  61   TKLMTRLTYTLDEIEGPFE  79



>gb|ABV57472.1| chloroplast PsbO [Phyllostachys edulis]
Length=160

 Score =   151 bits (381),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +1

Query  334  SKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEF  513
            SKTYMEVKG+GTANQCPTI+GGV++F FKPGKY  KKFCLEPTSFTVKAE V+KNAPPEF
Sbjct  1    SKTYMEVKGTGTANQCPTIDGGVDSFPFKPGKYYMKKFCLEPTSFTVKAEGVAKNAPPEF  60

Query  514  QNTKLMTRLTYTLDEIEGPFE  576
            Q TKLMTRLTYTLDEIEGP E
Sbjct  61   QKTKLMTRLTYTLDEIEGPLE  81



>ref|XP_010531775.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Tarenaya hassleriana]
Length=230

 Score =   150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +1

Query  346  MEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTK  525
            MEVKG+GTANQCPTI+GG + FAFKPGKYS KKFC EPTSFTVKAE VSKNAPPEFQNTK
Sbjct  1    MEVKGTGTANQCPTIDGGSDEFAFKPGKYSGKKFCFEPTSFTVKAEGVSKNAPPEFQNTK  60

Query  526  LMTRLTYTLDEIEGPFE  576
            LMTRLTYTLDEIEGPFE
Sbjct  61   LMTRLTYTLDEIEGPFE  77



>dbj|BAF94220.1| 33kDa oxygen evolving protein of photosystem II [Closterium peracerosum-strigosum-littorale 
complex]
Length=325

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 102/146 (70%), Gaps = 2/146 (1%)
 Frame = +1

Query  139  VGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLT  318
            V +A G+  + A+++CS +  ++      +DA K A  ALA++AL+ S A A  VP RL 
Sbjct  30   VSQAFGLKTASAKVSCSAEENVRGFVQKCADAGKAAALALASTALVASSAQA-AVP-RLN  87

Query  319  FDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKN  498
            FDE+QS TY EVKGSG ANQCP I GGV+ FAFK GKY   K CLEPT+FTVKAES  K 
Sbjct  88   FDELQSLTYSEVKGSGIANQCPIIAGGVDGFAFKSGKYQVSKMCLEPTAFTVKAESQFKG  147

Query  499  APPEFQNTKLMTRLTYTLDEIEGPFE  576
               EFQ TKLMTRLTYTLDEIEGP E
Sbjct  148  QGEEFQKTKLMTRLTYTLDEIEGPLE  173



>ref|XP_002992987.1| hypothetical protein SELMODRAFT_187141 [Selaginella moellendorffii]
 ref|XP_002994511.1| hypothetical protein SELMODRAFT_449377 [Selaginella moellendorffii]
 gb|EFJ04419.1| hypothetical protein SELMODRAFT_449377 [Selaginella moellendorffii]
 gb|EFJ05933.1| hypothetical protein SELMODRAFT_187141 [Selaginella moellendorffii]
Length=328

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 116/178 (65%), Gaps = 14/178 (8%)
 Frame = +1

Query  52   MAASLQTAA---TLMQPTKVGVTPRIGRSYQ--TVGKALGV--DPSPARITCSLQSQIKE  210
            MAAS+  A    +L+QP K+  +     S +  +V KA G+  +   AR+TCS++  +K 
Sbjct  1    MAASVVAAKAGPSLLQP-KLDASAGSSASLRPVSVSKAFGLRSNGGGARLTCSMEDIVKR  59

Query  211  LAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTI  390
                 +D  K+A    A + L+   A A   PKRLT+DE+Q++TY+EVKGSGTANQCP +
Sbjct  60   A----TDVGKVAVATAAATLLVAGTAAAN--PKRLTYDEVQAQTYLEVKGSGTANQCPIL  113

Query  391  EGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIE  564
             GG E F FKPG YS KKFCLEPTSFTVK ES  K    ++ +TKLMTRLTYTLDEIE
Sbjct  114  SGGDEGFKFKPGSYSVKKFCLEPTSFTVKKESPFKGGGDQYVDTKLMTRLTYTLDEIE  171



>dbj|BAF94218.1| 33kDa oxygen evolving protein of photosystem II [Chara braunii]
Length=337

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 99/142 (70%), Gaps = 2/142 (1%)
 Frame = +1

Query  151  LGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEI  330
             G+    +R++CSL  +        +DAAK A  ALATSALL   A A   P RLTFDEI
Sbjct  45   FGLSKCNSRLSCSLDEEASSFVSKVADAAKGAAVALATSALLAQAAVA--APPRLTFDEI  102

Query  331  QSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPE  510
             SKTY+EVKG+GTANQCP I GG++ F+FKPGKY  +K CLEPT F VKAES  K    E
Sbjct  103  NSKTYLEVKGTGTANQCPAIGGGLDGFSFKPGKYQMQKLCLEPTEFRVKAESQFKGGDTE  162

Query  511  FQNTKLMTRLTYTLDEIEGPFE  576
            F  TKLMTRLTYTLDEIEGPFE
Sbjct  163  FTKTKLMTRLTYTLDEIEGPFE  184



>ref|XP_002991827.1| hypothetical protein SELMODRAFT_272235 [Selaginella moellendorffii]
 gb|EFJ07089.1| hypothetical protein SELMODRAFT_272235 [Selaginella moellendorffii]
Length=328

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 115/178 (65%), Gaps = 14/178 (8%)
 Frame = +1

Query  52   MAASLQTAA---TLMQPTKVGVTPRIGRSYQ--TVGKALGV--DPSPARITCSLQSQIKE  210
            MAAS+  A    +L+QP K+  +     S +  +V KA G+  +   AR+TCS++  +K 
Sbjct  1    MAASVVAAKAGPSLLQP-KLDASAGSSASLRPVSVSKAFGLRSNGGGARLTCSMEDIVKR  59

Query  211  LAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTI  390
                 +D  K+A    A + L+   A A   PKRLT+DE+Q++TY+EVKGSGTANQCP +
Sbjct  60   A----TDVGKVAVATAAATLLVAGTAAAN--PKRLTYDEVQAQTYLEVKGSGTANQCPIL  113

Query  391  EGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIE  564
             GG   F FKPG YS KKFCLEPTSFTVK ES  K    ++ +TKLMTRLTYTLDEIE
Sbjct  114  SGGDGGFKFKPGSYSVKKFCLEPTSFTVKKESPFKGGGDQYVDTKLMTRLTYTLDEIE  171



>ref|NP_001140815.1| hypothetical protein [Zea mays]
 gb|ACF84695.1| unknown [Zea mays]
 gb|AFW75931.1| hypothetical protein ZEAMMB73_003972 [Zea mays]
Length=230

 Score =   139 bits (351),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +1

Query  346  MEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTK  525
            MEVKG+GTANQCPTI+GGVE+F FK GKY  KK CLEPTSFTVKAE ++KNAPPEFQ TK
Sbjct  1    MEVKGTGTANQCPTIDGGVESFPFKAGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTK  60

Query  526  LMTRLTYTLDEIEGPFE  576
            LMTRLTYTLDEIEGP E
Sbjct  61   LMTRLTYTLDEIEGPLE  77



>ref|XP_002994513.1| hypothetical protein SELMODRAFT_138743, partial [Selaginella 
moellendorffii]
 gb|EFJ04421.1| hypothetical protein SELMODRAFT_138743, partial [Selaginella 
moellendorffii]
Length=244

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +1

Query  304  PKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAE  483
            PKRLT+DE+Q++TY+EVKGSGTANQCP + GG E F FKPG YS KKFCLEPTSFTVK E
Sbjct  1    PKRLTYDEVQAQTYLEVKGSGTANQCPILSGGDEGFKFKPGSYSVKKFCLEPTSFTVKKE  60

Query  484  SVSKNAPPEFQNTKLMTRLTYTLDEIE  564
            S  K    ++ +TKLMTRLTYTLDEIE
Sbjct  61   SPFKGGGDQYVDTKLMTRLTYTLDEIE  87



>gb|ACT83791.1| putative photosystem II oxygen evolving system 33 kDa subunit 
[Lemna minor]
Length=151

 Score =   132 bits (332),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +1

Query  352  VKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  531
            VKG+GTANQCPTI+GGV+ F FK GKY+ KKFCLEPTSFTVKAE VSKN+ PEFQ TKLM
Sbjct  1    VKGTGTANQCPTIDGGVDGFPFKAGKYNLKKFCLEPTSFTVKAEGVSKNSAPEFQKTKLM  60

Query  532  TRLTYTLDEIEGPFE  576
            TRLTYTLDEIEGP E
Sbjct  61   TRLTYTLDEIEGPLE  75



>ref|XP_001784751.1| predicted protein [Physcomitrella patens]
 gb|EDQ50440.1| predicted protein [Physcomitrella patens]
Length=274

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +1

Query  292  AEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFT  471
            AEGVP+RLTFDEI ++TY++VKGSGTANQCP +  G + F  K G Y  KK CLEPTSFT
Sbjct  28   AEGVPQRLTFDEINAQTYLDVKGSGTANQCPIVAEGSDKFNLKDGNYQMKKLCLEPTSFT  87

Query  472  VKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPF  573
            VKAES  K    ++Q TKLMTRLTYTLDEIEGP 
Sbjct  88   VKAESQFKQGGEDYQPTKLMTRLTYTLDEIEGPL  121



>ref|XP_005644574.1| 33kDa oxygen evolving protein of photosystem II [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20030.1| 33kDa oxygen evolving protein of photosystem II [Coccomyxa subellipsoidea 
C-169]
Length=315

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 83/134 (62%), Gaps = 9/134 (7%)
 Frame = +1

Query  178  ITCSLQSQIKELAHNFS-DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEV  354
            + C L   ++      + +  K+A   +  S+L+++GA+     + LT+DE+Q  TY++V
Sbjct  37   VVCGLSENVQSAVAAAAANVGKMA--VVVGSSLMLAGAS-----QALTYDELQGLTYLQV  89

Query  355  KGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  531
            KGSG AN CP +EGG  N    K G Y+  KFCLEPTSFTVK ES  K    +F  TKLM
Sbjct  90   KGSGIANTCPVLEGGSSNLKDLKAGDYNISKFCLEPTSFTVKEESQFKGGDTDFVKTKLM  149

Query  532  TRLTYTLDEIEGPF  573
            TRLTYTLDEI G F
Sbjct  150  TRLTYTLDEISGKF  163



>ref|XP_005843863.1| hypothetical protein CHLNCDRAFT_32868 [Chlorella variabilis]
 gb|EFN51761.1| hypothetical protein CHLNCDRAFT_32868 [Chlorella variabilis]
Length=297

 Score =   116 bits (291),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = +1

Query  298  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  474
            G    L+FDE+Q  TY++VKGSG AN CPT++GG  N    KPG YS  KFC+EPTSFTV
Sbjct  53   GSANALSFDELQGLTYLQVKGSGIANTCPTLDGGSANIKDLKPGSYSLGKFCMEPTSFTV  112

Query  475  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            K ES  K    +F +TKLMTRLTYTLDE+ G F+
Sbjct  113  KEESQFKGGDSDFVSTKLMTRLTYTLDEMSGSFK  146



>gb|ADC54897.1| oxygen-evolving enhancer protein, partial [Cladophora coelothrix]
Length=235

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = +1

Query  313  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESV  489
            LT+D+ QS TYM++KG+G AN CP I+GG +N    KPG YS  KFC+EPTSF V+ ES+
Sbjct  1    LTYDQFQSLTYMQIKGTGLANTCPIIDGGSDNPKDIKPGTYSMYKFCMEPTSFKVQEESM  60

Query  490  SKNAPPEFQNTKLMTRLTYTLDEIEGPF  573
             + AP  F +TKL+TRLTYTLDE+EG F
Sbjct  61   QRGAPSFFSDTKLLTRLTYTLDEMEGKF  88



>ref|XP_010550781.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Tarenaya hassleriana]
Length=195

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 84/129 (65%), Gaps = 19/129 (15%)
 Frame = +1

Query  52   MAASLQTAATLMQ--PTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNF  225
            MAASLQ  A  +   P++     R+ RS  +V KA G+  S AR+TCSL S + + A   
Sbjct  1    MAASLQATAAFLSAAPSRC---VRL-RSSPSVAKAFGLGSSSARLTCSLHSDLSDFARKC  56

Query  226  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKG---SGTANQCPTIEG  396
            SDAAK+AGFALATSAL+VSGANAEGVPKRLTFDE    T MEVKG   +GTAN      G
Sbjct  57   SDAAKIAGFALATSALVVSGANAEGVPKRLTFDE----TCMEVKGITTTGTAN------G  106

Query  397  GVENFAFKP  423
              E F F+P
Sbjct  107  HSEKFGFEP  115



>emb|CEG01950.1| Photosystem II PsbO, manganese-stabilising [Ostreococcus tauri]
Length=302

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 71/106 (67%), Gaps = 0/106 (0%)
 Frame = +1

Query  259  ATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSA  438
            AT +L V+GA        +T+DE+Q  TY++VKG+G AN CP +EGGV     K G Y  
Sbjct  45   ATVSLGVAGAVLAQSASAVTYDELQGLTYLQVKGTGLANTCPVVEGGVSGKDIKAGDYKL  104

Query  439  KKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            ++FC+EPTSFTVK ES  K    EFQ T+LMTRLTYTLD + G F+
Sbjct  105  ERFCMEPTSFTVKEESQFKAGESEFQKTRLMTRLTYTLDGMTGDFK  150



>ref|XP_003082811.1| photosystem II oxygen-evolving complex protein 1 precursor-Chlamydomonas 
reinhardtii (ISS) [Ostreococcus tauri]
Length=180

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = +1

Query  313  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  492
            +T+DE+Q  TY++VKG+G AN CP +EGGV     K G Y  ++FC+EPTSFTVK ES  
Sbjct  9    VTYDELQGLTYLQVKGTGLANTCPVVEGGVSGKDIKAGDYKLERFCMEPTSFTVKEESQF  68

Query  493  KNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            K    EFQ T+LMTRLTYTLD + G F+
Sbjct  69   KAGESEFQKTRLMTRLTYTLDGMTGDFK  96



>ref|XP_001422458.1| psbO, PSII-O, OEE1, photosystem II polypeptide, oxygen evolving 
enhancer 1 [Ostreococcus lucimarinus CCE9901]
 gb|ABP00775.1| psbO, PSII-O, OEE1, photosystem II polypeptide, oxygen evolving 
enhancer 1 [Ostreococcus lucimarinus CCE9901]
Length=302

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 71/106 (67%), Gaps = 0/106 (0%)
 Frame = +1

Query  259  ATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSA  438
            A+ AL V+GA        +T+DE+Q  TY++VKG+G AN CP +EGGV     K G Y+ 
Sbjct  44   ASVALGVAGAVLAQSAGAVTYDELQGLTYLQVKGTGLANTCPVVEGGVSGKEIKAGDYAL  103

Query  439  KKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            ++FC+EPTSFTVK ES  K    EF  T+LMTRLTYTLD + G F+
Sbjct  104  ERFCMEPTSFTVKEESQFKQGESEFSKTRLMTRLTYTLDGMTGSFK  149



>gb|ABA01139.1| chloroplast oxygen-evolving enhancer protein 1 [Chlamydomonas 
incerta]
Length=291

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 61/94 (65%), Gaps = 1/94 (1%)
 Frame = +1

Query  298  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  474
            G    LTFDEIQ  TY++VKGSG AN CP +E G  N    K G Y  + FC+EPTSFTV
Sbjct  47   GSANALTFDEIQGLTYLQVKGSGIANTCPVLESGTTNLKELKAGSYKLENFCIEPTSFTV  106

Query  475  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            K ES  K    EF  TKLMTRLTYTLD + G F+
Sbjct  107  KEESQFKGGDSEFVKTKLMTRLTYTLDAMSGSFK  140



>gb|AFK37254.1| unknown [Medicago truncatula]
Length=66

 Score =   103 bits (257),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -2

Query  530  MSLVFWNSGGAFLLTLSAFTVNDVGSKQNFLALYFPGLNAKFSTPPSMVGHWLAVPLPFT  351
            MSLVFWN+ G FL+T SA TVN+VGS+QNFLALYFPGL    STPPSMVGHW AVP+P T
Sbjct  1    MSLVFWNASGVFLVTPSALTVNEVGSRQNFLALYFPGLKENESTPPSMVGHWFAVPVPLT  60

Query  350  SIYVLL  333
            S YVLL
Sbjct  61   SKYVLL  66



>gb|ACU65446.1| putative oxygen-evolving enhancer [Tragopogon dubius]
Length=77

 Score =   103 bits (257),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 64/77 (83%), Gaps = 1/77 (1%)
 Frame = +1

Query  82   LMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFAL  258
             MQPTKVGV+ R+  +S Q++ KA GVDP+ AR++CSLQS +K+ AH  +DAAK+AGFAL
Sbjct  1    FMQPTKVGVSGRLQLKSSQSICKAFGVDPATARVSCSLQSDLKDFAHKCTDAAKIAGFAL  60

Query  259  ATSALLVSGANAEGVPK  309
            ATSAL+VSGA+AEG PK
Sbjct  61   ATSALVVSGASAEGSPK  77



>sp|P12853.1|PSBO_CHLRE RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Chlamydomonas reinhardtii]
 emb|CAA32053.1| OEE1 precursor protein [Chlamydomonas reinhardtii]
 prf||1807335A photosystem II OEE1 protein
Length=291

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 61/94 (65%), Gaps = 1/94 (1%)
 Frame = +1

Query  298  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  474
            G    LTFDEIQ  TY++VKGSG AN CP +E G  N    K G Y  + FC+EPTSFTV
Sbjct  47   GSANALTFDEIQGLTYLQVKGSGIANTCPVLESGTTNLKELKAGSYKLENFCIEPTSFTV  106

Query  475  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            K ES  K    EF  TKLMTRLTYTLD + G F+
Sbjct  107  KEESQFKGGETEFVKTKLMTRLTYTLDAMSGSFK  140



>ref|XP_001694699.1| oxygen-evolving enhancer protein 1 of photosystem II [Chlamydomonas 
reinhardtii]
 gb|EDP02283.1| oxygen-evolving enhancer protein 1 of photosystem II [Chlamydomonas 
reinhardtii]
Length=291

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 61/94 (65%), Gaps = 1/94 (1%)
 Frame = +1

Query  298  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  474
            G    LTFDEIQ  TY++VKGSG AN CP +E G  N    K G Y  + FC+EPTSFTV
Sbjct  47   GSANALTFDEIQGLTYLQVKGSGIANTCPVLESGTTNLKELKAGSYKLENFCIEPTSFTV  106

Query  475  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            K ES  K    EF  TKLMTRLTYTLD + G F+
Sbjct  107  KEESQFKGGETEFVKTKLMTRLTYTLDAMSGSFK  140



>dbj|BAF94214.1| 33kDa oxygen evolving protein of photosystem II [Oedogonium obesum]
Length=291

 Score =   108 bits (269),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 63/86 (73%), Gaps = 3/86 (3%)
 Frame = +1

Query  313  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESV  489
            LTFDE+Q  TY++VKG+G AN CP I+GG  N    KPG YS +K CLEPTSFTVK E+ 
Sbjct  54   LTFDELQGLTYLQVKGTGIANTCPVIDGGSTNLKDLKPGTYSFEKLCLEPTSFTVKEENA  113

Query  490  SKNAPPEFQNTKLMTRLTYTLDEIEG  567
               +  EF +TKLMTRLTYTLDEI G
Sbjct  114  KGES--EFVSTKLMTRLTYTLDEISG  137



>dbj|BAF94213.1| 33kDa oxygen evolving protein of photosystem II [Hafniomonas 
montana]
Length=290

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 62/94 (66%), Gaps = 1/94 (1%)
 Frame = +1

Query  298  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF-AFKPGKYSAKKFCLEPTSFTV  474
            G    LT+DE+Q  TY++VKGSG AN CP +E G  N    K G Y  +K C+EPTSFTV
Sbjct  45   GSANALTYDELQGLTYLQVKGSGIANTCPVVEAGTTNLNELKAGNYKFQKMCMEPTSFTV  104

Query  475  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            K ES  +    EF  TKLMTRLTYTLDE+ G F+
Sbjct  105  KEESQFRGGDSEFVKTKLMTRLTYTLDEMSGTFK  138



>dbj|BAF94215.1| 33kDa oxygen evolving protein of photosystem II [Pyramimonas 
parkeae]
Length=303

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 63/95 (66%), Gaps = 6/95 (6%)
 Frame = +1

Query  283  GANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPT  462
            GANA      LT++E+Q+ TYM+VKG+G AN CP +EG   N     G Y  +K CLEPT
Sbjct  61   GANA------LTYNELQNLTYMQVKGTGIANTCPIVEGAAGNIKLGSGTYKIEKMCLEPT  114

Query  463  SFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEG  567
            SFTVK ES  K    E+  TKLMTRLTYTLDEI G
Sbjct  115  SFTVKEESQFKGGADEYVQTKLMTRLTYTLDEISG  149



>ref|XP_003063851.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
pusilla CCMP1545]
 gb|EEH52224.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
pusilla CCMP1545]
Length=303

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = +1

Query  313  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  492
            +T+DE+Q  TY++VKG+G AN CP ++GG  + + K G Y+ +KFC+EPTSFTVK +S  
Sbjct  65   VTYDELQGLTYLQVKGTGLANTCPVVDGGESSKSIKAGDYALEKFCMEPTSFTVKEDSAF  124

Query  493  KNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            K    EF  TKLMTRLTYTLD + G F+
Sbjct  125  KAGESEFTKTKLMTRLTYTLDGMTGSFK  152



>gb|ACU65447.1| putative oxygen-evolving enhancer [Tragopogon pratensis]
Length=77

 Score =   101 bits (251),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 64/77 (83%), Gaps = 1/77 (1%)
 Frame = +1

Query  82   LMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFAL  258
             MQPTKVGV+ R+  +S Q++ KA GV+P+ AR++CSLQS +K+ AH  +DAAK+AGFAL
Sbjct  1    FMQPTKVGVSGRLQLKSSQSICKAFGVEPATARVSCSLQSDLKDFAHKCTDAAKIAGFAL  60

Query  259  ATSALLVSGANAEGVPK  309
            ATSAL+VSGA+AEG PK
Sbjct  61   ATSALVVSGASAEGSPK  77



>ref|XP_011400268.1| Oxygen-evolving enhancer protein 1, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM27301.1| Oxygen-evolving enhancer protein 1, chloroplastic [Auxenochlorella 
protothecoides]
Length=303

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = +1

Query  316  TFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESVS  492
            TFDE+Q  TY++VKGSG AN CPT+ GG  N    K G YS  K CLEPTSF VK E+  
Sbjct  65   TFDELQGLTYLQVKGSGIANTCPTLSGGSSNIKDLKSGTYSVNKMCLEPTSFKVKEEAQF  124

Query  493  KNAPPEFQNTKLMTRLTYTLDEIEG  567
            KN   +F  TKL+TRLTYTLDEI G
Sbjct  125  KNGEADFVPTKLVTRLTYTLDEISG  149



>gb|ADC54902.1| oxygen-evolving enhancer protein, partial [Klebsormidium flaccidum]
Length=142

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +1

Query  364  GTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLT  543
            G AN C  I GG + F  K GKY+ KK CLEPTSFTVKAES  K+   +FQ TKLMTRLT
Sbjct  1    GVANTCAIIAGGEDGFKVKAGKYTLKKLCLEPTSFTVKAESQFKDKKEDFQKTKLMTRLT  60

Query  544  YTLDEIEGPFE  576
            YTLDEIEGP E
Sbjct  61   YTLDEIEGPLE  71



>gb|KIY97139.1| Oxygen-evolving enhancer protein 1 [Monoraphidium neglectum]
Length=289

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 67/105 (64%), Gaps = 7/105 (7%)
 Frame = +1

Query  265  SALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAK  441
            +++L   ANA      LT+DE+QS TY++VKGSG AN CP +  G  N    K G Y  +
Sbjct  40   TSMLAGAANA------LTYDELQSLTYLQVKGSGLANTCPVLSSGSTNLKDLKAGTYKLE  93

Query  442  KFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            +FC+EPT+F+VK ES  K     F  TKLMTRLTYTLD + G F+
Sbjct  94   RFCMEPTAFSVKEESQFKGGETNFVATKLMTRLTYTLDGMTGTFK  138



>gb|KIY92168.1| Oxygen-evolving enhancer protein 1,chloroplastic [Monoraphidium 
neglectum]
Length=153

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 58/90 (64%), Gaps = 1/90 (1%)
 Frame = +1

Query  298  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  474
            G    LT+DE+QS TY++VKGSG AN CP +  G  N    K G Y  ++FC+EPT+F+V
Sbjct  44   GAANALTYDELQSLTYLQVKGSGLANTCPVLSSGSTNLKDLKAGTYKLERFCMEPTAFSV  103

Query  475  KAESVSKNAPPEFQNTKLMTRLTYTLDEIE  564
            K ES  K     F  TKLMTRLTYTLD + 
Sbjct  104  KEESQFKGGETNFVATKLMTRLTYTLDGVR  133



>ref|XP_002954867.1| subunit of oxygen evolving complex of photosystem II [Volvox 
carteri f. nagariensis]
 gb|EFJ44066.1| subunit of oxygen evolving complex of photosystem II [Volvox 
carteri f. nagariensis]
Length=297

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 61/94 (65%), Gaps = 1/94 (1%)
 Frame = +1

Query  298  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  474
            G    LT+DE+Q  TY++VKG+G AN CP +E G  + +    G Y  + FC+EPTSFTV
Sbjct  52   GSANALTYDELQGLTYLQVKGTGIANTCPVLEKGSTDLSELSAGTYKLENFCIEPTSFTV  111

Query  475  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            K ESV K    EF  TKLMTRLTYTLD + G  +
Sbjct  112  KEESVFKGGETEFVKTKLMTRLTYTLDAMSGTLK  145



>sp|Q9SBN6.1|PSBO_VOLCA RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Volvox carteri]
 gb|AAD55562.1|AF110780_1 oxygen-evolving enhancer protein 1 precursor [Volvox carteri 
f. nagariensis]
Length=293

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 60/91 (66%), Gaps = 1/91 (1%)
 Frame = +1

Query  298  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  474
            G    LT+DE+Q  TY++VKG+G AN CP +E G  + +    G Y  + FC+EPTSFTV
Sbjct  48   GSANALTYDELQGLTYLQVKGTGIANTCPVLEKGSTDLSELSAGTYKLENFCIEPTSFTV  107

Query  475  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEG  567
            K ESV K    EF  TKLMTRLTYTLD + G
Sbjct  108  KEESVFKGGETEFVKTKLMTRLTYTLDAMSG  138



>dbj|BAF94217.1| 33kDa oxygen evolving protein of photosystem II, partial [Nephroselmis 
olivacea]
Length=260

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = +1

Query  313  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  492
            L++D++ + TY++VKG+G AN CP IE  V N   K G YS ++ C+EPTSFTVK ES  
Sbjct  23   LSYDDLNALTYLQVKGTGIANTCPVIEKNV-NDKIKAGDYSIEQLCMEPTSFTVKEESQF  81

Query  493  KNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            K    EF  TKL+TRLTYTLD+I G F+
Sbjct  82   KAGEAEFVKTKLLTRLTYTLDDISGKFK  109



>gb|ADC54900.1| oxygen-evolving enhancer protein, partial [Entransia fimbriata]
Length=151

 Score = 97.4 bits (241),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +1

Query  340  TYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQN  519
            TY +VKG+G ANQCP +         KPGKY+ +K CLEPTSFTVKA    K++P  FQ 
Sbjct  1    TYXQVKGTGIANQCPKLGSAEPGLKVKPGKYAVEKLCLEPTSFTVKAPGPLKDSPVAFQK  60

Query  520  TKLMTRLTYTLDEIEGPFE  576
            TKLMTRLTYTLDE EG  +
Sbjct  61   TKLMTRLTYTLDENEGTLD  79



>ref|XP_007513615.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16140.1| predicted protein [Bathycoccus prasinos]
Length=331

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 59/88 (67%), Gaps = 2/88 (2%)
 Frame = +1

Query  313  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  492
            +T+DE+Q  TY++VKG+G AN CP +E G    A K G Y   KFC+EPTSFTVK E   
Sbjct  95   VTYDELQGLTYLQVKGTGLANTCPVVESGSGPKALKAGDYKFDKFCVEPTSFTVKEEKA-  153

Query  493  KNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             +   EF  TKLMTRLTYTLD + G F+
Sbjct  154  -DGSTEFAKTKLMTRLTYTLDAMSGDFK  180



>ref|XP_002505809.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
sp. RCC299]
 gb|ACO67067.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
sp. RCC299]
Length=303

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 65/95 (68%), Gaps = 0/95 (0%)
 Frame = +1

Query  292  AEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFT  471
            A G  + +T+DE+Q  TY++VKG+G AN CP +E G    + K G Y+ +KFC+EPTSFT
Sbjct  57   AAGSAQAVTYDELQGLTYLQVKGTGLANTCPVVETGGSGSSIKGGDYALEKFCMEPTSFT  116

Query  472  VKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            VK ES  K    EF  TKLMTRLTYTLD + G F+
Sbjct  117  VKEESAFKAGESEFVKTKLMTRLTYTLDGMTGSFK  151



>emb|CCC15104.1| 33kDa oxygen evolving protein of photosystem II [Lepidodinium 
chlorophorum]
Length=341

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +1

Query  313  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKP-GKYSAKKFCLEPTSFTVKAESV  489
            L +D++Q  TY++VKGSG AN CP +  G  N    P G Y+  K CLEPTSF VK ES 
Sbjct  115  LDYDQLQGLTYLQVKGSGLANTCPDLNSGTTNLKELPAGDYAVSKLCLEPTSFKVKEESQ  174

Query  490  SKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
             K    +F +TKLMTRLTYTLD+I G  +
Sbjct  175  FKGGAADFVDTKLMTRLTYTLDDISGKLK  203



>gb|ABR26062.1| oxygen-evolving enhancer protein 1 [Oryza sativa Indica Group]
Length=203

 Score = 96.3 bits (238),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  427  KYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            KY+ KKFCLEPTSFTVKAE V+KNAPPEFQ TKLMTRLTYTLDEIEGP E
Sbjct  1    KYNMKKFCLEPTSFTVKAEGVAKNAPPEFQKTKLMTRLTYTLDEIEGPLE  50



>gb|AFK26084.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena stellata]
Length=248

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  313  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAESV  489
            LTFDEIQS +Y+EVKGSG AN CP +  G       + G Y    FCLEP+SF VK    
Sbjct  29   LTFDEIQSLSYLEVKGSGLANTCPVLADGTGSKLNLRSGNYKIDNFCLEPSSFQVKVPPT  88

Query  490  SKNAPPEFQNTKLMTRLTYTLDEI  561
                 PEF+ TKLMTRLTYTLD I
Sbjct  89   DSKPKPEFEKTKLMTRLTYTLDGI  112



>gb|AGI15739.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=167

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  442  KFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            KFCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFE
Sbjct  1    KFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFE  45



>gb|AFK26083.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena pseudostellata]
Length=249

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  313  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAESV  489
            LTFDEIQS +Y+EVKGSG AN CP +  G       + G Y    FCLEP+SF VK    
Sbjct  30   LTFDEIQSLSYLEVKGSGLANTCPVLADGTGSKLNLRSGNYKIDNFCLEPSSFQVKVPPT  89

Query  490  SKNAPPEFQNTKLMTRLTYTLDEI  561
                 PEF+ TKLMTRLTYTLD I
Sbjct  90   DSKPKPEFEKTKLMTRLTYTLDGI  113



>dbj|BAF94212.1| 33kDa oxygen evolving protein of photosystem II [Chlorarachnion 
reptans]
Length=328

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 59/92 (64%), Gaps = 4/92 (4%)
 Frame = +1

Query  298  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF--AFKPGKYSAKKFCLEPTSFT  471
            G  K LT+DE Q  +Y++VKGSG AN CP +  G  +   A KPG Y   KFC+EPT F 
Sbjct  81   GASKALTYDEFQGLSYLDVKGSGMANTCPVLSSGTTDVKTALKPGNYKFDKFCIEPTKFQ  140

Query  472  VKAESVSKNAPPEFQNTKLMTRLTYTLDEIEG  567
            VK E V K    EF +TKLMTRLTYTLD + G
Sbjct  141  VK-EDVGK-GKKEFIDTKLMTRLTYTLDAMSG  170



>dbj|BAF94216.1| 33kDa oxygen evolving protein of photosystem II [Tetraselmis 
cordiformis]
Length=308

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = +1

Query  313  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKP-GKYSAKKFCLEPTSFTVKAESV  489
            LT+D++Q  TY++VKG+G AN CP I GG  N    P G Y   +FCLEPTSFTVK +S 
Sbjct  67   LTYDQLQGLTYLQVKGTGVANTCPVISGGSTNPKDIPAGNYKFSEFCLEPTSFTVKEDSQ  126

Query  490  SKNAPPEFQNTKLMTRLTYTLDEIEG  567
             K    E   TKLMTRLTYTLD++ G
Sbjct  127  FKAGESELVKTKLMTRLTYTLDDMSG  152



>gb|ADC54906.1| oxygen-evolving enhancer protein, partial [Phyllodictyon orientale]
Length=148

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +1

Query  355  KGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  531
            KG+G AN CP I+GG +N    K G YS  KFC+EPTSF VK ES+ + A PE+  TKL+
Sbjct  2    KGTGLANTCPIIDGGSDNPKDLKAGNYSMYKFCMEPTSFKVKEESIIRGAAPEYSKTKLL  61

Query  532  TRLTYTLDEIEGPF  573
            TRLTY+LDE+EG F
Sbjct  62   TRLTYSLDEMEGKF  75



>gb|AFK26079.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Cryptoglena skujae]
Length=236

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 56/89 (63%), Gaps = 2/89 (2%)
 Frame = +1

Query  313  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAESV  489
            LTFDEIQS +Y+EVKGSG AN CP I  G     + K G Y     CLEP+SF VK  S 
Sbjct  19   LTFDEIQSLSYLEVKGSGLANTCPIIADGTGAKLSLKSGNYKINNMCLEPSSFQVKVPS-  77

Query  490  SKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            +   P EF+ TKLMTRLTYTLD I    +
Sbjct  78   TDGKPTEFEKTKLMTRLTYTLDGIRADLQ  106



>gb|AFK26085.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Monomorphina pyrum]
Length=237

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 55/84 (65%), Gaps = 2/84 (2%)
 Frame = +1

Query  313  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAESV  489
            LTFDEIQS +Y+EVKGSG AN CP I  G     + K G Y     CLEP+SF VK  S 
Sbjct  20   LTFDEIQSLSYLEVKGSGLANTCPXIADGTGAKLSLKSGNYKINNMCLEPSSFQVKTPS-  78

Query  490  SKNAPPEFQNTKLMTRLTYTLDEI  561
            +   P EF+ TKLMTRLTYTLD I
Sbjct  79   TDGKPSEFEKTKLMTRLTYTLDGI  102



>dbj|BAF94219.1| 33kDa oxygen evolving protein of photosystem II [Bryopsis plumosa]
Length=302

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = +1

Query  313  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  492
            +TFDE+Q  TY++VKG+G AN CPT+  G +    K G Y     C+EPT+F VK ES  
Sbjct  63   VTFDELQGLTYLQVKGTGVANTCPTLSTGGDGSTLKAGSYQISGMCIEPTAFKVKEESQF  122

Query  493  KNAPPEFQNTKLMTRLTYTLDEIEG  567
            K    EF  TKLMTRLTYTLD + G
Sbjct  123  KEGTSEFVKTKLMTRLTYTLDGLSG  147



>gb|ADC54893.1| oxygen-evolving enhancer protein, partial [Boodlea composita]
Length=148

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +1

Query  340  TYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQ  516
            T  + KG+G AN CP I+GG +N    K G YS  KFC+EPTSF VK ES+ +   PE+ 
Sbjct  2    TXXQXKGTGLANTCPIIDGGSDNPKDLKAGTYSMYKFCMEPTSFQVKEESIIRGGAPEYS  61

Query  517  NTKLMTRLTYTLDEIEGPF  573
             TKL+TRLTY+LDE+EG F
Sbjct  62   KTKLLTRLTYSLDEMEGKF  80



>gb|AGI15740.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15741.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=160

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +1

Query  445  FCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            FCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFE
Sbjct  1    FCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFE  44



>gb|AGI15756.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15757.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15758.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15759.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15760.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=166

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +1

Query  445  FCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            FCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFE
Sbjct  1    FCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFE  44



>gb|AGI15761.1| collinsiaXIII-like protein, partial [Collinsia linearis]
Length=167

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +1

Query  445  FCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            FCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFE
Sbjct  1    FCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFE  44



>gb|AGI15742.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15743.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15744.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15745.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15746.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15747.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15748.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15749.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15750.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15751.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15752.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15753.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15754.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15755.1| collinsiaXIII-like protein, partial [Collinsia linearis]
Length=164

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +1

Query  445  FCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            FCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFE
Sbjct  1    FCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFE  44



>gb|ADC54913.1| oxygen-evolving enhancer protein, partial [Valonia utricularis]
Length=147

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +1

Query  355  KGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  531
            KG+G AN CP I+GG +N    K G YS  KFC+EPTSF VK ESV++   P + +TKL+
Sbjct  2    KGTGLANTCPIIDGGSDNPKDLKAGSYSMYKFCMEPTSFKVKEESVARGGAPSYSSTKLL  61

Query  532  TRLTYTLDEIEGPF  573
            TRLTY+LDE+EG F
Sbjct  62   TRLTYSLDEMEGKF  75



>gb|ADC54905.1| oxygen-evolving enhancer protein, partial [Ostreococcus tauri]
Length=148

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  340  TYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQN  519
            T  + KG+G AN CP +EGGV     K G Y  ++FC+EPTSFTVK ES  K    EFQ 
Sbjct  2    TXXQXKGTGLANTCPVVEGGVSGKDIKAGDYKLERFCMEPTSFTVKEESQFKAGESEFQK  61

Query  520  TKLMTRLTYTLDEIEGPFE  576
            T+LMTRLTYTLD + G F+
Sbjct  62   TRLMTRLTYTLDGMTGDFK  80



>gb|ACF24544.1| photosystem II oxygen evolving enhancer protein 1 [Gymnochlora 
stellata]
Length=331

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 58/86 (67%), Gaps = 4/86 (5%)
 Frame = +1

Query  316  TFDEIQSKTYMEVKGSGTANQCPTIEGGVENF--AFKPGKYSAKKFCLEPTSFTVKAESV  489
            TFDE Q  +Y++VKGSG AN CP +  G  +   + KPG Y  +KFC+EP+SF VK E V
Sbjct  91   TFDEFQGLSYLDVKGSGMANTCPVLSSGTSDVKGSLKPGTYKFEKFCIEPSSFQVK-EDV  149

Query  490  SKNAPPEFQNTKLMTRLTYTLDEIEG  567
             K    EF NTKLMTRLTYTLD + G
Sbjct  150  GK-GKKEFINTKLMTRLTYTLDAMSG  174



>gb|AFB34200.1| hypothetical protein CL304Contig1_01, partial [Abies alba]
 gb|AFB34201.1| hypothetical protein CL304Contig1_01, partial [Abies alba]
Length=87

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +1

Query  424  GKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            GKY  KK C+EPTSFTVKAES +KN PP+FQ TKLMTRLTYTLDEIEGP +
Sbjct  1    GKYEMKKLCMEPTSFTVKAESTNKNLPPDFQKTKLMTRLTYTLDEIEGPLD  51



>dbj|BAA03529.2| oxygen-evolving enhancer protein 1 precursor [Euglena gracilis]
Length=384

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = +1

Query  313  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESV  489
            LT+DE+QS +Y+EVK SG A  CP +  GV +  + K GKY    +CLEP+SF VK    
Sbjct  142  LTYDELQSLSYLEVKSSGIAGTCPVLADGVSSKLSLKAGKYEINNWCLEPSSFQVKLPPT  201

Query  490  SKNAPPEFQNTKLMTRLTYTLDEI  561
             K    EF+ TKLMTRLTYTLD I
Sbjct  202  EKQQVTEFERTKLMTRLTYTLDAI  225



>gb|AFK26080.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Discoplastis spathirhyncha]
Length=239

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +1

Query  319  FDEIQSKTYMEVKGSGTANQCPTI-EGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSK  495
            +DEIQS +Y+EVKGSG AN CP I EG     A K G Y     CLEP+SF VK  S   
Sbjct  21   YDEIQSLSYLEVKGSGLANTCPIIAEGSGNKLALKAGNYKINNMCLEPSSFQVKVPSPDG  80

Query  496  NAPPEFQNTKLMTRLTYTLDEI  561
                +F+ TKLMTRLTYTLD I
Sbjct  81   KTVTDFEKTKLMTRLTYTLDGI  102



>sp|P46483.2|PSBO_EUGGR RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Euglena gracilis]
Length=338

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = +1

Query  313  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESV  489
            LT+DE+QS +Y+EVK SG A  CP +  GV +  + K GKY    +CLEP+SF VK    
Sbjct  96   LTYDELQSLSYLEVKSSGIAGTCPVLADGVSSKLSLKAGKYEINNWCLEPSSFQVKLPPT  155

Query  490  SKNAPPEFQNTKLMTRLTYTLDEI  561
             K    EF+ TKLMTRLTYTLD I
Sbjct  156  EKQQVTEFERTKLMTRLTYTLDAI  179



>emb|CCI69514.1| oxygen-evolving enhancer protein, partial [Scotinosphaera sp. 
CAUP H5307]
Length=173

 Score = 90.1 bits (222),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +1

Query  355  KGSGTANQCPTIEGGVENF--AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKL  528
            + SG AN C  IEGG  N   A KPG Y  ++FCLEPTSFTVK ES  K   PEF  TKL
Sbjct  11   RDSGVANTCAVIEGGSSNVRSALKPGSYKLERFCLEPTSFTVKEESSFKGGEPEFVKTKL  70

Query  529  MTRLTYTLDEIEG  567
            MTRLTYTLD I G
Sbjct  71   MTRLTYTLDSISG  83



>gb|AEW08532.1| hypothetical protein CL304Contig1_01, partial [Pinus radiata]
 gb|AFG43487.1| hypothetical protein CL304Contig1_01, partial [Pinus taeda]
 gb|AFG43488.1| hypothetical protein CL304Contig1_01, partial [Pinus taeda]
 gb|AFG43489.1| hypothetical protein CL304Contig1_01, partial [Pinus taeda]
Length=87

 Score = 87.8 bits (216),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  424  GKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            GKY  KK C+EPTSFTVKAE  +KN PP+FQ T+LMTRLTYTLDEIEGP E
Sbjct  1    GKYEMKKLCMEPTSFTVKAEGTNKNLPPDFQKTRLMTRLTYTLDEIEGPLE  51



>gb|ADC54908.1| oxygen-evolving enhancer protein, partial [Siphonocladus tropicus]
Length=145

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 1/76 (1%)
 Frame = +1

Query  349  EVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTK  525
            + KG+G AN CP I+GG +N    KPG Y+  KFC+EPTSFTVK +++ +   P +  TK
Sbjct  1    QXKGTGLANTCPIIDGGSDNPKDIKPGSYAMYKFCMEPTSFTVKEQALIRGGEPFYSKTK  60

Query  526  LMTRLTYTLDEIEGPF  573
            L+TRLTY+LDE+EG F
Sbjct  61   LLTRLTYSLDEMEGKF  76



>gb|AFK26081.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena archaeoplastidiata]
Length=237

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 56/84 (67%), Gaps = 2/84 (2%)
 Frame = +1

Query  313  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESV  489
            LT+DE+QS +Y+E+KGSG +N CP I  G  N  + K G Y     CLEP SF V++ S 
Sbjct  20   LTYDEMQSLSYLEMKGSGLSNTCPIIADGTGNKLSLKAGDYKILNMCLEPASFQVRSPS-  78

Query  490  SKNAPPEFQNTKLMTRLTYTLDEI  561
            +   P EF+ TKLMTRLTYTLD I
Sbjct  79   ADGKPSEFEKTKLMTRLTYTLDGI  102



>gb|AAP79149.1| photosystem II protein PsbO [Bigelowiella natans]
Length=327

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 72/139 (52%), Gaps = 17/139 (12%)
 Frame = +1

Query  157  VDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQS  336
            V P   R+  S  + +K +A         AG A A     VS     G    LTFDE Q 
Sbjct  47   VAPRQTRVFASKPNAMKNIA---------AGLAAAG----VSSIGFLGASNALTFDEFQG  93

Query  337  KTYMEVKGSGTANQCPTIEGGVENF--AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPE  510
             +Y +VKGSG AN CP +  G  +   + K G Y   KFC+EPTSF VK E V K    E
Sbjct  94   LSYTDVKGSGMANTCPILNSGTTDVKGSLKAGTYKFDKFCIEPTSFQVK-EDVGKG-KKE  151

Query  511  FQNTKLMTRLTYTLDEIEG  567
            F + KLMTRLTYTLD + G
Sbjct  152  FIDVKLMTRLTYTLDAMSG  170



>gb|ADC54894.1| oxygen-evolving enhancer protein, partial [Bornetella sphaerica]
Length=142

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  355  KGSGTANQCPTIEGGVENF-AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  531
            KG+G AN CPTIE G  +  A   G Y   KFC+EPTSFTVK ES  K    EF NTKLM
Sbjct  1    KGTGIANTCPTIETGTTDLSALXAGDYKFSKFCMEPTSFTVKEESQFKGGETEFVNTKLM  60

Query  532  TRLTYTLDEIEGPFE  576
            TRLTYTLD++ G F+
Sbjct  61   TRLTYTLDDMSGTFK  75



>gb|ADE06500.1| oxygen-evolving enhancer [Tragopogon porrifolius]
Length=61

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  127  SYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVP  306
            S Q++ KA GV+P+ AR++CSLQS +K+ AH  +DAAK+AGFALATSAL+VSGA+AEG P
Sbjct  1    SSQSICKAFGVEPATARVSCSLQSDLKDFAHKCTDAAKIAGFALATSALVVSGASAEGSP  60

Query  307  K  309
            K
Sbjct  61   K  61



>emb|CAH04962.1| oxygen-evolving enhancer protein 1 [Cyanophora paradoxa]
Length=347

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 65/101 (64%), Gaps = 6/101 (6%)
 Frame = +1

Query  277  VSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE-NFAFKPGK-YSAKKFC  450
            VS ANAEG    LTFD++ S  Y+++KG+G +N CPT+      N + + GK Y     C
Sbjct  86   VSQANAEG----LTFDQLNSANYLKLKGTGISNTCPTLGASARGNISLEKGKEYYLTDLC  141

Query  451  LEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPF  573
            ++PT   VKAES+ K    EFQ T+L+TR TYT+D++EGP 
Sbjct  142  IQPTEILVKAESLQKGKGEEFQPTRLVTRATYTIDKVEGPI  182



>emb|CCI69513.1| oxygen-evolving enhancer protein, partial [Chlorochytrium lemnae]
Length=143

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +1

Query  355  KGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  531
            KGSG AN CP IEGG  N    KPG Y+  K C+EPTSFTVK +S  K    EF  TKLM
Sbjct  1    KGSGIANTCPVIEGGSTNLKDLKPGXYTFDKLCMEPTSFTVKEDSQFKGGETEFVKTKLM  60

Query  532  TRLTYTLDEIEG  567
            TRLTYTLD + G
Sbjct  61   TRLTYTLDAMSG  72



>gb|ADC54901.1| oxygen-evolving enhancer protein, partial [Ignatius tetrasporus]
Length=145

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 48/75 (64%), Gaps = 2/75 (3%)
 Frame = +1

Query  349  EVKGSGTANQCPTIEGGVEN--FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNT  522
            ++KGSG AN CP IEGG  N     K G Y    FC+EPTSF VK ES  K    EF NT
Sbjct  1    QIKGSGIANTCPVIEGGSSNPKSDLKSGTYKFDNFCMEPTSFQVKEESQFKGGNEEFVNT  60

Query  523  KLMTRLTYTLDEIEG  567
            KLMTRLTYTLD + G
Sbjct  61   KLMTRLTYTLDAMSG  75



>gb|ADC54904.1| oxygen-evolving enhancer protein, partial [Nephroselmis olivacea]
Length=142

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = +1

Query  349  EVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKL  528
            + KG+G AN CP IE  V +   K G Y+ ++ CLEPTSFTVK ES  K+   EF  TKL
Sbjct  1    QXKGTGIANTCPVIEKDVSD-KIKGGDYAMEQLCLEPTSFTVKEESQFKDGKSEFVKTKL  59

Query  529  MTRLTYTLDEIEGPFE  576
            MTRLTYTLD+I G F+
Sbjct  60   MTRLTYTLDDITGKFK  75



>gb|AFK26082.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena granulata]
Length=239

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query  313  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAESV  489
            LT++E+QS +Y+E+KG+G +N CP I  G       K GKY     CLEP++F VK    
Sbjct  20   LTYNEMQSLSYLEMKGTGLSNTCPIITDGTGTKLNLKAGKYEINNMCLEPSAFQVKVPPT  79

Query  490  SKNAPPEFQNTKLMTRLTYTLDEI  561
                 PEF+ TKLMTRLTYTLD I
Sbjct  80   DVRPNPEFERTKLMTRLTYTLDGI  103



>ref|XP_005652213.1| 33kDa oxygen evolving protein of photosystem II, partial [Coccomyxa 
subellipsoidea C-169]
 gb|EIE27669.1| 33kDa oxygen evolving protein of photosystem II, partial [Coccomyxa 
subellipsoidea C-169]
Length=270

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 56/85 (66%), Gaps = 1/85 (1%)
 Frame = +1

Query  313  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESV  489
            +T+D++Q+ +Y EV+G+G A  CP IE G  N A  KPG Y  K  CLEPT   V+ E +
Sbjct  10   ITYDQLQNMSYNEVRGTGLAAVCPLIEEGSTNLADLKPGTYKLKNLCLEPTKIQVQEEGL  69

Query  490  SKNAPPEFQNTKLMTRLTYTLDEIE  564
            +K + P++ NTKL+TR T  L +IE
Sbjct  70   TKGSGPQWSNTKLLTRQTTNLSDIE  94



>gb|ADC54898.1| oxygen-evolving enhancer protein, partial [Codium sp. HEC 15711]
Length=151

 Score = 84.0 bits (206),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  TYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQN  519
            TY ++KG+G AN CPT+  G +  A KPG Y+    C+EPTS  VK ES  K+   +F  
Sbjct  1    TYXQIKGTGLANTCPTLSTGDDAKALKPGSYAVSSMCIEPTSIQVKDESQFKDGVADFVK  60

Query  520  TKLMTRLTYTLDEIEG  567
            TKLMTRLTYTLD + G
Sbjct  61   TKLMTRLTYTLDGLGG  76



>gb|ADC54912.1| oxygen-evolving enhancer protein, partial [Ulva intestinalis]
Length=151

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 53/79 (67%), Gaps = 5/79 (6%)
 Frame = +1

Query  340  TYMEVKGSGTANQCPTIE---GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPE  510
            TY ++KG+G AN CPT+E   G V +   KPG Y   +FC+EP+  TVK ES  K    E
Sbjct  1    TYXQIKGTGRANACPTLEETNGSVSDL--KPGNYKLDRFCMEPSKITVKEESQFKGGVTE  58

Query  511  FQNTKLMTRLTYTLDEIEG  567
            F NTKL+TRLTYTLD++ G
Sbjct  59   FVNTKLVTRLTYTLDQMSG  77



>dbj|BAF94211.1| 33kDa oxygen evolving protein of photosystem II [Eutreptiella 
gymnastica]
Length=346

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 52/83 (63%), Gaps = 1/83 (1%)
 Frame = +1

Query  316  TFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESVS  492
            T+DEIQS +YME+KG+G +N CP I    E+    + G Y     CLEP+SF VK  S  
Sbjct  106  TYDEIQSLSYMEMKGTGLSNTCPIIADSSESKLNLRAGNYKINNMCLEPSSFQVKVPSPD  165

Query  493  KNAPPEFQNTKLMTRLTYTLDEI  561
                 +F+ TKLMTRLTYTLD I
Sbjct  166  GKTVTDFEKTKLMTRLTYTLDGI  188



>gb|ADC54890.1| oxygen-evolving enhancer protein, partial [Acetabularia acetabulum]
Length=143

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +1

Query  364  GTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRL  540
            G AN C  IE G  + +  KPG Y   KFC+EP+SFTVK ES  K    EF NTKLMTRL
Sbjct  1    GVANTCAVIESGSTDLSVLKPGNYKFTKFCMEPSSFTVKEESQFKGGETEFVNTKLMTRL  60

Query  541  TYTLDEIEGPF  573
            TYTLD++ G F
Sbjct  61   TYTLDDMNGQF  71



>gb|ADC54891.1| oxygen-evolving enhancer protein, partial [Ulvella repens]
Length=140

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = +1

Query  364  GTANQCPTI-EGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRL  540
            G AN C T+ EG  E  A K G Y+  +FC+EPT FTVK ES  K    EF NTKLMTRL
Sbjct  1    GVANTCATLDEGSAEGSALKQGTYALSQFCMEPTKFTVKEESQFKGGVTEFVNTKLMTRL  60

Query  541  TYTLDEIEG  567
            TYTLD++ G
Sbjct  61   TYTLDQMSG  69



>gb|ADC54903.1| oxygen-evolving enhancer protein, partial [Mesostigma viride]
Length=151

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 45/76 (59%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  TYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQN  519
            T  + KG+G AN C  I+          GKY   K CLEPTS  VK ES+ K   P+F  
Sbjct  2    TXXQXKGTGLANTCAVIDNASTELKVAGGKYKVAKMCLEPTSVKVKEESILKGGAPQFVE  61

Query  520  TKLMTRLTYTLDEIEG  567
            TKL+TR+TYTLDEI G
Sbjct  62   TKLLTRMTYTLDEISG  77



>gb|AGI15762.1| collinsiaXIII-like protein, partial [Collinsia linearis]
Length=158

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/38 (97%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  463  SFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  576
            SFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFE
Sbjct  1    SFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFE  38



>gb|ADC54899.1| oxygen-evolving enhancer protein, partial [Derbesia sp. 2773-1]
Length=142

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +1

Query  355  KGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMT  534
            KG+G AN CPT+E G +  + K G Y+    C+EPT+F VK ES  ++ P  F +TKLMT
Sbjct  1    KGTGIANTCPTLETGEDGKSLKAGTYTVSGMCIEPTAFQVKEESEFRDQPAAFVDTKLMT  60

Query  535  RLTYTLDEIEG  567
            RLTYTLD + G
Sbjct  61   RLTYTLDGLGG  71



>gb|ADC54895.1| oxygen-evolving enhancer protein, partial [Bryopsis sp. EE4]
Length=144

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +1

Query  349  EVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKL  528
            + KG+G AN CPT+  G +  + K G Y     C+EPTS TVK ES  K+   EF  TKL
Sbjct  1    QXKGTGVANTCPTLATGGDGSSLKAGSYQVTGMCIEPTSITVKEESQFKDGVSEFVKTKL  60

Query  529  MTRLTYTLDEIEG  567
            MTRLTYTLD + G
Sbjct  61   MTRLTYTLDGLSG  73



>gb|ADC54907.1| oxygen-evolving enhancer protein, partial [Acutodesmus obliquus]
Length=141

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +1

Query  370  ANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTY  546
            AN C  +E G  N    K G Y   KFC+EPTSFTVK ES  K    EF  TKLMTRLTY
Sbjct  1    ANTCAVLESGSTNLKDLKAGTYKVDKFCMEPTSFTVKDESQFKGGETEFVKTKLMTRLTY  60

Query  547  TLDEIEG  567
            TLD++ G
Sbjct  61   TLDQMSG  67



Lambda      K        H        a         alpha
   0.313    0.128    0.358    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 696633491985