BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF008N07

Length=536
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009610166.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    182   2e-50   Nicotiana tomentosiformis
ref|XP_009610165.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    182   4e-50   Nicotiana tomentosiformis
ref|XP_009758479.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    175   8e-48   Nicotiana sylvestris
ref|XP_009758471.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    175   1e-47   Nicotiana sylvestris
gb|KDP28272.1|  hypothetical protein JCGZ_14043                         167   1e-44   Jatropha curcas
gb|EYU46816.1|  hypothetical protein MIMGU_mgv1a001735mg                157   6e-41   Erythranthe guttata [common monkey flower]
ref|XP_008454276.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    156   8e-41   Cucumis melo [Oriental melon]
emb|CAN74586.1|  hypothetical protein VITISV_041989                     155   2e-40   Vitis vinifera
ref|XP_002277419.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    155   2e-40   Vitis vinifera
ref|XP_010544963.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    155   2e-40   Tarenaya hassleriana [spider flower]
ref|XP_004152219.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    155   3e-40   Cucumis sativus [cucumbers]
ref|XP_010921475.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    154   3e-40   Elaeis guineensis
ref|XP_004156816.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    154   5e-40   
ref|XP_006444513.1|  hypothetical protein CICLE_v10018925mg             151   2e-39   
gb|KDO86973.1|  hypothetical protein CISIN_1g003881mg                   151   2e-39   Citrus sinensis [apfelsine]
ref|XP_006349177.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    152   2e-39   Solanum tuberosum [potatoes]
ref|XP_004229381.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    152   2e-39   Solanum lycopersicum
ref|XP_006444514.1|  hypothetical protein CICLE_v10018925mg             151   5e-39   Citrus clementina [clementine]
gb|KDO86968.1|  hypothetical protein CISIN_1g003881mg                   151   5e-39   Citrus sinensis [apfelsine]
ref|XP_002882116.1|  hypothetical protein ARALYDRAFT_483908             151   5e-39   
ref|XP_003625986.1|  DEAD-box ATP-dependent RNA helicase                151   7e-39   Medicago truncatula
emb|CDP17060.1|  unnamed protein product                                150   9e-39   Coffea canephora [robusta coffee]
ref|XP_006397925.1|  hypothetical protein EUTSA_v10001321mg             150   2e-38   Eutrema salsugineum [saltwater cress]
ref|XP_011042271.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    150   2e-38   Populus euphratica
ref|XP_002515267.1|  hypothetical protein RCOM_1346600                  149   3e-38   Ricinus communis
ref|XP_002301515.2|  DEAD/DEAH box helicase family protein              149   4e-38   
ref|XP_009403707.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    148   6e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_566099.1|  DEAD-box ATP-dependent RNA helicase 24                147   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010267974.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    146   4e-37   Nelumbo nucifera [Indian lotus]
ref|XP_007221465.1|  hypothetical protein PRUPE_ppa001666mg             145   6e-37   Prunus persica
ref|XP_011079539.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    144   7e-37   Sesamum indicum [beniseed]
ref|XP_010938236.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    145   8e-37   Elaeis guineensis
ref|XP_010518433.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    144   8e-37   Camelina sativa [gold-of-pleasure]
ref|XP_008227876.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    145   1e-36   Prunus mume [ume]
ref|XP_011079538.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    145   1e-36   Sesamum indicum [beniseed]
ref|XP_010518432.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    144   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_007163191.1|  hypothetical protein PHAVU_001G214100g             144   3e-36   Phaseolus vulgaris [French bean]
ref|XP_010506768.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    144   3e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010506769.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    143   4e-36   Camelina sativa [gold-of-pleasure]
gb|AGV54423.1|  DEAD-box ATP-dependent RNA helicase 24-like protein     143   4e-36   Phaseolus vulgaris [French bean]
ref|XP_011468779.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    142   9e-36   Fragaria vesca subsp. vesca
ref|XP_004288535.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    142   1e-35   Fragaria vesca subsp. vesca
ref|XP_009349922.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    142   1e-35   Pyrus x bretschneideri [bai li]
ref|XP_007051130.1|  P-loop containing nucleoside triphosphate hy...    140   1e-35   
ref|XP_006293732.1|  hypothetical protein CARUB_v10022694mg             141   2e-35   Capsella rubella
ref|XP_007051129.1|  P-loop containing nucleoside triphosphate hy...    141   3e-35   
ref|XP_008343158.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    140   4e-35   
ref|XP_007051128.1|  P-loop containing nucleoside triphosphate hy...    140   5e-35   
ref|XP_009370603.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    140   5e-35   Pyrus x bretschneideri [bai li]
ref|XP_008381412.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    139   1e-34   
ref|XP_010069832.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    138   4e-34   Eucalyptus grandis [rose gum]
ref|XP_004494432.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    137   4e-34   Cicer arietinum [garbanzo]
ref|XP_004494431.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    137   5e-34   Cicer arietinum [garbanzo]
ref|XP_008781128.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    137   5e-34   Phoenix dactylifera
ref|XP_010507898.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    136   5e-34   Camelina sativa [gold-of-pleasure]
ref|XP_008808687.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   7e-33   Phoenix dactylifera
ref|XP_006840470.1|  hypothetical protein AMTR_s00045p00182070          134   9e-33   
gb|KHG13094.1|  DEAD-box ATP-dependent RNA helicase 24 -like protein    132   3e-32   Gossypium arboreum [tree cotton]
gb|KJB22485.1|  hypothetical protein B456_004G050000                    132   4e-32   Gossypium raimondii
gb|KJB22484.1|  hypothetical protein B456_004G050000                    131   6e-32   Gossypium raimondii
ref|XP_009416320.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    129   6e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010679398.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    125   7e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010679397.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    125   1e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006388444.1|  hypothetical protein POPTR_0184s002102g            113   1e-28   
ref|XP_003521597.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    113   2e-25   Glycine max [soybeans]
gb|KJB22489.1|  hypothetical protein B456_004G050200                    112   5e-25   Gossypium raimondii
gb|KJB22491.1|  hypothetical protein B456_004G050200                    112   5e-25   Gossypium raimondii
gb|KJB22487.1|  hypothetical protein B456_004G050200                    112   6e-25   Gossypium raimondii
gb|KHG18820.1|  DEAD-box ATP-dependent RNA helicase 24 -like protein    111   7e-25   Gossypium arboreum [tree cotton]
gb|KJB22490.1|  hypothetical protein B456_004G050200                    111   7e-25   Gossypium raimondii
gb|KJB22488.1|  hypothetical protein B456_004G050200                    110   9e-25   Gossypium raimondii
gb|EPS66709.1|  hypothetical protein M569_08067                         108   8e-24   Genlisea aurea
gb|KHN19202.1|  DEAD-box ATP-dependent RNA helicase 24                  103   3e-22   Glycine soja [wild soybean]
ref|XP_003554554.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    102   9e-22   Glycine max [soybeans]
ref|XP_001779387.1|  predicted protein                                92.0    4e-18   
ref|NP_001049904.1|  Os03g0308500                                     85.5    8e-16   
emb|CDX83333.1|  BnaA03g21730D                                        82.8    6e-15   
ref|XP_009135930.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  82.8    6e-15   
gb|AFW88580.1|  putative DEAD-box ATP-dependent RNA helicase fami...  82.8    7e-15   
ref|XP_006649971.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  82.4    9e-15   
emb|CDX95719.1|  BnaC03g26000D                                        81.3    2e-14   
gb|EMS61774.1|  DEAD-box ATP-dependent RNA helicase 24                80.9    3e-14   Triticum urartu
gb|EEC75096.1|  hypothetical protein OsI_11255                        80.1    7e-14   Oryza sativa Indica Group [Indian rice]
dbj|BAJ97115.1|  predicted protein                                    79.3    9e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003558073.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  79.3    9e-14   Brachypodium distachyon [annual false brome]
gb|EMT30425.1|  DEAD-box ATP-dependent RNA helicase 24                79.3    1e-13   
emb|CDY37796.1|  BnaC04g00290D                                        78.6    2e-13   Brassica napus [oilseed rape]
emb|CDX80096.1|  BnaA05g00600D                                        78.2    2e-13   
ref|XP_009142546.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  77.4    4e-13   Brassica rapa
gb|KFK37476.1|  hypothetical protein AALP_AA4G262200                  77.0    6e-13   Arabis alpina [alpine rockcress]
ref|XP_002467976.1|  hypothetical protein SORBIDRAFT_01g037410        74.7    3e-12   Sorghum bicolor [broomcorn]
ref|NP_001147596.1|  pre-mRNA-processing ATP-dependent RNA helica...  74.3    4e-12   Zea mays [maize]
ref|XP_008654947.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  73.2    1e-11   Zea mays [maize]
ref|XP_008654950.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  73.2    1e-11   Zea mays [maize]
ref|XP_002980961.1|  hypothetical protein SELMODRAFT_51367            67.4    8e-10   
ref|XP_002989340.1|  hypothetical protein SELMODRAFT_41331            67.4    8e-10   
gb|KHG13095.1|  DEAD-box ATP-dependent RNA helicase 24 -like protein  58.9    4e-07   Gossypium arboreum [tree cotton]
ref|XP_004984607.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  54.3    1e-05   Setaria italica
gb|EEE58924.1|  hypothetical protein OsJ_10575                        48.9    7e-04   Oryza sativa Japonica Group [Japonica rice]



>ref|XP_009610166.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X2 
[Nicotiana tomentosiformis]
Length=636

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 128/144 (89%), Gaps = 2/144 (1%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFGIN+Q TYNFER +APQRLYVPPSSRS G HDNYEDTDLDNI+Y+E D 
Sbjct  1    MSKRKFGFEGFGINKQTTYNFERNQAPQRLYVPPSSRSGGSHDNYEDTDLDNIEYEEHDA  60

Query  289  nednnndindgsggadd--EIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPME  462
              ++N ++  G GG  +  EIDPLDAFMEGIHEEMKAAPPPKPKEKLDKYKDD+EDDPME
Sbjct  61   VGEDNKNVGGGGGGGAEDDEIDPLDAFMEGIHEEMKAAPPPKPKEKLDKYKDDVEDDPME  120

Query  463  SFLKAKKDIGLQLAAEALNAGYNS  534
            SFL+AKKD+GLQLAAEALNAGYNS
Sbjct  121  SFLRAKKDVGLQLAAEALNAGYNS  144



>ref|XP_009610165.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Nicotiana tomentosiformis]
Length=777

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 128/144 (89%), Gaps = 2/144 (1%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFGIN+Q TYNFER +APQRLYVPPSSRS G HDNYEDTDLDNI+Y+E D 
Sbjct  1    MSKRKFGFEGFGINKQTTYNFERNQAPQRLYVPPSSRSGGSHDNYEDTDLDNIEYEEHDA  60

Query  289  nednnndindgsggadd--EIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPME  462
              ++N ++  G GG  +  EIDPLDAFMEGIHEEMKAAPPPKPKEKLDKYKDD+EDDPME
Sbjct  61   VGEDNKNVGGGGGGGAEDDEIDPLDAFMEGIHEEMKAAPPPKPKEKLDKYKDDVEDDPME  120

Query  463  SFLKAKKDIGLQLAAEALNAGYNS  534
            SFL+AKKD+GLQLAAEALNAGYNS
Sbjct  121  SFLRAKKDVGLQLAAEALNAGYNS  144



>ref|XP_009758479.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X2 
[Nicotiana sylvestris]
Length=636

 Score =   175 bits (443),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 124/144 (86%), Gaps = 2/144 (1%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyde--r  282
            MSKRKFGF+GFGIN+Q TYNFER +APQRLYVPPS  S G HDNYEDTDLDNI+Y+E   
Sbjct  1    MSKRKFGFEGFGINKQTTYNFERNQAPQRLYVPPSLCSGGSHDNYEDTDLDNIEYEEHDA  60

Query  283  dgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPME  462
             G ++ N+    G G  DDEIDPLDAFMEGIHEEMKAA PPKPKEKLDKYKDD+EDDPME
Sbjct  61   VGEDNKNDGAGGGGGAEDDEIDPLDAFMEGIHEEMKAAAPPKPKEKLDKYKDDVEDDPME  120

Query  463  SFLKAKKDIGLQLAAEALNAGYNS  534
            SFL+AKKD+GLQLAAEALNAGYNS
Sbjct  121  SFLRAKKDVGLQLAAEALNAGYNS  144



>ref|XP_009758471.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Nicotiana sylvestris]
 ref|XP_009758473.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Nicotiana sylvestris]
Length=762

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 124/144 (86%), Gaps = 2/144 (1%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyde--r  282
            MSKRKFGF+GFGIN+Q TYNFER +APQRLYVPPS  S G HDNYEDTDLDNI+Y+E   
Sbjct  1    MSKRKFGFEGFGINKQTTYNFERNQAPQRLYVPPSLCSGGSHDNYEDTDLDNIEYEEHDA  60

Query  283  dgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPME  462
             G ++ N+    G G  DDEIDPLDAFMEGIHEEMKAA PPKPKEKLDKYKDD+EDDPME
Sbjct  61   VGEDNKNDGAGGGGGAEDDEIDPLDAFMEGIHEEMKAAAPPKPKEKLDKYKDDVEDDPME  120

Query  463  SFLKAKKDIGLQLAAEALNAGYNS  534
            SFL+AKKD+GLQLAAEALNAGYNS
Sbjct  121  SFLRAKKDVGLQLAAEALNAGYNS  144



>gb|KDP28272.1| hypothetical protein JCGZ_14043 [Jatropha curcas]
Length=774

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 126/142 (89%), Gaps = 2/142 (1%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFGINRQ TYNFER++APQRLYVPPSSR   GHDNYEDTDLDNIDY+E D 
Sbjct  1    MSKRKFGFEGFGINRQTTYNFERSQAPQRLYVPPSSRH--GHDNYEDTDLDNIDYEENDN  58

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMESF  468
             +D + D +  +G ADDEIDPLDAFMEGIHEEM+AAPPPKPKEK +KY+DD +DDPMESF
Sbjct  59   AKDTSADNSKDNGAADDEIDPLDAFMEGIHEEMRAAPPPKPKEKTEKYRDDEDDDPMESF  118

Query  469  LKAKKDIGLQLAAEALNAGYNS  534
            LKAKKD+GL LAA+AL+AGY+S
Sbjct  119  LKAKKDLGLTLAADALHAGYDS  140



>gb|EYU46816.1| hypothetical protein MIMGU_mgv1a001735mg [Erythranthe guttata]
Length=767

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 124/143 (87%), Gaps = 4/143 (3%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNId-yderd  285
            MSKRKFGF+GFGINRQATYNFER++ PQRLYVPPSSR   G D  ED DL+NID  DERD
Sbjct  1    MSKRKFGFEGFGINRQATYNFERSQPPQRLYVPPSSR---GGDADEDADLENIDYADERD  57

Query  286  gnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMES  465
             + ++  + NDG+   +DEIDPLDAFMEG+ EEMKAAPPPKPKEKLDKYKDD+EDDPMES
Sbjct  58   TSNEDAPNTNDGAAADEDEIDPLDAFMEGLQEEMKAAPPPKPKEKLDKYKDDVEDDPMES  117

Query  466  FLKAKKDIGLQLAAEALNAGYNS  534
            FL+AKKD+GLQLAA+AL+AGYNS
Sbjct  118  FLRAKKDLGLQLAADALHAGYNS  140



>ref|XP_008454276.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Cucumis melo]
Length=776

 Score =   156 bits (395),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 122/144 (85%), Gaps = 3/144 (2%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNId--yder  282
            MSKRKFGF+GFGINRQ TYNFER++APQRLYVPPSSR   GHDNYEDTD+DNI+   ++ 
Sbjct  1    MSKRKFGFEGFGINRQTTYNFERSQAPQRLYVPPSSRG-HGHDNYEDTDVDNIEYDDNDG  59

Query  283  dgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPME  462
            +    N++     +G  ++EIDPLDAFMEGIHEEMKA PPPKPKEK+DKY+DD EDDPME
Sbjct  60   EEASGNDDGGAGAAGAEEEEIDPLDAFMEGIHEEMKAPPPPKPKEKVDKYRDDEEDDPME  119

Query  463  SFLKAKKDIGLQLAAEALNAGYNS  534
            SFL+AKKD+GL LAA+AL+AGY+S
Sbjct  120  SFLRAKKDVGLTLAADALHAGYDS  143



>emb|CAN74586.1| hypothetical protein VITISV_041989 [Vitis vinifera]
Length=771

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 116/142 (82%), Gaps = 4/142 (3%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFGINR ATYNFER++APQRLYVPPSSRS GGHDNYED DLDNIDYD++D 
Sbjct  1    MSKRKFGFEGFGINRPATYNFERSQAPQRLYVPPSSRS-GGHDNYEDHDLDNIDYDDKDE  59

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMESF  468
            + +      +   G   EIDPLDAFMEGIHEEM+A PPPK  EK +KY DD EDDPMESF
Sbjct  60   HGEVAGGGGEVDDG---EIDPLDAFMEGIHEEMRAPPPPKVVEKAEKYVDDDEDDPMESF  116

Query  469  LKAKKDIGLQLAAEALNAGYNS  534
            L+AKKD GL LAA+ ++AGY+S
Sbjct  117  LRAKKDTGLALAADVMHAGYDS  138



>ref|XP_002277419.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Vitis vinifera]
 emb|CBI36962.3| unnamed protein product [Vitis vinifera]
Length=771

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 116/142 (82%), Gaps = 4/142 (3%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFGINR ATYNFER++APQRLYVPPSSRS GGHDNYED DLDNIDYD++D 
Sbjct  1    MSKRKFGFEGFGINRPATYNFERSQAPQRLYVPPSSRS-GGHDNYEDHDLDNIDYDDKDE  59

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMESF  468
            + +      +   G   EIDPLDAFMEGIHEEM+A PPPK  EK +KY DD EDDPMESF
Sbjct  60   HGEVAGGGGEVDDG---EIDPLDAFMEGIHEEMRAPPPPKLVEKAEKYVDDDEDDPMESF  116

Query  469  LKAKKDIGLQLAAEALNAGYNS  534
            L+AKKD GL LAA+ ++AGY+S
Sbjct  117  LRAKKDTGLALAADVMHAGYDS  138



>ref|XP_010544963.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Tarenaya hassleriana]
Length=774

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 120/145 (83%), Gaps = 6/145 (4%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFG+NRQ+TYNFER++APQRLYVPPSSR   GHD++ED D++NIDY + + 
Sbjct  1    MSKRKFGFEGFGLNRQSTYNFERSQAPQRLYVPPSSR---GHDDFEDADIENIDYADNEN  57

Query  289  nednnndindgsggaddE---IDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPM  459
             E++ ++    +     E   IDPLDAFMEGIHEEMKAAPP KPKEKL++YK+D +DDPM
Sbjct  58   AEEDVSEGGGATEANGGEDDEIDPLDAFMEGIHEEMKAAPPTKPKEKLERYKEDEDDDPM  117

Query  460  ESFLKAKKDIGLQLAAEALNAGYNS  534
            ESFL AKKD+GL LAA+AL+AGYNS
Sbjct  118  ESFLNAKKDVGLTLAADALHAGYNS  142



>ref|XP_004152219.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Cucumis 
sativus]
 gb|KGN52865.1| hypothetical protein Csa_4G004270 [Cucumis sativus]
Length=777

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 121/144 (84%), Gaps = 3/144 (2%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNId--yder  282
            MSKRKFGF+GFGINRQ TYNFER++APQRLYVPPSSR   GHDNYEDTD+DNI+   ++ 
Sbjct  1    MSKRKFGFEGFGINRQTTYNFERSQAPQRLYVPPSSRG-HGHDNYEDTDVDNIEYDDNDG  59

Query  283  dgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPME  462
            +    N +     SG  ++EIDPLDAFMEGIHEEMKA PPPKPKEK+DKY+DD E+DPME
Sbjct  60   EEASGNADGGAGASGAEEEEIDPLDAFMEGIHEEMKAPPPPKPKEKVDKYRDDDEEDPME  119

Query  463  SFLKAKKDIGLQLAAEALNAGYNS  534
            SFL+AKKD+GL LAA+AL+AGY+S
Sbjct  120  SFLRAKKDVGLTLAADALHAGYDS  143



>ref|XP_010921475.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Elaeis 
guineensis]
 ref|XP_010921477.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Elaeis 
guineensis]
 ref|XP_010921478.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Elaeis 
guineensis]
Length=767

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 112/144 (78%), Gaps = 9/144 (6%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFGINR ATY+FER++APQRLYVPPSSRS GG+DNYED DLDNI       
Sbjct  1    MSKRKFGFEGFGINRPATYSFERSQAPQRLYVPPSSRSGGGNDNYEDHDLDNI-------  53

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpke--kLDKYKDDIEDDPME  462
            + D  +  +     AD EIDPLDAFMEGIHEE++A PPP  K   K DKY DD EDDP+E
Sbjct  54   DYDQPDAPDRQPDAADGEIDPLDAFMEGIHEEIRAPPPPSAKPKDKGDKYPDDEEDDPVE  113

Query  463  SFLKAKKDIGLQLAAEALNAGYNS  534
            SFL+AKKD+GL LA+EAL AGY+S
Sbjct  114  SFLRAKKDVGLTLASEALRAGYDS  137



>ref|XP_004156816.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
24-like [Cucumis sativus]
Length=774

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 122/147 (83%), Gaps = 6/147 (4%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNId-----y  273
            MSKRKFGF+GFGINRQ TYNFER++APQRLYVPPSSR   GHDNYEDTD+DNI+      
Sbjct  1    MSKRKFGFEGFGINRQTTYNFERSQAPQRLYVPPSSRG-HGHDNYEDTDVDNIEYDDNDG  59

Query  274  derdgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDD  453
            +E  GN+D        SG  ++EIDPLDAFMEGIHEEMKA PPPKPKEK+DKY+DD E+D
Sbjct  60   EEASGNDDGGAGAAGASGAEEEEIDPLDAFMEGIHEEMKAPPPPKPKEKVDKYRDDDEED  119

Query  454  PMESFLKAKKDIGLQLAAEALNAGYNS  534
            PMESFL+AKKD+GL LAA+AL+AGY+S
Sbjct  120  PMESFLRAKKDVGLTLAADALHAGYDS  146



>ref|XP_006444513.1| hypothetical protein CICLE_v10018925mg [Citrus clementina]
 gb|ESR57753.1| hypothetical protein CICLE_v10018925mg [Citrus clementina]
 gb|KDO86971.1| hypothetical protein CISIN_1g003881mg [Citrus sinensis]
 gb|KDO86972.1| hypothetical protein CISIN_1g003881mg [Citrus sinensis]
Length=630

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 117/142 (82%), Gaps = 5/142 (4%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            M+KRKFGF+GF INRQ +Y+FE+++APQRLYVPPSSR    HDNYEDTDLDNIDY++ D 
Sbjct  1    MTKRKFGFEGFNINRQTSYSFEQSQAPQRLYVPPSSRY--SHDNYEDTDLDNIDYEDNDA  58

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMESF  468
             +  N+  N        EIDPLDAFMEGIHEEM+AAPPPKPKEKL++YKDD E+DPMESF
Sbjct  59   AKAANDTGNGAEKE---EIDPLDAFMEGIHEEMRAAPPPKPKEKLERYKDDDEEDPMESF  115

Query  469  LKAKKDIGLQLAAEALNAGYNS  534
            L AKKD+GL LAA+AL AGY+S
Sbjct  116  LMAKKDVGLTLAADALRAGYDS  137



>gb|KDO86973.1| hypothetical protein CISIN_1g003881mg [Citrus sinensis]
Length=618

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 117/142 (82%), Gaps = 5/142 (4%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            M+KRKFGF+GF INRQ +Y+FE+++APQRLYVPPSSR    HDNYEDTDLDNIDY++ D 
Sbjct  1    MTKRKFGFEGFNINRQTSYSFEQSQAPQRLYVPPSSRY--SHDNYEDTDLDNIDYEDNDA  58

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMESF  468
             +  N+  N        EIDPLDAFMEGIHEEM+AAPPPKPKEKL++YKDD E+DPMESF
Sbjct  59   AKAANDTGNGAEKE---EIDPLDAFMEGIHEEMRAAPPPKPKEKLERYKDDDEEDPMESF  115

Query  469  LKAKKDIGLQLAAEALNAGYNS  534
            L AKKD+GL LAA+AL AGY+S
Sbjct  116  LMAKKDVGLTLAADALRAGYDS  137



>ref|XP_006349177.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Solanum 
tuberosum]
Length=774

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFGINRQ TYNFER +APQRLYVPPSSRS G HDNYEDTDLDNI   +   
Sbjct  1    MSKRKFGFEGFGINRQTTYNFERNQAPQRLYVPPSSRSGGSHDNYEDTDLDNI-EYDDHE  59

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMESF  468
                NND   G GG DDEIDPLDAFMEGIHEEMKAAPPPKPKEKLDKYKDD++DDPMESF
Sbjct  60   AVGGNNDDGGGGGGEDDEIDPLDAFMEGIHEEMKAAPPPKPKEKLDKYKDDVDDDPMESF  119

Query  469  LKAKKDIGLQLAAEALNAGYNS  534
            L+AKKD+GLQLAA+AL+AGYNS
Sbjct  120  LRAKKDVGLQLAADALHAGYNS  141



>ref|XP_004229381.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Solanum lycopersicum]
 ref|XP_010322339.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Solanum lycopersicum]
Length=774

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFGINRQ TYNFER +APQRLYVPPSSRS G HDNYEDTDLDNI   +   
Sbjct  1    MSKRKFGFEGFGINRQTTYNFERNQAPQRLYVPPSSRSGGSHDNYEDTDLDNI-EYDEHD  59

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMESF  468
                NN+   G GG DDEIDPLDAFMEGIH+EMKAAPPPKPKEKLDKYKDD++DDPMESF
Sbjct  60   AVGGNNNDGGGGGGEDDEIDPLDAFMEGIHQEMKAAPPPKPKEKLDKYKDDVDDDPMESF  119

Query  469  LKAKKDIGLQLAAEALNAGYNS  534
            L+AKKD+GLQLAA+AL+AGYNS
Sbjct  120  LRAKKDVGLQLAADALHAGYNS  141



>ref|XP_006444514.1| hypothetical protein CICLE_v10018925mg [Citrus clementina]
 ref|XP_006492349.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Citrus 
sinensis]
 gb|ESR57754.1| hypothetical protein CICLE_v10018925mg [Citrus clementina]
 gb|KDO86969.1| hypothetical protein CISIN_1g003881mg [Citrus sinensis]
 gb|KDO86970.1| hypothetical protein CISIN_1g003881mg [Citrus sinensis]
Length=789

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 117/142 (82%), Gaps = 5/142 (4%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            M+KRKFGF+GF INRQ +Y+FE+++APQRLYVPPSSR    HDNYEDTDLDNIDY++ D 
Sbjct  1    MTKRKFGFEGFNINRQTSYSFEQSQAPQRLYVPPSSRY--SHDNYEDTDLDNIDYEDNDA  58

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMESF  468
             +  N+  N        EIDPLDAFMEGIHEEM+AAPPPKPKEKL++YKDD E+DPMESF
Sbjct  59   AKAANDTGNGAEKE---EIDPLDAFMEGIHEEMRAAPPPKPKEKLERYKDDDEEDPMESF  115

Query  469  LKAKKDIGLQLAAEALNAGYNS  534
            L AKKD+GL LAA+AL AGY+S
Sbjct  116  LMAKKDVGLTLAADALRAGYDS  137



>gb|KDO86968.1| hypothetical protein CISIN_1g003881mg [Citrus sinensis]
Length=787

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 117/142 (82%), Gaps = 5/142 (4%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            M+KRKFGF+GF INRQ +Y+FE+++APQRLYVPPSSR    HDNYEDTDLDNIDY++ D 
Sbjct  1    MTKRKFGFEGFNINRQTSYSFEQSQAPQRLYVPPSSRY--SHDNYEDTDLDNIDYEDNDA  58

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMESF  468
             +  N+  N        EIDPLDAFMEGIHEEM+AAPPPKPKEKL++YKDD E+DPMESF
Sbjct  59   AKAANDTGNGAEKE---EIDPLDAFMEGIHEEMRAAPPPKPKEKLERYKDDDEEDPMESF  115

Query  469  LKAKKDIGLQLAAEALNAGYNS  534
            L AKKD+GL LAA+AL AGY+S
Sbjct  116  LMAKKDVGLTLAADALRAGYDS  137



>ref|XP_002882116.1| hypothetical protein ARALYDRAFT_483908 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58375.1| hypothetical protein ARALYDRAFT_483908 [Arabidopsis lyrata subsp. 
lyrata]
Length=739

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 115/144 (80%), Gaps = 5/144 (3%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNI--dyder  282
            MS RKFG +GFGINRQ +Y+FER++APQRLYVPPSSR   G DN ED DLDNI    +E 
Sbjct  1    MSNRKFGIEGFGINRQTSYSFERSQAPQRLYVPPSSR---GGDNSEDADLDNIDYIENEE  57

Query  283  dgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPME  462
               +         +GG DDEIDPLDAFMEGIH+EMK+APPPKPKEKL++YKDD +DDP+E
Sbjct  58   AEEDIEEGGSAAANGGEDDEIDPLDAFMEGIHQEMKSAPPPKPKEKLERYKDDEDDDPVE  117

Query  463  SFLKAKKDIGLQLAAEALNAGYNS  534
            SFLKAKKD+GL LAA+ALNAGYNS
Sbjct  118  SFLKAKKDLGLTLAADALNAGYNS  141



>ref|XP_003625986.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES82204.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=775

 Score =   151 bits (381),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 125/145 (86%), Gaps = 5/145 (3%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNId--yder  282
            MSKRKFGF+GFGINRQ+TY+FER++ PQRLYVPPSSR    HDN+ED DLDNI+   D R
Sbjct  1    MSKRKFGFEGFGINRQSTYSFERSQPPQRLYVPPSSRK--SHDNFEDNDLDNIEYDDDSR  58

Query  283  dgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekL-DKYKDDIEDDPM  459
            +   +N+++   G GG +DEIDPLDAFMEGIHEEMK+APPPKPKEK+ D+YKDD+EDDPM
Sbjct  59   EEQSNNDDNAGGGGGGEEDEIDPLDAFMEGIHEEMKSAPPPKPKEKVEDRYKDDLEDDPM  118

Query  460  ESFLKAKKDIGLQLAAEALNAGYNS  534
            ESFL+AKKD+GL LA++AL+AGY+S
Sbjct  119  ESFLRAKKDLGLTLASDALHAGYDS  143



>emb|CDP17060.1| unnamed protein product [Coffea canephora]
Length=778

 Score =   150 bits (380),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 124/145 (86%), Gaps = 5/145 (3%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSR-SVGGHDNYEDTDLDNIdyderd  285
            MSKRKFGF+GFGINRQATYNFER++APQRLYVPPS+R S GGHDNYEDTDLDNI  +  D
Sbjct  1    MSKRKFGFEGFGINRQATYNFERSQAPQRLYVPPSARSSSGGHDNYEDTDLDNI--EYDD  58

Query  286  gnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekL--DKYKDDIEDDPM  459
             + D+N + ND   G +DEIDPLDAFMEGIHEEM+A PPPKPK++L   K  ++ +DDPM
Sbjct  59   RDVDHNINNNDNGTGGNDEIDPLDAFMEGIHEEMRAPPPPKPKDRLDKYKDDEEDDDDPM  118

Query  460  ESFLKAKKDIGLQLAAEALNAGYNS  534
            ESFLKAKKD+GLQLAA+AL+AGYNS
Sbjct  119  ESFLKAKKDVGLQLAADALHAGYNS  143



>ref|XP_006397925.1| hypothetical protein EUTSA_v10001321mg [Eutrema salsugineum]
 gb|ESQ39378.1| hypothetical protein EUTSA_v10001321mg [Eutrema salsugineum]
Length=772

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 114/145 (79%), Gaps = 6/145 (4%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNI---dyde  279
            MS RK GF GFGINRQ TY+FER++APQRLYVPPSSR   G DN ED DLDNI   + +E
Sbjct  1    MSNRKSGFQGFGINRQTTYSFERSQAPQRLYVPPSSR---GGDNSEDADLDNIDYLENEE  57

Query  280  rdgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPM  459
             + + +        +   DDEIDPLDAFMEGIHEE+KAAPPPKPKEKL +YKDD +DDP+
Sbjct  58   AEEDVEIGGSAAAANDLEDDEIDPLDAFMEGIHEEVKAAPPPKPKEKLQRYKDDEDDDPV  117

Query  460  ESFLKAKKDIGLQLAAEALNAGYNS  534
            ESFLKAKKD+GL LAA+ALNAGYNS
Sbjct  118  ESFLKAKKDLGLTLAADALNAGYNS  142



>ref|XP_011042271.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Populus euphratica]
Length=800

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 118/144 (82%), Gaps = 9/144 (6%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFGINRQATYNFER++APQRLYVPPSSR    HDNYEDTDLDNI     D 
Sbjct  1    MSKRKFGFEGFGINRQATYNFERSQAPQRLYVPPSSRQ--NHDNYEDTDLDNI-----DY  53

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYK--DDIEDDPME  462
             +++    +  + G+  EIDPLDAFMEGIHEEM+AAPPP  KEK+++YK  DD +DDPME
Sbjct  54   ADNDAAKESAENNGSAAEIDPLDAFMEGIHEEMRAAPPPNAKEKVERYKDDDDEDDDPME  113

Query  463  SFLKAKKDIGLQLAAEALNAGYNS  534
            SFL+AKKD+GL LAA+AL+AGY+S
Sbjct  114  SFLRAKKDLGLTLAADALHAGYDS  137



>ref|XP_002515267.1| hypothetical protein RCOM_1346600 [Ricinus communis]
 gb|EEF47251.1| hypothetical protein RCOM_1346600 [Ricinus communis]
Length=791

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 114/143 (80%), Gaps = 8/143 (6%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFGINRQ TYNFE+++ PQRLYVPPS+R    HDNYEDTDLD I     D 
Sbjct  1    MSKRKFGFEGFGINRQKTYNFEQSQPPQRLYVPPSTRR--SHDNYEDTDLDEI-----DY  53

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIED-DPMES  465
             E+N N         +DEIDPLDAFMEGIHEEMKAAPPPK K+K +KY+DD +D DPMES
Sbjct  54   AEENENAKESNGAEENDEIDPLDAFMEGIHEEMKAAPPPKAKDKAEKYRDDEDDNDPMES  113

Query  466  FLKAKKDIGLQLAAEALNAGYNS  534
            FLKAKKD+GL LAA+AL+AGY+S
Sbjct  114  FLKAKKDVGLTLAADALHAGYDS  136



>ref|XP_002301515.2| DEAD/DEAH box helicase family protein [Populus trichocarpa]
 gb|EEE80788.2| DEAD/DEAH box helicase family protein [Populus trichocarpa]
Length=807

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 119/144 (83%), Gaps = 9/144 (6%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFGINRQATYNFER++APQRLYVPPSSR    HDNYEDTDLDNI     D 
Sbjct  1    MSKRKFGFEGFGINRQATYNFERSQAPQRLYVPPSSRQ--NHDNYEDTDLDNI-----DY  53

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYK--DDIEDDPME  462
            ++++    +  + G+  EIDPLDAFMEGIHEEM+AAPPPK KEK+++YK  DD EDDPME
Sbjct  54   DDNDAAKESAENNGSAAEIDPLDAFMEGIHEEMRAAPPPKAKEKVERYKDDDDEEDDPME  113

Query  463  SFLKAKKDIGLQLAAEALNAGYNS  534
            SFL+AKKD+GL LAA+AL AGY+S
Sbjct  114  SFLRAKKDLGLTLAADALRAGYDS  137



>ref|XP_009403707.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Musa 
acuminata subsp. malaccensis]
Length=768

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 115/144 (80%), Gaps = 3/144 (2%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFGINR ATYNFERA APQRLYVPPSSR VGGHDN+ED DLDNI+YD+ D 
Sbjct  1    MSKRKFGFEGFGINRPATYNFERASAPQRLYVPPSSR-VGGHDNHEDADLDNIEYDQSDA  59

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemka--apppkpkekLDKYKDDIEDDPME  462
             + +  +  DG+G  D EIDPLDAFMEGI EE++A      KPK+K DKY ++ +DDP+E
Sbjct  60   PDQSPPNGGDGAGDGDGEIDPLDAFMEGIQEEIRAPPPGTAKPKDKGDKYNEEDDDDPVE  119

Query  463  SFLKAKKDIGLQLAAEALNAGYNS  534
            SFL++KKD GL LA+E L+AGY S
Sbjct  120  SFLRSKKDAGLTLASEVLHAGYES  143



>ref|NP_566099.1| DEAD-box ATP-dependent RNA helicase 24 [Arabidopsis thaliana]
 sp|O22907.2|RH24_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 24 [Arabidopsis 
thaliana]
 gb|AAL15330.1| At2g47330/T8I13.17 [Arabidopsis thaliana]
 gb|AAB63833.2| putative ATP-dependent RNA helicase [Arabidopsis thaliana]
 gb|AAM70580.1| At2g47330/T8I13.17 [Arabidopsis thaliana]
 gb|AEC10828.1| DEAD-box ATP-dependent RNA helicase 24 [Arabidopsis thaliana]
Length=760

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 114/144 (79%), Gaps = 6/144 (4%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNI--dyder  282
            MS RKFG +GFGINRQ +Y+FER++APQRLYVPPSSR   G DN ED DLDNI    +E 
Sbjct  1    MSNRKFGMEGFGINRQTSYSFERSQAPQRLYVPPSSR---GGDNSEDADLDNIDYMENEE  57

Query  283  dgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPME  462
               +         SGG  DEIDPLDAFMEGIH+EMK+APPPKPKEKL++YKDD +DDP+E
Sbjct  58   AEEDIEEGGSAAASGGEVDEIDPLDAFMEGIHQEMKSAPPPKPKEKLERYKDD-DDDPVE  116

Query  463  SFLKAKKDIGLQLAAEALNAGYNS  534
            S+LKAKKD+GL LAA+ALNAGYNS
Sbjct  117  SYLKAKKDLGLTLAADALNAGYNS  140



>ref|XP_010267974.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Nelumbo nucifera]
Length=771

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 120/142 (85%), Gaps = 3/142 (2%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFGINR ATYNFER++APQRLYVPPSSRS  GHDNYED DLDNI+YDERD 
Sbjct  1    MSKRKFGFEGFGINRSATYNFERSQAPQRLYVPPSSRS-AGHDNYEDHDLDNIEYDERDD  59

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMESF  468
              D  ND + G+     EIDPLDAFMEGIHEEM+AAPPPK KEK DK+ DD EDDP+E F
Sbjct  60   RNDAPNDQSGGADDG--EIDPLDAFMEGIHEEMRAAPPPKAKEKADKFGDDDEDDPIEIF  117

Query  469  LKAKKDIGLQLAAEALNAGYNS  534
            L+AKKD+GL LA+EAL+AGY+S
Sbjct  118  LRAKKDVGLTLASEALHAGYDS  139



>ref|XP_007221465.1| hypothetical protein PRUPE_ppa001666mg [Prunus persica]
 gb|EMJ22664.1| hypothetical protein PRUPE_ppa001666mg [Prunus persica]
Length=783

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 120/146 (82%), Gaps = 5/146 (3%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAE-APQRLYVPPSSRSVGGHDNYEDTDLDNId---yd  276
            MSKRKFGF+GFGIN+Q+T+NFER++ APQRLYVPPSSR    HDNYEDTDLDNID    D
Sbjct  1    MSKRKFGFEGFGINKQSTFNFERSQQAPQRLYVPPSSRG-QSHDNYEDTDLDNIDYDDND  59

Query  277  erdgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDP  456
                  +NNN    G GG +DEIDPLDAFME IHEE+++APPPKPKEK +KYKDD EDDP
Sbjct  60   GSKDPGNNNNHDEGGGGGENDEIDPLDAFMESIHEEVRSAPPPKPKEKAEKYKDDEEDDP  119

Query  457  MESFLKAKKDIGLQLAAEALNAGYNS  534
            MESFL+AKKD+ L LA++AL+AGY+S
Sbjct  120  MESFLRAKKDVTLTLASDALHAGYDS  145



>ref|XP_011079539.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X2 
[Sesamum indicum]
Length=654

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFGINRQATYNFER++ PQRLYVPPSSR  GG D+ +  +++  +  +   
Sbjct  1    MSKRKFGFEGFGINRQATYNFERSQPPQRLYVPPSSRGGGGDDDADLDNIEYAEDRDTLD  60

Query  289  ned-nnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMES  465
            ++  NNN+ N+G+   +DEIDPLDAFMEG+ EEMK+APPPK KEKLD+YKDD+EDDPMES
Sbjct  61   DDVPNNNNNNNGAAADEDEIDPLDAFMEGLQEEMKSAPPPKAKEKLDRYKDDVEDDPMES  120

Query  466  FLKAKKDIGLQLAAEALNAGYNS  534
            FLKAKKD+GLQLAA+AL+AGYNS
Sbjct  121  FLKAKKDVGLQLAADALHAGYNS  143



>ref|XP_010938236.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Elaeis 
guineensis]
 ref|XP_010938237.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Elaeis 
guineensis]
 ref|XP_010938238.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Elaeis 
guineensis]
Length=769

 Score =   145 bits (366),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 113/144 (78%), Gaps = 7/144 (5%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFGINR ATY+FER++APQRLYVPPSSR  GG DNYED DLDNI     D 
Sbjct  1    MSKRKFGFEGFGINRPATYSFERSQAPQRLYVPPSSRGGGGQDNYEDHDLDNI-----DY  55

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemka--apppkpkekLDKYKDDIEDDPME  462
            ++ +  D    +   D EIDPLDAFMEGIHEE++A      KPK+K+DKY+DD EDDP+E
Sbjct  56   DQSDAPDRLPDAADGDGEIDPLDAFMEGIHEEIRAPPPASTKPKDKVDKYRDDDEDDPVE  115

Query  463  SFLKAKKDIGLQLAAEALNAGYNS  534
            SFL+AKKD+GL LAA+AL AGY+S
Sbjct  116  SFLRAKKDVGLTLAADALRAGYDS  139



>ref|XP_010518433.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X2 
[Camelina sativa]
Length=657

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 112/144 (78%), Gaps = 5/144 (3%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNI--dyder  282
            MS RKFG + FGINRQ TY+FER+EAPQR YVPPSSR   G DN ED DLDNI    +E 
Sbjct  1    MSNRKFGIEKFGINRQTTYSFERSEAPQRFYVPPSSR---GGDNSEDADLDNIDYIENEE  57

Query  283  dgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPME  462
               +         +GG DDEIDPLDAFMEGIH+EMKAAPPPKPKEKL++YKDD +DD +E
Sbjct  58   AEEDVEEGGSAAANGGEDDEIDPLDAFMEGIHQEMKAAPPPKPKEKLERYKDDEDDDHIE  117

Query  463  SFLKAKKDIGLQLAAEALNAGYNS  534
            SFLKAKKD+GL LAA+ALNAGYNS
Sbjct  118  SFLKAKKDLGLTLAADALNAGYNS  141



>ref|XP_008227876.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Prunus mume]
Length=787

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 121/148 (82%), Gaps = 7/148 (5%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAE-APQRLYVPPSSRSVGGHDNYEDTDLDNId-----  270
            MSKRKFGF+GFGIN+Q+T+NFER++ APQRLYVPPSSR    HDNYEDTDLDNID     
Sbjct  1    MSKRKFGFEGFGINKQSTFNFERSQQAPQRLYVPPSSRG-QSHDNYEDTDLDNIDYDDND  59

Query  271  yderdgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIED  450
                 GN +N+++   G G  +DEIDPLDAFME IHEE+++APPPKPKEK +KYKDD ED
Sbjct  60   GSRDPGNNNNHDEGGGGGGDENDEIDPLDAFMESIHEEVRSAPPPKPKEKAEKYKDDEED  119

Query  451  DPMESFLKAKKDIGLQLAAEALNAGYNS  534
            DPMESFL+AKKD+ L LA++AL+AGY+S
Sbjct  120  DPMESFLRAKKDVTLTLASDALHAGYDS  147



>ref|XP_011079538.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Sesamum indicum]
Length=770

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFGINRQATYNFER++ PQRLYVPPSSR  GG D+ +  +++  +  +   
Sbjct  1    MSKRKFGFEGFGINRQATYNFERSQPPQRLYVPPSSRGGGGDDDADLDNIEYAEDRDTLD  60

Query  289  ned-nnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMES  465
            ++  NNN+ N+G+   +DEIDPLDAFMEG+ EEMK+APPPK KEKLD+YKDD+EDDPMES
Sbjct  61   DDVPNNNNNNNGAAADEDEIDPLDAFMEGLQEEMKSAPPPKAKEKLDRYKDDVEDDPMES  120

Query  466  FLKAKKDIGLQLAAEALNAGYNS  534
            FLKAKKD+GLQLAA+AL+AGYNS
Sbjct  121  FLKAKKDVGLQLAADALHAGYNS  143



>ref|XP_010518432.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Camelina sativa]
Length=764

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 112/144 (78%), Gaps = 5/144 (3%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNI--dyder  282
            MS RKFG + FGINRQ TY+FER+EAPQR YVPPSSR   G DN ED DLDNI    +E 
Sbjct  1    MSNRKFGIEKFGINRQTTYSFERSEAPQRFYVPPSSR---GGDNSEDADLDNIDYIENEE  57

Query  283  dgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPME  462
               +         +GG DDEIDPLDAFMEGIH+EMKAAPPPKPKEKL++YKDD +DD +E
Sbjct  58   AEEDVEEGGSAAANGGEDDEIDPLDAFMEGIHQEMKAAPPPKPKEKLERYKDDEDDDHIE  117

Query  463  SFLKAKKDIGLQLAAEALNAGYNS  534
            SFLKAKKD+GL LAA+ALNAGYNS
Sbjct  118  SFLKAKKDLGLTLAADALNAGYNS  141



>ref|XP_007163191.1| hypothetical protein PHAVU_001G214100g [Phaseolus vulgaris]
 gb|ESW35185.1| hypothetical protein PHAVU_001G214100g [Phaseolus vulgaris]
Length=760

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 115/142 (81%), Gaps = 9/142 (6%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFGINRQ+TY+FER++APQRLYVPPSSR   GHDNYEDTDLDNI       
Sbjct  1    MSKRKFGFEGFGINRQSTYSFERSQAPQRLYVPPSSRH--GHDNYEDTDLDNI-------  51

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMESF  468
            + D NND    +   DDEIDPLDAFMEGIHEEM+AAPPP PKEK +    D +DDPM+SF
Sbjct  52   DYDENNDEGIKNSNDDDEIDPLDAFMEGIHEEMRAAPPPVPKEKAEDRYRDDDDDPMDSF  111

Query  469  LKAKKDIGLQLAAEALNAGYNS  534
            LKAKKD+GL LA+EAL+AGY+S
Sbjct  112  LKAKKDLGLTLASEALHAGYDS  133



>ref|XP_010506768.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X1 [Camelina sativa]
Length=765

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 113/145 (78%), Gaps = 6/145 (4%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MS RKFG + FGINRQ TY+FER+EAPQRLY PPSSR   G DN ED DLDNIDY E + 
Sbjct  1    MSNRKFGIEKFGINRQTTYSFERSEAPQRLYAPPSSR---GGDNSEDADLDNIDYIENEE  57

Query  289  nednnndindgsggadd---EIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPM  459
             +++  +    +        EIDPLDAFMEGIH+EMKAAPPPKPKEKL++YKDD +DD +
Sbjct  58   ADEDVEEGGGSAAANGGDDDEIDPLDAFMEGIHQEMKAAPPPKPKEKLERYKDDEDDDHI  117

Query  460  ESFLKAKKDIGLQLAAEALNAGYNS  534
            ESFLKAKKD+GL LAA+ALNAGYNS
Sbjct  118  ESFLKAKKDLGLTLAADALNAGYNS  142



>ref|XP_010506769.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X2 [Camelina sativa]
 ref|XP_010506771.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X3 [Camelina sativa]
Length=765

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 113/145 (78%), Gaps = 6/145 (4%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MS RKFG + FGINRQ TY+FER+EAPQRLY PPSSR   G DN ED DLDNIDY E + 
Sbjct  1    MSNRKFGIEKFGINRQTTYSFERSEAPQRLYAPPSSR---GGDNSEDADLDNIDYIENEE  57

Query  289  nednnndindgsggadd---EIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPM  459
             +++  +    +        EIDPLDAFMEGIH+EMKAAPPPKPKEKL++YKDD +DD +
Sbjct  58   ADEDVEEGGGSAAANGGDDDEIDPLDAFMEGIHQEMKAAPPPKPKEKLERYKDDEDDDHI  117

Query  460  ESFLKAKKDIGLQLAAEALNAGYNS  534
            ESFLKAKKD+GL LAA+ALNAGYNS
Sbjct  118  ESFLKAKKDLGLTLAADALNAGYNS  142



>gb|AGV54423.1| DEAD-box ATP-dependent RNA helicase 24-like protein [Phaseolus 
vulgaris]
Length=760

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 115/142 (81%), Gaps = 9/142 (6%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFGINRQ+TY+FER++APQRLYVPPSSR   GHDNYEDTDLDNI       
Sbjct  1    MSKRKFGFEGFGINRQSTYSFERSQAPQRLYVPPSSRH--GHDNYEDTDLDNI-------  51

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMESF  468
            + D NND    +   DDEIDPLDAFMEGIHEEM+AAPPP PKEK +    D +DDPM+SF
Sbjct  52   DYDENNDEGIKNSNDDDEIDPLDAFMEGIHEEMRAAPPPVPKEKAEDRYRDDDDDPMDSF  111

Query  469  LKAKKDIGLQLAAEALNAGYNS  534
            LKAKKD+GL LA+EAL+AGY+S
Sbjct  112  LKAKKDLGLTLASEALHAGYDS  133



>ref|XP_011468779.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X2 
[Fragaria vesca subsp. vesca]
Length=745

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 118/143 (83%), Gaps = 7/143 (5%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAP-QRLYVPPSSRSVGGHDNYEDTDLDNIdyderd  285
            MSKRKFGF+GFGINRQ+TYNFE+++ P QRLYVPPSSR+  GHDNYEDTDLDNI     D
Sbjct  1    MSKRKFGFEGFGINRQSTYNFEQSQQPPQRLYVPPSSRA-HGHDNYEDTDLDNI-----D  54

Query  286  gnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMES  465
             ++ +      G GG ++E+DPLDAFMEGIHEE+++APPPKPKEK DKY+DD E+D +ES
Sbjct  55   YDDVDAAANKGGDGGEEEEVDPLDAFMEGIHEEVRSAPPPKPKEKADKYQDDDEEDHLES  114

Query  466  FLKAKKDIGLQLAAEALNAGYNS  534
            FL+AKKD  L LA++AL+AGY+S
Sbjct  115  FLRAKKDATLTLASDALHAGYDS  137



>ref|XP_004288535.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Fragaria vesca subsp. vesca]
Length=779

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 118/143 (83%), Gaps = 7/143 (5%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAP-QRLYVPPSSRSVGGHDNYEDTDLDNIdyderd  285
            MSKRKFGF+GFGINRQ+TYNFE+++ P QRLYVPPSSR+  GHDNYEDTDLDNI     D
Sbjct  1    MSKRKFGFEGFGINRQSTYNFEQSQQPPQRLYVPPSSRA-HGHDNYEDTDLDNI-----D  54

Query  286  gnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMES  465
             ++ +      G GG ++E+DPLDAFMEGIHEE+++APPPKPKEK DKY+DD E+D +ES
Sbjct  55   YDDVDAAANKGGDGGEEEEVDPLDAFMEGIHEEVRSAPPPKPKEKADKYQDDDEEDHLES  114

Query  466  FLKAKKDIGLQLAAEALNAGYNS  534
            FL+AKKD  L LA++AL+AGY+S
Sbjct  115  FLRAKKDATLTLASDALHAGYDS  137



>ref|XP_009349922.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Pyrus 
x bretschneideri]
Length=782

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 120/144 (83%), Gaps = 2/144 (1%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAE-APQRLYVPPSSRSVGGHDNYEDTDLDNId-yder  282
            MSKRKFGF+GFGIN+Q+T++FER++ APQRLYVPPSSR    HDN+EDTDLDNID  D  
Sbjct  1    MSKRKFGFEGFGINKQSTFDFERSQQAPQRLYVPPSSRGGNSHDNFEDTDLDNIDYDDND  60

Query  283  dgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPME  462
              N+  N++ +   GG D+E+DPLDAFMEGIHEE+++APPPK KEK +KYKDD E+D ME
Sbjct  61   GSNDPGNDNSHGDGGGGDEEVDPLDAFMEGIHEEVRSAPPPKQKEKAEKYKDDEEEDHME  120

Query  463  SFLKAKKDIGLQLAAEALNAGYNS  534
            SFL+AKKD+ L LA++AL+AGY+S
Sbjct  121  SFLRAKKDVMLTLASDALHAGYDS  144



>ref|XP_007051130.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 3, partial [Theobroma cacao]
 gb|EOX95287.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 3, partial [Theobroma cacao]
Length=622

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 120/145 (83%), Gaps = 5/145 (3%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNI--dyder  282
            MSKRKFGF+GFGINRQ TYNFERA+APQRLYVPPSSR   GHDNYEDTDLDNI    ++ 
Sbjct  1    MSKRKFGFEGFGINRQPTYNFERAQAPQRLYVPPSSRH--GHDNYEDTDLDNIDYADNDT  58

Query  283  dgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYK-DDIEDDPM  459
                D NN  N+G+G  DDEIDPLDAFM+GI E++KA PPPKPKEK ++Y+ DD EDDP+
Sbjct  59   SREADKNNPNNNGNGAEDDEIDPLDAFMQGIQEDLKAPPPPKPKEKAERYRDDDEEDDPV  118

Query  460  ESFLKAKKDIGLQLAAEALNAGYNS  534
            ESFL+AKKD+GL LAA+AL AGY+S
Sbjct  119  ESFLRAKKDVGLTLAADALRAGYDS  143



>ref|XP_006293732.1| hypothetical protein CARUB_v10022694mg [Capsella rubella]
 gb|EOA26630.1| hypothetical protein CARUB_v10022694mg [Capsella rubella]
Length=761

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 114/144 (79%), Gaps = 5/144 (3%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNI--dyder  282
            MS RKFG +GFGINRQ TY+FER++ PQRLYVPPSSR   G DN ED DLDNI    +E 
Sbjct  1    MSNRKFGIEGFGINRQTTYSFERSQVPQRLYVPPSSR---GGDNSEDADLDNIDYMENEE  57

Query  283  dgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPME  462
               +         +GG DDEIDPLDAFMEGIH+EMKAAPPPKPKEKL++YKDD +DDP+E
Sbjct  58   AEEDVEEGPSAAANGGEDDEIDPLDAFMEGIHQEMKAAPPPKPKEKLERYKDDDDDDPIE  117

Query  463  SFLKAKKDIGLQLAAEALNAGYNS  534
            SFLKAKKD+GL LAA+ALNAGYNS
Sbjct  118  SFLKAKKDLGLTLAADALNAGYNS  141



>ref|XP_007051129.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOX95286.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2 [Theobroma cacao]
Length=781

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 120/145 (83%), Gaps = 5/145 (3%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNI--dyder  282
            MSKRKFGF+GFGINRQ TYNFERA+APQRLYVPPSSR   GHDNYEDTDLDNI    ++ 
Sbjct  1    MSKRKFGFEGFGINRQPTYNFERAQAPQRLYVPPSSRH--GHDNYEDTDLDNIDYADNDT  58

Query  283  dgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYK-DDIEDDPM  459
                D NN  N+G+G  DDEIDPLDAFM+GI E++KA PPPKPKEK ++Y+ DD EDDP+
Sbjct  59   SREADKNNPNNNGNGAEDDEIDPLDAFMQGIQEDLKAPPPPKPKEKAERYRDDDEEDDPV  118

Query  460  ESFLKAKKDIGLQLAAEALNAGYNS  534
            ESFL+AKKD+GL LAA+AL AGY+S
Sbjct  119  ESFLRAKKDVGLTLAADALRAGYDS  143



>ref|XP_008343158.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Malus 
domestica]
Length=778

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 118/145 (81%), Gaps = 3/145 (2%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFER-AEAPQRLYVPPSSRSVGGHDNYEDTDLDNId--yde  279
            MSKRKFGF+GFGIN+Q++++FER  +APQRLYVPPSSR    HDNYED DLDNID   ++
Sbjct  1    MSKRKFGFEGFGINKQSSFDFERPQQAPQRLYVPPSSRGGNSHDNYEDADLDNIDYDDND  60

Query  280  rdgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPM  459
               +  ++++ +   GG D+E+DPLDAFMEGIHEE+++APPPKPK K +KYKDD E+D M
Sbjct  61   GSKDPGSDDNNHGNGGGGDEEVDPLDAFMEGIHEEVRSAPPPKPKAKAEKYKDDEEEDHM  120

Query  460  ESFLKAKKDIGLQLAAEALNAGYNS  534
            ESFL AKKD+ L LA++AL+AGY+S
Sbjct  121  ESFLSAKKDVVLTLASDALHAGYDS  145



>ref|XP_007051128.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOX95285.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
Length=838

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 120/145 (83%), Gaps = 5/145 (3%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNI--dyder  282
            MSKRKFGF+GFGINRQ TYNFERA+APQRLYVPPSSR   GHDNYEDTDLDNI    ++ 
Sbjct  1    MSKRKFGFEGFGINRQPTYNFERAQAPQRLYVPPSSRH--GHDNYEDTDLDNIDYADNDT  58

Query  283  dgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYK-DDIEDDPM  459
                D NN  N+G+G  DDEIDPLDAFM+GI E++KA PPPKPKEK ++Y+ DD EDDP+
Sbjct  59   SREADKNNPNNNGNGAEDDEIDPLDAFMQGIQEDLKAPPPPKPKEKAERYRDDDEEDDPV  118

Query  460  ESFLKAKKDIGLQLAAEALNAGYNS  534
            ESFL+AKKD+GL LAA+AL AGY+S
Sbjct  119  ESFLRAKKDVGLTLAADALRAGYDS  143



>ref|XP_009370603.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Pyrus 
x bretschneideri]
Length=778

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 119/145 (82%), Gaps = 3/145 (2%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFER-AEAPQRLYVPPSSRSVGGHDNYEDTDLDNId--yde  279
            MSKRKFGF+GFG+N+Q++++FER  +APQRLYVPPSSR    HDNYED DLDNID   ++
Sbjct  1    MSKRKFGFEGFGMNKQSSFDFERPQQAPQRLYVPPSSRGGNSHDNYEDADLDNIDYDDND  60

Query  280  rdgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPM  459
               +  ++++ +   GG D+E+DPLDAFMEGIHEE+++APPPKPK K +KYKDD E+D M
Sbjct  61   GSKDPGSDDNNHGNGGGGDEEVDPLDAFMEGIHEEVRSAPPPKPKAKAEKYKDDEEEDHM  120

Query  460  ESFLKAKKDIGLQLAAEALNAGYNS  534
            ESFL+AKKD+ L LA++AL+AGY+S
Sbjct  121  ESFLRAKKDVVLTLASDALHAGYDS  145



>ref|XP_008381412.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Malus 
domestica]
Length=777

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 120/144 (83%), Gaps = 2/144 (1%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAE-APQRLYVPPSSRSVGGHDNYEDTDLDNId-yder  282
            MSKRKFGF+GFGIN+Q+ ++FER++ APQRLYVPPSSR    HDN+EDTDLDNID  D  
Sbjct  1    MSKRKFGFEGFGINKQSXFDFERSQQAPQRLYVPPSSRGGNSHDNFEDTDLDNIDYDDND  60

Query  283  dgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPME  462
              N+  N++ +   GG D+E+DPLDAFMEGIHEE+++APPPKPKEK +KYKDD E+D ME
Sbjct  61   GSNDPGNDNSHGDGGGGDEEVDPLDAFMEGIHEEVRSAPPPKPKEKAEKYKDDEEEDHME  120

Query  463  SFLKAKKDIGLQLAAEALNAGYNS  534
            SFL+AKKD+ L LA++AL+AGY+S
Sbjct  121  SFLRAKKDVMLTLASDALHAGYDS  144



>ref|XP_010069832.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Eucalyptus 
grandis]
 gb|KCW58317.1| hypothetical protein EUGRSUZ_H01004 [Eucalyptus grandis]
Length=797

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 121/154 (79%), Gaps = 12/154 (8%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRS---VGGHDNYEDTDLDNId---  270
            MSKRKFGF+GFGINRQATYNFER++ PQRL+VP  S S     GHDNYEDTDLDNI+   
Sbjct  1    MSKRKFGFEGFGINRQATYNFERSQPPQRLFVPSPSSSSSRAHGHDNYEDTDLDNIEYDA  60

Query  271  ------yderdgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKY  432
                   +E +G    + D + G GG ++EIDPLDAFMEGIHEEM+AAPPPKPKEK +KY
Sbjct  61   EAEDAAGEEENGGGAGDGDGDGGDGGGEEEIDPLDAFMEGIHEEMRAAPPPKPKEKAEKY  120

Query  433  KDDIEDDPMESFLKAKKDIGLQLAAEALNAGYNS  534
            +DD +DDPMESFL+AKKD+GL LA++ L+AGY+S
Sbjct  121  RDDEDDDPMESFLRAKKDVGLTLASDVLHAGYDS  154



>ref|XP_004494432.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X2 [Cicer arietinum]
Length=775

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 119/144 (83%), Gaps = 4/144 (3%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNId-yderd  285
            MSKRKFGF+GFGINRQ+TY+FER++ PQRLYVPPSSR   GHDNYEDTD+DNI+  D+  
Sbjct  1    MSKRKFGFEGFGINRQSTYSFERSQPPQRLYVPPSSRK--GHDNYEDTDIDNIEYDDDTR  58

Query  286  gnednnndindgsggaddEIDPLDAFMEGIHeemkaa-pppkpkekLDKYKDDIEDDPME  462
               +NNND + G    ++EIDPLDAFMEGIHEEMKAA PP   ++  D+Y+DD EDDPME
Sbjct  59   DEANNNNDGDGGGADKEEEIDPLDAFMEGIHEEMKAAPPPKPKEKAEDRYRDDEEDDPME  118

Query  463  SFLKAKKDIGLQLAAEALNAGYNS  534
            SFL+AKKD+GL LA+EAL+AGY+S
Sbjct  119  SFLRAKKDLGLTLASEALHAGYDS  142



>ref|XP_004494431.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X1 [Cicer arietinum]
Length=776

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 119/144 (83%), Gaps = 4/144 (3%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNId-yderd  285
            MSKRKFGF+GFGINRQ+TY+FER++ PQRLYVPPSSR   GHDNYEDTD+DNI+  D+  
Sbjct  1    MSKRKFGFEGFGINRQSTYSFERSQPPQRLYVPPSSRK--GHDNYEDTDIDNIEYDDDTR  58

Query  286  gnednnndindgsggaddEIDPLDAFMEGIHeemkaa-pppkpkekLDKYKDDIEDDPME  462
               +NNND + G    ++EIDPLDAFMEGIHEEMKAA PP   ++  D+Y+DD EDDPME
Sbjct  59   DEANNNNDGDGGGADKEEEIDPLDAFMEGIHEEMKAAPPPKPKEKAEDRYRDDEEDDPME  118

Query  463  SFLKAKKDIGLQLAAEALNAGYNS  534
            SFL+AKKD+GL LA+EAL+AGY+S
Sbjct  119  SFLRAKKDLGLTLASEALHAGYDS  142



>ref|XP_008781128.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
24-like [Phoenix dactylifera]
Length=765

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 106/140 (76%), Gaps = 7/140 (5%)
 Frame = +1

Query  121  KFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdgnedn  300
            KFGF+GFGINR ATY+FER++APQRLYVPPSSR  GG D+YED DLDNI     D ++ +
Sbjct  3    KFGFEGFGINRPATYSFERSQAPQRLYVPPSSRRGGGLDSYEDHDLDNI-----DYDQSD  57

Query  301  nndindgsggaddEIDPLDAFMEGIHeemkaapppkpke--kLDKYKDDIEDDPMESFLK  474
              D    +G  D EIDPLDAFMEGI EE++A PPP  K   K D Y DD EDDP+ESFL+
Sbjct  58   ATDRRPDAGDGDGEIDPLDAFMEGIQEEIRAPPPPSAKPKDKEDNYPDDEEDDPVESFLR  117

Query  475  AKKDIGLQLAAEALNAGYNS  534
            AKKD+GL LA+EAL AGY+S
Sbjct  118  AKKDVGLTLASEALRAGYDS  137



>ref|XP_010507898.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Camelina 
sativa]
Length=647

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 113/144 (78%), Gaps = 5/144 (3%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNI--dyder  282
            MS RKFG + FGINRQ TY+FER+EAPQRLYVPPSSR   G DN ED DLDNI    +E 
Sbjct  1    MSNRKFGIEKFGINRQTTYSFERSEAPQRLYVPPSSR---GGDNSEDADLDNIDYIENEE  57

Query  283  dgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPME  462
               +         +GG DDEIDPLDAFMEGIH+EMKAAPPPKPKEKL++YKDD +DD +E
Sbjct  58   AEEDVEEGGSAAANGGDDDEIDPLDAFMEGIHQEMKAAPPPKPKEKLERYKDDDDDDHIE  117

Query  463  SFLKAKKDIGLQLAAEALNAGYNS  534
            SFLKAKKD+GL LAA+ALNAGYNS
Sbjct  118  SFLKAKKDLGLTLAADALNAGYNS  141



>ref|XP_008808687.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Phoenix 
dactylifera]
 ref|XP_008808688.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Phoenix 
dactylifera]
 ref|XP_008808689.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Phoenix 
dactylifera]
Length=771

 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 109/146 (75%), Gaps = 9/146 (6%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFGINR ATY+FER++APQRLYVPPSSR  GGHDN+ED DLDNI     D 
Sbjct  1    MSKRKFGFEGFGINRPATYSFERSQAPQRLYVPPSSRGGGGHDNHEDHDLDNI-----DY  55

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemka----apppkpkekLDKYKDDIEDDP  456
            ++ +  D    +GG D EIDPLDAFMEGIHEE++A    +  PK K       DD +DDP
Sbjct  56   DQPDAPDRPADAGGGDGEIDPLDAFMEGIHEEIRAPPPPSVKPKDKGDKYPDDDDDDDDP  115

Query  457  MESFLKAKKDIGLQLAAEALNAGYNS  534
            +ESFL+A+KD+GL LAAE L AGY+S
Sbjct  116  VESFLRARKDVGLTLAAEVLRAGYDS  141



>ref|XP_006840470.1| hypothetical protein AMTR_s00045p00182070 [Amborella trichopoda]
 gb|ERN02145.1| hypothetical protein AMTR_s00045p00182070 [Amborella trichopoda]
Length=768

 Score =   134 bits (336),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 104/142 (73%), Gaps = 5/142 (4%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFGINRQ TY+FER+ APQRLY PPSSR+ G HDNYED DLD+I   E D 
Sbjct  1    MSKRKFGFEGFGINRQQTYSFERSSAPQRLYTPPSSRN-GDHDNYEDHDLDDI---EYDN  56

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMESF  468
            +    N+        D EIDPLDAFME IH+EM    P   ++   K+++D +DDP+ESF
Sbjct  57   SGSKENENEAKPDSGDGEIDPLDAFMEAIHQEMIKETPKPKEKP-SKFEEDEDDDPVESF  115

Query  469  LKAKKDIGLQLAAEALNAGYNS  534
            L+AKKD+GL LAAEAL AGY+S
Sbjct  116  LRAKKDVGLTLAAEALQAGYDS  137



>gb|KHG13094.1| DEAD-box ATP-dependent RNA helicase 24 -like protein [Gossypium 
arboreum]
Length=775

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 117/146 (80%), Gaps = 6/146 (4%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFGINRQ+TYNFER++APQRLYVPPSSR    HDNYED DLD+IDY + + 
Sbjct  1    MSKRKFGFEGFGINRQSTYNFERSQAPQRLYVPPSSRH--SHDNYEDNDLDDIDYADNND  58

Query  289  nednnndindgsggadd---EIDPLDAFMEGIHeemkaapppkpkekLDKYK-DDIEDDP  456
              ++ +  +  S G      EIDPLDAFM+GI E++KA PPPKPKEK ++YK D+ EDDP
Sbjct  59   TSNDADTSDPTSNGNGGEDDEIDPLDAFMQGIEEDLKAKPPPKPKEKAERYKEDEDEDDP  118

Query  457  MESFLKAKKDIGLQLAAEALNAGYNS  534
            +ESFL++KKD+GL LAA+AL AGY+S
Sbjct  119  VESFLRSKKDVGLTLAADALRAGYDS  144



>gb|KJB22485.1| hypothetical protein B456_004G050000 [Gossypium raimondii]
Length=776

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 120/147 (82%), Gaps = 7/147 (5%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNI----dyd  276
            MSKRKFGF+GFGINRQ+TYNFER++APQRLYVPPSSR    HDNYED DLD+I    + D
Sbjct  1    MSKRKFGFEGFGINRQSTYNFERSQAPQRLYVPPSSRH--SHDNYEDNDLDDIDYADNND  58

Query  277  erdgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYK-DDIEDD  453
              +  + N+   ++G+GG DDEIDPLDAFM+GI E++KA P PKPKEK ++Y+ D+ EDD
Sbjct  59   TSNDADTNDPTTSNGNGGEDDEIDPLDAFMQGIEEDLKAKPTPKPKEKAERYRDDEDEDD  118

Query  454  PMESFLKAKKDIGLQLAAEALNAGYNS  534
            P+ESFL++KKD+GL LAA+AL AGY+S
Sbjct  119  PVESFLRSKKDVGLTLAADALRAGYDS  145



>gb|KJB22484.1| hypothetical protein B456_004G050000 [Gossypium raimondii]
Length=661

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 116/147 (79%), Gaps = 7/147 (5%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFGINRQ+TYNFER++APQRLYVPPSSR    HDNYED DLD+IDY + + 
Sbjct  1    MSKRKFGFEGFGINRQSTYNFERSQAPQRLYVPPSSRH--SHDNYEDNDLDDIDYADNND  58

Query  289  nednnndindgsggadd----EIDPLDAFMEGIHeemkaapppkpkekLDKYK-DDIEDD  453
              ++ +  +  +   +     EIDPLDAFM+GI E++KA P PKPKEK ++Y+ D+ EDD
Sbjct  59   TSNDADTNDPTTSNGNGGEDDEIDPLDAFMQGIEEDLKAKPTPKPKEKAERYRDDEDEDD  118

Query  454  PMESFLKAKKDIGLQLAAEALNAGYNS  534
            P+ESFL++KKD+GL LAA+AL AGY+S
Sbjct  119  PVESFLRSKKDVGLTLAADALRAGYDS  145



>ref|XP_009416320.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Musa 
acuminata subsp. malaccensis]
Length=764

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 106/144 (74%), Gaps = 9/144 (6%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFG+NR ATYNFER  APQRLYVPPSSR  GGHDN+ED DLDNI       
Sbjct  1    MSKRKFGFEGFGVNRPATYNFERTSAPQRLYVPPSSRG-GGHDNHEDADLDNI------D  53

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemka--apppkpkekLDKYKDDIEDDPME  462
             +  +        G D EIDPLDAFMEGI EE++A       PK+K DKYKDD EDDP+E
Sbjct  54   YDQPDFPERSSPAGDDGEIDPLDAFMEGIQEEIRAPPPASVNPKDKDDKYKDDDEDDPVE  113

Query  463  SFLKAKKDIGLQLAAEALNAGYNS  534
            SFL++KKD GL LA+EAL+AGY+S
Sbjct  114  SFLRSKKDTGLTLASEALHAGYDS  137



>ref|XP_010679398.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=666

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 115/145 (79%), Gaps = 6/145 (4%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAE-APQRLYVPPSSRSVGGHDNYEDTDLDNIdyderd  285
            MSKRKFGF+GFGINRQ TYNFE ++  PQRLY+PPSS S   HD+YEDTD+DN   D  +
Sbjct  1    MSKRKFGFEGFGINRQQTYNFEGSQPQPQRLYIPPSSSS-RPHDHYEDTDVDN--IDFDN  57

Query  286  gnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYK--DDIEDDPM  459
               DNNN+ N    G  +EIDPLDAFMEGIH+E+  APPPKPKEKLDKY+  DD EDDPM
Sbjct  58   NVNDNNNNNNISDVGNSEEIDPLDAFMEGIHKEVSEAPPPKPKEKLDKYRDDDDDEDDPM  117

Query  460  ESFLKAKKDIGLQLAAEALNAGYNS  534
            ESFL+AKKD+GL LA++AL AGY+S
Sbjct  118  ESFLRAKKDVGLALASDALRAGYDS  142



>ref|XP_010679397.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=772

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 115/145 (79%), Gaps = 6/145 (4%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAE-APQRLYVPPSSRSVGGHDNYEDTDLDNIdyderd  285
            MSKRKFGF+GFGINRQ TYNFE ++  PQRLY+PPSS S   HD+YEDTD+DN   D  +
Sbjct  1    MSKRKFGFEGFGINRQQTYNFEGSQPQPQRLYIPPSSSS-RPHDHYEDTDVDN--IDFDN  57

Query  286  gnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYK--DDIEDDPM  459
               DNNN+ N    G  +EIDPLDAFMEGIH+E+  APPPKPKEKLDKY+  DD EDDPM
Sbjct  58   NVNDNNNNNNISDVGNSEEIDPLDAFMEGIHKEVSEAPPPKPKEKLDKYRDDDDDEDDPM  117

Query  460  ESFLKAKKDIGLQLAAEALNAGYNS  534
            ESFL+AKKD+GL LA++AL AGY+S
Sbjct  118  ESFLRAKKDVGLALASDALRAGYDS  142



>ref|XP_006388444.1| hypothetical protein POPTR_0184s002102g, partial [Populus trichocarpa]
 gb|ERP47358.1| hypothetical protein POPTR_0184s002102g, partial [Populus trichocarpa]
Length=97

 Score =   113 bits (282),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 71/90 (79%), Gaps = 7/90 (8%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFGINRQATYNFER++APQRLYVPPSSR    HDNYEDTDLDNI     D 
Sbjct  1    MSKRKFGFEGFGINRQATYNFERSQAPQRLYVPPSSRQ--NHDNYEDTDLDNI-----DY  53

Query  289  nednnndindgsggaddEIDPLDAFMEGIH  378
            ++++    +  + G+  EIDPLDAFMEGIH
Sbjct  54   DDNDAAKESAENNGSAAEIDPLDAFMEGIH  83



>ref|XP_003521597.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Glycine 
max]
Length=782

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 123/151 (81%), Gaps = 11/151 (7%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFGINRQ+TY+FER +APQRLY+PPS+R   GHD+YEDTD+DNIDYD+ + 
Sbjct  1    MSKRKFGFEGFGINRQSTYSFERPQAPQRLYIPPSARH--GHDHYEDTDIDNIDYDDNNS  58

Query  289  nednnndindgsggadd--------EIDPLDAFMEGIHeemkaapppk-pkekLDKYKDD  441
            N +NN D +D  G  ++        EIDPLDAFMEGIHEEM+AAPPPK  ++  D+Y+DD
Sbjct  59   NNNNNKDDDDDYGSNNNNGGGNDEDEIDPLDAFMEGIHEEMRAAPPPKPKEKAEDRYRDD  118

Query  442  IEDDPMESFLKAKKDIGLQLAAEALNAGYNS  534
             +DDPMESFL AKKD+GL LA++AL+AGY+S
Sbjct  119  EDDDPMESFLMAKKDLGLTLASDALHAGYDS  149



>gb|KJB22489.1| hypothetical protein B456_004G050200 [Gossypium raimondii]
Length=774

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 109/158 (69%), Gaps = 30/158 (19%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSR---------------SVGGHDNY  243
            MSKRKFGF+GFGINRQ+TYNFER++APQRLYVPPSSR                   +D  
Sbjct  1    MSKRKFGFEGFGINRQSTYNFERSQAPQRLYVPPSSRHSHDNYDDNDLDDIDYADNNDTS  60

Query  244  EDTDLDNIdyderdgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekL  423
             D D +                 ++G+GG DDEIDPLDAFM+GI E++KA PPPKPKEK 
Sbjct  61   NDADTNG--------------PTSNGNGGEDDEIDPLDAFMQGIEEDLKAKPPPKPKEKA  106

Query  424  DKYK-DDIEDDPMESFLKAKKDIGLQLAAEALNAGYNS  534
            ++YK D+ EDDP+ESFL++KKD+GL LAA+AL AGY+S
Sbjct  107  ERYKEDEDEDDPVESFLRSKKDVGLTLAADALRAGYDS  144



>gb|KJB22491.1| hypothetical protein B456_004G050200 [Gossypium raimondii]
 gb|KJB22492.1| hypothetical protein B456_004G050200 [Gossypium raimondii]
Length=775

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 109/158 (69%), Gaps = 30/158 (19%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSR---------------SVGGHDNY  243
            MSKRKFGF+GFGINRQ+TYNFER++APQRLYVPPSSR                   +D  
Sbjct  1    MSKRKFGFEGFGINRQSTYNFERSQAPQRLYVPPSSRHSHDNYDDNDLDDIDYADNNDTS  60

Query  244  EDTDLDNIdyderdgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekL  423
             D D +                 ++G+GG DDEIDPLDAFM+GI E++KA PPPKPKEK 
Sbjct  61   NDADTNG--------------PTSNGNGGEDDEIDPLDAFMQGIEEDLKAKPPPKPKEKA  106

Query  424  DKYK-DDIEDDPMESFLKAKKDIGLQLAAEALNAGYNS  534
            ++YK D+ EDDP+ESFL++KKD+GL LAA+AL AGY+S
Sbjct  107  ERYKEDEDEDDPVESFLRSKKDVGLTLAADALRAGYDS  144



>gb|KJB22487.1| hypothetical protein B456_004G050200 [Gossypium raimondii]
Length=793

 Score =   112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 109/158 (69%), Gaps = 30/158 (19%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSR---------------SVGGHDNY  243
            MSKRKFGF+GFGINRQ+TYNFER++APQRLYVPPSSR                   +D  
Sbjct  1    MSKRKFGFEGFGINRQSTYNFERSQAPQRLYVPPSSRHSHDNYDDNDLDDIDYADNNDTS  60

Query  244  EDTDLDNIdyderdgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekL  423
             D D +                 ++G+GG DDEIDPLDAFM+GI E++KA PPPKPKEK 
Sbjct  61   NDADTNG--------------PTSNGNGGEDDEIDPLDAFMQGIEEDLKAKPPPKPKEKA  106

Query  424  DKYK-DDIEDDPMESFLKAKKDIGLQLAAEALNAGYNS  534
            ++YK D+ EDDP+ESFL++KKD+GL LAA+AL AGY+S
Sbjct  107  ERYKEDEDEDDPVESFLRSKKDVGLTLAADALRAGYDS  144



>gb|KHG18820.1| DEAD-box ATP-dependent RNA helicase 24 -like protein [Gossypium 
arboreum]
Length=775

 Score =   111 bits (278),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 119/144 (83%), Gaps = 2/144 (1%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSR-SVGGHDNYEDTDLDNIdyderd  285
            MSKRKFGF+GFGINRQ+TYNFER++APQRLYVPPSSR S   +D+ +  D+D  D ++  
Sbjct  1    MSKRKFGFEGFGINRQSTYNFERSQAPQRLYVPPSSRHSHDNYDDNDLDDIDYADNNDTS  60

Query  286  gnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYK-DDIEDDPME  462
             + + N+  ++G+GG DDEIDPLDAFM+GI E++KA PPPKPKEK ++YK D+ EDDP+E
Sbjct  61   NDANTNDPTSNGNGGEDDEIDPLDAFMQGIEEDLKAKPPPKPKEKAERYKEDEDEDDPVE  120

Query  463  SFLKAKKDIGLQLAAEALNAGYNS  534
            SFL++KKD+GL LAA+AL AGY+S
Sbjct  121  SFLRSKKDVGLTLAADALRAGYDS  144



>gb|KJB22490.1| hypothetical protein B456_004G050200 [Gossypium raimondii]
Length=636

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 109/158 (69%), Gaps = 30/158 (19%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSR---------------SVGGHDNY  243
            MSKRKFGF+GFGINRQ+TYNFER++APQRLYVPPSSR                   +D  
Sbjct  1    MSKRKFGFEGFGINRQSTYNFERSQAPQRLYVPPSSRHSHDNYDDNDLDDIDYADNNDTS  60

Query  244  EDTDLDNIdyderdgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekL  423
             D D +                 ++G+GG DDEIDPLDAFM+GI E++KA PPPKPKEK 
Sbjct  61   NDADTNG--------------PTSNGNGGEDDEIDPLDAFMQGIEEDLKAKPPPKPKEKA  106

Query  424  DKYK-DDIEDDPMESFLKAKKDIGLQLAAEALNAGYNS  534
            ++YK D+ EDDP+ESFL++KKD+GL LAA+AL AGY+S
Sbjct  107  ERYKEDEDEDDPVESFLRSKKDVGLTLAADALRAGYDS  144



>gb|KJB22488.1| hypothetical protein B456_004G050200 [Gossypium raimondii]
Length=660

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 109/158 (69%), Gaps = 30/158 (19%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSR---------------SVGGHDNY  243
            MSKRKFGF+GFGINRQ+TYNFER++APQRLYVPPSSR                   +D  
Sbjct  1    MSKRKFGFEGFGINRQSTYNFERSQAPQRLYVPPSSRHSHDNYDDNDLDDIDYADNNDTS  60

Query  244  EDTDLDNIdyderdgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekL  423
             D D +                 ++G+GG DDEIDPLDAFM+GI E++KA PPPKPKEK 
Sbjct  61   NDADTNG--------------PTSNGNGGEDDEIDPLDAFMQGIEEDLKAKPPPKPKEKA  106

Query  424  DKYK-DDIEDDPMESFLKAKKDIGLQLAAEALNAGYNS  534
            ++YK D+ EDDP+ESFL++KKD+GL LAA+AL AGY+S
Sbjct  107  ERYKEDEDEDDPVESFLRSKKDVGLTLAADALRAGYDS  144



>gb|EPS66709.1| hypothetical protein M569_08067 [Genlisea aurea]
Length=753

 Score =   108 bits (270),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 102/142 (72%), Gaps = 9/142 (6%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGFDG   +RQ+ YNFE +   QR Y PPSSR  GG D+ +  +++       + 
Sbjct  1    MSKRKFGFDG---DRQSNYNFEESSRSQRFYFPPSSRLGGGDDDADLDNIE------YEE  51

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMESF  468
            ++D + +      G ++EIDPLDA+M G+ EE+KAAPPPK KEK DKYKDD EDDPMESF
Sbjct  52   DQDTSGEAARDCNGGEEEIDPLDAYMNGLEEEIKAAPPPKAKEKFDKYKDDAEDDPMESF  111

Query  469  LKAKKDIGLQLAAEALNAGYNS  534
            L AKKD+ LQLAA+AL+AGYNS
Sbjct  112  LMAKKDVALQLAADALHAGYNS  133



>gb|KHN19202.1| DEAD-box ATP-dependent RNA helicase 24 [Glycine soja]
Length=784

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 121/154 (79%), Gaps = 15/154 (10%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYV---PPSSRSVGGHDNYEDTDLDNIdyde  279
            MSKRKFGF+GFGINRQ+TY+FER +APQRLY+   PP+     GHD+YEDTD+DNIDYD+
Sbjct  1    MSKRKFGFEGFGINRQSTYSFERPQAPQRLYIHIPPPAPH---GHDHYEDTDIDNIDYDD  57

Query  280  rdgnednnndindgsggadd--------EIDPLDAFMEGIHeemkaapppk-pkekLDKY  432
             + N +NN D +D  G  ++        EIDPLDAFMEGIHEEM+AAPPPK  ++  D+Y
Sbjct  58   NNSNNNNNKDDDDDYGSNNNNGGGNDEDEIDPLDAFMEGIHEEMRAAPPPKPKEKAEDRY  117

Query  433  KDDIEDDPMESFLKAKKDIGLQLAAEALNAGYNS  534
            +DD +DDPMESFL AKKD+GL LA++AL+AGY+S
Sbjct  118  RDDEDDDPMESFLMAKKDLGLTLASDALHAGYDS  151



>ref|XP_003554554.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Glycine 
max]
Length=768

 Score =   102 bits (255),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 115/142 (81%), Gaps = 4/142 (3%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKRKFGF+GFGINRQ+TY+FER++ PQRLYVPPS+R   GHD+YEDTD+DNID+D+ + 
Sbjct  1    MSKRKFGFEGFGINRQSTYSFERSQPPQRLYVPPSARH--GHDHYEDTDIDNIDFDDNNN  58

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMESF  468
            ++ + N+   G+   D+    LDAFMEGIHEEM+AAPPPK K +     D+ +DDP+ESF
Sbjct  59   DDGSKNNNGGGNDDDDEIDP-LDAFMEGIHEEMRAAPPPKEKAEDRYRDDE-DDDPLESF  116

Query  469  LKAKKDIGLQLAAEALNAGYNS  534
            LKAKKD+GL LA++AL+AGY+S
Sbjct  117  LKAKKDLGLTLASDALHAGYDS  138



>ref|XP_001779387.1| predicted protein [Physcomitrella patens]
 gb|EDQ55777.1| predicted protein [Physcomitrella patens]
Length=741

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 96/150 (64%), Gaps = 13/150 (9%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVP-PSSRSVGGHDNYEDTDLDNIdyderd  285
            MSKR+FGF+GFGIN++  Y+FE   A  RLY+P P +R     +  ED DLDNI  ++  
Sbjct  1    MSKRRFGFEGFGINKKTNYDFEAQPAKPRLYLPSPRNRR---SEYVEDHDLDNIGSEDDG  57

Query  286  gnednnndindgsggadd-------EIDPLDAFMEGIHeemkaapppkpkekLDKYKDDI  444
               +N  + ++ +            E+DPLDAFMEGIHEE+K AP       + +  +D 
Sbjct  58   RESENFRNRDENNNAGSGAVPDNDDEVDPLDAFMEGIHEEVKKAPVKPRP--IVEELEDD  115

Query  445  EDDPMESFLKAKKDIGLQLAAEALNAGYNS  534
            EDDPMESFLKA++D GL LAAEAL+AGY++
Sbjct  116  EDDPMESFLKARRDAGLSLAAEALHAGYDT  145



>ref|NP_001049904.1| Os03g0308500 [Oryza sativa Japonica Group]
 sp|Q10MH8.1|RH24_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 24 [Oryza sativa 
Japonica Group]
 gb|ABF95549.1| DEAD/DEAH box helicase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11818.1| Os03g0308500 [Oryza sativa Japonica Group]
 dbj|BAG96306.1| unnamed protein product [Oryza sativa Japonica Group]
Length=770

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 89/144 (62%), Gaps = 15/144 (10%)
 Frame = +1

Query  109  MSKR-KFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNId-yder  282
            MSKR K G  GF I R  +Y+FER++ PQRLYVP            +D DLD+I   D+ 
Sbjct  1    MSKRPKLG--GFSIPRPTSYSFERSQPPQRLYVP-----------ADDPDLDDIAFSDDA  47

Query  283  dgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPME  462
                D       G+ G ++EIDPLDAFM  I EE++A PP    E L +   D EDDP+E
Sbjct  48   AAPSDAPPAGGGGAAGDEEEIDPLDAFMAEIQEEIRAPPPAPKPEALRRADSDDEDDPVE  107

Query  463  SFLKAKKDIGLQLAAEALNAGYNS  534
            SFL+AKKD GL LAA+A++AGY+S
Sbjct  108  SFLRAKKDSGLALAADAMHAGYDS  131



>emb|CDX83333.1| BnaA03g21730D [Brassica napus]
Length=637

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 87/108 (81%), Gaps = 2/108 (2%)
 Frame = +1

Query  211  SSRSVGGHDNYEDTDLDNIdyderdgnednnndindgsggaddEIDPLDAFMEGIHeemk  390
            S+R  GG DN ED D+DNID+ E + +E+++ D    +   D EIDPLDAFMEGIHEEMK
Sbjct  6    STRFRGG-DNSEDADVDNIDFTENEEDEEDDVDNGASASAND-EIDPLDAFMEGIHEEMK  63

Query  391  aapppkpkekLDKYKDDIEDDPMESFLKAKKDIGLQLAAEALNAGYNS  534
            AAPPPKPKEK+++YKDD +DD + SFLKAKKD+GL LAA+ALNAGYNS
Sbjct  64   AAPPPKPKEKVERYKDDEDDDHVVSFLKAKKDLGLTLAADALNAGYNS  111



>ref|XP_009135930.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like, partial 
[Brassica rapa]
Length=636

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 87/108 (81%), Gaps = 2/108 (2%)
 Frame = +1

Query  211  SSRSVGGHDNYEDTDLDNIdyderdgnednnndindgsggaddEIDPLDAFMEGIHeemk  390
            S+R  GG DN ED D+DNID+ E + +E+++ D    +   D EIDPLDAFMEGIHEEMK
Sbjct  6    STRFRGG-DNSEDADVDNIDFTENEEDEEDDVDNGASASAND-EIDPLDAFMEGIHEEMK  63

Query  391  aapppkpkekLDKYKDDIEDDPMESFLKAKKDIGLQLAAEALNAGYNS  534
            AAPPPKPKEK+++YKDD +DD + SFLKAKKD+GL LAA+ALNAGYNS
Sbjct  64   AAPPPKPKEKVERYKDDEDDDHVVSFLKAKKDLGLTLAADALNAGYNS  111



>gb|AFW88580.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
Length=768

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 86/143 (60%), Gaps = 13/143 (9%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKR    +GF I R  +YNFER++  QRLY P            +D DLD+I + +   
Sbjct  1    MSKRP-KLEGFSIPRPTSYNFERSQPVQRLYRP-----------TDDPDLDDIAFSDDAP  48

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKY-KDDIEDDPMES  465
            ++       DG    D+EIDPLDAFM  I EE++A PPP   E L +    D EDDP+ES
Sbjct  49   SDAPAGTAVDGKAEHDEEIDPLDAFMAEIQEEIRAPPPPPKAEALRRADSGDDEDDPVES  108

Query  466  FLKAKKDIGLQLAAEALNAGYNS  534
            FL+AKKD GL LAA+A+ AGY+S
Sbjct  109  FLRAKKDAGLTLAADAMRAGYDS  131



>ref|XP_006649971.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Oryza 
brachyantha]
Length=772

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 83/146 (57%), Gaps = 16/146 (11%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNId----yd  276
            MSKR    +GF I R  +Y+FER++  QRLYVP            +D DLD+I       
Sbjct  1    MSKRP-KLEGFSIPRPTSYSFERSQPAQRLYVP-----------ADDPDLDDIAFSDDAA  48

Query  277  erdgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDP  456
                    +      + G D+EIDPLDAFM  I EE++A  P    E L +   D EDDP
Sbjct  49   ATSDAPSADGAGAGEAAGDDEEIDPLDAFMAEIQEEIRAPTPAPKPEALRRTDSDDEDDP  108

Query  457  MESFLKAKKDIGLQLAAEALNAGYNS  534
            +ESFL+AKKD GL LAA+A++AGY+S
Sbjct  109  VESFLRAKKDAGLTLAADAMHAGYDS  134



>emb|CDX95719.1| BnaC03g26000D [Brassica napus]
Length=735

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 86/108 (80%), Gaps = 5/108 (5%)
 Frame = +1

Query  211  SSRSVGGHDNYEDTDLDNIdyderdgnednnndindgsggaddEIDPLDAFMEGIHeemk  390
            S+R  GG DN ED D+DNID+ E + +E++ ++  +       EIDPLDAFMEGIHEE+K
Sbjct  6    STRFRGG-DNSEDADVDNIDFIENEEDEEDVDNGGEEDD----EIDPLDAFMEGIHEEVK  60

Query  391  aapppkpkekLDKYKDDIEDDPMESFLKAKKDIGLQLAAEALNAGYNS  534
            AAPPPKPKEK+++YKDD +DD + SFLKAKKD+GL LAA+ALNAGYNS
Sbjct  61   AAPPPKPKEKVERYKDDEDDDHVVSFLKAKKDLGLTLAADALNAGYNS  108



>gb|EMS61774.1| DEAD-box ATP-dependent RNA helicase 24 [Triticum urartu]
Length=765

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 80/142 (56%), Gaps = 16/142 (11%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKR    +GF I R  +Y+FER++   RLYVP             D DLD+I + +   
Sbjct  1    MSKRP-RLEGFSIPRPTSYSFERSQPAPRLYVP------------ADDDLDDIAFSDDAA  47

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMESF  468
               +  +          EIDPLDAFM  I EE++A PPP   E L     D +DDPMESF
Sbjct  48   APSDAAEGGKAEDD---EIDPLDAFMAEIQEEIRAPPPPPKPEALRPADSDEDDDPMESF  104

Query  469  LKAKKDIGLQLAAEALNAGYNS  534
            L+AKKD GL LAA+ +NAGYNS
Sbjct  105  LRAKKDAGLTLAADVMNAGYNS  126



>gb|EEC75096.1| hypothetical protein OsI_11255 [Oryza sativa Indica Group]
Length=1023

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 85/140 (61%), Gaps = 15/140 (11%)
 Frame = +1

Query  109  MSKR-KFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNId-yder  282
            MSKR K G  GF I R  +Y+FER++ PQRLYVP            +D DLD+I   D+ 
Sbjct  1    MSKRPKLG--GFSIPRPTSYSFERSQTPQRLYVP-----------ADDPDLDDIAFSDDA  47

Query  283  dgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPME  462
                D       G+ G ++EIDPLDAFM  I EE++A PP    E L +   D EDDP+E
Sbjct  48   AAPSDAPPAGGGGAAGDEEEIDPLDAFMAEIQEEIRAPPPAPKPEALRRADSDDEDDPVE  107

Query  463  SFLKAKKDIGLQLAAEALNA  522
            SFL+AKKD GL LAA+A++A
Sbjct  108  SFLRAKKDSGLALAADAMHA  127



>dbj|BAJ97115.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=764

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 79/142 (56%), Gaps = 16/142 (11%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKR    +GF I R  +Y+FER++   RLYVP             D DL+ I + +   
Sbjct  1    MSKRP-RLEGFSIPRPTSYSFERSQPAPRLYVP------------ADDDLEEIAFSDDAA  47

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMESF  468
               +  +          EIDPLDAFM  I EE++A PPP   E L     D +DDPMESF
Sbjct  48   APSDAAEGGKAEDD---EIDPLDAFMAEIQEEIRAPPPPPKPEALRPADSDEDDDPMESF  104

Query  469  LKAKKDIGLQLAAEALNAGYNS  534
            L+AKKD GL LAA+ +NAGYNS
Sbjct  105  LRAKKDAGLTLAADVMNAGYNS  126



>ref|XP_003558073.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Brachypodium 
distachyon]
Length=767

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 80/142 (56%), Gaps = 16/142 (11%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKR    +GF I R  +Y+FER++   RLYVP             + DLD+I + +   
Sbjct  1    MSKRT-RLEGFSIPRPTSYSFERSQPAPRLYVP------------AEDDLDDIAFSDDAA  47

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMESF  468
               +  +          EIDPLDAFM  I EE++A PPP   E L     D +DDPMESF
Sbjct  48   APSDAAEGGKAEDE---EIDPLDAFMAEIQEEIRAPPPPPKPEALRLGDSDEDDDPMESF  104

Query  469  LKAKKDIGLQLAAEALNAGYNS  534
            L+AKKD GL LAA+ +NAGYNS
Sbjct  105  LRAKKDAGLALAADVMNAGYNS  126



>gb|EMT30425.1| DEAD-box ATP-dependent RNA helicase 24 [Aegilops tauschii]
Length=789

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 80/142 (56%), Gaps = 16/142 (11%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKR    +GF I R  +Y+FER++   RLYVP             D DLD+I + +   
Sbjct  1    MSKRP-RLEGFSIPRPTSYSFERSQPAPRLYVP------------ADDDLDDIAFSDDAA  47

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMESF  468
               +  +          EIDPLDAFM  I EE++A PPP   + L     D +DDPMESF
Sbjct  48   APSDAGEGGKAEDD---EIDPLDAFMAEIQEEIRAPPPPPKPKALRPADSDEDDDPMESF  104

Query  469  LKAKKDIGLQLAAEALNAGYNS  534
            L+AKKD GL LAA+ +NAGYNS
Sbjct  105  LRAKKDAGLTLAADVMNAGYNS  126



>emb|CDY37796.1| BnaC04g00290D [Brassica napus]
Length=734

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 78/102 (76%), Gaps = 1/102 (1%)
 Frame = +1

Query  229  GHDNYEDTDLDNIdyderdgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppk  408
            G DN ED D+D ID+ E +  E+       G    +DEIDPLDAFMEGIH+EMK+APPPK
Sbjct  11   GGDNSEDADVDEIDFIENEEEEEQAVQNGGGDNDDEDEIDPLDAFMEGIHQEMKSAPPPK  70

Query  409  pkekLDKYKDDIEDDPMESFLKAKKDIGLQLAAEALNAGYNS  534
            PKEK ++YKDD +DD + SFLKAKKD+GL LAA+ALNAGYNS
Sbjct  71   PKEKAERYKDD-DDDHVVSFLKAKKDLGLTLAADALNAGYNS  111



>emb|CDX80096.1| BnaA05g00600D [Brassica napus]
Length=728

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 77/102 (75%), Gaps = 8/102 (8%)
 Frame = +1

Query  229  GHDNYEDTDLDNIdyderdgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppk  408
            G DN ED D+DNID+ + + +E+      D       EIDPLDAFMEGIH+EMK+APPPK
Sbjct  11   GGDNSEDADVDNIDFIDNEEDEEQAVHNGD-------EIDPLDAFMEGIHQEMKSAPPPK  63

Query  409  pkekLDKYKDDIEDDPMESFLKAKKDIGLQLAAEALNAGYNS  534
            PK K ++YKDD +DD + SFLKAKKD+GL LAA+ALNAGYNS
Sbjct  64   PKAKAERYKDD-DDDHVVSFLKAKKDLGLTLAADALNAGYNS  104



>ref|XP_009142546.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Brassica rapa]
Length=732

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 76/102 (75%), Gaps = 3/102 (3%)
 Frame = +1

Query  229  GHDNYEDTDLDNIdyderdgnednnndindgsggaddEIDPLDAFMEGIHeemkaapppk  408
            G DN ED D+DNID+ + +  E+       G      EIDPLDAFMEGIH+EMK+APPPK
Sbjct  11   GGDNSEDADVDNIDFIDNEEEEEQAVHNGGGDDED--EIDPLDAFMEGIHQEMKSAPPPK  68

Query  409  pkekLDKYKDDIEDDPMESFLKAKKDIGLQLAAEALNAGYNS  534
            PK K ++YKDD +DD + SFLKAKKD+GL LAA+ALNAGYNS
Sbjct  69   PKAKAERYKDD-DDDHVVSFLKAKKDLGLTLAADALNAGYNS  109



>gb|KFK37476.1| hypothetical protein AALP_AA4G262200 [Arabis alpina]
Length=758

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 91/125 (73%), Gaps = 12/125 (10%)
 Frame = +1

Query  166  NFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNI--dyderdgnednnndindgsggadd  339
            +F+R++ PQR           G DN ED DLDNI    +E +  E   +  N G G  DD
Sbjct  5    SFDRSQPPQRR----------GGDNSEDFDLDNIDYMENEEEPEEYGASPANGGGGDDDD  54

Query  340  EIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMESFLKAKKDIGLQLAAEALN  519
            EIDPLDAFMEGIHEEMK+APPPKPKEKL++YKDD +DDP+ESFLKAKKD+GL LAA+A N
Sbjct  55   EIDPLDAFMEGIHEEMKSAPPPKPKEKLERYKDDEDDDPIESFLKAKKDLGLTLAADAFN  114

Query  520  AGYNS  534
            AGYNS
Sbjct  115  AGYNS  119



>ref|XP_002467976.1| hypothetical protein SORBIDRAFT_01g037410 [Sorghum bicolor]
 gb|EER94974.1| hypothetical protein SORBIDRAFT_01g037410 [Sorghum bicolor]
Length=766

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 88/143 (62%), Gaps = 13/143 (9%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKR    +GF I R  +YNFER++  QRLY P            +D DLD+I + +   
Sbjct  1    MSKRP-KLEGFSIPRPTSYNFERSQPVQRLYRP-----------TDDPDLDDIAFSDDAP  48

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDK-YKDDIEDDPMES  465
            ++   +   +G    D+EIDPLDAFM  I EE++A PPP   E L +   DD EDDP+ES
Sbjct  49   SDAPASTAVEGKAEDDEEIDPLDAFMAEIQEEIRAPPPPPKPEALRRADSDDDEDDPVES  108

Query  466  FLKAKKDIGLQLAAEALNAGYNS  534
            FL+AKKD GL LAA+A+ AGY+S
Sbjct  109  FLRAKKDAGLTLAADAMRAGYDS  131



>ref|NP_001147596.1| pre-mRNA-processing ATP-dependent RNA helicase prp-5 [Zea mays]
 gb|ACG28038.1| pre-mRNA-processing ATP-dependent RNA helicase prp-5 [Zea mays]
Length=768

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 87/143 (61%), Gaps = 13/143 (9%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKR    +GF I R  +YNFER++  QRLY P            +D DLD+I + +   
Sbjct  1    MSKRP-KLEGFSIPRPTSYNFERSQPVQRLYRP-----------TDDPDLDDIAFSDDAP  48

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDK-YKDDIEDDPMES  465
            ++       DG    D+EIDPLDAFM  I EE++A PPP   E L +   DD EDDP+ES
Sbjct  49   SDAPAGTAVDGKAEHDEEIDPLDAFMAEIQEEIRAPPPPPKAEALRRADSDDDEDDPVES  108

Query  466  FLKAKKDIGLQLAAEALNAGYNS  534
            FL+AKKD GL LAA+A+ AGY+S
Sbjct  109  FLRAKKDAGLTLAADAMRAGYDS  131



>ref|XP_008654947.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X1 [Zea mays]
 tpg|DAA45029.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=766

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 87/143 (61%), Gaps = 13/143 (9%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKR    +GF I R  +YNFER+++ QRLY P            +D DLD+I + +   
Sbjct  1    MSKRP-KLEGFSIPRPTSYNFERSQSVQRLYRP-----------TDDPDLDDIAFSDDAP  48

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDD-PMES  465
            ++   +   +G    ++E+DPLDAFM  I EE++A PPP   E L +   D ++D P+ES
Sbjct  49   SDAQASTAVEGKAENEEEMDPLDAFMAEIQEEIRAPPPPPKPEALRRTDSDDDEDDPVES  108

Query  466  FLKAKKDIGLQLAAEALNAGYNS  534
            FL+AKKD GL LAA+ + AGY+S
Sbjct  109  FLRAKKDAGLTLAADVMRAGYDS  131



>ref|XP_008654950.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X2 [Zea mays]
Length=750

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 87/143 (61%), Gaps = 13/143 (9%)
 Frame = +1

Query  109  MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  288
            MSKR    +GF I R  +YNFER+++ QRLY P            +D DLD+I + +   
Sbjct  1    MSKRP-KLEGFSIPRPTSYNFERSQSVQRLYRP-----------TDDPDLDDIAFSDDAP  48

Query  289  nednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDD-PMES  465
            ++   +   +G    ++E+DPLDAFM  I EE++A PPP   E L +   D ++D P+ES
Sbjct  49   SDAQASTAVEGKAENEEEMDPLDAFMAEIQEEIRAPPPPPKPEALRRTDSDDDEDDPVES  108

Query  466  FLKAKKDIGLQLAAEALNAGYNS  534
            FL+AKKD GL LAA+ + AGY+S
Sbjct  109  FLRAKKDAGLTLAADVMRAGYDS  131



>ref|XP_002980961.1| hypothetical protein SELMODRAFT_51367, partial [Selaginella moellendorffii]
 gb|EFJ18146.1| hypothetical protein SELMODRAFT_51367, partial [Selaginella moellendorffii]
Length=653

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +1

Query  340  EIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMESFLKAKKDIGLQLAAEALN  519
            E+DPLDAFMEGIHEE+   P P  K    + +++ EDDPME+FLKA++D GL LAAEAL+
Sbjct  30   EVDPLDAFMEGIHEEVSRIPTPGSKPSRIQEEEEEEDDPMETFLKARRDAGLSLAAEALH  89

Query  520  AGYNS  534
            AGY+S
Sbjct  90   AGYDS  94



>ref|XP_002989340.1| hypothetical protein SELMODRAFT_41331, partial [Selaginella moellendorffii]
 gb|EFJ09614.1| hypothetical protein SELMODRAFT_41331, partial [Selaginella moellendorffii]
Length=653

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +1

Query  340  EIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDDPMESFLKAKKDIGLQLAAEALN  519
            E+DPLDAFMEGIHEE+   P P  K    + +++ EDDPME+FLKA++D GL LAAEAL+
Sbjct  30   EVDPLDAFMEGIHEEVSRIPTPGSKPSRIQEEEEEEDDPMETFLKARRDAGLSLAAEALH  89

Query  520  AGYNS  534
            AGY+S
Sbjct  90   AGYDS  94



>gb|KHG13095.1| DEAD-box ATP-dependent RNA helicase 24 -like protein [Gossypium 
arboreum]
Length=731

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 59/66 (89%), Gaps = 1/66 (2%)
 Frame = +1

Query  340  EIDPLDAFMEGIHeemkaapppkpkekLDKYKDDIEDD-PMESFLKAKKDIGLQLAAEAL  516
            EIDPLDAFM+GI E++KA PPPKPKEK ++YK+D ++D P+ESFL++KKD+GL LAA+AL
Sbjct  35   EIDPLDAFMQGIEEDLKAKPPPKPKEKAERYKEDEDEDDPVESFLRSKKDVGLTLAADAL  94

Query  517  NAGYNS  534
             AGY+S
Sbjct  95   RAGYDS  100



>ref|XP_004984607.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Setaria 
italica]
Length=768

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 83/144 (58%), Gaps = 15/144 (10%)
 Frame = +1

Query  109  MSKR-KFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderd  285
            MSKR K G  GF I R  TY+FER++   RLY P            +D DLD+I + +  
Sbjct  1    MSKRPKLG--GFSIPRPTTYSFERSQPVPRLYRP-----------TDDPDLDDIAFSDDA  47

Query  286  gnednnndindgsggaddEIDPLDAFMEGIHeemkaapppkpkekLDK-YKDDIEDDPME  462
              +              +EIDPLDAFM  I EE++A PPP   E + +   DD EDDP+E
Sbjct  48   PTDAPAAAAVASKAQDAEEIDPLDAFMAEIQEEIRAPPPPPKPEAVRRADSDDDEDDPVE  107

Query  463  SFLKAKKDIGLQLAAEALNAGYNS  534
            SFL+AKKD GL LAA+A+ AGY+S
Sbjct  108  SFLRAKKDAGLALAADAMRAGYDS  131



>gb|EEE58924.1| hypothetical protein OsJ_10575 [Oryza sativa Japonica Group]
Length=696

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  421  LDKYKDDIEDDPMESFLKAKKDIGLQLAAEALNAGYNS  534
            L +   D EDDP+ESFL+AKKD GL LAA+A++AGY+S
Sbjct  20   LRRADSDDEDDPVESFLRAKKDSGLALAADAMHAGYDS  57



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553975666000