BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF008M01

Length=495
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009780936.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    258   5e-81   Nicotiana sylvestris
ref|XP_009595874.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    253   4e-79   Nicotiana tomentosiformis
ref|XP_009629570.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    253   4e-79   Nicotiana tomentosiformis
ref|XP_006342156.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    253   6e-79   
gb|EYU41183.1|  hypothetical protein MIMGU_mgv1a025772mg                243   2e-78   Erythranthe guttata [common monkey flower]
ref|XP_004238446.2|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    251   2e-78   
ref|XP_009786329.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    251   3e-78   Nicotiana sylvestris
gb|AEO45784.1|  glyceraldehyde-3-phosphate dehydrogenase B              251   4e-78   Scoparia dulcis [escobilla]
ref|XP_011074072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    250   7e-78   Sesamum indicum [beniseed]
ref|XP_006342537.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    250   1e-77   Solanum tuberosum [potatoes]
ref|XP_004253122.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    249   1e-77   Solanum lycopersicum
emb|CBL43264.1|  glyceraldehyde-3-phosphate dehydrogenase               249   1e-77   Solanum tuberosum [potatoes]
ref|XP_004300121.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    249   2e-77   Fragaria vesca subsp. vesca
ref|XP_008237955.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    245   6e-76   Prunus mume [ume]
ref|XP_007211185.1|  hypothetical protein PRUPE_ppa005598mg             245   7e-76   Prunus persica
ref|XP_008346447.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    244   2e-75   Malus domestica [apple tree]
ref|NP_001289237.1|  glyceraldehyde-3-phosphate dehydrogenase B, ...    243   2e-75   Pyrus x bretschneideri [bai li]
gb|AFG28405.1|  glyceraldehyde-3-phosphate dehydrogenase B              243   3e-75   Pyrus x bretschneideri [bai li]
gb|KJB14201.1|  hypothetical protein B456_002G114000                    241   2e-74   Gossypium raimondii
gb|KJB57937.1|  hypothetical protein B456_009G186400                    235   4e-74   Gossypium raimondii
gb|KHG00663.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    240   5e-74   Gossypium arboreum [tree cotton]
emb|CAN69459.1|  hypothetical protein VITISV_021576                     240   5e-74   Vitis vinifera
gb|KHN20097.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    239   1e-73   Glycine soja [wild soybean]
gb|KJB57939.1|  hypothetical protein B456_009G186400                    235   2e-73   Gossypium raimondii
ref|XP_003603852.1|  Glyceraldehyde-3-phosphate dehydrogenase           233   2e-73   
ref|XP_009362873.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    237   2e-73   
ref|XP_002273754.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    238   5e-73   Vitis vinifera
ref|XP_006581071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    238   6e-73   
gb|KHG26323.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    238   6e-73   Gossypium arboreum [tree cotton]
ref|XP_009362871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    237   8e-73   Pyrus x bretschneideri [bai li]
ref|XP_009362872.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    237   9e-73   
ref|NP_001237135.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    237   1e-72   
ref|XP_010270515.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    236   2e-72   Nelumbo nucifera [Indian lotus]
gb|ACU20783.1|  unknown                                                 236   2e-72   Glycine max [soybeans]
gb|ACJ85309.1|  unknown                                                 229   3e-72   Medicago truncatula
sp|P12859.2|G3PB_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    235   6e-72   Pisum sativum [garden pea]
gb|KJB57936.1|  hypothetical protein B456_009G186400                    235   6e-72   Gossypium raimondii
emb|CAA33262.1|  unnamed protein product                                234   7e-72   Pisum sativum [garden pea]
gb|AES74103.2|  glyceraldehyde-3-phosphate dehydrogenase B              233   1e-71   Medicago truncatula
ref|XP_007135965.1|  hypothetical protein PHAVU_009G006600g             233   2e-71   Phaseolus vulgaris [French bean]
ref|NP_001240080.1|  uncharacterized protein LOC100806482               233   2e-71   Glycine max [soybeans]
gb|ACJ84309.1|  unknown                                                 232   7e-71   Medicago truncatula
ref|XP_003603851.1|  Glyceraldehyde-3-phosphate dehydrogenase           232   7e-71   Medicago truncatula
ref|XP_002510706.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    232   8e-71   Ricinus communis
ref|XP_006577850.1|  PREDICTED: uncharacterized protein LOC100806...    232   8e-71   Glycine max [soybeans]
emb|CDP07271.1|  unnamed protein product                                231   1e-70   Coffea canephora [robusta coffee]
ref|XP_004500847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    233   2e-70   Cicer arietinum [garbanzo]
ref|XP_011034836.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    231   2e-70   Populus euphratica
sp|P09044.1|G3PB_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    231   2e-70   Nicotiana tabacum [American tobacco]
ref|XP_003603850.1|  Glyceraldehyde-3-phosphate dehydrogenase           232   2e-70   
ref|XP_011034837.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    231   2e-70   Populus euphratica
ref|XP_006383782.1|  hypothetical protein POPTR_0005s27550g             226   4e-70   
ref|XP_008452998.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    230   5e-70   Cucumis melo [Oriental melon]
ref|XP_007018105.1|  Glyceraldehyde-3-phosphate dehydrogenase B s...    229   8e-70   
ref|XP_011041188.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    229   1e-69   Populus euphratica
ref|XP_009384600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    229   1e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004145550.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    229   1e-69   Cucumis sativus [cucumbers]
ref|XP_010094540.1|  Glyceraldehyde-3-phosphate dehydrogenase B         239   1e-69   
ref|XP_009384599.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    228   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    228   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP36765.1|  hypothetical protein JCGZ_08056                         227   5e-69   Jatropha curcas
ref|XP_010918353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    227   6e-69   Elaeis guineensis
ref|XP_010686856.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    227   7e-69   Beta vulgaris subsp. vulgaris [field beet]
sp|P12860.1|G3PB_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    226   1e-68   Spinacia oleracea
ref|XP_002300632.2|  hypothetical protein POPTR_0002s00840g             227   1e-68   
ref|XP_008452997.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    226   1e-68   
ref|XP_002307806.1|  glyceraldehyde-3-phosphate dehydrogenase fam...    225   4e-68   Populus trichocarpa [western balsam poplar]
ref|XP_008786670.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    225   4e-68   Phoenix dactylifera
gb|KDO85183.1|  hypothetical protein CISIN_1g012940mg                   219   5e-68   Citrus sinensis [apfelsine]
gb|KDO85179.1|  hypothetical protein CISIN_1g012940mg                   218   5e-68   Citrus sinensis [apfelsine]
gb|KDO85181.1|  hypothetical protein CISIN_1g012940mg                   219   9e-68   Citrus sinensis [apfelsine]
gb|KDO85177.1|  hypothetical protein CISIN_1g012940mg                   219   1e-67   Citrus sinensis [apfelsine]
ref|XP_010061201.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    223   3e-67   Eucalyptus grandis [rose gum]
ref|XP_010539030.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    222   5e-67   Tarenaya hassleriana [spider flower]
gb|KDO85176.1|  hypothetical protein CISIN_1g012940mg                   218   1e-66   Citrus sinensis [apfelsine]
ref|XP_006435407.1|  hypothetical protein CICLE_v10001114mg             218   1e-66   
gb|KDO85175.1|  hypothetical protein CISIN_1g012940mg                   217   1e-66   Citrus sinensis [apfelsine]
ref|XP_006395998.1|  hypothetical protein EUTSA_v10004217mg             220   2e-66   Eutrema salsugineum [saltwater cress]
gb|KDO85174.1|  hypothetical protein CISIN_1g012940mg                   219   4e-66   Citrus sinensis [apfelsine]
gb|ADH43199.1|  glyceraldehyde-3-phosphate dehydrogenase                218   4e-66   Vicia sativa [spring vetch]
ref|XP_006473831.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    218   1e-65   Citrus sinensis [apfelsine]
ref|XP_006435406.1|  hypothetical protein CICLE_v10001114mg             218   1e-65   Citrus clementina [clementine]
ref|XP_009107645.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    218   1e-65   Brassica rapa
gb|KFK29151.1|  hypothetical protein AALP_AA7G095400                    216   8e-65   Arabis alpina [alpine rockcress]
ref|NP_174996.1|  glyceraldehyde-3-phosphate dehydrogenase B            215   2e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500213.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    214   8e-64   Camelina sativa [gold-of-pleasure]
ref|XP_006307502.1|  hypothetical protein CARUB_v10009127mg             213   1e-63   Capsella rubella
ref|XP_002891244.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    211   9e-63   
ref|XP_006383783.1|  hypothetical protein POPTR_0005s27550g             210   1e-62   
gb|EPS70760.1|  hypothetical protein M569_03997                         209   5e-62   Genlisea aurea
gb|ABC68431.1|  putative glyceraldehyde 3-phosphate dehydrogenase       197   3e-61   Tragopogon pratensis [Jack-go-to-bed-at-noon]
gb|ABC68432.1|  putative glyceraldehyde 3-phosphate dehydrogenase       197   4e-61   Tragopogon dubius [yellow salsify]
ref|XP_010478986.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    201   3e-59   Camelina sativa [gold-of-pleasure]
gb|ABF93790.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    193   1e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004985859.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    199   2e-58   Setaria italica
gb|EMT30317.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    198   6e-58   
gb|EMS49604.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    197   9e-58   Triticum urartu
ref|XP_006649326.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    197   2e-57   
dbj|BAJ86633.1|  predicted protein                                      196   3e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87214.1|  predicted protein                                      196   4e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008650588.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    195   1e-56   
ref|NP_001048847.1|  Os03g0129300                                       192   8e-56   
gb|ABR16095.1|  unknown                                                 186   8e-56   Picea sitchensis
ref|XP_003558903.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    190   9e-55   
gb|ABK24645.1|  unknown                                                 189   3e-54   Picea sitchensis
gb|ACN40006.1|  unknown                                                 189   4e-54   Picea sitchensis
emb|CDY69523.1|  BnaC08g46180D                                          186   1e-53   Brassica napus [oilseed rape]
gb|ACN40526.1|  unknown                                                 187   2e-53   Picea sitchensis
gb|AAD10210.1|  glyceraldehyde 3-phosphate dehydrogenase B subunit      182   4e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478985.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    180   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_002982608.1|  hypothetical protein SELMODRAFT_179517             179   1e-50   Selaginella moellendorffii
ref|XP_002981126.1|  hypothetical protein SELMODRAFT_271457             179   1e-50   
ref|XP_001779769.1|  predicted protein                                  174   3e-49   
ref|XP_006855683.1|  hypothetical protein AMTR_s00044p00131190          171   7e-48   
gb|ABK00053.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    169   2e-47   Marchantia polymorpha
emb|CAC80389.2|  glyceraldehyde-3-phosphate dehydrogenase               170   5e-47   Marchantia polymorpha
ref|XP_001771209.1|  predicted protein                                  167   2e-46   
emb|CBI21236.3|  unnamed protein product                                164   3e-46   Vitis vinifera
gb|KJB57938.1|  hypothetical protein B456_009G186400                    164   2e-45   Gossypium raimondii
ref|XP_010660642.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    164   3e-45   
emb|CAN78872.1|  hypothetical protein VITISV_021726                     164   3e-45   Vitis vinifera
ref|XP_002278352.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    164   3e-45   Vitis vinifera
ref|XP_001753934.1|  predicted protein                                  159   2e-43   
ref|XP_003548805.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    157   7e-43   
gb|KHN46819.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    157   7e-43   Glycine soja [wild soybean]
gb|KHG29734.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    157   7e-43   Gossypium arboreum [tree cotton]
gb|ADE06487.1|  putative glyceraldehyde 3-phosphate dehydrogenase       149   1e-42   Tragopogon dubius [yellow salsify]
gb|ADE06488.1|  putative glyceraldehyde 3-phosphate dehydrogenase       148   1e-42   Tragopogon porrifolius [oyster plant]
gb|KHN46369.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    157   1e-42   Glycine soja [wild soybean]
ref|NP_001238484.1|  glyceraldehyde-3-phosphate dehydrogenase A s...    157   1e-42   
gb|ACU21011.1|  unknown                                                 157   1e-42   Glycine max [soybeans]
ref|XP_001771246.1|  predicted protein                                  156   3e-42   
emb|CAC80388.1|  glyceraldehyde-3-phosphate dehydrogenase               155   4e-42   Marchantia polymorpha
gb|KJB11771.1|  hypothetical protein B456_001G276400                    155   4e-42   Gossypium raimondii
ref|XP_002985183.1|  hypothetical protein SELMODRAFT_181561             155   6e-42   Selaginella moellendorffii
ref|XP_002970103.1|  hypothetical protein SELMODRAFT_270825             155   6e-42   Selaginella moellendorffii
ref|XP_010028899.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    154   1e-41   Eucalyptus grandis [rose gum]
ref|XP_010270465.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    148   3e-41   
ref|XP_008449974.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    153   4e-41   Cucumis melo [Oriental melon]
ref|XP_011070460.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    153   5e-41   Sesamum indicum [beniseed]
emb|CCF55355.1|  Glyceraldehyde-3-phosphate dehydrogenase A             153   5e-41   Cucumis sativus [cucumbers]
ref|XP_008449975.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    153   5e-41   Cucumis melo [Oriental melon]
ref|XP_004161334.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    152   5e-41   
ref|XP_001779753.1|  predicted protein                                  152   1e-40   
ref|XP_008379036.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    151   1e-40   Malus domestica [apple tree]
ref|NP_172750.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2        151   1e-40   Arabidopsis thaliana [mouse-ear cress]
gb|AIU56855.1|  glyceraldehyde-3-phosphate dehydrogenase B              150   2e-40   Brassica rapa subsp. chinensis [bok-choy]
gb|AAA33780.1|  glyceraldehyde-phosphate dehydrogenase                  151   2e-40   Pinus sylvestris [Scotch pine]
emb|CAC80374.1|  glyceraldehyde-3-phosphate dehydrogenase               149   2e-40   Capsicum annuum
ref|XP_006844714.1|  hypothetical protein AMTR_s00016p00251680          151   2e-40   Amborella trichopoda
ref|XP_004145622.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    151   2e-40   
ref|NP_001289256.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    151   2e-40   Pyrus x bretschneideri [bai li]
gb|KFK43560.1|  hypothetical protein AALP_AA1G142100                    151   2e-40   Arabis alpina [alpine rockcress]
gb|ABD37962.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A1     150   2e-40   Physcomitrella patens
ref|XP_009378071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    151   2e-40   Pyrus x bretschneideri [bai li]
ref|XP_008231212.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    150   4e-40   Prunus mume [ume]
emb|CDY48981.1|  BnaA02g28150D                                          149   4e-40   Brassica napus [oilseed rape]
pdb|2PKQ|O  Chain O, Crystal Structure Of The Photosynthetic A2b2...    149   4e-40   Spinacia oleracea
ref|XP_001766703.1|  predicted protein                                  149   6e-40   
gb|AEH04452.1|  glyceraldehyde-3-phosphate dehydrogenase                150   6e-40   Arachis hypogaea [goober]
sp|P09043.1|G3PA_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    149   7e-40   Nicotiana tabacum [American tobacco]
ref|XP_010090946.1|  Glyceraldehyde-3-phosphate dehydrogenase A         149   8e-40   Morus notabilis
ref|XP_009800449.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    149   9e-40   Nicotiana sylvestris
gb|ABD37965.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      149   1e-39   Mesostigma viride
emb|CAC80378.2|  glyceraldehyde-3-phosphate dehydrogenase               150   1e-39   Chara vulgaris
dbj|BAP91041.1|  glyceraldehyde 3-phosphate dehydrogenase-A             149   1e-39   Nicotiana benthamiana
ref|XP_009631078.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    149   1e-39   Nicotiana tomentosiformis
ref|XP_008362077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    149   1e-39   Malus domestica [apple tree]
gb|EPS59235.1|  hypothetical protein M569_15573                         149   1e-39   Genlisea aurea
ref|XP_002892719.1|  GAPA-2                                             149   1e-39   Arabidopsis lyrata subsp. lyrata
ref|XP_006417177.1|  hypothetical protein EUTSA_v10007809mg             149   2e-39   Eutrema salsugineum [saltwater cress]
ref|XP_007217883.1|  hypothetical protein PRUPE_ppa006610mg             149   2e-39   Prunus persica
ref|XP_009118048.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    149   2e-39   Brassica rapa
emb|CDY16038.1|  BnaC08g40850D                                          149   2e-39   Brassica napus [oilseed rape]
ref|XP_010528117.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    148   3e-39   Tarenaya hassleriana [spider flower]
ref|XP_010476269.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    147   4e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010249379.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    147   4e-39   Nelumbo nucifera [Indian lotus]
gb|ADX97321.1|  glyceraldehyde-3-phosphate dehydrogenase                147   5e-39   Mangifera indica
emb|CDY26599.1|  BnaA09g46780D                                          147   5e-39   Brassica napus [oilseed rape]
ref|XP_010494747.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    147   6e-39   Camelina sativa [gold-of-pleasure]
ref|XP_009148556.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    147   8e-39   Brassica rapa
ref|XP_004975847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    147   8e-39   Setaria italica
ref|XP_004304578.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    147   8e-39   Fragaria vesca subsp. vesca
emb|CDY19412.1|  BnaC05g09210D                                          147   8e-39   Brassica napus [oilseed rape]
dbj|BAJ10475.1|  glyceraldehyde-3-phosphate dehydrogenase               147   8e-39   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_003624553.1|  Glyceraldehyde-3-phosphate dehydrogenase A         147   8e-39   Medicago truncatula
gb|AHZ58488.1|  glyceraldehyde-3-phosphate dehydrogenase                146   9e-39   Syntrichia caninervis
ref|XP_006304985.1|  hypothetical protein CARUB_v10009349mg             146   9e-39   
gb|AGV54738.1|  glyceraldehyde-3-phosphate dehydrogenase A chloro...    144   1e-38   Phaseolus vulgaris [French bean]
emb|CDP18560.1|  unnamed protein product                                146   1e-38   Coffea canephora [robusta coffee]
ref|XP_007032095.1|  Glyceraldehyde 3-phosphate dehydrogenase A s...    145   2e-38   Theobroma cacao [chocolate]
gb|ABK00052.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    145   2e-38   Marchantia polymorpha
ref|XP_010250427.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    145   2e-38   Nelumbo nucifera [Indian lotus]
ref|XP_006468948.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    145   3e-38   Citrus sinensis [apfelsine]
ref|XP_006446865.1|  hypothetical protein CICLE_v10015476mg             145   3e-38   Citrus clementina [clementine]
ref|XP_002875330.1|  gapa                                               145   3e-38   Arabidopsis lyrata subsp. lyrata
gb|ACV32597.1|  putative glyceraldehyde-3-phosphate dehydrogenase       145   3e-38   Medicago sativa [alfalfa]
ref|NP_566796.2|  glyceraldehyde-3-phosphate dehydrogenase A subunit    145   3e-38   Arabidopsis thaliana [mouse-ear cress]
gb|AAA32793.1|  glyceraldehyde 3-phosphate dehydrogenase                145   3e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006291258.1|  hypothetical protein CARUB_v10017390mg             145   3e-38   Capsella rubella
ref|XP_004493116.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    145   3e-38   Cicer arietinum [garbanzo]
ref|XP_010514317.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    145   4e-38   
ref|XP_011033706.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    145   4e-38   Populus euphratica
ref|XP_010694632.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    145   4e-38   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO63477.1|  hypothetical protein CISIN_1g013492mg                   145   4e-38   Citrus sinensis [apfelsine]
gb|KDO63476.1|  hypothetical protein CISIN_1g013492mg                   145   4e-38   Citrus sinensis [apfelsine]
ref|XP_007161788.1|  hypothetical protein PHAVU_001G098100g             145   5e-38   Phaseolus vulgaris [French bean]
ref|XP_010425375.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    145   5e-38   Camelina sativa [gold-of-pleasure]
gb|KFK33590.1|  hypothetical protein AALP_AA5G033500                    145   5e-38   Arabis alpina [alpine rockcress]
gb|AHA84230.1|  glyceraldehyde-3-phosphate dehydrogenase A              145   5e-38   Phaseolus vulgaris [French bean]
ref|XP_006395535.1|  hypothetical protein EUTSA_v10004349mg             144   6e-38   Eutrema salsugineum [saltwater cress]
gb|KJB70723.1|  hypothetical protein B456_011G088800                    144   6e-38   Gossypium raimondii
gb|KHG21941.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    144   7e-38   Gossypium arboreum [tree cotton]
ref|XP_002512790.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    144   7e-38   Ricinus communis
gb|ACN41006.1|  unknown                                                 145   9e-38   Picea sitchensis
gb|AGJ50596.1|  GAPDH                                                   144   1e-37   Pericallis cruenta
gb|AEO45783.1|  glyceraldehyde-3-phosphate dehydrogenase A              144   1e-37   Scoparia dulcis [escobilla]
ref|XP_010502597.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    144   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_011003600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    144   1e-37   Populus euphratica
emb|CDY28536.1|  BnaC02g36240D                                          143   2e-37   Brassica napus [oilseed rape]
ref|XP_004236849.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    143   2e-37   Solanum lycopersicum
ref|XP_006359279.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    143   2e-37   Solanum tuberosum [potatoes]
gb|ACN40537.1|  unknown                                                 143   2e-37   Picea sitchensis
emb|CDX83635.1|  BnaC07g23750D                                          143   2e-37   
gb|ABK25233.1|  unknown                                                 143   2e-37   Picea sitchensis
gb|ACN40000.1|  unknown                                                 143   2e-37   Picea sitchensis
gb|ABK24313.1|  unknown                                                 143   2e-37   Picea sitchensis
gb|ABK96233.1|  unknown                                                 142   3e-37   Populus trichocarpa x Populus deltoides
gb|ABK96725.1|  unknown                                                 142   3e-37   Populus trichocarpa x Populus deltoides
dbj|BAJ34149.1|  unnamed protein product                                142   4e-37   Eutrema halophilum
ref|XP_006386825.1|  hypothetical protein POPTR_0002s22600g             142   4e-37   
gb|ABK94956.1|  unknown                                                 142   4e-37   Populus trichocarpa [western balsam poplar]
ref|XP_002321065.2|  hypothetical protein POPTR_0014s13660g             142   5e-37   Populus trichocarpa [western balsam poplar]
gb|ABK00057.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    141   6e-37   Mesostigma viride
emb|CDY13649.1|  BnaA06g32740D                                          141   6e-37   Brassica napus [oilseed rape]
ref|XP_009152035.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    142   6e-37   Brassica rapa
sp|P19866.2|G3PA_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    141   8e-37   Spinacia oleracea
gb|ACT21568.1|  glyceraldehyde-3-phosphate dehydrogenase                141   8e-37   Bruguiera gymnorhiza [Burma mangrove]
gb|KDP41897.1|  hypothetical protein JCGZ_26915                         141   1e-36   Jatropha curcas
tpg|DAA37468.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1         137   2e-36   
ref|XP_004231523.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    140   2e-36   Solanum lycopersicum
ref|NP_001105414.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    140   2e-36   Zea mays [maize]
dbj|BAJ90885.1|  predicted protein                                      140   3e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS61784.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    139   3e-36   Triticum urartu
ref|XP_009404713.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    139   4e-36   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU35565.1|  hypothetical protein MIMGU_mgv1a005886mg                140   5e-36   Erythranthe guttata [common monkey flower]
emb|CAA30152.1|  GADPH (383 AA)                                         139   5e-36   Zea mays [maize]
gb|AHZ94971.1|  glyceraldehyde-3-phosphate dehydrogenase                138   5e-36   Lilium regale
ref|XP_006652372.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    138   1e-35   
ref|XP_006652373.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    138   1e-35   Oryza brachyantha
dbj|BAJ90530.1|  predicted protein                                      138   1e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABR18416.1|  unknown                                                 139   2e-35   Picea sitchensis
ref|XP_009378072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    137   2e-35   Pyrus x bretschneideri [bai li]
gb|ABG85190.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    137   2e-35   Ostreococcus sp. 'lucimarinus'
ref|XP_010942312.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    138   2e-35   
gb|ACX37507.1|  chloroplast glyceraldehyde 3-phosphate dehydrogenase    137   3e-35   Botryococcus braunii
ref|XP_005644071.1|  glyceraldehyde-3-phosphate dehydrogenase           137   3e-35   Coccomyxa subellipsoidea C-169
sp|P12858.2|G3PA_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    137   4e-35   Pisum sativum [garden pea]
emb|CAA33264.1|  unnamed protein product                                137   4e-35   Pisum sativum [garden pea]
tpg|DAA37469.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1         137   4e-35   
ref|NP_001117276.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2     136   4e-35   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57068.1|  AT1G12900                                              135   5e-35   Arabidopsis thaliana [mouse-ear cress]
gb|ABG85189.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    136   6e-35   Ostreococcus tauri
ref|XP_006417176.1|  hypothetical protein EUTSA_v10007809mg             135   6e-35   
ref|XP_003081785.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    136   7e-35   
ref|XP_008797069.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    136   8e-35   
ref|XP_003579898.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    136   8e-35   Brachypodium distachyon [annual false brome]
ref|XP_009420999.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    135   1e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001052984.1|  Os04g0459500                                       135   1e-34   
gb|ABD37964.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      136   1e-34   Chlorokybus atmophyticus
pir||DESPGA  glyceraldehyde-3-phosphate dehydrogenase (NADP)  (ph...    134   1e-34
pdb|1RM5|O  Chain O, Crystal Structure Of Mutant S188a Of Photosy...    134   1e-34   Spinacia oleracea
gb|AAD10209.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit      135   1e-34   Arabidopsis thaliana [mouse-ear cress]
pdb|1RM3|O  Chain O, Crystal Structure Of Mutant T33a Of Photosyn...    134   1e-34   Spinacia oleracea
pdb|1NBO|O  Chain O, The Dual Coenzyme Specificity Of Photosynthe...    134   1e-34   Spinacia oleracea
emb|CAC80393.1|  glyceraldehyde-3-phosphate dehydrogenase               134   1e-34   Sphagnum cuspidatum
gb|AFK38236.1|  unknown                                                 128   2e-34   Medicago truncatula
ref|XP_002503470.1|  glyceraldehyde-3-phosphate dehydrogenase a c...    134   2e-34   Micromonas commoda
ref|XP_003055659.1|  hypothetical protein MICPUCDRAFT_49403             134   2e-34   Micromonas pusilla CCMP1545
pdb|2PKR|O  Chain O, Crystal Structure Of (a+cte)4 Chimeric Form ...    134   3e-34   
gb|ABD37966.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      133   3e-34   
emb|CAC80392.1|  glyceraldehyde-3-phosphate dehydrogenase               132   4e-34   
ref|XP_010458726.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    131   1e-33   
ref|XP_003548929.2|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    132   1e-33   
gb|ABD37961.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      130   4e-33   
gb|EMT31124.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    131   4e-33   
gb|KHN13412.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    127   8e-33   
ref|XP_001689871.1|  glyceraldehyde-3-phosphate dehydrogenase           130   1e-32   
ref|XP_007510189.1|  glyceraldehyde-3-phosphate dehydrogenase           130   1e-32   
gb|ABA01156.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    129   1e-32   
gb|ABA01125.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    129   1e-32   
ref|XP_002955293.1|  hypothetical protein VOLCADRAFT_76662              129   1e-32   
gb|ADB81492.1|  glyceraldehyde-3-phosphate dehydrogenase                127   3e-32   
pdb|3K2B|A  Chain A, Crystal Structure Of Photosynthetic A4 Isofo...    127   4e-32   
emb|CAC80390.1|  glyceraldehyde-3-phosphate dehydrogenase               127   6e-32   
ref|XP_008663264.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    128   6e-32   
gb|KIY96104.1|  hypothetical protein MNEG_11860                         122   2e-31   
emb|CAC80391.2|  glyceraldehyde-3-phosphate dehydrogenase               125   2e-31   
gb|AIU56856.1|  glyceraldehyde-3-phosphate dehydrogenase A              126   2e-31   
gb|ADB81491.1|  glyceraldehyde-3-phosphate dehydrogenase                125   3e-31   
emb|CAC80373.1|  glyceraldehyde-3-phosphate dehydrogenase               125   3e-31   
gb|AAA33484.1|  glyceraldehyde-3-phosphate dehydrogenase precursor      119   5e-31   
emb|CEF96577.1|  Glyceraldehyde 3-phosphate dehydrogenase, NAD(P)...    125   8e-31   
ref|XP_001420043.1|  predicted protein                                  124   9e-31   
gb|ABC00187.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    124   1e-30   
ref|XP_002507103.1|  glyceraldehyde-3-phosphate dehydrogenase B         124   2e-30   
gb|ABD37960.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      123   2e-30   
ref|XP_003074208.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    124   2e-30   
gb|ACA35006.1|  glyceraldehyde-3-phosphate dehydrogenase                124   2e-30   
gb|ABD37958.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      122   5e-30   
ref|XP_001415434.1|  predicted protein                                  123   5e-30   
emb|CAC80372.1|  glyceraldehyde-3-phosphate dehydrogenase               122   5e-30   
gb|ABD37955.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      122   6e-30   
ref|XP_008663258.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    122   9e-30   
pdb|1JN0|O  Chain O, Crystal Structure Of The Non-regulatory A4 I...    121   1e-29   
gb|AAB82133.1|  glyceralehyde-3-phosphate dehydrogenase subunit         120   2e-29   
gb|AAF03099.1|AF162198_1  NADP-dependent glyceraldehyde phosphate...    114   3e-29   
ref|XP_008664191.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    120   3e-29   
gb|AEW46689.1|  glyceraldehyde-3-phosphate dehydrogenase                120   4e-29   
ref|XP_003056194.1|  hypothetical protein MICPUCDRAFT_25339             120   4e-29   
gb|ABD37959.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      119   5e-29   
gb|ABG85191.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    120   8e-29   
gb|AAF19788.1|AF162202_1  NADP-dependent glyceraldehyde phosphate...    113   9e-29   
gb|AFW58485.1|  hypothetical protein ZEAMMB73_956640                    118   2e-28   
gb|ABD37954.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      118   3e-28   
ref|XP_005715477.1|  glyceraldehyde-3-phosphate dehydrogenase           116   1e-27   
sp|P34919.1|G3PA_CHOCR  RecName: Full=Glyceraldehyde-3-phosphate ...    116   1e-27   
ref|XP_007515295.1|  glyceraldehyde-3-phosphate dehydrogenase           115   2e-27   
gb|ABD37957.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      115   2e-27   
sp|P30724.1|G3PA_GRAGA  RecName: Full=Glyceraldehyde-3-phosphate ...    115   2e-27   
ref|XP_005704189.1|  glyceraldehyde-3-phosphate dehydrogenase (NA...    114   6e-27   
ref|XP_005843104.1|  hypothetical protein CHLNCDRAFT_49269              113   6e-27   
ref|XP_011399143.1|  Glyceraldehyde-3-phosphate dehydrogenase A, ...    113   1e-26   
dbj|BAG68209.1|  glyceraldehyde-3-phosphate dehydrogenase               112   2e-26   
gb|ADB81494.1|  glyceraldehyde-3-phosphate dehydrogenase                112   2e-26   
gb|AAP32469.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      112   5e-26   
gb|ADB81486.1|  glyceraldehyde-3-phosphate dehydrogenase                110   6e-26   
gb|ACN39951.1|  unknown                                                 109   3e-25   
sp|Q8VXQ9.1|G3PA_SCEVA  RecName: Full=Glyceraldehyde-3-phosphate ...    107   1e-24   
gb|AAP80811.1|  glyceraldehyde-3-phosphate dehydrogenase precursor      103   2e-24   
ref|WP_015160704.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    104   1e-23   
ref|WP_026103380.1|  glyceraldehyde-3-phosphate dehydrogenase           103   3e-23   
gb|AAB66887.1|  glyceraldehyde-3-phosphate dehydrogenase                102   5e-23   
ref|WP_018398495.1|  glyceraldehyde-3-phosphate dehydrogenase           102   8e-23   
ref|WP_028949102.1|  glyceraldehyde-3-phosphate dehydrogenase           102   1e-22   
gb|ABD37963.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A2     101   2e-22   
ref|WP_011378166.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    101   2e-22   
gb|ADB81489.1|  glyceraldehyde-3-phosphate dehydrogenase                101   2e-22   
ref|WP_017293448.1|  glyceraldehyde-3-phosphate dehydrogenase           101   2e-22   
ref|WP_011244659.1|  glyceraldehyde-3-phosphate dehydrogenase           100   2e-22   
pdb|2D2I|A  Chain A, Crystal Structure Of Nadp-Dependent Glyceral...    101   3e-22   
ref|WP_036532393.1|  glyceraldehyde-3-phosphate dehydrogenase           100   3e-22   
ref|WP_010874115.1|  glyceraldehyde-3-phosphate dehydrogenase           100   4e-22   
ref|WP_015168952.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    100   4e-22   
sp|P80505.3|G3P2_SYNY3  RecName: Full=Glyceraldehyde-3-phosphate ...    100   4e-22   
ref|WP_015145817.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    100   4e-22   
ref|WP_015954248.1|  glyceraldehyde-3-phosphate dehydrogenase         99.8    7e-22   
ref|WP_036001291.1|  glyceraldehyde-3-phosphate dehydrogenase         99.4    1e-21   
ref|WP_007307714.1|  glyceraldehyde-3-phosphate dehydrogenase         99.4    1e-21   
emb|CAA58550.1|  glyceraldehyde-3-phosphate dehydrogenase (NADP+)...  99.0    1e-21   
ref|XP_005534792.1|  glyceraldehyde-3-phosphate dehydrogenase         99.4    1e-21   
ref|WP_015220848.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  99.0    1e-21   
ref|WP_040932844.1|  glyceraldehyde-3-phosphate dehydrogenase         98.6    2e-21   
ref|WP_008276272.1|  glyceraldehyde-3-phosphate dehydrogenase         98.2    2e-21   
ref|WP_017659782.1|  glyceraldehyde-3-phosphate dehydrogenase         98.2    2e-21   
gb|KHN00649.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  97.8    2e-21   
gb|AFZ13204.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)      98.6    2e-21   
ref|WP_009626155.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  98.2    2e-21   
ref|WP_009544928.1|  glyceraldehyde-3-phosphate dehydrogenase         98.2    2e-21   
ref|WP_041226596.1|  glyceraldehyde-3-phosphate dehydrogenase         97.8    3e-21   
ref|WP_002780388.1|  Glyceraldehyde-3-phosphate dehydrogenase 2       97.8    4e-21   
ref|WP_015172689.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  97.8    4e-21   
ref|WP_012595832.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  97.4    4e-21   
ref|WP_007358062.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  97.4    5e-21   
ref|WP_015146993.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  97.1    6e-21   
ref|WP_015228987.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  96.7    8e-21   
ref|WP_026079517.1|  glyceraldehyde-3-phosphate dehydrogenase         96.7    1e-20   
emb|CCI33980.1|  Glyceraldehyde-3-phosphate dehydrogenase 2           96.7    1e-20   
emb|CCH97953.1|  Glyceraldehyde-3-phosphate dehydrogenase 2           96.7    1e-20   
emb|CCI19184.1|  Glyceraldehyde-3-phosphate dehydrogenase 2           96.7    1e-20   
emb|CCH91489.1|  Glyceraldehyde-3-phosphate dehydrogenase 2           96.7    1e-20   
ref|WP_027840812.1|  glyceraldehyde-3-phosphate dehydrogenase         96.3    1e-20   
ref|WP_015163373.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  96.3    1e-20   
ref|WP_013324586.1|  glyceraldehyde-3-phosphate dehydrogenase         96.3    1e-20   
ref|WP_039900510.1|  glyceraldehyde-3-phosphate dehydrogenase         95.9    2e-20   
ref|WP_002799040.1|  glyceraldehyde-3-phosphate dehydrogenase         95.9    2e-20   
ref|WP_004268080.1|  glyceraldehyde-3-phosphate dehydrogenase         95.9    2e-20   
ref|WP_002731954.1|  glyceraldehyde-3-phosphate dehydrogenase         95.9    2e-20   
gb|EGJ33840.1|  glyceraldehyde 3-phosphate dehydrogenase, NADP+       95.9    2e-20   
ref|WP_012265625.1|  glyceraldehyde-3-phosphate dehydrogenase         95.9    2e-20   
dbj|GAL93645.1|  NADPH-dependent glyceraldehyde-3-phosphate dehyd...  95.9    2e-20   
ref|WP_023172550.1|  glyceraldehyde-3-phosphate dehydrogenase         95.5    2e-20   
ref|WP_015224818.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  95.5    3e-20   
ref|WP_026098586.1|  glyceraldehyde-3-phosphate dehydrogenase         95.1    3e-20   
ref|WP_011319102.1|  glyceraldehyde-3-phosphate dehydrogenase         95.1    3e-20   
ref|WP_044492436.1|  glyceraldehyde-3-phosphate dehydrogenase         95.1    3e-20   
emb|CAC81001.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...  95.1    3e-20   
ref|WP_022607378.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  95.1    3e-20   
emb|CAC85938.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...  94.7    4e-20   
ref|WP_026100517.1|  glyceraldehyde-3-phosphate dehydrogenase         94.7    4e-20   
ref|WP_015113093.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  94.7    5e-20   
ref|WP_042341685.1|  glyceraldehyde-3-phosphate dehydrogenase         94.4    5e-20   
ref|WP_011140533.1|  glyceraldehyde-3-phosphate dehydrogenase         94.4    5e-20   
ref|WP_016951733.1|  glyceraldehyde-3-phosphate dehydrogenase         94.4    6e-20   
ref|WP_010999188.1|  glyceraldehyde-3-phosphate dehydrogenase         94.4    6e-20   
gb|AFY30551.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)      94.4    7e-20   
ref|WP_026082358.1|  glyceraldehyde-3-phosphate dehydrogenase         94.0    7e-20   
ref|WP_015116915.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  94.0    8e-20   
ref|WP_013190254.1|  glyceraldehyde-3-phosphate dehydrogenase         94.0    9e-20   
gb|KIE07728.1|  glyceraldehyde-3-phosphate dehydrogenase              93.6    9e-20   
ref|WP_017291296.1|  glyceraldehyde-3-phosphate dehydrogenase         93.6    9e-20   
ref|WP_026072888.1|  glyceraldehyde-3-phosphate dehydrogenase         93.6    1e-19   
ref|WP_039728353.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  93.6    1e-19   
ref|WP_010475353.1|  glyceraldehyde-3-phosphate dehydrogenase         93.6    1e-19   
ref|WP_012164673.1|  glyceraldehyde-3-phosphate dehydrogenase         93.6    1e-19   
ref|WP_008311916.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  93.6    1e-19   
ref|WP_015189930.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  93.6    1e-19   
ref|WP_009459769.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  93.6    1e-19   
ref|WP_017320834.1|  glyceraldehyde-3-phosphate dehydrogenase         93.2    1e-19   
ref|WP_035985041.1|  glyceraldehyde-3-phosphate dehydrogenase         93.2    1e-19   
ref|WP_011613378.1|  glyceraldehyde-3-phosphate dehydrogenase         93.2    1e-19   
ref|WP_035157424.1|  glyceraldehyde-3-phosphate dehydrogenase         93.2    1e-19   
ref|WP_028089468.1|  glyceraldehyde-3-phosphate dehydrogenase         93.2    2e-19   
ref|WP_017312563.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  93.2    2e-19   
ref|WP_026719817.1|  glyceraldehyde-3-phosphate dehydrogenase         93.2    2e-19   
ref|WP_016860363.1|  glyceraldehyde-3-phosphate dehydrogenase         93.2    2e-19   
ref|WP_026787014.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  93.2    2e-19   
ref|WP_026731665.1|  glyceraldehyde-3-phosphate dehydrogenase         92.8    2e-19   
ref|WP_016865320.1|  glyceraldehyde-3-phosphate dehydrogenase         92.8    2e-19   
ref|WP_015210633.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  92.8    2e-19   
ref|WP_041036790.1|  glyceraldehyde-3-phosphate dehydrogenase         92.8    2e-19   
gb|AAM68968.1|AF406628_1  glyceraldehyde-3-phosphate dehydrogenase    93.2    2e-19   
ref|WP_015141410.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  92.8    2e-19   
ref|WP_006528243.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  92.4    2e-19   
gb|AGW80488.1|  glyceraldehyde 3 phosphate dehydrogenase              92.4    2e-19   
ref|WP_042151414.1|  glyceraldehyde-3-phosphate dehydrogenase         92.4    3e-19   
gb|AAD10216.1|  glyceraldehyde-3-phosphate dehydrogenase              94.0    3e-19   
gb|AAA21996.1|  glyceraldehyde-3-phosphate dehydrogenase              92.4    3e-19   
ref|WP_012407249.1|  glyceraldehyde-3-phosphate dehydrogenase         92.4    3e-19   
ref|WP_006197155.1|  glyceraldehyde-3-phosphate dehydrogenase         92.0    3e-19   
ref|WP_015191528.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  92.0    3e-19   
ref|WP_036481597.1|  glyceraldehyde-3-phosphate dehydrogenase         92.0    3e-19   
ref|WP_028085442.1|  glyceraldehyde-3-phosphate dehydrogenase         92.0    3e-19   
ref|WP_009343864.1|  glyceraldehyde-3-phosphate dehydrogenase         92.0    3e-19   
ref|WP_028954384.1|  glyceraldehyde-3-phosphate dehydrogenase         92.0    4e-19   
ref|WP_006510998.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  92.0    4e-19   
ref|WP_015178398.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  92.0    4e-19   
ref|WP_006634268.1|  glyceraldehyde-3-phosphate dehydrogenase         92.0    4e-19   
ref|WP_015212526.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  91.7    4e-19   
ref|WP_037218187.1|  glyceraldehyde-3-phosphate dehydrogenase         91.7    4e-19   
ref|WP_026099703.1|  glyceraldehyde-3-phosphate dehydrogenase         91.7    5e-19   
ref|WP_039933175.1|  glyceraldehyde-3-phosphate dehydrogenase         91.7    5e-19   
ref|WP_006279110.1|  glyceraldehyde-3-phosphate dehydrogenase         91.7    5e-19   
gb|EDZ94203.1|  glyceraldehyde-3-phosphate dehydrogenase, type I      91.7    5e-19   
ref|WP_044205566.1|  glyceraldehyde-3-phosphate dehydrogenase         91.7    5e-19   
ref|WP_016876187.1|  glyceraldehyde-3-phosphate dehydrogenase         91.7    5e-19   
ref|WP_029229478.1|  hypothetical protein                             89.0    7e-19   
ref|WP_015182060.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  91.3    7e-19   
gb|EDX77136.1|  glyceraldehyde-3-phosphate dehydrogenase, type I      91.3    8e-19   
ref|WP_008231341.1|  NADPH-dependent glyceraldehyde-3-phosphate d...  90.9    8e-19   
ref|WP_011433307.1|  glyceraldehyde-3-phosphate dehydrogenase         90.9    9e-19   
ref|WP_039753495.1|  glyceraldehyde-3-phosphate dehydrogenase         90.9    1e-18   
ref|WP_006619928.1|  glyceraldehyde-3-phosphate dehydrogenase         90.9    1e-18   
ref|WP_019493013.1|  glyceraldehyde-3-phosphate dehydrogenase         90.9    1e-18   
gb|KIJ84331.1|  glyceraldehyde-3-phosphate dehydrogenase              90.5    1e-18   
dbj|BAI88897.1|  glyceraldehyde-3-phosphate dehydrogenase             90.5    1e-18   
ref|WP_017742837.1|  glyceraldehyde-3-phosphate dehydrogenase         90.5    1e-18   
ref|WP_029637377.1|  glyceraldehyde-3-phosphate dehydrogenase [       90.1    2e-18   
ref|WP_027404344.1|  glyceraldehyde-3-phosphate dehydrogenase         90.1    2e-18   
ref|WP_015132368.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  90.1    2e-18   
ref|WP_009787048.1|  glyceraldehyde-3-phosphate dehydrogenase         90.1    2e-18   
ref|WP_006515538.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  89.7    2e-18   
ref|WP_015199557.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  89.7    2e-18   
ref|WP_009555393.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  89.7    2e-18   
ref|WP_011429234.1|  glyceraldehyde-3-phosphate dehydrogenase         89.7    2e-18   
ref|WP_006625490.1|  glyceraldehyde-3-phosphate dehydrogenase         89.7    2e-18   
ref|WP_024545764.1|  glyceraldehyde-3-phosphate dehydrogenase         89.7    2e-18   
ref|WP_008050956.1|  glyceraldehyde-3-phosphate dehydrogenase         89.4    3e-18   
ref|WP_015156647.1|  MULTISPECIES: glyceraldehyde 3-phosphate deh...  89.4    3e-18   
ref|WP_023075014.1|  glyceraldehyde 3-phosphate dehydrogenase (na...  89.4    3e-18   
ref|WP_012305745.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  89.4    4e-18   
ref|WP_040484381.1|  glyceraldehyde-3-phosphate dehydrogenase         89.0    4e-18   
ref|WP_015125741.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  89.0    5e-18   
ref|WP_039200023.1|  glyceraldehyde-3-phosphate dehydrogenase         89.0    5e-18   
emb|CAC41001.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...  88.2    7e-18   
ref|WP_038015315.1|  glyceraldehyde-3-phosphate dehydrogenase         88.2    8e-18   
ref|WP_015222961.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  87.8    1e-17   
ref|WP_011057306.1|  glyceraldehyde-3-phosphate dehydrogenase         87.0    2e-17   
pdb|3ZCX|A  Chain A, Structure Of Gapdh From Thermosynechococcus ...  87.0    2e-17   
dbj|BAK02737.1|  predicted protein                                    86.3    3e-17   
ref|WP_041429017.1|  glyceraldehyde-3-phosphate dehydrogenase         86.3    4e-17   
ref|WP_015080375.1|  type I glyceraldehyde-3-phosphate dehydrogenase  86.3    4e-17   
ref|WP_015109880.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  86.3    5e-17   
gb|KFD10652.1|  NAD-dependent glyceraldehyde-3-phosphate dehydrog...  82.0    7e-17   
emb|CAC81000.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...  85.1    8e-17   
gb|AAB23533.1|  glyceraldehyde-3-phosphate-dehydrogenase subunit ...  81.3    1e-16   
emb|CAC81003.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...  84.7    1e-16   
gb|ADB81488.1|  glyceraldehyde-3-phosphate dehydrogenase              84.3    1e-16   
gb|ABK00056.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  84.3    2e-16   
emb|CAC80998.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...  84.3    2e-16   



>ref|XP_009780936.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana sylvestris]
Length=449

 Score =   258 bits (659),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 137/151 (91%), Gaps = 4/151 (3%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  224
            SRIPT TRLP+K S     QCFSK+ EVAEFSGLRSSGCVTFSNRE+SF DVV+AQLTPK
Sbjct  10   SRIPTSTRLPAKNSHSFPTQCFSKKFEVAEFSGLRSSGCVTFSNRESSFFDVVSAQLTPK  69

Query  225  ATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLK  401
             TG APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+HLLK
Sbjct  70   TTGSAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLK  129

Query  402  YDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            YDSMLGTFKADVK+VDNETISVDGK IKVVS
Sbjct  130  YDSMLGTFKADVKIVDNETISVDGKHIKVVS  160



>ref|XP_009595874.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana tomentosiformis]
Length=449

 Score =   253 bits (647),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 136/151 (90%), Gaps = 4/151 (3%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  224
            SRIPT TRLPSK S     QC SK+ EVAEF+GLRSSGCVTFSN+E+SF DVV+AQLTPK
Sbjct  10   SRIPTTTRLPSKNSHSFPTQCLSKKFEVAEFAGLRSSGCVTFSNKESSFFDVVSAQLTPK  69

Query  225  ATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLK  401
             TG APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+HLLK
Sbjct  70   TTGLAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLK  129

Query  402  YDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            YDSMLGTFKADVK+VDNETISVDGK IKVVS
Sbjct  130  YDSMLGTFKADVKIVDNETISVDGKHIKVVS  160



>ref|XP_009629570.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=449

 Score =   253 bits (646),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 135/151 (89%), Gaps = 4/151 (3%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  224
            SRIPT TRLPSK S     QCFSK+ EVAEFSGLRSSG VTFSNRE+S  DVV+AQLTPK
Sbjct  10   SRIPTSTRLPSKNSQSFPTQCFSKKFEVAEFSGLRSSGYVTFSNRESSLFDVVSAQLTPK  69

Query  225  ATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLK  401
             TG APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+HLLK
Sbjct  70   TTGSAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLK  129

Query  402  YDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            YDSMLGTFKADVK+VDNETISVDGK IKVVS
Sbjct  130  YDSMLGTFKADVKIVDNETISVDGKHIKVVS  160



>ref|XP_006342156.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   253 bits (646),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 136/152 (89%), Gaps = 5/152 (3%)
 Frame = +3

Query  54   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  221
            SRIPT TRLPS  ++     QC SK+ EVAEFSGLRSSGCVTFSNRE+SF DVV+AQLTP
Sbjct  10   SRIPTSTRLPSNKNSYSFPTQCLSKKFEVAEFSGLRSSGCVTFSNRESSFFDVVSAQLTP  69

Query  222  KATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLL  398
            K TG APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+HLL
Sbjct  70   KTTGSAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  129

Query  399  KYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            KYDSMLGTFKADVK+VDNETISVDGK IKVVS
Sbjct  130  KYDSMLGTFKADVKIVDNETISVDGKHIKVVS  161



>gb|EYU41183.1| hypothetical protein MIMGU_mgv1a025772mg, partial [Erythranthe 
guttata]
Length=182

 Score =   243 bits (619),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 137/154 (89%), Gaps = 7/154 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTS---TPQCFSKRLEVAEFSGLRSSGCVTFS--NREASFSDVVAAQLT  218
            SRIPT TRLPSKT+   + QCFSK++EVAEFSGL+S+GCV F+  +REAS  DVVAAQLT
Sbjct  10   SRIPTSTRLPSKTTHSFSAQCFSKKVEVAEFSGLKSNGCVAFTKNSREASLFDVVAAQLT  69

Query  219  PKATG--APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  392
             K +G  APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+V+NDS GVKNA+H
Sbjct  70   TKTSGESAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASH  129

Query  393  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LLKYDSMLGTFKADVK+V+NETISVDGK IKVVS
Sbjct  130  LLKYDSMLGTFKADVKIVNNETISVDGKLIKVVS  163



>ref|XP_004238446.2| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Solanum lycopersicum]
Length=450

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 135/152 (89%), Gaps = 5/152 (3%)
 Frame = +3

Query  54   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  221
            SRIPT TRLPS  ++     QC SK+ EVAEFSGLRSSGCVTFSNRE+SF DVV+AQLTP
Sbjct  10   SRIPTSTRLPSNKNSYSFPTQCLSKKFEVAEFSGLRSSGCVTFSNRESSFFDVVSAQLTP  69

Query  222  KATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLL  398
            K TG AP KG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+HLL
Sbjct  70   KTTGSAPAKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  129

Query  399  KYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            KYDSMLGTFKADVK+VDNETISVDGK IKVVS
Sbjct  130  KYDSMLGTFKADVKIVDNETISVDGKHIKVVS  161



>ref|XP_009786329.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana sylvestris]
Length=449

 Score =   251 bits (641),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 136/151 (90%), Gaps = 4/151 (3%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  224
            SRIPT TRLP+K S     QC SK+ EVAEF+GLRSSGCVTFSN+E+SF DVV+AQLTPK
Sbjct  10   SRIPTTTRLPTKNSHSFPTQCLSKKFEVAEFAGLRSSGCVTFSNKESSFFDVVSAQLTPK  69

Query  225  ATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLK  401
             TG+ PVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+HLLK
Sbjct  70   TTGSTPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLK  129

Query  402  YDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            YDSMLGTFKADVK+VDNETISVDGK IKVVS
Sbjct  130  YDSMLGTFKADVKIVDNETISVDGKHIKVVS  160



>gb|AEO45784.1| glyceraldehyde-3-phosphate dehydrogenase B [Scoparia dulcis]
Length=452

 Score =   251 bits (640),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 136/153 (89%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTS----TPQCFSKRLEVAEFSGLRSSGCVTFS-NREASFSDVVAAQLT  218
            SRIPT TRLPSKTS      QCFSK+LEVAEFSGLRSSGCVTF+ N+EASF D VAAQLT
Sbjct  10   SRIPTSTRLPSKTSHSFPAAQCFSKKLEVAEFSGLRSSGCVTFAKNKEASFFDAVAAQLT  69

Query  219  PKATGAP-VKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
             K  G+  VKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   LKTAGSTTVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKADVK+VDNETISVDGKPIKVVS
Sbjct  130  LKYDSMLGTFKADVKIVDNETISVDGKPIKVVS  162



>ref|XP_011074072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Sesamum indicum]
Length=452

 Score =   250 bits (639),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 135/153 (88%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFS--NREASFSDVVAAQLT  218
            SR+PT TRLPSK S     QCFSK+LEVAEFSGLR  G VTF+   REASF DVVAAQLT
Sbjct  10   SRVPTSTRLPSKASNAFPAQCFSKKLEVAEFSGLRVGGSVTFAKNGREASFFDVVAAQLT  69

Query  219  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            PKA G+ PVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   PKAAGSTPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKADVK+VDNETISVDGKPIKVVS
Sbjct  130  LKYDSMLGTFKADVKIVDNETISVDGKPIKVVS  162



>ref|XP_006342537.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 135/152 (89%), Gaps = 5/152 (3%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  224
            SRIPT TRL SK S     QCFSK+ EVAEFSGLRSSGCVTF N+E+SF DVV+AQLTPK
Sbjct  10   SRIPTSTRLLSKNSYSFPTQCFSKKFEVAEFSGLRSSGCVTFCNKESSFFDVVSAQLTPK  69

Query  225  ATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLL  398
             TG+  PVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+HLL
Sbjct  70   TTGSAGPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  129

Query  399  KYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            KYDSMLGTFKADVK+VDNETISVDGK IKVVS
Sbjct  130  KYDSMLGTFKADVKIVDNETISVDGKNIKVVS  161



>ref|XP_004253122.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum lycopersicum]
Length=450

 Score =   249 bits (637),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 135/152 (89%), Gaps = 5/152 (3%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  224
            SRIPT TRL SK S     QCFSK+ EVAEFSGLRSSGCVTF N+E+SF DVV+AQLTPK
Sbjct  10   SRIPTSTRLLSKNSYSFPTQCFSKKFEVAEFSGLRSSGCVTFCNKESSFFDVVSAQLTPK  69

Query  225  ATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLL  398
             TG+  PVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+HLL
Sbjct  70   TTGSAGPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  129

Query  399  KYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            KYDSMLGTFKADVK+VDNETISVDGK IKVVS
Sbjct  130  KYDSMLGTFKADVKIVDNETISVDGKNIKVVS  161



>emb|CBL43264.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum]
Length=450

 Score =   249 bits (637),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 135/152 (89%), Gaps = 5/152 (3%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  224
            SRIPT TRL SK S     QCFSK+ EVAEFSGLRSSGCVTF N+E+SF DVV+AQLTPK
Sbjct  10   SRIPTSTRLLSKNSYSFPTQCFSKKFEVAEFSGLRSSGCVTFCNKESSFFDVVSAQLTPK  69

Query  225  ATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLL  398
             TG+  PVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+HLL
Sbjct  70   TTGSAGPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  129

Query  399  KYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            KYDSMLGTFKADVK+VDNETISVDGK IKVVS
Sbjct  130  KYDSMLGTFKADVKIVDNETISVDGKNIKVVS  161



>ref|XP_004300121.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=452

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 136/153 (89%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            +RIP  TRLPSKTS     QCFSKRLEVAEFSGLRSS C+T+++  REAS  D VAAQLT
Sbjct  10   TRIPANTRLPSKTSHSYPTQCFSKRLEVAEFSGLRSSSCLTYASNGREASLFDAVAAQLT  69

Query  219  PKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            P+ +G APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   PQTSGSAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKAD+K+VDNETISVDGKPIKVVS
Sbjct  130  LKYDSMLGTFKADIKIVDNETISVDGKPIKVVS  162



>ref|XP_008237955.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Prunus mume]
Length=452

 Score =   245 bits (625),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 134/153 (88%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTST---PQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            +RIP  TRLPSK+S     QCFSKRLEV EFSGLRSS CVT+++  RE SF D VAAQLT
Sbjct  10   TRIPANTRLPSKSSHSFPAQCFSKRLEVGEFSGLRSSSCVTYASNGRETSFFDAVAAQLT  69

Query  219  PKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            PK TG APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+HL
Sbjct  70   PKTTGPAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLG FKADVK+VDNETISVDGKP++VVS
Sbjct  130  LKYDSMLGIFKADVKIVDNETISVDGKPVQVVS  162



>ref|XP_007211185.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
 gb|EMJ12384.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
Length=452

 Score =   245 bits (625),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 134/153 (88%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTST---PQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            +RIP  TRLPSK+S     QCFSKRLEV EFSGLRSS CVT+++  RE SF D VAAQLT
Sbjct  10   TRIPANTRLPSKSSHSFPAQCFSKRLEVGEFSGLRSSSCVTYASNGRETSFFDAVAAQLT  69

Query  219  PKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            PK TG APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+HL
Sbjct  70   PKTTGPAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLG FKADVK+VDNETISVDGKP++VVS
Sbjct  130  LKYDSMLGIFKADVKIVDNETISVDGKPVQVVS  162



>ref|XP_008346447.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Malus domestica]
Length=452

 Score =   244 bits (622),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 132/153 (86%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            SR+P  TRLPSK S     QCFSKRLEV EFSGLRSS CVT+++  RE SF D VAAQLT
Sbjct  10   SRVPANTRLPSKPSHSFPTQCFSKRLEVGEFSGLRSSSCVTYASNGREQSFFDTVAAQLT  69

Query  219  PKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            PK  G  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   PKTAGPTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKADVK+VDNETISVDGKP+KVVS
Sbjct  130  LKYDSMLGTFKADVKIVDNETISVDGKPVKVVS  162



>ref|NP_001289237.1| glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Pyrus 
x bretschneideri]
 gb|AHM26621.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 132/153 (86%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            SR+P  TRLPSK S     QCFSKRLEV EFSGLRSS CVT+++  RE SF D VAAQLT
Sbjct  10   SRVPANTRLPSKPSHSFPTQCFSKRLEVGEFSGLRSSSCVTYASNGREQSFFDTVAAQLT  69

Query  219  PKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            PK  G  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   PKTAGPTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKADVK+VDNETISVDGKP+KVVS
Sbjct  130  LKYDSMLGTFKADVKIVDNETISVDGKPVKVVS  162



>gb|AFG28405.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   243 bits (621),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 132/153 (86%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            SR+P  TRLPSK S     QCFSKRLEV EFSGLRSS CVT+++  RE SF D VAAQLT
Sbjct  10   SRVPANTRLPSKPSHSFPTQCFSKRLEVGEFSGLRSSSCVTYASNGREQSFFDTVAAQLT  69

Query  219  PKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            PK  G  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   PKTAGPTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKADVK+VDNETISVDGKP+KVVS
Sbjct  130  LKYDSMLGTFKADVKIVDNETISVDGKPVKVVS  162



>gb|KJB14201.1| hypothetical protein B456_002G114000 [Gossypium raimondii]
Length=454

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 133/155 (86%), Gaps = 8/155 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            SRIP  TRLPSKT+     QC SKRLEV EFSGLRSS CVTF+   R+ASF DV+AAQL+
Sbjct  10   SRIPANTRLPSKTTHSFPTQCPSKRLEVTEFSGLRSSSCVTFAKNVRDASFFDVLAAQLS  69

Query  219  PKATGAP---VKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAA  389
            PK  G P   V+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+
Sbjct  70   PKGVGVPSTSVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNAS  129

Query  390  HLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            HLLKYDSMLGTFKADVK+VDNETISVDGKPIKVVS
Sbjct  130  HLLKYDSMLGTFKADVKIVDNETISVDGKPIKVVS  164



>gb|KJB57937.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=278

 Score =   235 bits (599),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 131/156 (84%), Gaps = 9/156 (6%)
 Frame = +3

Query  54   SRIPTRTRLPSKT-----STPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQ  212
            SRI   TRLPSKT     S  QC S RL+V EFSGLRS+ CVTF N  R+ASF DVVAAQ
Sbjct  10   SRIRATTRLPSKTTHSFPSQIQCSSTRLQVTEFSGLRSASCVTFVNNARDASFFDVVAAQ  69

Query  213  LTPKATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNA  386
            LTPK  G   PV+G TVAKLKVAINGFGRIGRNFLRCWHGRK+SPL+VIVVNDS GVKNA
Sbjct  70   LTPKTAGGATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGGVKNA  129

Query  387  AHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            +HLLKYDSMLGTFKADVK+VDNETISVDGKPIKVVS
Sbjct  130  SHLLKYDSMLGTFKADVKIVDNETISVDGKPIKVVS  165



>gb|KHG00663.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=454

 Score =   240 bits (613),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 133/155 (86%), Gaps = 8/155 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            S+IP  TRLPSKT+     QC SKRLEV EFSGLRSS CVTF+   R+ SF DV+AAQLT
Sbjct  10   SKIPANTRLPSKTTHSFPTQCSSKRLEVTEFSGLRSSSCVTFAKNVRDTSFFDVLAAQLT  69

Query  219  PKATGAP---VKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAA  389
            PK+ G P   V+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+
Sbjct  70   PKSEGVPSASVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNAS  129

Query  390  HLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            HLLKYDSMLGTFKADVK+VDNETISVDGKPIKVVS
Sbjct  130  HLLKYDSMLGTFKADVKIVDNETISVDGKPIKVVS  164



>emb|CAN69459.1| hypothetical protein VITISV_021576 [Vitis vinifera]
Length=453

 Score =   240 bits (613),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 135/154 (88%), Gaps = 7/154 (5%)
 Frame = +3

Query  54   SRIPT-RTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQL  215
            SRIPT  TRLPSK S     Q F+KRLEVAEFSGLRS GCVTF+   RE SF DVVA+QL
Sbjct  10   SRIPTTNTRLPSKASHSFPTQFFAKRLEVAEFSGLRSGGCVTFAKNAREPSFFDVVASQL  69

Query  216  TPKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  392
            TPKA G APV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+H
Sbjct  70   TPKAGGPAPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASH  129

Query  393  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LLKYDSMLGTFKA+VK+VDNETISVDGKPIKVVS
Sbjct  130  LLKYDSMLGTFKAEVKIVDNETISVDGKPIKVVS  163



>gb|KHN20097.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=452

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 134/154 (87%), Gaps = 7/154 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            +RIPT T+ PSK S     QC SKRLEV EFSGLRS+ CVT++N  RE+SF D+VA+QLT
Sbjct  10   TRIPTNTKFPSKASHSFPTQCASKRLEVTEFSGLRSTSCVTYANDARESSFFDLVASQLT  69

Query  219  PKATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  392
            PK  G+  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+H
Sbjct  70   PKTNGSSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASH  129

Query  393  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LLKYDSMLGTFKADVK++DNETI+VDGKPIKVVS
Sbjct  130  LLKYDSMLGTFKADVKILDNETITVDGKPIKVVS  163



>gb|KJB57939.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=320

 Score =   235 bits (599),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 131/156 (84%), Gaps = 9/156 (6%)
 Frame = +3

Query  54   SRIPTRTRLPSKT-----STPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQ  212
            SRI   TRLPSKT     S  QC S RL+V EFSGLRS+ CVTF N  R+ASF DVVAAQ
Sbjct  10   SRIRATTRLPSKTTHSFPSQIQCSSTRLQVTEFSGLRSASCVTFVNNARDASFFDVVAAQ  69

Query  213  LTPKATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNA  386
            LTPK  G   PV+G TVAKLKVAINGFGRIGRNFLRCWHGRK+SPL+VIVVNDS GVKNA
Sbjct  70   LTPKTAGGATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGGVKNA  129

Query  387  AHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            +HLLKYDSMLGTFKADVK+VDNETISVDGKPIKVVS
Sbjct  130  SHLLKYDSMLGTFKADVKIVDNETISVDGKPIKVVS  165



>ref|XP_003603852.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=283

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 133/153 (87%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            +RIPT TR PSK S     QC SKRLEVAEFSGL+S+ C+T+++  RE+SFSDVVAAQL 
Sbjct  10   TRIPTSTRFPSKASHSFPTQCASKRLEVAEFSGLKSTSCITYASNARESSFSDVVAAQLA  69

Query  219  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
             KA G+  V+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   TKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKADVK+++NETI+VDGKPI VVS
Sbjct  130  LKYDSMLGTFKADVKILNNETITVDGKPILVVS  162



>ref|XP_009362873.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X3 [Pyrus x bretschneideri]
Length=408

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 131/152 (86%), Gaps = 6/152 (4%)
 Frame = +3

Query  57   RIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLTP  221
            ++P  TRLPSK S     QCFSKRLEV EFSGLR S C+T+++  R+ SF + VAAQLTP
Sbjct  11   KVPANTRLPSKPSHSFPTQCFSKRLEVGEFSGLRLSSCMTYASNGRDQSFFEAVAAQLTP  70

Query  222  KATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLL  398
            K  G APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HLL
Sbjct  71   KTAGPAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLL  130

Query  399  KYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            KYDSMLGTFKADVK+VDNETISVDGKP+KVVS
Sbjct  131  KYDSMLGTFKADVKIVDNETISVDGKPVKVVS  162



>ref|XP_002273754.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Vitis vinifera]
 emb|CBI40744.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   238 bits (606),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 134/154 (87%), Gaps = 7/154 (5%)
 Frame = +3

Query  54   SRIPT-RTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQL  215
            SRIPT  TR PSK S     Q F+KRLEVAEFSGLRS GCVTF+   RE SF DVVA+QL
Sbjct  10   SRIPTTNTRHPSKASHSFPTQFFAKRLEVAEFSGLRSGGCVTFAKNAREPSFFDVVASQL  69

Query  216  TPKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  392
            TPKA G APV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+H
Sbjct  70   TPKAGGPAPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASH  129

Query  393  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LLKYDSMLGTFKA+VK+VDNETISVDGKPIKVVS
Sbjct  130  LLKYDSMLGTFKAEVKIVDNETISVDGKPIKVVS  163



>ref|XP_006581071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B subunit 
isoform X1 [Glycine max]
Length=453

 Score =   238 bits (606),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 133/155 (86%), Gaps = 8/155 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            +RIPT T+ PSK S     QC SKRLEV EFSGLRS+ CVT++N  RE+SF D+VA+QLT
Sbjct  10   TRIPTNTKFPSKASHSFPTQCASKRLEVTEFSGLRSTSCVTYANDARESSFFDLVASQLT  69

Query  219  PKATGA---PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAA  389
            PK T     PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+
Sbjct  70   PKQTNGSSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNAS  129

Query  390  HLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            HLLKYDSMLGTFKADVK++DNETI+VDGKPIKVVS
Sbjct  130  HLLKYDSMLGTFKADVKILDNETITVDGKPIKVVS  164



>gb|KHG26323.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=455

 Score =   238 bits (606),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 131/156 (84%), Gaps = 9/156 (6%)
 Frame = +3

Query  54   SRIPTRTRLPSKT-----STPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQ  212
            SRIP  TRLPSK      S  QC S RL+V EFSGLRS+ CVTF N  R+ASF DVVAAQ
Sbjct  10   SRIPATTRLPSKATHSFPSQIQCSSTRLQVTEFSGLRSASCVTFVNNARDASFYDVVAAQ  69

Query  213  LTPKATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNA  386
            LTPK  G   PV+G TVAKLKVAINGFGRIGRNFLRCWHGRK+SPL+VIVVNDS GVKNA
Sbjct  70   LTPKTAGGATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGGVKNA  129

Query  387  AHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            +HLLKYDSMLGTFKADVK+VDNETISVDGKPIKVVS
Sbjct  130  SHLLKYDSMLGTFKADVKIVDNETISVDGKPIKVVS  165



>ref|XP_009362871.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=452

 Score =   237 bits (605),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 131/152 (86%), Gaps = 6/152 (4%)
 Frame = +3

Query  57   RIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLTP  221
            ++P  TRLPSK S     QCFSKRLEV EFSGLR S C+T+++  R+ SF + VAAQLTP
Sbjct  11   KVPANTRLPSKPSHSFPTQCFSKRLEVGEFSGLRLSSCMTYASNGRDQSFFEAVAAQLTP  70

Query  222  KATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLL  398
            K  G APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HLL
Sbjct  71   KTAGPAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLL  130

Query  399  KYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            KYDSMLGTFKADVK+VDNETISVDGKP+KVVS
Sbjct  131  KYDSMLGTFKADVKIVDNETISVDGKPVKVVS  162



>ref|XP_009362872.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=450

 Score =   237 bits (604),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 131/152 (86%), Gaps = 6/152 (4%)
 Frame = +3

Query  57   RIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLTP  221
            ++P  TRLPSK S     QCFSKRLEV EFSGLR S C+T+++  R+ SF + VAAQLTP
Sbjct  11   KVPANTRLPSKPSHSFPTQCFSKRLEVGEFSGLRLSSCMTYASNGRDQSFFEAVAAQLTP  70

Query  222  KATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLL  398
            K  G APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HLL
Sbjct  71   KTAGPAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLL  130

Query  399  KYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            KYDSMLGTFKADVK+VDNETISVDGKP+KVVS
Sbjct  131  KYDSMLGTFKADVKIVDNETISVDGKPVKVVS  162



>ref|NP_001237135.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
 gb|ABA86964.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
Length=451

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 133/153 (87%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            +RIP+ TR PSK S     QC  KRLEV EFSGLRS+ CVT++N  RE+SF D+VA+QLT
Sbjct  10   TRIPSNTRFPSKASHSFPTQCALKRLEVTEFSGLRSTSCVTYANSARESSFFDLVASQLT  69

Query  219  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            PK  G+ PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+HL
Sbjct  70   PKTNGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKADVK++DNETI+VDGKPIKVVS
Sbjct  130  LKYDSMLGTFKADVKILDNETITVDGKPIKVVS  162



>ref|XP_010270515.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nelumbo nucifera]
Length=452

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 132/153 (86%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTS---TPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            SRIP  TRLPS++S     QCFSKRLEVA+FSGLRSS  VTF    RE+SF DVVA+QL 
Sbjct  10   SRIPANTRLPSRSSHSHATQCFSKRLEVADFSGLRSSTSVTFGKNARESSFFDVVASQLA  69

Query  219  PK-ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            PK A   PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+HL
Sbjct  70   PKVAASTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKA+VK+VDNETISVDGKPIKVVS
Sbjct  130  LKYDSMLGTFKAEVKIVDNETISVDGKPIKVVS  162



>gb|ACU20783.1| unknown [Glycine max]
Length=452

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 133/154 (86%), Gaps = 7/154 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            +RIPT T+ PSK S     QC SKRLEV EFSGLRS+ CVT++N  RE+SF D+VA+QLT
Sbjct  10   TRIPTNTKFPSKASHSFPTQCASKRLEVTEFSGLRSTSCVTYANDARESSFFDLVASQLT  69

Query  219  PKATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  392
            PK  G+  PV+G TVAKLKVAINGFGRIG NFLRCWHGRKDSPLEV+VVNDS GVKNA+H
Sbjct  70   PKTNGSSTPVRGETVAKLKVAINGFGRIGGNFLRCWHGRKDSPLEVVVVNDSGGVKNASH  129

Query  393  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LLKYDSMLGTFKADVK++DNETI+VDGKPIKVVS
Sbjct  130  LLKYDSMLGTFKADVKILDNETITVDGKPIKVVS  163



>gb|ACJ85309.1| unknown [Medicago truncatula]
Length=229

 Score =   229 bits (583),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 132/153 (86%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            +RIPT TR PSK S     QC S+RLEVAEFSGL+S+ C+T+++  RE+SFSDVVAAQL 
Sbjct  10   TRIPTSTRFPSKASHSFPTQCASRRLEVAEFSGLKSTSCITYASNARESSFSDVVAAQLA  69

Query  219  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
             KA G+  V+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   TKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKADVK+++N TI+VDGKPI VVS
Sbjct  130  LKYDSMLGTFKADVKILNNGTITVDGKPILVVS  162



>sp|P12859.2|G3PB_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Pisum sativum]
 gb|AAA84543.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Pisum sativum]
Length=451

 Score =   235 bits (599),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 134/153 (88%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTF--SNREASFSDVVAAQLT  218
            +RIPT TR PSKTS     QC SKRLEV EFSGL+S+ C+++  S R++SF DVVAAQLT
Sbjct  10   TRIPTNTRFPSKTSHSFPSQCASKRLEVGEFSGLKSTSCISYVHSARDSSFYDVVAAQLT  69

Query  219  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
             KA G+  VKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   SKANGSTAVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKA+VK+++NETI+VDGKPIKVVS
Sbjct  130  LKYDSMLGTFKAEVKILNNETITVDGKPIKVVS  162



>gb|KJB57936.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=455

 Score =   235 bits (599),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 131/156 (84%), Gaps = 9/156 (6%)
 Frame = +3

Query  54   SRIPTRTRLPSKT-----STPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQ  212
            SRI   TRLPSKT     S  QC S RL+V EFSGLRS+ CVTF N  R+ASF DVVAAQ
Sbjct  10   SRIRATTRLPSKTTHSFPSQIQCSSTRLQVTEFSGLRSASCVTFVNNARDASFFDVVAAQ  69

Query  213  LTPKATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNA  386
            LTPK  G   PV+G TVAKLKVAINGFGRIGRNFLRCWHGRK+SPL+VIVVNDS GVKNA
Sbjct  70   LTPKTAGGATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGGVKNA  129

Query  387  AHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            +HLLKYDSMLGTFKADVK+VDNETISVDGKPIKVVS
Sbjct  130  SHLLKYDSMLGTFKADVKIVDNETISVDGKPIKVVS  165



>emb|CAA33262.1| unnamed protein product [Pisum sativum]
Length=447

 Score =   234 bits (598),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 134/153 (88%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTF--SNREASFSDVVAAQLT  218
            +RIPT TR PSKTS     QC SKRLEV EFSGL+S+ C+++  S R++SF DVVAAQLT
Sbjct  6    TRIPTNTRFPSKTSHSFPSQCASKRLEVGEFSGLKSTSCISYVHSARDSSFYDVVAAQLT  65

Query  219  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
             KA G+  VKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  66   SKANGSTAVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  125

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKA+VK+++NETI+VDGKPIKVVS
Sbjct  126  LKYDSMLGTFKAEVKILNNETITVDGKPIKVVS  158



>gb|AES74103.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=415

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 133/153 (87%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            +RIPT TR PSK S     QC SKRLEVAEFSGL+S+ C+T+++  RE+SFSDVVAAQL 
Sbjct  10   TRIPTSTRFPSKASHSFPTQCASKRLEVAEFSGLKSTSCITYASNARESSFSDVVAAQLA  69

Query  219  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
             KA G+  V+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   TKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKADVK+++NETI+VDGKPI VVS
Sbjct  130  LKYDSMLGTFKADVKILNNETITVDGKPILVVS  162



>ref|XP_007135965.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
 gb|ESW07959.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
Length=451

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 131/153 (86%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            +RIPT T  PSK S     QC SKRLEV +FSGLRS+ CVT+++  RE+SF D VAAQLT
Sbjct  10   TRIPTNTSFPSKASHSFPTQCTSKRLEVNDFSGLRSTSCVTYASNARESSFFDTVAAQLT  69

Query  219  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            PK  G+ PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   PKTNGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKADVK+VDNETISVDGK IKVVS
Sbjct  130  LKYDSMLGTFKADVKIVDNETISVDGKLIKVVS  162



>ref|NP_001240080.1| uncharacterized protein LOC100806482 [Glycine max]
 gb|ACU18570.1| unknown [Glycine max]
 gb|KHN33783.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=451

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 132/153 (86%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            +RIP+ TR PSK S     QC  KRLEV EFSGLRS+ CVT++N  RE+SF D+VA+QLT
Sbjct  10   TRIPSNTRFPSKASHSFPTQCALKRLEVTEFSGLRSTSCVTYANSARESSFFDLVASQLT  69

Query  219  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            PK  G+ PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+HL
Sbjct  70   PKTNGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKADVK++DNETI+VDGK IKVVS
Sbjct  130  LKYDSMLGTFKADVKILDNETITVDGKSIKVVS  162



>gb|ACJ84309.1| unknown [Medicago truncatula]
 gb|AFK44245.1| unknown [Medicago truncatula]
Length=451

 Score =   232 bits (591),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 133/153 (87%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            +RIPT TR PSK S     QC SKRLEVAEFSGL+S+ C+T+++  RE+SFSDVVAAQL 
Sbjct  10   TRIPTSTRFPSKASHSFPTQCASKRLEVAEFSGLKSTSCITYASNARESSFSDVVAAQLA  69

Query  219  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
             KA G+  V+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   TKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKADVK+++NETI+VDGKPI VVS
Sbjct  130  LKYDSMLGTFKADVKILNNETITVDGKPILVVS  162



>ref|XP_003603851.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES74102.1| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=451

 Score =   232 bits (591),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 133/153 (87%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            +RIPT TR PSK S     QC SKRLEVAEFSGL+S+ C+T+++  RE+SFSDVVAAQL 
Sbjct  10   TRIPTSTRFPSKASHSFPTQCASKRLEVAEFSGLKSTSCITYASNARESSFSDVVAAQLA  69

Query  219  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
             KA G+  V+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   TKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKADVK+++NETI+VDGKPI VVS
Sbjct  130  LKYDSMLGTFKADVKILNNETITVDGKPILVVS  162



>ref|XP_002510706.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF52893.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=458

 Score =   232 bits (592),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 130/153 (85%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  218
            SRIP  TRLPSK++     QC SKRLEVAEFSGLR+S C+T++    EASF D+VAAQ+ 
Sbjct  10   SRIPASTRLPSKSAHSFPTQCSSKRLEVAEFSGLRASSCMTYAKNASEASFFDLVAAQMA  69

Query  219  PK-ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            PK AT  P +  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+HL
Sbjct  70   PKVATSTPTRAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKADVK+VDN TISVDGKPIKVVS
Sbjct  130  LKYDSMLGTFKADVKIVDNTTISVDGKPIKVVS  162



>ref|XP_006577850.1| PREDICTED: uncharacterized protein LOC100806482 isoform X1 [Glycine 
max]
Length=452

 Score =   232 bits (591),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 131/154 (85%), Gaps = 7/154 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            +RIP+ TR PSK S     QC  KRLEV EFSGLRS+ CVT++N  RE+SF D+VA+QLT
Sbjct  10   TRIPSNTRFPSKASHSFPTQCALKRLEVTEFSGLRSTSCVTYANSARESSFFDLVASQLT  69

Query  219  PKATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  392
            PK T    PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+H
Sbjct  70   PKQTNGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASH  129

Query  393  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LLKYDSMLGTFKADVK++DNETI+VDGK IKVVS
Sbjct  130  LLKYDSMLGTFKADVKILDNETITVDGKSIKVVS  163



>emb|CDP07271.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   231 bits (590),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 130/158 (82%), Gaps = 11/158 (7%)
 Frame = +3

Query  54   SRIPTRTRLPSKTS------TPQCFSKRLEVAEFSGLRSSGCVTFS--NREASFSDVVAA  209
            SRIP  TRL SKTS      T   FSKRLEV E+SGLRSSGCVTF+  +RE SF D  A 
Sbjct  11   SRIPANTRLVSKTSHYNSFPTQYSFSKRLEVDEYSGLRSSGCVTFATNSRETSFFDAAAV  70

Query  210  QLTPK---ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVK  380
            QLTPK   A   PVKG TVAKLKVAINGFGRIGRNFLRCWHGRK+SPL+VIVVNDSAGVK
Sbjct  71   QLTPKRQNAGSTPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSAGVK  130

Query  381  NAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            NA+HLLKYDSMLGTFKADVKVVD ETISVDGKPI+VVS
Sbjct  131  NASHLLKYDSMLGTFKADVKVVDTETISVDGKPIQVVS  168



>ref|XP_004500847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cicer arietinum]
Length=525

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 132/154 (86%), Gaps = 7/154 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTST---PQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            +RIPT TR PSK S     QC SKRLEVAEF GL+S+ C+T++N  R++SFSDVVAAQLT
Sbjct  83   TRIPTNTRFPSKASHNFPTQCASKRLEVAEFCGLKSTSCITYANNARDSSFSDVVAAQLT  142

Query  219  PKAT--GAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  392
             KA     PV+G TVAKLKVAINGFGRIGRNFLRCWH RKDSPLEVIVVNDS GVKNA+H
Sbjct  143  SKAAVGSIPVRGETVAKLKVAINGFGRIGRNFLRCWHERKDSPLEVIVVNDSGGVKNASH  202

Query  393  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LLKYDSMLGTFKADVK+++NETI+VDGKPIKVVS
Sbjct  203  LLKYDSMLGTFKADVKILNNETITVDGKPIKVVS  236



>ref|XP_011034836.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Populus euphratica]
Length=452

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 131/153 (86%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKT--STP-QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  218
            SRIP  TRLPSKT  S P QC SKRLEVAEFSGLR+S CVT++    E SF D+VA+QL 
Sbjct  10   SRIPANTRLPSKTNHSFPTQCSSKRLEVAEFSGLRASSCVTYAKNACEGSFFDMVASQLA  69

Query  219  PK-ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            PK A   PV+  TV+KLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+HL
Sbjct  70   PKVAVSTPVRAETVSKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKA+VK+VDNETISVDGKPIKVVS
Sbjct  130  LKYDSMLGTFKAEVKIVDNETISVDGKPIKVVS  162



>sp|P09044.1|G3PB_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34076.1| glyceraldehyde-3-phosphate dehydrogenase B-subunit precursor, 
partial [Nicotiana tabacum]
Length=438

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 121/131 (92%), Gaps = 1/131 (1%)
 Frame = +3

Query  105  CFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKAT-GAPVKGVTVAKLKVAIN  281
            C SK+ EVAEF+GLRSSGCVTFSN+E+SF DVV+AQLTPK T   PVKG TVAKLKVAIN
Sbjct  1    CLSKKFEVAEFAGLRSSGCVTFSNKESSFFDVVSAQLTPKTTRSTPVKGETVAKLKVAIN  60

Query  282  GFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETI  461
            GFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+HLLKYDSMLGTFKADVK+VDNETI
Sbjct  61   GFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADVKIVDNETI  120

Query  462  SVDGKPIKVVS  494
            SVDGK IKVVS
Sbjct  121  SVDGKHIKVVS  131



>ref|XP_003603850.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=490

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 133/153 (87%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            +RIPT TR PSK S     QC SKRLEVAEFSGL+S+ C+T+++  RE+SFSDVVAAQL 
Sbjct  10   TRIPTSTRFPSKASHSFPTQCASKRLEVAEFSGLKSTSCITYASNARESSFSDVVAAQLA  69

Query  219  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
             KA G+  V+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   TKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKADVK+++NETI+VDGKPI VVS
Sbjct  130  LKYDSMLGTFKADVKILNNETITVDGKPILVVS  162



>ref|XP_011034837.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Populus euphratica]
Length=450

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 131/153 (86%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKT--STP-QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  218
            SRIP  TRLPSKT  S P QC SKRLEVAEFSGLR+S CVT++    E SF D+VA+QL 
Sbjct  10   SRIPANTRLPSKTNHSFPTQCSSKRLEVAEFSGLRASSCVTYAKNACEGSFFDMVASQLA  69

Query  219  PK-ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            PK A   PV+  TV+KLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+HL
Sbjct  70   PKVAVSTPVRAETVSKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKA+VK+VDNETISVDGKPIKVVS
Sbjct  130  LKYDSMLGTFKAEVKIVDNETISVDGKPIKVVS  162



>ref|XP_006383782.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61579.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=308

 Score =   226 bits (575),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 127/153 (83%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  218
            SRIP  TRLPSK +     Q   KRLEVAEFSGLR+S CVT++    E SF DVVA+QL 
Sbjct  10   SRIPANTRLPSKINHSFPTQSSLKRLEVAEFSGLRASSCVTYAKNASEGSFFDVVASQLA  69

Query  219  PK-ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            PK A   PV+  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+HL
Sbjct  70   PKVAVSTPVRAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKA+VK+VDNETISVDGKPIKVVS
Sbjct  130  LKYDSMLGTFKAEVKIVDNETISVDGKPIKVVS  162



>ref|XP_008452998.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Cucumis melo]
Length=451

 Score =   230 bits (586),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 134/153 (88%), Gaps = 7/153 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            +RIPT TRLPSKTS     +C +KRL+VAEF+GLRS+  ++F N  RE SF DVVAAQLT
Sbjct  10   TRIPTNTRLPSKTSYSFPTRCSAKRLDVAEFNGLRSAS-LSFPNNGREGSFFDVVAAQLT  68

Query  219  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            PK  G+ PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+HL
Sbjct  69   PKVVGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHL  128

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKA+VK+VDNETISVDGKPIKVVS
Sbjct  129  LKYDSMLGTFKAEVKIVDNETISVDGKPIKVVS  161



>ref|XP_007018105.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
 gb|EOY15330.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
Length=452

 Score =   229 bits (584),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 132/153 (86%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  218
            SRIP  T LPSK++     QC +KRLEVAEFSGLRSS  VTF+    EASF DVVAAQLT
Sbjct  10   SRIPASTTLPSKSTHSFPTQCSTKRLEVAEFSGLRSSSRVTFARNVGEASFFDVVAAQLT  69

Query  219  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            PK  G+ PV+G TVAKLKVAINGFGRIGRNFLRCWHGR++SPL+VIVVNDS GVKNA+HL
Sbjct  70   PKTGGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRENSPLDVIVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKADVK+V+NETISVDGKPIKVVS
Sbjct  130  LKYDSMLGTFKADVKIVNNETISVDGKPIKVVS  162



>ref|XP_011041188.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Populus euphratica]
Length=452

 Score =   229 bits (584),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 129/153 (84%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKT--STP-QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  218
            SRIP  TRLPSK   S P Q  SKRLEVAEFSGLR+S CVT++    E SF DVVA+QL 
Sbjct  10   SRIPATTRLPSKINRSFPTQSSSKRLEVAEFSGLRASSCVTYAKNASEGSFFDVVASQLA  69

Query  219  PKAT-GAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            PKA    PV+  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+HL
Sbjct  70   PKAAVSTPVRAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKADVK+VDNETISVDGKPIKVVS
Sbjct  130  LKYDSMLGTFKADVKIVDNETISVDGKPIKVVS  162



>ref|XP_009384600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=447

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 130/150 (87%), Gaps = 5/150 (3%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLTPK-  224
            SRIP+ TR   K +T   FSKRLEVAEFSGLRSS  +TF+   REASFSDV+A+QL+ K 
Sbjct  10   SRIPSNTRFHCKANT--SFSKRLEVAEFSGLRSSTSLTFATHGREASFSDVLASQLSTKT  67

Query  225  ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKY  404
            A   PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+HLLKY
Sbjct  68   ARAVPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVLVVNDSGGVKNASHLLKY  127

Query  405  DSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            DSMLGTFKADVK+VDNETISVDGKPIKVVS
Sbjct  128  DSMLGTFKADVKIVDNETISVDGKPIKVVS  157



>ref|XP_004145550.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157068.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55522.1| hypothetical protein Csa_4G664300 [Cucumis sativus]
Length=451

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 131/152 (86%), Gaps = 5/152 (3%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN-REASFSDVVAAQLTP  221
            +RIPT TRLPSKTS     +C SKRL VAEF+GLRS+   + +N RE SF D VAAQLTP
Sbjct  10   TRIPTNTRLPSKTSYSFPTRCSSKRLNVAEFNGLRSASLSSSNNGREGSFFDAVAAQLTP  69

Query  222  KATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLL  398
            KA  + PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+HLL
Sbjct  70   KAVASTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  129

Query  399  KYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            KYDSMLGTFKA+VK+VDNETISVDGKPIKVVS
Sbjct  130  KYDSMLGTFKAEVKIVDNETISVDGKPIKVVS  161



>ref|XP_010094540.1| Glyceraldehyde-3-phosphate dehydrogenase B [Morus notabilis]
 gb|EXB56294.1| Glyceraldehyde-3-phosphate dehydrogenase B [Morus notabilis]
Length=1333

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 135/154 (88%), Gaps = 8/154 (5%)
 Frame = +3

Query  57   RIPTRTRLPSKT----STP-QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQL  215
            RIPT TRLPS +    S P QCFSK+LEVAEFSGLRSS CVT++   REASF DVVAAQL
Sbjct  12   RIPTNTRLPSNSKPSHSFPTQCFSKKLEVAEFSGLRSSSCVTYAKNAREASFFDVVAAQL  71

Query  216  TPKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  392
            TP+  G APVKG TVAKLKVAINGFGRIGRNFLRCWHGR++SPL+VI+VNDS GVKNA+H
Sbjct  72   TPRTAGSAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRQNSPLDVIIVNDSGGVKNASH  131

Query  393  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LLKYDSMLGTFKADVK+VD+ TISVDGKPIKVVS
Sbjct  132  LLKYDSMLGTFKADVKIVDDTTISVDGKPIKVVS  165



>ref|XP_009384599.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=449

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 130/152 (86%), Gaps = 7/152 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLTPK-  224
            SRIP+ TR   K +T   FSKRLEVAEFSGLRSS  +TF+   REASFSDV+A+QL+ K 
Sbjct  10   SRIPSNTRFHCKANT--SFSKRLEVAEFSGLRSSTSLTFATHGREASFSDVLASQLSTKL  67

Query  225  --ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLL  398
              A   PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+HLL
Sbjct  68   QTARAVPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVLVVNDSGGVKNASHLL  127

Query  399  KYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            KYDSMLGTFKADVK+VDNETISVDGKPIKVVS
Sbjct  128  KYDSMLGTFKADVKIVDNETISVDGKPIKVVS  159



>ref|XP_009382077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=452

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 128/153 (84%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTPQ---CFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQL-  215
            SRIP+ T   SK +      CFSKRLEVAEFSGLRSS CVTF+   R+ASFSDV+AAQL 
Sbjct  10   SRIPSNTWFHSKAAHSHPTSCFSKRLEVAEFSGLRSSACVTFATNGRDASFSDVLAAQLS  69

Query  216  TPKATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            T  A    VKG TVAKLKVAINGFGRIGRNFLRCWHGR DSPLEV+VVNDS GVKNA+HL
Sbjct  70   TETARAVLVKGETVAKLKVAINGFGRIGRNFLRCWHGRNDSPLEVVVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDS+LGTFKADVK+VDNETISVDGKPIKVVS
Sbjct  130  LKYDSILGTFKADVKIVDNETISVDGKPIKVVS  162



>gb|KDP36765.1| hypothetical protein JCGZ_08056 [Jatropha curcas]
Length=452

 Score =   227 bits (579),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 129/153 (84%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  218
            SRIP  TRLPSKT+     QC SKRLEVAEFSGLR++  V+++    E SF DVVAAQ+T
Sbjct  10   SRIPASTRLPSKTTYSFPSQCSSKRLEVAEFSGLRATSHVSYAKNATEGSFFDVVAAQMT  69

Query  219  PK-ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            PK A   P++  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL
Sbjct  70   PKVAASTPIRAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKADVK+VD+ TISVDGK IKVVS
Sbjct  130  LKYDSMLGTFKADVKIVDDSTISVDGKHIKVVS  162



>ref|XP_010918353.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Elaeis guineensis]
Length=452

 Score =   227 bits (578),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 131/154 (85%), Gaps = 8/154 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTS----TPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQL  215
            SRIP+ TR  SK +    TP  F+KRLEVAEFSGLRSS CVTF+   REASFSDV+AAQL
Sbjct  10   SRIPSNTRFHSKATHSHPTPS-FTKRLEVAEFSGLRSSTCVTFATQGREASFSDVLAAQL  68

Query  216  TPKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  392
              K  GA PV+G TVAKLKVAINGFGRIGRNFLRCWHGRK+SPL+V+VVNDS GVKNA+H
Sbjct  69   ASKTVGASPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVVVVNDSGGVKNASH  128

Query  393  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LLKYDSMLGTFKADVK+VDN TISVDGKPI VV+
Sbjct  129  LLKYDSMLGTFKADVKIVDNGTISVDGKPIMVVA  162



>ref|XP_010686856.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=451

 Score =   227 bits (578),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 130/153 (85%), Gaps = 7/153 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP-----QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLT  218
            +RIP  TRLP+K +       QC  K+L+VA+FSGLRSS CVTF+ REASF DV+AAQLT
Sbjct  10   TRIPASTRLPTKAAQQHSFPTQCSFKKLDVADFSGLRSSNCVTFT-REASFHDVIAAQLT  68

Query  219  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
             K TGA PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVK+A HL
Sbjct  69   TKTTGAAPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHL  128

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDS+LGTFKADVK+VDNET S+DGK IKVVS
Sbjct  129  LKYDSILGTFKADVKIVDNETFSIDGKSIKVVS  161



>sp|P12860.1|G3PB_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Spinacia oleracea]
 emb|CAA33263.1| unnamed protein product [Spinacia oleracea]
 gb|AAD10218.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
B [Spinacia oleracea]
Length=451

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 129/153 (84%), Gaps = 7/153 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP-----QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLT  218
            SRIP  TRL SK S       QC  KRL+VA+FSGLRSS  VTF+ REASF DV+AAQLT
Sbjct  10   SRIPASTRLASKASQQYSFLTQCSFKRLDVADFSGLRSSNSVTFT-REASFHDVIAAQLT  68

Query  219  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
             K TGA PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVK+A HL
Sbjct  69   TKPTGAAPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHL  128

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDS+LGTFKADVK++DNET S+DGKPIKVVS
Sbjct  129  LKYDSILGTFKADVKIIDNETFSIDGKPIKVVS  161



>ref|XP_002300632.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
 gb|EEE79905.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
Length=474

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 129/151 (85%), Gaps = 6/151 (4%)
 Frame = +3

Query  60   IPTRTRLPSKT--STP-QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLTPK  224
            IP  TRLPSKT  S P QC SKRLEVAEFSGLR+S CVT++    E SF D+VA+QL PK
Sbjct  34   IPANTRLPSKTNHSFPTQCSSKRLEVAEFSGLRASSCVTYAKNASEGSFFDMVASQLAPK  93

Query  225  -ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLK  401
             A   PV+  TV+KLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+HLLK
Sbjct  94   VAVSTPVRAETVSKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLK  153

Query  402  YDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            YDSMLGTFKA+VK+VDNETISVDGKPIKVVS
Sbjct  154  YDSMLGTFKAEVKIVDNETISVDGKPIKVVS  184



>ref|XP_008452997.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Cucumis melo]
Length=452

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 132/154 (86%), Gaps = 8/154 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            +RIPT TRLPSKTS     +C +KRL+VAEF+GLRS+  ++F N  RE SF DVVAAQLT
Sbjct  10   TRIPTNTRLPSKTSYSFPTRCSAKRLDVAEFNGLRSA-SLSFPNNGREGSFFDVVAAQLT  68

Query  219  PKAT--GAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  392
            PK      PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+H
Sbjct  69   PKQVVGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASH  128

Query  393  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LLKYDSMLGTFKA+VK+VDNETISVDGKPIKVVS
Sbjct  129  LLKYDSMLGTFKAEVKIVDNETISVDGKPIKVVS  162



>ref|XP_002307806.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE94802.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
Length=452

 Score =   225 bits (573),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 128/153 (84%), Gaps = 6/153 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKT--STP-QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  218
            SRIP  TRLPSK   S P Q   KRLEVAEFSGLR+S CVT++    E SF DVVA+QL 
Sbjct  10   SRIPANTRLPSKINHSFPTQSSLKRLEVAEFSGLRASSCVTYAKNASEGSFFDVVASQLA  69

Query  219  PK-ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            PK A   PV+  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+HL
Sbjct  70   PKVAVSTPVRAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHL  129

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKA+VK+VDNETISVDGKPIKVVS
Sbjct  130  LKYDSMLGTFKAEVKIVDNETISVDGKPIKVVS  162



>ref|XP_008786670.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Phoenix dactylifera]
Length=452

 Score =   225 bits (573),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 130/154 (84%), Gaps = 8/154 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTS----TPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQL  215
            SRIP+ TR  SK +    TP  F+KRLEVAEF GLRSS CVTF+   REASFSDV+AAQL
Sbjct  10   SRIPSNTRFHSKATHVPPTPS-FTKRLEVAEFLGLRSSTCVTFATQGREASFSDVLAAQL  68

Query  216  TPKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  392
              K  GA PV+G TVAKLKVAINGFGRIGRNFLRCWHGRK+SPL+V+VVNDS GVKNA+H
Sbjct  69   ASKTVGASPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVVVVNDSGGVKNASH  128

Query  393  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LLKYDSMLGTFKADVK+VDN TISVDGKP+ VVS
Sbjct  129  LLKYDSMLGTFKADVKIVDNGTISVDGKPVMVVS  162



>gb|KDO85183.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85184.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=275

 Score =   219 bits (559),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 128/154 (83%), Gaps = 7/154 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  219  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  392
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+H
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASH  129

Query  393  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LLKYDS+LGTFKADVK+VDNETISVDGK IKVVS
Sbjct  130  LLKYDSLLGTFKADVKIVDNETISVDGKLIKVVS  163



>gb|KDO85179.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85180.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=248

 Score =   218 bits (556),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 128/154 (83%), Gaps = 7/154 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  219  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  392
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+H
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASH  129

Query  393  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LLKYDS+LGTFKADVK+VDNETISVDGK IKVVS
Sbjct  130  LLKYDSLLGTFKADVKIVDNETISVDGKLIKVVS  163



>gb|KDO85181.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85182.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=269

 Score =   219 bits (557),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 128/154 (83%), Gaps = 7/154 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  219  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  392
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+H
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASH  129

Query  393  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LLKYDS+LGTFKADVK+VDNETISVDGK IKVVS
Sbjct  130  LLKYDSLLGTFKADVKIVDNETISVDGKLIKVVS  163



>gb|KDO85177.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85178.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=304

 Score =   219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 128/154 (83%), Gaps = 7/154 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  219  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  392
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+H
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASH  129

Query  393  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LLKYDS+LGTFKADVK+VDNETISVDGK IKVVS
Sbjct  130  LLKYDSLLGTFKADVKIVDNETISVDGKLIKVVS  163



>ref|XP_010061201.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Eucalyptus grandis]
 gb|KCW68119.1| hypothetical protein EUGRSUZ_F01793 [Eucalyptus grandis]
Length=454

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 119/134 (89%), Gaps = 3/134 (2%)
 Frame = +3

Query  102  QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLTPKATG-APVKGVTVAKLKV  272
            QCFSKRLEVAEFSGLR+  CVT++    E SF D VAAQLTPK +  AP KG TVAKLKV
Sbjct  30   QCFSKRLEVAEFSGLRAGSCVTYAKNAGEGSFFDAVAAQLTPKTSAPAPAKGETVAKLKV  89

Query  273  AINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDN  452
            AINGFGRIGRNFLRCWHGRK+SPL+VIVVNDS GVKNA+HLLKYDSMLGTFKADVK+VDN
Sbjct  90   AINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGGVKNASHLLKYDSMLGTFKADVKIVDN  149

Query  453  ETISVDGKPIKVVS  494
            ETISVDGKP+KVVS
Sbjct  150  ETISVDGKPVKVVS  163



>ref|XP_010539030.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Tarenaya hassleriana]
Length=453

 Score =   222 bits (566),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 128/154 (83%), Gaps = 7/154 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQL  215
            SRIP   R  SK++      QC SKR+E AEF+GLRSSGC+ +S    ++SF D VA+QL
Sbjct  10   SRIPVNPRFHSKSNVNSFHAQCSSKRVEFAEFAGLRSSGCMVYSKNGGDSSFFDAVASQL  69

Query  216  TPKA-TGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  392
            TPKA   APV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+H
Sbjct  70   TPKAVAAAPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASH  129

Query  393  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LLKYDSMLGTFKADVK+V+NETISVDGK IKVVS
Sbjct  130  LLKYDSMLGTFKADVKIVNNETISVDGKLIKVVS  163



>gb|KDO85176.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=329

 Score =   218 bits (554),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 128/154 (83%), Gaps = 7/154 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  219  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  392
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+H
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASH  129

Query  393  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LLKYDS+LGTFKADVK+VDNETISVDGK IKVVS
Sbjct  130  LLKYDSLLGTFKADVKIVDNETISVDGKLIKVVS  163



>ref|XP_006435407.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
 gb|ESR48647.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
Length=329

 Score =   218 bits (554),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 128/154 (83%), Gaps = 7/154 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  219  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  392
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+H
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASH  129

Query  393  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LLKYDS+LGTFKADVK+VDNETISVDGK IKVVS
Sbjct  130  LLKYDSLLGTFKADVKIVDNETISVDGKLIKVVS  163



>gb|KDO85175.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=309

 Score =   217 bits (552),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 128/154 (83%), Gaps = 7/154 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  219  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  392
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+H
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASH  129

Query  393  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LLKYDS+LGTFKADVK+VDNETISVDGK IKVVS
Sbjct  130  LLKYDSLLGTFKADVKIVDNETISVDGKLIKVVS  163



>ref|XP_006395998.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
 dbj|BAJ34314.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33284.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
Length=447

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 126/153 (82%), Gaps = 10/153 (7%)
 Frame = +3

Query  54   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  221
            SRIP   RL SK++      QC SKRLEVAEFSGLR    V+ +  EASF D +AAQ+TP
Sbjct  10   SRIPVNPRLQSKSAIHSFPAQCSSKRLEVAEFSGLR----VSNNGGEASFFDAIAAQITP  65

Query  222  KA--TGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            KA  T  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  66   KAVTTSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  125

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKADVK+VDNETISVDGK IKVVS
Sbjct  126  LKYDSMLGTFKADVKIVDNETISVDGKLIKVVS  158



>gb|KDO85174.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=409

 Score =   219 bits (557),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 128/154 (83%), Gaps = 7/154 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  219  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  392
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+H
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASH  129

Query  393  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LLKYDS+LGTFKADVK+VDNETISVDGK IKVVS
Sbjct  130  LLKYDSLLGTFKADVKIVDNETISVDGKLIKVVS  163



>gb|ADH43199.1| glyceraldehyde-3-phosphate dehydrogenase [Vicia sativa]
Length=380

 Score =   218 bits (554),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 122/134 (91%), Gaps = 3/134 (2%)
 Frame = +3

Query  102  QCFSKRLEVAEFSGLRSSGCVTFS--NREASFSDVVAAQLTPKATGA-PVKGVTVAKLKV  272
            QC SKRLEV EFSGL+S+ CVT++   RE+SF DVVAAQL+ K TG+ PV+G TVAKLKV
Sbjct  7    QCGSKRLEVPEFSGLKSTSCVTYAINARESSFYDVVAAQLSTKRTGSTPVRGETVAKLKV  66

Query  273  AINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDN  452
            AINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HLLKYDSMLGTFKA+VK+++N
Sbjct  67   AINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGTFKAEVKILNN  126

Query  453  ETISVDGKPIKVVS  494
            ETI+VDGKPIKVVS
Sbjct  127  ETITVDGKPIKVVS  140



>ref|XP_006473831.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Citrus sinensis]
 gb|KDO85173.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=453

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 128/154 (83%), Gaps = 7/154 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  219  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  392
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+H
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASH  129

Query  393  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LLKYDS+LGTFKADVK+VDNETISVDGK IKVVS
Sbjct  130  LLKYDSLLGTFKADVKIVDNETISVDGKLIKVVS  163



>ref|XP_006435406.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
 gb|ESR48646.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
Length=453

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 128/154 (83%), Gaps = 7/154 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  218
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  219  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  392
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+H
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASH  129

Query  393  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LLKYDS+LGTFKADVK+VDNETISVDGK IKVVS
Sbjct  130  LLKYDSLLGTFKADVKIVDNETISVDGKLIKVVS  163



>ref|XP_009107645.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Brassica rapa]
 emb|CDY35800.1| BnaA08g04610D [Brassica napus]
Length=448

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 127/153 (83%), Gaps = 10/153 (7%)
 Frame = +3

Query  54   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  221
            SRIP + RL SK++      QC SKRLEVA FSGLR    V+ +  EASF D +AAQ+TP
Sbjct  10   SRIPVKPRLQSKSAIHSFPAQCSSKRLEVAAFSGLR----VSSNGGEASFFDAIAAQITP  65

Query  222  KATG--APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            KA G  +PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+V+NDS GVKNA+HL
Sbjct  66   KAVGTSSPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHL  125

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKADVK+VDNETISVDGK IKVVS
Sbjct  126  LKYDSMLGTFKADVKIVDNETISVDGKLIKVVS  158



>gb|KFK29151.1| hypothetical protein AALP_AA7G095400 [Arabis alpina]
Length=448

 Score =   216 bits (550),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 125/153 (82%), Gaps = 10/153 (7%)
 Frame = +3

Query  54   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  221
            SRIP   RL SK++      QC SKRL+VAEFSGLR+S     ++ +ASF D + AQ+  
Sbjct  10   SRIPANPRLQSKSAIHSFPAQCSSKRLQVAEFSGLRASN----NSGDASFFDAIVAQIAS  65

Query  222  KA--TGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            KA  T  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  66   KAVTTSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  125

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKADVK+VDNETISVDGKPIKVVS
Sbjct  126  LKYDSMLGTFKADVKIVDNETISVDGKPIKVVS  158



>ref|NP_174996.1| glyceraldehyde-3-phosphate dehydrogenase B [Arabidopsis thaliana]
 sp|P25857.2|G3PB_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPB, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase B; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51517.1|AC068324_5 glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAA32795.1| glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAK62594.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 gb|AAK64065.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAL85133.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAM19948.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 gb|AAM98232.1| unknown protein [Arabidopsis thaliana]
 gb|AAN72278.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 dbj|BAF02115.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AEE31933.1| glyceraldehyde-3-phosphate dehydrogenase B [Arabidopsis thaliana]
Length=447

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 123/153 (80%), Gaps = 10/153 (7%)
 Frame = +3

Query  54   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  221
            SRIP   RL SK++      QC SKRLEVAEFSGLR S        EASF D VAAQ+ P
Sbjct  10   SRIPVTQRLQSKSAIHSFPAQCSSKRLEVAEFSGLRMSSI----GGEASFFDAVAAQIIP  65

Query  222  KA--TGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            KA  T  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+V+NDS GVKNA+HL
Sbjct  66   KAVTTSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHL  125

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKA+VK+VDNETISVDGK IKVVS
Sbjct  126  LKYDSMLGTFKAEVKIVDNETISVDGKLIKVVS  158



>ref|XP_010500213.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic-like 
[Camelina sativa]
Length=447

 Score =   214 bits (544),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 124/153 (81%), Gaps = 10/153 (7%)
 Frame = +3

Query  54   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  221
            SRIP   RL SK++      QC SKRLEVAEFSGLR S     +  EASF D VAAQ+T 
Sbjct  10   SRIPVAQRLQSKSAVHSFPAQCSSKRLEVAEFSGLRMSS----NGGEASFFDAVAAQITA  65

Query  222  KATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            KA  A  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+V+NDS GVKNA+HL
Sbjct  66   KAVTASTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHL  125

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKA+VK+VDNETISVDGK IKVVS
Sbjct  126  LKYDSMLGTFKAEVKIVDNETISVDGKIIKVVS  158



>ref|XP_006307502.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
 gb|EOA40400.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
Length=447

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 125/153 (82%), Gaps = 10/153 (7%)
 Frame = +3

Query  54   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  221
            SRIP   RL SK++      QC SKRLEVAEFSGLR S     ++ EASF D VA+Q+T 
Sbjct  10   SRIPVAQRLQSKSAIHSFPAQCSSKRLEVAEFSGLRMSS----NSGEASFFDAVASQITT  65

Query  222  KA--TGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            KA  T  P++G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+V+NDS GVKNA+HL
Sbjct  66   KAVTTSTPIRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHL  125

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKA+VK+VDNETISVDGK IKVVS
Sbjct  126  LKYDSMLGTFKAEVKIVDNETISVDGKNIKVVS  158



>ref|XP_002891244.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH67503.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
Length=447

 Score =   211 bits (537),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 122/153 (80%), Gaps = 10/153 (7%)
 Frame = +3

Query  54   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  221
            SRIP   RL SK++      Q  SKRLEVAEFSGLR S        EASF D VAAQ+ P
Sbjct  10   SRIPVTQRLQSKSAIHSFPAQWSSKRLEVAEFSGLRMSSI----GGEASFFDAVAAQIIP  65

Query  222  KA--TGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  395
            KA  T  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+V+NDS GVKNA+HL
Sbjct  66   KAVTTSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHL  125

Query  396  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            LKYDSMLGTFKA+VK+VDNETISVDGK IKVVS
Sbjct  126  LKYDSMLGTFKAEVKIVDNETISVDGKLIKVVS  158



>ref|XP_006383783.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61580.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=421

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 115/130 (88%), Gaps = 3/130 (2%)
 Frame = +3

Query  114  KRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLTPK-ATGAPVKGVTVAKLKVAING  284
            +RLEVAEFSGLR+S CVT++    E SF DVVA+QL PK A   PV+  TVAKLKVAING
Sbjct  2    QRLEVAEFSGLRASSCVTYAKNASEGSFFDVVASQLAPKVAVSTPVRAETVAKLKVAING  61

Query  285  FGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETIS  464
            FGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+HLLKYDSMLGTFKA+VK+VDNETIS
Sbjct  62   FGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGTFKAEVKIVDNETIS  121

Query  465  VDGKPIKVVS  494
            VDGKPIKVVS
Sbjct  122  VDGKPIKVVS  131



>gb|EPS70760.1| hypothetical protein M569_03997, partial [Genlisea aurea]
Length=440

 Score =   209 bits (531),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 122/142 (86%), Gaps = 1/142 (1%)
 Frame = +3

Query  72   TRLPSKTS-TPQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKG  248
            +R+P+  + T QCFSKR+EV +FSGL+SS  ++F+ +E SF D VA +L   ++  PVKG
Sbjct  9    SRIPATPAFTSQCFSKRVEVGDFSGLKSSRGLSFAAKEVSFFDAVAPKLAGPSSSPPVKG  68

Query  249  VTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFK  428
             TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+HLLKYDSMLGTFK
Sbjct  69   ETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLLKYDSMLGTFK  128

Query  429  ADVKVVDNETISVDGKPIKVVS  494
            ADV+VVD++TISVDGK IKVVS
Sbjct  129  ADVQVVDSQTISVDGKLIKVVS  150



>gb|ABC68431.1| putative glyceraldehyde 3-phosphate dehydrogenase [Tragopogon 
pratensis]
Length=143

 Score =   197 bits (502),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 114/134 (85%), Gaps = 8/134 (6%)
 Frame = +3

Query  54   SRIPTRTRLPSK----TSTP-QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQ  212
            +RIPT TRLPSK    TS P QC +KRLEVAEFSGLRSSG VT++   +++SF DVV+AQ
Sbjct  10   TRIPTITRLPSKLSLSTSFPSQCSTKRLEVAEFSGLRSSGSVTYAKYVKDSSFFDVVSAQ  69

Query  213  LTPKATGAPVKGV-TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAA  389
             TPKA G+ V  V TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+
Sbjct  70   FTPKAAGSTVAKVETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNAS  129

Query  390  HLLKYDSMLGTFKA  431
            HLLKYDSMLGTFKA
Sbjct  130  HLLKYDSMLGTFKA  143



>gb|ABC68432.1| putative glyceraldehyde 3-phosphate dehydrogenase [Tragopogon 
dubius]
Length=143

 Score =   197 bits (501),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 114/134 (85%), Gaps = 8/134 (6%)
 Frame = +3

Query  54   SRIPTRTRLPSK----TSTP-QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQ  212
            +RIPT TRLPSK    TS P QC +KRLEVAEFSGLRSSG VT++   +++SF DVV+AQ
Sbjct  10   TRIPTITRLPSKPSLSTSFPSQCSTKRLEVAEFSGLRSSGSVTYAKYVKDSSFFDVVSAQ  69

Query  213  LTPKATGAPVKGV-TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAA  389
             TPKA G+ V  V TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+
Sbjct  70   FTPKAAGSTVAKVETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNAS  129

Query  390  HLLKYDSMLGTFKA  431
            HLLKYDSMLGTFKA
Sbjct  130  HLLKYDSMLGTFKA  143



>ref|XP_010478986.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X2 [Camelina sativa]
Length=445

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 122/151 (81%), Gaps = 8/151 (5%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTPQCFSK--RLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKA  227
            SRIP   R+ SK++     ++  RLEVA+FSGLR S     +  EASF D VAAQ+T KA
Sbjct  10   SRIPVTQRVQSKSAIHSFPAQXPRLEVADFSGLRMSS----NGGEASFFDAVAAQITAKA  65

Query  228  TGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLK  401
              A  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+V+NDS GVKNA+HLLK
Sbjct  66   VTASTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHLLK  125

Query  402  YDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            YDSMLGTFKA+VK+VDNETISVDGK IKVVS
Sbjct  126  YDSMLGTFKAEVKIVDNETISVDGKLIKVVS  156



>gb|ABF93790.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
Length=207

 Score =   193 bits (490),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 119/149 (80%), Gaps = 6/149 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  230
            SRIP   RL SK ++ Q    R++ A+FSGLR   C ++ + REASFSDV+ +QL  +AT
Sbjct  10   SRIPATARLHSKAASKQ----RVDFADFSGLRPGSCSISHAAREASFSDVLGSQLVARAT  65

Query  231  GA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYD  407
            G   V+    AKLKVAINGFGRIGRNFLRCWH R++SPLEV+VVNDS GV+NA+HLLKYD
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHERENSPLEVVVVNDSGGVRNASHLLKYD  125

Query  408  SMLGTFKADVKVVDNETISVDGKPIKVVS  494
            SMLGTFKADVK+VD++TISVDGK IKVV+
Sbjct  126  SMLGTFKADVKIVDDQTISVDGKLIKVVA  154



>ref|XP_004985859.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Setaria italica]
Length=445

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 120/149 (81%), Gaps = 6/149 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  230
            SRIPT  RL S+ ++ Q    R++ A+FSGLR   C V+ + REASF DV+ AQL  KAT
Sbjct  10   SRIPTSARLNSRAASRQ----RVDFADFSGLRPGSCSVSTAAREASFYDVLGAQLVAKAT  65

Query  231  GA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYD  407
            G   V+    AKLKVAINGFGRIGRNFLRCWHGR+DSPL+V+VVNDS GV+NA+HLLKYD
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGREDSPLDVVVVNDSGGVRNASHLLKYD  125

Query  408  SMLGTFKADVKVVDNETISVDGKPIKVVS  494
            SMLGTFKADVK+VD+ TISVDGKPIKVVS
Sbjct  126  SMLGTFKADVKIVDDTTISVDGKPIKVVS  154



>gb|EMT30317.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Aegilops 
tauschii]
Length=442

 Score =   198 bits (503),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 121/149 (81%), Gaps = 6/149 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  230
            +RIPT  RL SK ++ Q    R++ A+FSGLR   C V+ + REASFSDV+ AQL  +A+
Sbjct  10   TRIPTSARLHSKAASRQ----RVDFADFSGLRPGSCSVSAAAREASFSDVLGAQLVARAS  65

Query  231  GA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYD  407
            G   V+    AKLKVAINGFGRIGRNFLRCWHGR++SPLEVIV+NDS GV+NA+HLLKYD
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVINDSGGVRNASHLLKYD  125

Query  408  SMLGTFKADVKVVDNETISVDGKPIKVVS  494
            SMLGTFKADVK+VDNETISVDGK I+VVS
Sbjct  126  SMLGTFKADVKIVDNETISVDGKNIQVVS  154



>gb|EMS49604.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Triticum 
urartu]
Length=444

 Score =   197 bits (502),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 121/149 (81%), Gaps = 6/149 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  230
            +RIPT  RL SK ++ Q    R++ A+FSGLR   C V+ + REASFSDV+ AQL  +A+
Sbjct  10   TRIPTSARLHSKAASRQ----RVDFADFSGLRPGSCSVSAAAREASFSDVLGAQLVARAS  65

Query  231  GA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYD  407
            G   V+    AKLKVAINGFGRIGRNFLRCWHGR++SPLEVIV+NDS GV+NA+HLLKYD
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVINDSGGVRNASHLLKYD  125

Query  408  SMLGTFKADVKVVDNETISVDGKPIKVVS  494
            SMLGTFKADVK+VDNETISVDGK I+VVS
Sbjct  126  SMLGTFKADVKIVDNETISVDGKNIQVVS  154



>ref|XP_006649326.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Oryza brachyantha]
Length=444

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 120/149 (81%), Gaps = 6/149 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  230
            SRIP   RL S+ ++ Q    R++ A+FSGLR   C V+ + REASFSDV+ +QL  +AT
Sbjct  10   SRIPATARLHSRAASKQ----RVDFADFSGLRPGSCSVSHAAREASFSDVLGSQLVARAT  65

Query  231  GA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYD  407
            G   V+    AKLKVAINGFGRIGRNFLRCWHGR++SPLEVIVVNDS GV+NA+HLLKYD
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVVNDSGGVRNASHLLKYD  125

Query  408  SMLGTFKADVKVVDNETISVDGKPIKVVS  494
            SMLGTFKADVK+VD+ETISVDGK IKVVS
Sbjct  126  SMLGTFKADVKIVDDETISVDGKLIKVVS  154



>dbj|BAJ86633.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 120/149 (81%), Gaps = 6/149 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  230
            +RIP   RL SK ++ Q    R++ A+FSGLR   C V+ + REASFSDV+ AQL  +A+
Sbjct  10   TRIPASARLHSKAASRQ----RVDFADFSGLRPGSCSVSAAAREASFSDVLGAQLVARAS  65

Query  231  GA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYD  407
            G   V+    AKLKVAINGFGRIGRNFLRCWHGR++SPLEVIV+NDS GV+NA+HLLKYD
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVINDSGGVRNASHLLKYD  125

Query  408  SMLGTFKADVKVVDNETISVDGKPIKVVS  494
            SMLGTFKADVK+VDNETISVDGK I+VVS
Sbjct  126  SMLGTFKADVKIVDNETISVDGKNIQVVS  154



>dbj|BAJ87214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   196 bits (498),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 120/149 (81%), Gaps = 6/149 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  230
            +RIP   RL SK ++ Q    R++ A+FSGLR   C V+ + REASFSDV+ AQL  +A+
Sbjct  10   TRIPASARLHSKAASRQ----RVDFADFSGLRPGSCSVSAAAREASFSDVLGAQLVARAS  65

Query  231  GA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYD  407
            G   V+    AKLKVAINGFGRIGRNFLRCWHGR++SPLEVIV+NDS GV+NA+HLLKYD
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVINDSGGVRNASHLLKYD  125

Query  408  SMLGTFKADVKVVDNETISVDGKPIKVVS  494
            SMLGTFKADVK+VDNETISVDGK I+VVS
Sbjct  126  SMLGTFKADVKIVDNETISVDGKNIQVVS  154



>ref|XP_008650588.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Zea mays]
 gb|ACF78460.1| unknown [Zea mays]
 gb|ACF87738.1| unknown [Zea mays]
 gb|ACG28147.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACG29047.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACR36877.1| unknown [Zea mays]
 tpg|DAA43140.1| TPA: glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
Length=449

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 120/150 (80%), Gaps = 3/150 (2%)
 Frame = +3

Query  54   SRIPTRTRLPSKT-STPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKA  227
            SRIP   RL S+  ++ +   +RL+ A+FSGLR   C V+ + REASFSDV+ AQL  KA
Sbjct  10   SRIPAGARLHSRAPASSRHGVQRLDFADFSGLRPGSCSVSAAAREASFSDVLGAQLVAKA  69

Query  228  TGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKY  404
            TG   V+    AKLKVAINGFGRIGRNFLRCWHGR+DSP++V+VVNDS GV+NA+HLLKY
Sbjct  70   TGENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGREDSPIDVVVVNDSGGVRNASHLLKY  129

Query  405  DSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            DSMLGTFKADVK+VD+ TISVDGKPI VVS
Sbjct  130  DSMLGTFKADVKIVDDTTISVDGKPITVVS  159



>ref|NP_001048847.1| Os03g0129300 [Oryza sativa Japonica Group]
 dbj|BAA85402.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AAN17393.1| Putative glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa 
Japonica Group]
 gb|ABF93788.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10761.1| Os03g0129300 [Oryza sativa Japonica Group]
 gb|EAY88378.1| hypothetical protein OsI_09835 [Oryza sativa Indica Group]
 gb|EAZ25455.1| hypothetical protein OsJ_09272 [Oryza sativa Japonica Group]
Length=444

 Score =   192 bits (489),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 119/149 (80%), Gaps = 6/149 (4%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  230
            SRIP   RL SK ++ Q    R++ A+FSGLR   C ++ + REASFSDV+ +QL  +AT
Sbjct  10   SRIPATARLHSKAASKQ----RVDFADFSGLRPGSCSISHAAREASFSDVLGSQLVARAT  65

Query  231  GA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYD  407
            G   V+    AKLKVAINGFGRIGRNFLRCWH R++SPLEV+VVNDS GV+NA+HLLKYD
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHERENSPLEVVVVNDSGGVRNASHLLKYD  125

Query  408  SMLGTFKADVKVVDNETISVDGKPIKVVS  494
            SMLGTFKADVK+VD++TISVDGK IKVVS
Sbjct  126  SMLGTFKADVKIVDDQTISVDGKLIKVVS  154



>gb|ABR16095.1| unknown [Picea sitchensis]
Length=229

 Score =   186 bits (473),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 113/133 (85%), Gaps = 6/133 (5%)
 Frame = +3

Query  114  KRLEVAEFSGLRS-SGCVTFSN--REASFS--DVVAAQLTPKA-TGAPVKGVTVAKLKVA  275
            KR+E++EF+GL+S SGC+T+    RE + +  D +A+Q+  KA     +KG TVAKLKVA
Sbjct  38   KRVEISEFAGLKSTSGCITYGRQARENNLNLFDALASQVVAKAGNSGAIKGETVAKLKVA  97

Query  276  INGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNE  455
            INGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+HLLKYDSMLGTFKA+VKVVDN+
Sbjct  98   INGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLLKYDSMLGTFKANVKVVDNK  157

Query  456  TISVDGKPIKVVS  494
            TISVDGKPI VVS
Sbjct  158  TISVDGKPILVVS  170



>ref|XP_003558903.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Brachypodium distachyon]
Length=446

 Score =   190 bits (482),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 118/150 (79%), Gaps = 5/150 (3%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGCVT--FSNREASFSDVVAAQLTPKA  227
            SRIPT      K ++ +   +RL++A+FSGLR   C     + REASFSDV+ AQL  +A
Sbjct  10   SRIPTGRLQHGKAASSKL--QRLDLADFSGLRPGSCSVSVAATREASFSDVLGAQLVARA  67

Query  228  TGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKY  404
            +G   V+    AKLKVAINGFGRIGRNFLRCWHGR++SPLEV+V+NDS GV+NA+HLLKY
Sbjct  68   SGENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVVVINDSGGVRNASHLLKY  127

Query  405  DSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            DSMLGTFKADVK+VDNETISVDGK I+VVS
Sbjct  128  DSMLGTFKADVKIVDNETISVDGKNIQVVS  157



>gb|ABK24645.1| unknown [Picea sitchensis]
Length=460

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 116/140 (83%), Gaps = 7/140 (5%)
 Frame = +3

Query  93   STPQCFSKRLEVAEFSGLRS-SGCVTFSN--REASFS--DVVAAQLTPKA-TGAPVKGVT  254
            S P  F KR+E++EF+GL+S SGC+T+    RE + +  D +A+Q+  KA     +KG T
Sbjct  32   SLPSTF-KRVEISEFAGLKSTSGCITYGRQARENNLNLFDALASQVVAKAGNSGAIKGET  90

Query  255  VAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKAD  434
            VAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+HLLKYDSMLGTFKA+
Sbjct  91   VAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLLKYDSMLGTFKAN  150

Query  435  VKVVDNETISVDGKPIKVVS  494
            VKVVDN+TISVDGKPI VVS
Sbjct  151  VKVVDNKTISVDGKPILVVS  170



>gb|ACN40006.1| unknown [Picea sitchensis]
Length=460

 Score =   189 bits (479),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 116/140 (83%), Gaps = 7/140 (5%)
 Frame = +3

Query  93   STPQCFSKRLEVAEFSGLRS-SGCVTFSN--REASFS--DVVAAQLTPKA-TGAPVKGVT  254
            S P  F KR+E++EF+GL+S SGC+T+    RE + +  D +A+Q+  KA     +KG T
Sbjct  32   SLPSTF-KRVEISEFAGLKSTSGCITYGRQARENNLNLFDALASQVVAKAGNSGAIKGET  90

Query  255  VAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKAD  434
            VAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+HLLKYDSMLGTFKA+
Sbjct  91   VAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLLKYDSMLGTFKAN  150

Query  435  VKVVDNETISVDGKPIKVVS  494
            VKVVDN+TISVDGKPI VVS
Sbjct  151  VKVVDNKTISVDGKPILVVS  170



>emb|CDY69523.1| BnaC08g46180D, partial [Brassica napus]
Length=402

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 99/107 (93%), Gaps = 2/107 (2%)
 Frame = +3

Query  180  EASFSDVVAAQLTPKATG--APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVI  353
            EASF D +AAQ+TPKA G  +PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+
Sbjct  6    EASFFDAIAAQITPKAVGTPSPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVV  65

Query  354  VVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            V+NDS GVKNA+HLLKYDSMLGTFKADVK+VDNETISVDGK IKVVS
Sbjct  66   VLNDSGGVKNASHLLKYDSMLGTFKADVKIVDNETISVDGKLIKVVS  112



>gb|ACN40526.1| unknown [Picea sitchensis]
Length=460

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 113/133 (85%), Gaps = 6/133 (5%)
 Frame = +3

Query  114  KRLEVAEFSGLRS-SGCVTFSN--REASFS--DVVAAQLTPKA-TGAPVKGVTVAKLKVA  275
            KR+E++EF+GL+S SGC+T+    RE + +  D +A+Q+  KA     +KG TVAKLKVA
Sbjct  38   KRVEISEFAGLKSTSGCITYGRQARENNLNLFDALASQVVAKAGNSGAIKGETVAKLKVA  97

Query  276  INGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNE  455
            INGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+HLLKYDSMLGTFKA+VKVVDN+
Sbjct  98   INGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLLKYDSMLGTFKANVKVVDNK  157

Query  456  TISVDGKPIKVVS  494
            TISVDGKPI VVS
Sbjct  158  TISVDGKPILVVS  170



>gb|AAD10210.1| glyceraldehyde 3-phosphate dehydrogenase B subunit [Arabidopsis 
thaliana]
Length=402

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 97/107 (91%), Gaps = 2/107 (2%)
 Frame = +3

Query  180  EASFSDVVAAQLTPKA--TGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVI  353
            EASF D VAAQ+ PKA  T  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+
Sbjct  7    EASFFDAVAAQIIPKAVTTSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVV  66

Query  354  VVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            V+NDS GVKNA+HLLKYDSMLGTFKA+VK+VDNETISVDGK IKVVS
Sbjct  67   VLNDSGGVKNASHLLKYDSMLGTFKAEVKIVDNETISVDGKLIKVVS  113



>ref|XP_010478985.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X1 [Camelina sativa]
Length=402

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 97/107 (91%), Gaps = 2/107 (2%)
 Frame = +3

Query  180  EASFSDVVAAQLTPKATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVI  353
            EASF D VAAQ+T KA  A  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+
Sbjct  7    EASFFDAVAAQITAKAVTASTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVV  66

Query  354  VVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            V+NDS GVKNA+HLLKYDSMLGTFKA+VK+VDNETISVDGK IKVVS
Sbjct  67   VLNDSGGVKNASHLLKYDSMLGTFKAEVKIVDNETISVDGKLIKVVS  113



>ref|XP_002982608.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
 gb|EFJ16361.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
Length=431

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 106/127 (83%), Gaps = 1/127 (1%)
 Frame = +3

Query  117  RLEVAEFSGLRSSGCVTFSNR-EASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGR  293
            ++E+AEFSGL++S  + F+ R +A+  D V  Q++   +G  +KG T AKLKVAINGFGR
Sbjct  15   KMELAEFSGLKASSSMPFAARNDATLFDTVRQQVSIVKSGGAIKGETTAKLKVAINGFGR  74

Query  294  IGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDG  473
            IGRNFLRCWHGRKDSPL+VI VNDS GVKNA+HLLKYDSMLGTFKA+VKVVD++TISVDG
Sbjct  75   IGRNFLRCWHGRKDSPLDVIAVNDSGGVKNASHLLKYDSMLGTFKANVKVVDDKTISVDG  134

Query  474  KPIKVVS  494
            K I VVS
Sbjct  135  KNITVVS  141



>ref|XP_002981126.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
 gb|EFJ17827.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
Length=431

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 106/127 (83%), Gaps = 1/127 (1%)
 Frame = +3

Query  117  RLEVAEFSGLRSSGCVTFSNR-EASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGR  293
            ++E+AEFSGL++S  + F+ R +A+  D V  Q++   +G  +KG T AKLKVAINGFGR
Sbjct  15   KMELAEFSGLKASSSMPFAARNDATLFDTVRQQVSIVKSGGAIKGETTAKLKVAINGFGR  74

Query  294  IGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDG  473
            IGRNFLRCWHGRKDSPL+VI VNDS GVKNA+HLLKYDSMLGTFKA+VKVVD++TISVDG
Sbjct  75   IGRNFLRCWHGRKDSPLDVIAVNDSGGVKNASHLLKYDSMLGTFKANVKVVDDKTISVDG  134

Query  474  KPIKVVS  494
            K I VVS
Sbjct  135  KNIAVVS  141



>ref|XP_001779769.1| predicted protein [Physcomitrella patens]
 gb|EDQ55453.1| predicted protein [Physcomitrella patens]
Length=400

 Score =   174 bits (442),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = +3

Query  126  VAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  305
            +AEFSG++S  CVTF  R    S +VAAQ    A+    + VT AK+KVAINGFGRIGRN
Sbjct  19   LAEFSGMKSVNCVTFEKRSDDLSTIVAAQTVVAASSGASRAVTEAKIKVAINGFGRIGRN  78

Query  306  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  485
            F+RCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDSMLGTF ADVKV  N+ ISVDGK IK
Sbjct  79   FIRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSMLGTFNADVKVEGNDAISVDGKVIK  138

Query  486  VVS  494
            VVS
Sbjct  139  VVS  141



>ref|XP_006855683.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
 gb|ERN17150.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
Length=413

 Score =   171 bits (433),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 101/147 (69%), Gaps = 32/147 (22%)
 Frame = +3

Query  54   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATG  233
            SR+PT T LPS+++  Q  S        S  R+ G V                       
Sbjct  10   SRVPTTTGLPSRSTQSQAHS--------SFFRTEGSV-----------------------  38

Query  234  APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSM  413
             PVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNAAHLLKYDSM
Sbjct  39   -PVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNAAHLLKYDSM  97

Query  414  LGTFKADVKVVDNETISVDGKPIKVVS  494
            LGTFKA VK+VDNETISVDGK IKVVS
Sbjct  98   LGTFKAAVKIVDNETISVDGKLIKVVS  124



>gb|ABK00053.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=393

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 101/131 (77%), Gaps = 4/131 (3%)
 Frame = +3

Query  114  KRLEVAEFSGLRSSGCVTF--SNREASFSDVVAAQLTPKA-TGAPVKGVTVAKLKVAING  284
            KR  + EFSGL++S  VTF  S+ E  F D VA+Q+  KA     +KG T AKL+VAING
Sbjct  9    KRSSLGEFSGLKASSAVTFGKSSSENGFFDAVASQVAVKAGASGAIKGETSAKLRVAING  68

Query  285  FGRIGRNFLRCWHGRKD-SPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETI  461
            FGRIGRNFLRCWHGR D SPLEV+ VNDS GVKNAAHLLKYDSMLG FKADVKV D+ T+
Sbjct  69   FGRIGRNFLRCWHGRGDESPLEVVAVNDSGGVKNAAHLLKYDSMLGIFKADVKVGDDTTL  128

Query  462  SVDGKPIKVVS  494
             VDGKPI VVS
Sbjct  129  LVDGKPITVVS  139



>emb|CAC80389.2| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=457

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 101/131 (77%), Gaps = 4/131 (3%)
 Frame = +3

Query  114  KRLEVAEFSGLRSSGCVTF--SNREASFSDVVAAQLTPKA-TGAPVKGVTVAKLKVAING  284
            KR  + EFSGL++S  VTF  S+ E  F D VA+Q+  KA     +KG T AKL+VAING
Sbjct  38   KRSSLGEFSGLKASSAVTFGKSSSENGFFDAVASQVAVKAGASGAIKGETSAKLRVAING  97

Query  285  FGRIGRNFLRCWHGRKD-SPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETI  461
            FGRIGRNFLRCWHGR D SPLEV+ VNDS GVKNAAHLLKYDSMLG FKADVKV D+ T+
Sbjct  98   FGRIGRNFLRCWHGRGDESPLEVVAVNDSGGVKNAAHLLKYDSMLGIFKADVKVGDDTTL  157

Query  462  SVDGKPIKVVS  494
             VDGKPI VVS
Sbjct  158  LVDGKPITVVS  168



>ref|XP_001771209.1| predicted protein [Physcomitrella patens]
 gb|EDQ63920.1| predicted protein [Physcomitrella patens]
Length=399

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 101/139 (73%), Gaps = 2/139 (1%)
 Frame = +3

Query  84   SKTSTP--QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTV  257
            S T+ P   C  K    +EFSG++S+  VTF  R    + +V AQ    A+    + VT 
Sbjct  2    SATAFPAASCAVKASGFSEFSGIKSTNSVTFGKRHDDLTTIVTAQSAVAASSGAKRAVTE  61

Query  258  AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADV  437
            AK+KVAINGFGRIGRNF+RCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDSMLGTF ADV
Sbjct  62   AKIKVAINGFGRIGRNFVRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSMLGTFDADV  121

Query  438  KVVDNETISVDGKPIKVVS  494
            KV  N+ ISVDGK IKVVS
Sbjct  122  KVEGNDAISVDGKVIKVVS  140



>emb|CBI21236.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   164 bits (414),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 102/127 (80%), Gaps = 6/127 (5%)
 Frame = +3

Query  129  AEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTP--KATGAPVKGVTVAKLKVAINGFGR  293
            AEFSGLR SS C++F NR+ S  F  VVA Q +     +G   KGVT AKLKVAINGFGR
Sbjct  21   AEFSGLRNSSACLSF-NRKTSDDFLSVVAFQTSAVGSNSGGYRKGVTEAKLKVAINGFGR  79

Query  294  IGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDG  473
            IGRNFLRCWHGRKDSPL+VIVVND+ GVK A+HLLKYDS+LGTF+ADVK V ++ ISVDG
Sbjct  80   IGRNFLRCWHGRKDSPLDVIVVNDTGGVKQASHLLKYDSILGTFEADVKAVGDDAISVDG  139

Query  474  KPIKVVS  494
            K IK+VS
Sbjct  140  KVIKIVS  146



>gb|KJB57938.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=399

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 94/120 (78%), Gaps = 9/120 (8%)
 Frame = +3

Query  54   SRIPTRTRLPSKT-----STPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQ  212
            SRI   TRLPSKT     S  QC S RL+V EFSGLRS+ CVTF N  R+ASF DVVAAQ
Sbjct  10   SRIRATTRLPSKTTHSFPSQIQCSSTRLQVTEFSGLRSASCVTFVNNARDASFFDVVAAQ  69

Query  213  LTPKATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNA  386
            LTPK  G   PV+G TVAKLKVAINGFGRIGRNFLRCWHGRK+SPL+VIVVNDS GVKN 
Sbjct  70   LTPKTAGGATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGGVKNG  129



>ref|XP_010660642.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Vitis vinifera]
Length=403

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 103/126 (82%), Gaps = 5/126 (4%)
 Frame = +3

Query  129  AEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTPKA-TGAPVKGVTVAKLKVAINGFGRI  296
            AEFSGLR SS C++F NR+ S  F  VVA Q +  + +G   KGVT AKLKVAINGFGRI
Sbjct  21   AEFSGLRNSSACLSF-NRKTSDDFLSVVAFQTSVGSNSGGYRKGVTEAKLKVAINGFGRI  79

Query  297  GRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  476
            GRNFLRCWHGRKDSPL+VIVVND+ GVK A+HLLKYDS+LGTF+ADVK V ++ ISVDGK
Sbjct  80   GRNFLRCWHGRKDSPLDVIVVNDTGGVKQASHLLKYDSILGTFEADVKAVGDDAISVDGK  139

Query  477  PIKVVS  494
             IK+VS
Sbjct  140  VIKIVS  145



>emb|CAN78872.1| hypothetical protein VITISV_021726 [Vitis vinifera]
Length=404

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 102/127 (80%), Gaps = 6/127 (5%)
 Frame = +3

Query  129  AEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTP--KATGAPVKGVTVAKLKVAINGFGR  293
            AEFSGLR SS C++F NR+ S  F  VVA Q +     +G   KGVT AKLKVAINGFGR
Sbjct  21   AEFSGLRNSSACLSF-NRKTSDDFLSVVAFQTSAVGSNSGGYRKGVTEAKLKVAINGFGR  79

Query  294  IGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDG  473
            IGRNFLRCWHGRKDSPL+VIVVND+ GVK A+HLLKYDS+LGTF+ADVK V ++ ISVDG
Sbjct  80   IGRNFLRCWHGRKDSPLDVIVVNDTGGVKQASHLLKYDSILGTFEADVKAVGDDAISVDG  139

Query  474  KPIKVVS  494
            K IK+VS
Sbjct  140  KVIKIVS  146



>ref|XP_002278352.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Vitis vinifera]
Length=404

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 102/127 (80%), Gaps = 6/127 (5%)
 Frame = +3

Query  129  AEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTP--KATGAPVKGVTVAKLKVAINGFGR  293
            AEFSGLR SS C++F NR+ S  F  VVA Q +     +G   KGVT AKLKVAINGFGR
Sbjct  21   AEFSGLRNSSACLSF-NRKTSDDFLSVVAFQTSAVGSNSGGYRKGVTEAKLKVAINGFGR  79

Query  294  IGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDG  473
            IGRNFLRCWHGRKDSPL+VIVVND+ GVK A+HLLKYDS+LGTF+ADVK V ++ ISVDG
Sbjct  80   IGRNFLRCWHGRKDSPLDVIVVNDTGGVKQASHLLKYDSILGTFEADVKAVGDDAISVDG  139

Query  474  KPIKVVS  494
            K IK+VS
Sbjct  140  KVIKIVS  146



>ref|XP_001753934.1| predicted protein [Physcomitrella patens]
 gb|EDQ81256.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 102/143 (71%), Gaps = 2/143 (1%)
 Frame = +3

Query  66   TRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVK  245
            T   +PS  S     SK L  +EFSG++S+  VTF  R    + +VAAQ    A+    +
Sbjct  7    TAVSVPSNASLKVAGSKGL--SEFSGMKSTNAVTFGKRSDDLASIVAAQSAVSASSGATR  64

Query  246  GVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTF  425
             VT AK+KVAINGFGRIGRNF+RCW GRKDSPL+V+V+ND+ GVK A+HLLKYDSMLGTF
Sbjct  65   AVTEAKIKVAINGFGRIGRNFIRCWQGRKDSPLDVVVINDTGGVKQASHLLKYDSMLGTF  124

Query  426  KADVKVVDNETISVDGKPIKVVS  494
             ADVKV  N  ISVDGK IKVVS
Sbjct  125  NADVKVEGNNAISVDGKVIKVVS  147



>ref|XP_003548805.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Glycine max]
Length=403

 Score =   157 bits (398),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 98/125 (78%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLRSS-GCVTFSNREA-SFSDVVAAQ-LTPKATGAPVKGVTVAKLKVAINGFGRIG  299
            +EFSGLRSS G + FS + +  F  V+A Q     ++G   KGVT AKLKVAINGFGRIG
Sbjct  21   SEFSGLRSSSGFLPFSRKSSEDFHSVIAFQTYAVGSSGGYKKGVTEAKLKVAINGFGRIG  80

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS+LGTF ADVK V ++ ISVDGK 
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSILGTFDADVKPVGSDIISVDGKE  140

Query  480  IKVVS  494
            IKVVS
Sbjct  141  IKVVS  145



>gb|KHN46819.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   157 bits (398),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 98/125 (78%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLRSS-GCVTFSNREA-SFSDVVAAQ-LTPKATGAPVKGVTVAKLKVAINGFGRIG  299
            +EFSGLRSS G + FS + +  F  V+A Q     ++G   KGVT AKLKVAINGFGRIG
Sbjct  21   SEFSGLRSSSGFLPFSRKSSEDFHSVIAFQTYAVGSSGGYKKGVTEAKLKVAINGFGRIG  80

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS+LGTF ADVK V ++ ISVDGK 
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSILGTFDADVKPVGSDIISVDGKE  140

Query  480  IKVVS  494
            IKVVS
Sbjct  141  IKVVS  145



>gb|KHG29734.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Gossypium 
arboreum]
Length=360

 Score =   157 bits (396),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 94/125 (75%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREAS-FSDVVAAQLTPKA--TGAPVKGVTVAKLKVAINGFGRIG  299
            AEFSGLR+S  +TF+ + +  F  V+A Q +      G   KGV  AKLKVAINGFGRIG
Sbjct  21   AEFSGLRNSASLTFARKTSDDFQSVIAFQTSALGINNGGYQKGVVEAKLKVAINGFGRIG  80

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F+ADVK V +  ISVDGK 
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFEADVKPVGDNAISVDGKV  140

Query  480  IKVVS  494
            IKVVS
Sbjct  141  IKVVS  145



>gb|ADE06487.1| putative glyceraldehyde 3-phosphate dehydrogenase [Tragopogon 
dubius]
Length=90

 Score =   149 bits (375),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 78/86 (91%), Gaps = 1/86 (1%)
 Frame = +3

Query  177  REASFSDVVAAQLTPKATGAPVKGV-TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVI  353
            +++SF DVV+AQ TPKA G+ V  V TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVI
Sbjct  5    KDSSFFDVVSAQFTPKAAGSTVAKVETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVI  64

Query  354  VVNDSAGVKNAAHLLKYDSMLGTFKA  431
            VVNDS GVKNA+HLLKYDSMLGTFKA
Sbjct  65   VVNDSGGVKNASHLLKYDSMLGTFKA  90



>gb|ADE06488.1| putative glyceraldehyde 3-phosphate dehydrogenase [Tragopogon 
porrifolius]
Length=86

 Score =   148 bits (374),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 78/86 (91%), Gaps = 1/86 (1%)
 Frame = +3

Query  177  REASFSDVVAAQLTPKATGAPVKGV-TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVI  353
            +++SF DVV+AQ TPKA G+ V  V TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVI
Sbjct  1    KDSSFFDVVSAQFTPKAAGSTVAKVETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVI  60

Query  354  VVNDSAGVKNAAHLLKYDSMLGTFKA  431
            VVNDS GVKNA+HLLKYDSMLGTFKA
Sbjct  61   VVNDSGGVKNASHLLKYDSMLGTFKA  86



>gb|KHN46369.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 97/125 (78%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLRSS-GCVTFSNREAS-FSDVVAAQ-LTPKATGAPVKGVTVAKLKVAINGFGRIG  299
            +EFSGLRSS G + FS + +  F  V+A Q     ++G   KGVT AKLKVAINGFGRIG
Sbjct  21   SEFSGLRSSSGFLPFSRKSSEDFHSVIAFQTYAVGSSGGYKKGVTEAKLKVAINGFGRIG  80

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS+LGTF ADVK V +  ISVDGK 
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSILGTFDADVKPVGSNVISVDGKE  140

Query  480  IKVVS  494
            IKVVS
Sbjct  141  IKVVS  145



>ref|NP_001238484.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
 gb|ABA86963.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
Length=403

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 97/125 (78%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLRSS-GCVTFSNREAS-FSDVVAAQ-LTPKATGAPVKGVTVAKLKVAINGFGRIG  299
            +EFSGLRSS G + FS + +  F  V+A Q     ++G   KGVT AKLKVAINGFGRIG
Sbjct  21   SEFSGLRSSSGFLPFSRKSSEDFHSVIAFQTYAVGSSGGYKKGVTEAKLKVAINGFGRIG  80

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS+LGTF ADVK V +  ISVDGK 
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSILGTFDADVKPVGSNVISVDGKE  140

Query  480  IKVVS  494
            IKVVS
Sbjct  141  IKVVS  145



>gb|ACU21011.1| unknown [Glycine max]
Length=403

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 97/125 (78%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLRSS-GCVTFSNREA-SFSDVVAAQ-LTPKATGAPVKGVTVAKLKVAINGFGRIG  299
            +EFSGLRSS G + FS + +  F  V+A Q     ++G   KGVT AKLKVAINGFGRIG
Sbjct  21   SEFSGLRSSSGFLPFSRKSSEDFHSVIAFQTYAVGSSGGYKKGVTEAKLKVAINGFGRIG  80

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS+LGTF ADVK V +  ISVDGK 
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSILGTFDADVKPVGSNVISVDGKE  140

Query  480  IKVVS  494
            IKVVS
Sbjct  141  IKVVS  145



>ref|XP_001771246.1| predicted protein [Physcomitrella patens]
 gb|EDQ63957.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRNF  308
            ++FSG++S+  VTF  R    + +V+AQ    A+    + VT AK+KVAINGFGRIGRNF
Sbjct  26   SDFSGIKSTSAVTFGKRSEDLASIVSAQSAVSASSGAKRAVTEAKIKVAINGFGRIGRNF  85

Query  309  LRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKV  488
            +RCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDSMLGTF ADVKV  N+ ISVDGK IKV
Sbjct  86   VRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSMLGTFDADVKVEGNDAISVDGKVIKV  145

Query  489  VS  494
            VS
Sbjct  146  VS  147



>emb|CAC80388.1| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=400

 Score =   155 bits (393),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 90/121 (74%), Gaps = 0/121 (0%)
 Frame = +3

Query  132  EFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRNFL  311
            +FSGL+S+   TF  R       VAAQ     +GA  + V  AK+KVAINGFGRIGRNF+
Sbjct  20   DFSGLKSTSVATFGKRSDDLLTRVAAQSAVAVSGAQKRAVVEAKVKVAINGFGRIGRNFI  79

Query  312  RCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVV  491
            RCWHGRKDSPLEV+V+ND+ GVK A+HLLKYDSMLG F A VK V ++ ISVDGK IK+V
Sbjct  80   RCWHGRKDSPLEVVVINDTGGVKQASHLLKYDSMLGIFDAYVKAVGDDAISVDGKIIKIV  139

Query  492  S  494
            S
Sbjct  140  S  140



>gb|KJB11771.1| hypothetical protein B456_001G276400 [Gossypium raimondii]
Length=403

 Score =   155 bits (393),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 94/125 (75%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREAS-FSDVVAAQLTPKA--TGAPVKGVTVAKLKVAINGFGRIG  299
            AEFSGLR+S  +TF+ + +  F  V+A Q +      G   KGV  AKLKVAINGFGRIG
Sbjct  21   AEFSGLRNSASLTFARKTSDDFQSVIAFQTSALGINNGGYRKGVVEAKLKVAINGFGRIG  80

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F+ADVK V +  ISVDGK 
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFEADVKPVGDNAISVDGKV  140

Query  480  IKVVS  494
            IKVVS
Sbjct  141  IKVVS  145



>ref|XP_002985183.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
 gb|EFJ13677.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
Length=402

 Score =   155 bits (392),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 92/123 (75%), Gaps = 1/123 (1%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREASFSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIGRN  305
            ++FSGL+S   VTF       +  VAAQ     ++G   + V  AK+KVAINGFGRIGRN
Sbjct  22   SDFSGLKSKNAVTFGRGAEDLASRVAAQTCKVSSSGGAKRAVAEAKIKVAINGFGRIGRN  81

Query  306  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  485
            F+RCWHGRKDSPL+VIV+ND+ GVK A+HLLKYDSMLGTF ADVKV  +  ISVDGK IK
Sbjct  82   FIRCWHGRKDSPLDVIVINDTGGVKQASHLLKYDSMLGTFDADVKVSGDSAISVDGKVIK  141

Query  486  VVS  494
            VVS
Sbjct  142  VVS  144



>ref|XP_002970103.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
 gb|EFJ29227.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
Length=402

 Score =   155 bits (392),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 92/123 (75%), Gaps = 1/123 (1%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREASFSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIGRN  305
            ++FSGL+S   VTF       +  VAAQ     ++G   + V  AK+KVAINGFGRIGRN
Sbjct  22   SDFSGLKSKNAVTFGRGAEDLASRVAAQTCKVSSSGGAKRAVAEAKIKVAINGFGRIGRN  81

Query  306  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  485
            F+RCWHGRKDSPL+VIV+ND+ GVK A+HLLKYDSMLGTF ADVKV  +  ISVDGK IK
Sbjct  82   FIRCWHGRKDSPLDVIVINDTGGVKQASHLLKYDSMLGTFDADVKVSGDSAISVDGKVIK  141

Query  486  VVS  494
            VVS
Sbjct  142  VVS  144



>ref|XP_010028899.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55732.1| hypothetical protein EUGRSUZ_I01564 [Eucalyptus grandis]
Length=402

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 94/124 (76%), Gaps = 2/124 (2%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREA-SFSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIGR  302
            AEFSGLR+S  V+F  + +  F  V+A Q +   + G   KGV  AKLKVAINGFGRIGR
Sbjct  21   AEFSGLRNSASVSFGRKNSEDFLSVIAFQTSAVGSNGGYRKGVVEAKLKVAINGFGRIGR  80

Query  303  NFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPI  482
            NFLRCWHGRKDSPL++I +ND+ G+K A+HLLKYDS LG F+ADVK V  + ISVDGK I
Sbjct  81   NFLRCWHGRKDSPLDIIAINDTGGIKQASHLLKYDSTLGIFEADVKPVGTDGISVDGKVI  140

Query  483  KVVS  494
            KVVS
Sbjct  141  KVVS  144



>ref|XP_010270465.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, chloroplastic-like 
[Nelumbo nucifera]
Length=179

 Score =   148 bits (373),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 78/84 (93%), Gaps = 1/84 (1%)
 Frame = +3

Query  246  GVTVAKLKVAIN-GFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGT  422
            G TVAKLKVAIN GFGRIGRNFLRCWHGRKDSPL+++VVNDS  VKN++H+L YDSMLGT
Sbjct  31   GQTVAKLKVAINIGFGRIGRNFLRCWHGRKDSPLDIVVVNDSGSVKNSSHILNYDSMLGT  90

Query  423  FKADVKVVDNETISVDGKPIKVVS  494
            FKA+VK+VDNETIS+DGKPIK+ +
Sbjct  91   FKAEVKIVDNETISIDGKPIKIAT  114



>ref|XP_008449974.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Cucumis melo]
Length=404

 Score =   153 bits (386),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 102/148 (69%), Gaps = 5/148 (3%)
 Frame = +3

Query  60   IPTRTRLPSKTSTPQCFSKRLEVAEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTP-KAT  230
            + T T   +K S  Q   K     EFSGLR SS C+ F+ R +  F  ++A Q +   + 
Sbjct  1    MATATLSVAKPSIQQANGKGF--GEFSGLRNSSTCLPFARRTSDDFLSIIAFQTSAVGSN  58

Query  231  GAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDS  410
            G   KG+  AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS
Sbjct  59   GGYKKGIVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  411  MLGTFKADVKVVDNETISVDGKPIKVVS  494
             LG F+ADVK   +E ISVDGK IKVVS
Sbjct  119  TLGIFEADVKPAGDEAISVDGKIIKVVS  146



>ref|XP_011070460.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Sesamum indicum]
Length=399

 Score =   153 bits (386),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 93/124 (75%), Gaps = 2/124 (2%)
 Frame = +3

Query  129  AEFSGLR-SSGCVTFSNR-EASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGR  302
            +EFSGLR SS  + F+ R    F  V+A Q +    G   +GV  AKLKVAINGFGRIGR
Sbjct  18   SEFSGLRGSSSALPFAKRANDDFVSVIAFQTSVVGGGKNKRGVVEAKLKVAINGFGRIGR  77

Query  303  NFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPI  482
            NFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F+ADVK V N+ ISVDGK I
Sbjct  78   NFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFEADVKPVGNDGISVDGKVI  137

Query  483  KVVS  494
            KVVS
Sbjct  138  KVVS  141



>emb|CCF55355.1| Glyceraldehyde-3-phosphate dehydrogenase A [Cucumis sativus]
Length=403

 Score =   153 bits (386),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 96/125 (77%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIG  299
            AEFSGLR SS  ++F+ R +  F  V+A Q +   ++G   KG+  AKLKVAINGFGRIG
Sbjct  21   AEFSGLRNSSTSLSFARRTSDDFLSVIAFQTSAVGSSGGYKKGIVEAKLKVAINGFGRIG  80

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F+ADVK   +E ISVDGK 
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFEADVKPAGDEAISVDGKI  140

Query  480  IKVVS  494
            IKVVS
Sbjct  141  IKVVS  145



>ref|XP_008449975.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Cucumis melo]
Length=403

 Score =   153 bits (386),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 94/125 (75%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIG  299
             EFSGLR SS C+ F+ R +  F  ++A Q +   + G   KG+  AKLKVAINGFGRIG
Sbjct  21   GEFSGLRNSSTCLPFARRTSDDFLSIIAFQTSAVGSNGGYKKGIVEAKLKVAINGFGRIG  80

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F+ADVK   +E ISVDGK 
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFEADVKPAGDEAISVDGKI  140

Query  480  IKVVS  494
            IKVVS
Sbjct  141  IKVVS  145



>ref|XP_004161334.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
Length=403

 Score =   152 bits (385),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 96/125 (77%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIG  299
            AEFSGLR SS  ++F+ R +  F  V+A Q +   ++G   KG+  AKLKVAINGFGRIG
Sbjct  21   AEFSGLRNSSTSLSFARRTSDDFLSVIAFQTSAVGSSGGYKKGIVEAKLKVAINGFGRIG  80

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F+ADVK   +E ISVDGK 
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFEADVKPAGDEAISVDGKI  140

Query  480  IKVVS  494
            IKVVS
Sbjct  141  IKVVS  145



>ref|XP_001779753.1| predicted protein [Physcomitrella patens]
 gb|EDQ55437.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 101/139 (73%), Gaps = 2/139 (1%)
 Frame = +3

Query  78   LPSKTSTPQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTV  257
            +PS  S     SK    +EFSG++S+   TF  +    + +VAAQ    A+    + VT 
Sbjct  11   VPSTASLKGAGSKGF--SEFSGMKSTSIATFGKQIDDLASIVAAQSAVSASSGASRAVTE  68

Query  258  AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADV  437
            AK+KVAINGFGRIGRNF+RCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDSMLGTF ADV
Sbjct  69   AKIKVAINGFGRIGRNFIRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSMLGTFNADV  128

Query  438  KVVDNETISVDGKPIKVVS  494
            KV  N+ ISVDGK IKVVS
Sbjct  129  KVEGNDAISVDGKVIKVVS  147



>ref|XP_008379036.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 92/125 (74%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIG  299
            AEFSGLR SS C+ F  + +   FS +     +  + G   KGVT AKLKVAINGFGRIG
Sbjct  21   AEFSGLRTSSACLPFGRKTSDDLFSVIAFQTSSVGSNGGYKKGVTEAKLKVAINGFGRIG  80

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  +SVDGK 
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNGLSVDGKI  140

Query  480  IKVVS  494
            IKVVS
Sbjct  141  IKVVS  145



>ref|NP_172750.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 sp|Q9LPW0.1|G3PA2_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA2, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF78494.1|AC012187_14 Strong similarity to GAPDH subunit A from Pisum sativum gb|X15190 
and contains a GAPDH PF|00044 domain. ESTs gb|T42920, gb|T43410, 
gb|T46101, gb|T04006, gb|T20630, gb|Z34677, gb|T46805, 
gb|N37754, gb|N37754, gb|Z26072, gb|H37169, gb|H76419, 
gb|T20834, gb|T21557, gb|AA713258, gb|T04005, gb|AI099909, gb|Z34793 
come from this gene [Arabidopsis thaliana]
 gb|AAP40454.1| putative calcium-binding protein, calreticulin [Arabidopsis thaliana]
 gb|AAU94430.1| At1g12900 [Arabidopsis thaliana]
 gb|AEE28944.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=399

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 95/125 (76%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIG  299
            +EFSGLR+S  + F+ R +S  F   V+ Q +  ++ G   KGVT AK+KVAINGFGRIG
Sbjct  17   SEFSGLRNSSALPFAKRSSSDEFVSFVSFQTSAMRSNGGYRKGVTEAKIKVAINGFGRIG  76

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  77   RNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSTLGIFDADVKPSGDSALSVDGKI  136

Query  480  IKVVS  494
            IK+VS
Sbjct  137  IKIVS  141



>gb|AIU56855.1| glyceraldehyde-3-phosphate dehydrogenase B, partial [Brassica 
rapa subsp. chinensis]
Length=367

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/78 (91%), Positives = 75/78 (96%), Gaps = 0/78 (0%)
 Frame = +3

Query  261  KLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVK  440
            KLKVAINGFG IGRNFLRCWHGRKDSPLEV+V+NDS GVKNA+HLLKYDSMLGTFKADVK
Sbjct  1    KLKVAINGFGGIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHLLKYDSMLGTFKADVK  60

Query  441  VVDNETISVDGKPIKVVS  494
            +VDNETISVDGK IKVVS
Sbjct  61   IVDNETISVDGKLIKVVS  78



>gb|AAA33780.1| glyceraldehyde-phosphate dehydrogenase [Pinus sylvestris]
Length=411

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 93/125 (74%), Gaps = 4/125 (3%)
 Frame = +3

Query  129  AEFSGLRSSG---CVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIG  299
            +E+SGL+SS    C+   N E  F  +VA Q     +    +GV  AK+KVAINGFGRIG
Sbjct  29   SEYSGLKSSSGFPCLRKYNEELRFQ-LVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIG  87

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS+LGTF  DV+V  N+ ISVDGK 
Sbjct  88   RNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDPDVQVAGNDGISVDGKV  147

Query  480  IKVVS  494
            IKVVS
Sbjct  148  IKVVS  152



>emb|CAC80374.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=317

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/73 (95%), Positives = 72/73 (99%), Gaps = 0/73 (0%)
 Frame = +3

Query  276  INGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNE  455
            INGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+HLLKYDSMLGTFKADVKVVDNE
Sbjct  1    INGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADVKVVDNE  60

Query  456  TISVDGKPIKVVS  494
            TISVDGKPIKVVS
Sbjct  61   TISVDGKPIKVVS  73



>ref|XP_006844714.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
 gb|ERN06389.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
Length=398

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 91/123 (74%), Gaps = 1/123 (1%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREAS-FSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  305
            +EFSGLRSS  + FS + +  F  VVA Q +        +GV  AK+KVAINGFGRIGRN
Sbjct  18   SEFSGLRSSASIPFSRKPSEDFLSVVAFQTSVVWGSGYKRGVVEAKIKVAINGFGRIGRN  77

Query  306  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  485
            FLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVKV   + ISVDGK I+
Sbjct  78   FLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKVAGVDAISVDGKVIR  137

Query  486  VVS  494
            VVS
Sbjct  138  VVS  140



>ref|XP_004145622.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
 gb|KGN57690.1| hypothetical protein Csa_3G252490 [Cucumis sativus]
Length=403

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 95/125 (76%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIG  299
             EFSGLR SS  ++F+ R +  F  V+A Q +   ++G   KG+  AKLKVAINGFGRIG
Sbjct  21   GEFSGLRNSSTSLSFARRTSDDFLSVIAFQTSAVGSSGGYKKGIVEAKLKVAINGFGRIG  80

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F+ADVK   +E ISVDGK 
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFEADVKPAGDEAISVDGKI  140

Query  480  IKVVS  494
            IKVVS
Sbjct  141  IKVVS  145



>ref|NP_001289256.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Pyrus 
x bretschneideri]
 gb|AFG28404.1| glyceraldehyde-3-phosphate dehydrogenase A [Pyrus x bretschneideri]
Length=403

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 95/126 (75%), Gaps = 5/126 (4%)
 Frame = +3

Query  129  AEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRI  296
            AEFSGLR SS C+ F  + +   FS V+A Q +   + G   KGVT AKLKVAINGFGRI
Sbjct  21   AEFSGLRTSSACLPFGRKTSDDLFS-VIAFQTSAVGSNGGYKKGVTEAKLKVAINGFGRI  79

Query  297  GRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  476
            GRNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  +SVDGK
Sbjct  80   GRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNGLSVDGK  139

Query  477  PIKVVS  494
             IKVVS
Sbjct  140  IIKVVS  145



>gb|KFK43560.1| hypothetical protein AALP_AA1G142100 [Arabis alpina]
Length=399

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 94/125 (75%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVAKLKVAINGFGRIG  299
            +EFSGLR+S  + F+ R +S  F   V+ Q +   + GA  KGVT AK+KVAINGFGRIG
Sbjct  17   SEFSGLRNSSALPFAKRSSSDEFVSFVSFQTSAMGSNGAYRKGVTEAKIKVAINGFGRIG  76

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  77   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGDSALSVDGKI  136

Query  480  IKVVS  494
            IK+VS
Sbjct  137  IKIVS  141



>gb|ABD37962.1| glyceraldehyde-3-phosphate dehydrogenase subunit A1, partial 
[Physcomitrella patens]
Length=378

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +3

Query  138  SGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRNFLRC  317
            SG++S+  VTF  R    + +VAAQ    A+    + VT AK+KVAINGFGRIGRNF+RC
Sbjct  1    SGMKSTNAVTFGKRSDDLASIVAAQSAVSASSGATRAVTEAKIKVAINGFGRIGRNFIRC  60

Query  318  WHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            W GRKDSPL+V+V+ND+ GVK A+HLLKYDSMLGTF ADVKV  N  ISVDGK IKVVS
Sbjct  61   WQGRKDSPLDVVVINDTGGVKQASHLLKYDSMLGTFNADVKVEGNNAISVDGKVIKVVS  119



>ref|XP_009378071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=403

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 92/126 (73%), Gaps = 3/126 (2%)
 Frame = +3

Query  126  VAEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRI  296
            +AEFSGLR SS C+ F  + +   FS +        + G   KGVT AKLKVAINGFGRI
Sbjct  20   LAEFSGLRTSSACLPFGKKTSDDLFSVITFQTSALGSNGGYKKGVTEAKLKVAINGFGRI  79

Query  297  GRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  476
            GRNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  +SVDGK
Sbjct  80   GRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNGLSVDGK  139

Query  477  PIKVVS  494
             +KVVS
Sbjct  140  IVKVVS  145



>ref|XP_008231212.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Prunus mume]
Length=403

 Score =   150 bits (379),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 92/125 (74%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIG  299
            AEFSGLR SS C+ F  + +   FS +        ++G   KG+  AKLKVAINGFGRIG
Sbjct  21   AEFSGLRTSSACLPFGRKTSDDLFSVISFQTSAVGSSGGYKKGIAEAKLKVAINGFGRIG  80

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS LG F ADVK V +  ISVDGK 
Sbjct  81   RNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNGISVDGKV  140

Query  480  IKVVS  494
            IKVVS
Sbjct  141  IKVVS  145



>emb|CDY48981.1| BnaA02g28150D [Brassica napus]
Length=368

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 91/122 (75%), Gaps = 1/122 (1%)
 Frame = +3

Query  132  EFSGLRSSGC-VTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRNF  308
            EFSGLRSS   + F N++ S  + V+A     +  + +KGVT AKLKVAINGFGRIGRNF
Sbjct  18   EFSGLRSSSASLPFGNKKLSSDEFVSAVTFQTSAVSSLKGVTEAKLKVAINGFGRIGRNF  77

Query  309  LRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKV  488
            LRCWHGRKDSP +VI +ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK IK+
Sbjct  78   LRCWHGRKDSPFDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKIIKI  137

Query  489  VS  494
            VS
Sbjct  138  VS  139



>pdb|2PKQ|O Chain O, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|Q Chain Q, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|T Chain T, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=368

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 75/78 (96%), Gaps = 0/78 (0%)
 Frame = +3

Query  261  KLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVK  440
            KLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVK+A HLLKYDS+LGTFKADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHLLKYDSILGTFKADVK  60

Query  441  VVDNETISVDGKPIKVVS  494
            ++DNET S+DGKPIKVVS
Sbjct  61   IIDNETFSIDGKPIKVVS  78



>ref|XP_001766703.1| predicted protein [Physcomitrella patens]
 gb|EDQ68556.1| predicted protein [Physcomitrella patens]
Length=376

 Score =   149 bits (377),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = +3

Query  144  LRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWH  323
            ++S+  VTF  R    + +V+AQ    A+    + VT AK+KVAINGFGRIGRNF+RCWH
Sbjct  1    MKSTNAVTFGKRSDDLATIVSAQSAVAASSGATRAVTEAKIKVAINGFGRIGRNFVRCWH  60

Query  324  GRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            GRKDSPL+++V+ND+ GVK A+HLLKYDSMLGTF ADVKV  N+ ISVDGK IKVVS
Sbjct  61   GRKDSPLDIVVINDTGGVKQASHLLKYDSMLGTFDADVKVEGNDAISVDGKVIKVVS  117



>gb|AEH04452.1| glyceraldehyde-3-phosphate dehydrogenase [Arachis hypogaea]
Length=405

 Score =   150 bits (378),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 95/126 (75%), Gaps = 4/126 (3%)
 Frame = +3

Query  129  AEFSGLR--SSGCVTFSNREAS-FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRI  296
            +EFSGLR  SS  + FS + +  F  +++ Q +   ++G   KGVT AKLKVAINGFGRI
Sbjct  22   SEFSGLRNSSSSYLPFSRKTSDDFHSIISFQTSAVGSSGGYRKGVTEAKLKVAINGFGRI  81

Query  297  GRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  476
            GRNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V  + ISVDGK
Sbjct  82   GRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGEDAISVDGK  141

Query  477  PIKVVS  494
             IKVVS
Sbjct  142  VIKVVS  147



>sp|P09043.1|G3PA_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34075.1| glyceraldehyde-3-phosphate dehydrogenase A-subunit precursor, 
partial [Nicotiana tabacum]
Length=392

 Score =   149 bits (377),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 89/123 (72%), Gaps = 1/123 (1%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNR-EASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  305
            +EFSGLR+S  + F  +       VVA Q +    G   +GV  AKLKVAINGFGRIGRN
Sbjct  12   SEFSGLRTSSAIPFGRKTNDDLLSVVAFQTSVIGGGNSKRGVVEAKLKVAINGFGRIGRN  71

Query  306  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  485
            FLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V  + ISVDGK I+
Sbjct  72   FLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGKVIQ  131

Query  486  VVS  494
            VVS
Sbjct  132  VVS  134



>ref|XP_010090946.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
 gb|EXB41431.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
Length=404

 Score =   149 bits (377),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 101/142 (71%), Gaps = 10/142 (7%)
 Frame = +3

Query  81   PSKTSTPQCFSKRLEVAEFSGLRSS-GCVTFSNREAS--FSDVVAAQLTP-KATGAPVKG  248
            PS  ++ + FS      EFSGLRSS   + F+ + +S  F  V+A Q +   ++G   KG
Sbjct  11   PSLQASGKGFS------EFSGLRSSTASLPFARKASSDDFLSVIAFQTSAVGSSGGYKKG  64

Query  249  VTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFK  428
            V  AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+ G+K A+HLLKYDS LG F 
Sbjct  65   VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGIKQASHLLKYDSTLGIFN  124

Query  429  ADVKVVDNETISVDGKPIKVVS  494
            ADVK V  + ISVDGK IKVVS
Sbjct  125  ADVKPVGTDGISVDGKVIKVVS  146



>ref|XP_009800449.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana sylvestris]
Length=401

 Score =   149 bits (377),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 89/123 (72%), Gaps = 1/123 (1%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNR-EASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  305
            +EFSGLR+S  + F  +       VVA Q +    G   +GV  AKLKVAINGFGRIGRN
Sbjct  21   SEFSGLRTSSAIPFGRKTNDDLLSVVAFQTSVIGGGNSKRGVVEAKLKVAINGFGRIGRN  80

Query  306  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  485
            FLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V  + ISVDGK I+
Sbjct  81   FLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGKVIQ  140

Query  486  VVS  494
            VVS
Sbjct  141  VVS  143



>gb|ABD37965.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Mesostigma 
viride]
Length=415

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 96/123 (78%), Gaps = 5/123 (4%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREASFSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIGRN  305
            A F+GL+++   +  + + +F    AA+L P +ATG+  K VT AKLKVAINGFGRIGRN
Sbjct  7    ANFTGLKATSLFSAKSADEAF----AARLAPVQATGSSQKQVTEAKLKVAINGFGRIGRN  62

Query  306  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  485
            FLRCW GR++SPLEV+ +NDS GVK AAHLLKYDSMLGTFKADVKV+    ++V+GK I+
Sbjct  63   FLRCWVGRENSPLEVVAINDSGGVKQAAHLLKYDSMLGTFKADVKVISETALAVNGKTIE  122

Query  486  VVS  494
            +VS
Sbjct  123  IVS  125



>emb|CAC80378.2| glyceraldehyde-3-phosphate dehydrogenase [Chara vulgaris]
Length=480

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 93/131 (71%), Gaps = 8/131 (6%)
 Frame = +3

Query  126  VAEFSGLRSSGCVTF---SNREAS-----FSDVVAAQLTPKATGAPVKGVTVAKLKVAIN  281
            + E+ GL++S    F   + R+A+     F D V   ++ K  G+  +G T AKL+VAIN
Sbjct  58   LCEYKGLKASTAHVFGGVTGRDAADASDLFVDSVTRDVSSKVIGSGHRGETEAKLRVAIN  117

Query  282  GFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETI  461
            GFGRIGRNFLRCWHGR DSPLEVI +NDS GVK A HLLKYDSMLGTF ADVK VD   I
Sbjct  118  GFGRIGRNFLRCWHGRPDSPLEVIAINDSGGVKQATHLLKYDSMLGTFNADVKTVDETHI  177

Query  462  SVDGKPIKVVS  494
            SVDGK I++VS
Sbjct  178  SVDGKVIQIVS  188



>dbj|BAP91041.1| glyceraldehyde 3-phosphate dehydrogenase-A [Nicotiana benthamiana]
Length=401

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 89/123 (72%), Gaps = 1/123 (1%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNR-EASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  305
            +EFSGLR+S  + F  +       VVA Q +    G   +GV  AKLKVAINGFGRIGRN
Sbjct  21   SEFSGLRTSSAIPFGRKTNDDLLSVVAFQTSVIGGGNNKRGVVEAKLKVAINGFGRIGRN  80

Query  306  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  485
            FLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V  + ISVDGK I+
Sbjct  81   FLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGKVIQ  140

Query  486  VVS  494
            VVS
Sbjct  141  VVS  143



>ref|XP_009631078.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana tomentosiformis]
Length=401

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 89/123 (72%), Gaps = 1/123 (1%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNR-EASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  305
            +EFSGLR+S  + F  +       VVA Q +    G   +GV  AKLKVAINGFGRIGRN
Sbjct  21   SEFSGLRTSSAIPFGRKTNDDLLSVVAFQTSVIGGGNNKRGVVEAKLKVAINGFGRIGRN  80

Query  306  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  485
            FLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V  + ISVDGK I+
Sbjct  81   FLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGKVIQ  140

Query  486  VVS  494
            VVS
Sbjct  141  VVS  143



>ref|XP_008362077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 95/126 (75%), Gaps = 5/126 (4%)
 Frame = +3

Query  129  AEFSGLRSS-GCVTFSNREAS--FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRI  296
            AEFSGLR+S  C+ F  + +   FS V+A Q +   + G   KGVT AKLKVAINGFGRI
Sbjct  21   AEFSGLRTSLACLPFGRKTSDDLFS-VIAFQTSALGSNGVYKKGVTEAKLKVAINGFGRI  79

Query  297  GRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  476
            GRNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  +SVDGK
Sbjct  80   GRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNGLSVDGK  139

Query  477  PIKVVS  494
             +KVVS
Sbjct  140  IVKVVS  145



>gb|EPS59235.1| hypothetical protein M569_15573, partial [Genlisea aurea]
Length=395

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 90/124 (73%), Gaps = 2/124 (2%)
 Frame = +3

Query  129  AEFSGLRSS-GCVTFSNR-EASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGR  302
            +EFSGLRSS   + F  R    F  V+A Q +        +GV  AKLKVAINGFGRIGR
Sbjct  14   SEFSGLRSSSAALPFPRRPNDDFFSVIAFQTSSVGGDKNSRGVVEAKLKVAINGFGRIGR  73

Query  303  NFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPI  482
            NFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V N+ ISVDGK I
Sbjct  74   NFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGNDAISVDGKVI  133

Query  483  KVVS  494
            KVV+
Sbjct  134  KVVT  137



>ref|XP_002892719.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68978.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
Length=399

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 94/125 (75%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVAKLKVAINGFGRIG  299
            +EFSGLR+S  + F+ + +S  F   V+ Q +   + G   KGVT AK+KVAINGFGRIG
Sbjct  17   SEFSGLRNSSALPFAKKSSSDEFVSFVSFQTSAMGSNGGYRKGVTEAKIKVAINGFGRIG  76

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  77   RNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKI  136

Query  480  IKVVS  494
            IK+VS
Sbjct  137  IKIVS  141



>ref|XP_006417177.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35530.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=399

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 92/124 (74%), Gaps = 3/124 (2%)
 Frame = +3

Query  132  EFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVAKLKVAINGFGRIGR  302
            EFSGLR+S  + F+ + +S  F   V+ Q +   + G   KGVT AKLKVAINGFGRIGR
Sbjct  18   EFSGLRNSSALPFAKKSSSDEFVSFVSFQTSAMGSNGGYRKGVTEAKLKVAINGFGRIGR  77

Query  303  NFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPI  482
            NFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK I
Sbjct  78   NFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGDSALSVDGKII  137

Query  483  KVVS  494
            K+VS
Sbjct  138  KIVS  141



>ref|XP_007217883.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
 gb|EMJ19082.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
Length=403

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 91/125 (73%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIG  299
            AEFSGLR SS C+ F  + +   FS +        ++G   KG+  AKLKVAINGFGRIG
Sbjct  21   AEFSGLRTSSACLPFGRKTSDDLFSVISFQTSAVGSSGGYKKGIAEAKLKVAINGFGRIG  80

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS LG F ADVK   +  ISVDGK 
Sbjct  81   RNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSTLGIFDADVKPAGDNGISVDGKV  140

Query  480  IKVVS  494
            IKVVS
Sbjct  141  IKVVS  145



>ref|XP_009118048.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 92/125 (74%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVAKLKVAINGFGRIG  299
            +EFSGLR+S  + F  + +S  F   V+ Q +   + G   KGVT AKLKVAINGFGRIG
Sbjct  17   SEFSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNGGYRKGVTEAKLKVAINGFGRIG  76

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  77   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGDSALSVDGKI  136

Query  480  IKVVS  494
            IK+VS
Sbjct  137  IKIVS  141



>emb|CDY16038.1| BnaC08g40850D [Brassica napus]
Length=399

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 91/125 (73%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVAKLKVAINGFGRIG  299
            +EFSGLR+S  + F  + +S  F   V+ Q +   + G   KGVT AKLKVAINGFGRIG
Sbjct  17   SEFSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNGGYSKGVTEAKLKVAINGFGRIG  76

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  77   RNFLRCWHGRKDSPLDVIAINDTGGVKQATHLLKYDSTLGIFDADVKPSGDSALSVDGKI  136

Query  480  IKVVS  494
            IK+VS
Sbjct  137  IKIVS  141



>ref|XP_010528117.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=402

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 91/126 (72%), Gaps = 4/126 (3%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREASFSDVVAAQLTPKA----TGAPVKGVTVAKLKVAINGFGRI  296
            +EFSGLRSS  + F+ + +S   V       KA     G   KGVT AK+KVAINGFGRI
Sbjct  19   SEFSGLRSSSGLPFAKKPSSDEFVSFVTFQTKALGNNNGGYRKGVTEAKIKVAINGFGRI  78

Query  297  GRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  476
            GRNFLRCWHGRKDSPL+VI +ND+ GVK AAHLLKYDS LG F ADVK   ++ +SVDGK
Sbjct  79   GRNFLRCWHGRKDSPLDVIAINDTGGVKQAAHLLKYDSTLGIFDADVKPSGDKALSVDGK  138

Query  477  PIKVVS  494
             I+VVS
Sbjct  139  IIQVVS  144



>ref|XP_010476269.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   147 bits (372),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 94/125 (75%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVAKLKVAINGFGRIG  299
            +EFSGLR+S  + F+ + +S  F   V+ Q +   + G   KGVT AK+KVAINGFGRIG
Sbjct  17   SEFSGLRNSSALPFAKKSSSDEFVSFVSFQTSAMGSNGGYRKGVTEAKIKVAINGFGRIG  76

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  77   RNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKI  136

Query  480  IKVVS  494
            I++VS
Sbjct  137  IQIVS  141



>ref|XP_010249379.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Nelumbo nucifera]
Length=402

 Score =   147 bits (372),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 93/124 (75%), Gaps = 2/124 (2%)
 Frame = +3

Query  129  AEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGR  302
            ++FSGLR SS  + F+ + +  F  V+A Q +        +GV  AKLKVAINGFGRIGR
Sbjct  21   SDFSGLRISSASLPFARKTSDDFLSVIAFQTSAVGGSGQKRGVVEAKLKVAINGFGRIGR  80

Query  303  NFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPI  482
            NFLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS LG F+ADVK   ++ ISVDGK I
Sbjct  81   NFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSTLGIFEADVKPAGDDAISVDGKII  140

Query  483  KVVS  494
            KVVS
Sbjct  141  KVVS  144



>gb|ADX97321.1| glyceraldehyde-3-phosphate dehydrogenase [Mangifera indica]
Length=401

 Score =   147 bits (372),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 89/122 (73%), Gaps = 1/122 (1%)
 Frame = +3

Query  132  EFSGLRSSGCVTFSNREA-SFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRNF  308
            +FSGLR+S  + FS + +  F  V+A Q +        KG   AKLKVAINGFGRIGRNF
Sbjct  22   DFSGLRNSASLPFSRKTSEDFLSVIAFQTSAVGNSGYRKGAAEAKLKVAINGFGRIGRNF  81

Query  309  LRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKV  488
            LRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F A+VK V +  ISVDGK IKV
Sbjct  82   LRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDANVKPVGDNAISVDGKVIKV  141

Query  489  VS  494
            V+
Sbjct  142  VT  143



>emb|CDY26599.1| BnaA09g46780D [Brassica napus]
Length=399

 Score =   147 bits (372),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 92/125 (74%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVAKLKVAINGFGRIG  299
            ++FSGLR+S  + F  + +S  F   V+ Q +   + G   KGVT AKLKVAINGFGRIG
Sbjct  17   SDFSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNGGYKKGVTEAKLKVAINGFGRIG  76

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  77   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGDSALSVDGKI  136

Query  480  IKVVS  494
            IK+VS
Sbjct  137  IKIVS  141



>ref|XP_010494747.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   147 bits (371),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 93/125 (74%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVAKLKVAINGFGRIG  299
            +EFSGLR+S  + F  + +S  F   V+ Q +   + G   KGVT AK+KVAINGFGRIG
Sbjct  17   SEFSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNGGYRKGVTEAKIKVAINGFGRIG  76

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  77   RNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKI  136

Query  480  IKVVS  494
            I++VS
Sbjct  137  IQIVS  141



>ref|XP_009148556.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   147 bits (370),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 91/125 (73%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVAKLKVAINGFGRIG  299
            ++FSGLR+S  + F  + +S  F   V+ Q +   + G   KGVT AKLKVAINGFGRIG
Sbjct  17   SDFSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNGGYRKGVTEAKLKVAINGFGRIG  76

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  77   RNFLRCWHGRKDSPLDVIAINDTGGVKQATHLLKYDSTLGIFDADVKPSGDSALSVDGKI  136

Query  480  IKVVS  494
            IK+VS
Sbjct  137  IKIVS  141



>ref|XP_004975847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Setaria italica]
Length=401

 Score =   147 bits (370),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 87/126 (69%), Gaps = 3/126 (2%)
 Frame = +3

Query  126  VAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKA---TGAPVKGVTVAKLKVAINGFGRI  296
            ++EFSGLRSS  +       S   V A      A   +G P +  T AKLKVAINGFGRI
Sbjct  18   LSEFSGLRSSASLPLRRNATSDDFVNAVSFRTHAVGTSGGPRRAPTEAKLKVAINGFGRI  77

Query  297  GRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  476
            GRNFLRCWHGR DSPLEVI +ND+ GVK A+HLLKYDS LG F ADVK V +  ISVDGK
Sbjct  78   GRNFLRCWHGRDDSPLEVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGK  137

Query  477  PIKVVS  494
             IKVVS
Sbjct  138  VIKVVS  143



>ref|XP_004304578.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=404

 Score =   147 bits (370),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 99/138 (72%), Gaps = 8/138 (6%)
 Frame = +3

Query  96   TPQCFSKRLEVAEFSGLRSSGCVT--FSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVA  260
            +PQ   K    AEF+GLR+S   +  F  R +   FS V+A Q +   T G   +G+T A
Sbjct  12   SPQANGKGF--AEFAGLRNSSAASLCFGRRTSDDLFS-VIAFQTSAVGTNGGYKRGITEA  68

Query  261  KLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVK  440
            KLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F A+VK
Sbjct  69   KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDAEVK  128

Query  441  VVDNETISVDGKPIKVVS  494
             V ++ ISVDGK IKVVS
Sbjct  129  PVGDDGISVDGKVIKVVS  146



>emb|CDY19412.1| BnaC05g09210D [Brassica napus]
 emb|CDX98028.1| BnaA06g07790D [Brassica napus]
Length=399

 Score =   147 bits (370),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 91/125 (73%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVAKLKVAINGFGRIG  299
            ++FSGLR+S  + F  + +S  F   V+ Q +   + G   KGVT AKLKVAINGFGRIG
Sbjct  17   SDFSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNGGYRKGVTEAKLKVAINGFGRIG  76

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  77   RNFLRCWHGRKDSPLDVIAINDTGGVKQATHLLKYDSTLGIFDADVKPSGDSALSVDGKI  136

Query  480  IKVVS  494
            IK+VS
Sbjct  137  IKIVS  141



>dbj|BAJ10475.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=399

 Score =   147 bits (370),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 91/125 (73%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVAKLKVAINGFGRIG  299
            ++FSGLR+S  + F  + +S  F   V+ Q +   + G   KGVT AKLKVAINGFGRIG
Sbjct  17   SDFSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNGGYRKGVTEAKLKVAINGFGRIG  76

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  77   RNFLRCWHGRKDSPLDVIAINDTGGVKQATHLLKYDSTLGIFDADVKPSGDSALSVDGKI  136

Query  480  IKVVS  494
            IK+VS
Sbjct  137  IKIVS  141



>ref|XP_003624553.1| Glyceraldehyde-3-phosphate dehydrogenase A [Medicago truncatula]
 gb|AES80771.1| glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=404

 Score =   147 bits (370),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 95/126 (75%), Gaps = 4/126 (3%)
 Frame = +3

Query  129  AEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTP-KATGAPVKGVTV-AKLKVAINGFGRI  296
            +EFSGLR SSG + FS + +  F  V++ Q     ++G   KGV V AK+KVAINGFGRI
Sbjct  21   SEFSGLRNSSGYLPFSRKTSDDFHSVISFQTNAVGSSGRSKKGVVVEAKIKVAINGFGRI  80

Query  297  GRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  476
            GRNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V  + ISVDGK
Sbjct  81   GRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGK  140

Query  477  PIKVVS  494
             IKVVS
Sbjct  141  VIKVVS  146



>gb|AHZ58488.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Syntrichia 
caninervis]
Length=377

 Score =   146 bits (369),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +3

Query  138  SGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRNFLRC  317
            SG++++  VTF  R      VVAAQ    A+    + VT AK++VAINGFGRIGRNF+RC
Sbjct  1    SGIKNTNAVTFGKRTDDLVSVVAAQSAVSASSGATRAVTEAKIRVAINGFGRIGRNFVRC  60

Query  318  WHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            WHGRKDSPLEV+V+ND+ GVK A+HLLKYDSMLGTF ADVK VD + ISVDGK IKVVS
Sbjct  61   WHGRKDSPLEVVVINDTGGVKQASHLLKYDSMLGTFNADVK-VDGDGISVDGKTIKVVS  118



>ref|XP_006304985.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
 gb|EOA37883.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
Length=399

 Score =   146 bits (369),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 92/125 (74%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVAKLKVAINGFGRIG  299
            +EFSGLR+S  + F+ + +S  F   V+ Q +   + G   KGVT AK+KVAINGFGRIG
Sbjct  17   SEFSGLRNSSALPFAKKSSSDEFVSFVSFQTSSMGSNGGYRKGVTEAKIKVAINGFGRIG  76

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+V+ +ND+ GVK A HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  77   RNFLRCWHGRKDSPLDVVAINDTGGVKQATHLLKYDSTLGIFDADVKPSGDAALSVDGKI  136

Query  480  IKVVS  494
            IK+VS
Sbjct  137  IKIVS  141



>gb|AGV54738.1| glyceraldehyde-3-phosphate dehydrogenase A chloroplastic-like 
protein [Phaseolus vulgaris]
Length=316

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 93/125 (74%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKATGAPVKGVTV-AKLKVAINGFGRIG  299
            ++FSGLRSS      +R+ S  F+ V+A Q +        K V V AKLKVAINGFGRIG
Sbjct  21   SDFSGLRSSSSYLPFSRKTSEDFNSVIAFQTSAVGNSGGYKKVVVEAKLKVAINGFGRIG  80

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRK+SPL+VI +ND+ GVK A+HLLKYDS+LGTF A VK V ++ ISVDGK 
Sbjct  81   RNFLRCWHGRKESPLDVIAINDTGGVKQASHLLKYDSILGTFDAVVKPVGSDIISVDGKE  140

Query  480  IKVVS  494
            IKVVS
Sbjct  141  IKVVS  145



>emb|CDP18560.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 88/122 (72%), Gaps = 1/122 (1%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRNF  308
            +EF+GLRSS              VVA Q +    G   +GV  AKLKVAINGFGRIGRNF
Sbjct  21   SEFAGLRSSSLPFARKASDDLLSVVAFQTSVIGGGKNKRGVVEAKLKVAINGFGRIGRNF  80

Query  309  LRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKV  488
            LRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS LG F+ADVK  D E ISVDGK IKV
Sbjct  81   LRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSTLGIFEADVKPAD-EGISVDGKVIKV  139

Query  489  VS  494
            V+
Sbjct  140  VT  141



>ref|XP_007032095.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
 gb|EOY03021.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
Length=404

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 91/126 (72%), Gaps = 4/126 (3%)
 Frame = +3

Query  129  AEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTPKAT--GAPVKGVTVAKLKVAINGFGRI  296
             EFSGLR SS  + F  + +  F  VVA Q +   +  G   KGV  AKLKVAINGFGRI
Sbjct  21   GEFSGLRNSSSSLPFPRKTSDDFLSVVAFQTSALGSNNGGYRKGVVEAKLKVAINGFGRI  80

Query  297  GRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  476
            GRNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK   ++ ISVDGK
Sbjct  81   GRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPAGDDAISVDGK  140

Query  477  PIKVVS  494
             IKVVS
Sbjct  141  IIKVVS  146



>gb|ABK00052.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=359

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  201  VAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVK  380
            VAAQ     +GA  + V  AK+KVAINGFGRIGRNF+RCWHGRKDSPLEV+V+ND+ GVK
Sbjct  2    VAAQSAVAVSGAQKRAVVEAKVKVAINGFGRIGRNFIRCWHGRKDSPLEVVVINDTGGVK  61

Query  381  NAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
             A+HLLKYDSMLG F ADVK V ++ ISVDGK IK+VS
Sbjct  62   QASHLLKYDSMLGIFDADVKAVGDDAISVDGKIIKIVS  99



>ref|XP_010250427.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nelumbo nucifera]
Length=402

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 89/124 (72%), Gaps = 2/124 (2%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGR  302
            +EFSGLR+S       R+AS     V+A Q +        +GV  AKLKVAINGFGRIGR
Sbjct  21   SEFSGLRNSSASLPFARKASDDLLSVIAFQTSVVGGNGQKRGVVEAKLKVAINGFGRIGR  80

Query  303  NFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPI  482
            NFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F+ADVK   +  ISVDGK I
Sbjct  81   NFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFEADVKPAGDNAISVDGKII  140

Query  483  KVVS  494
            KVVS
Sbjct  141  KVVS  144



>ref|XP_006468948.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Citrus sinensis]
 gb|KDO63478.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=403

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 92/127 (72%), Gaps = 7/127 (6%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREAS-FSDVVAAQLTPKATGAPVKG----VTVAKLKVAINGFGR  293
            +EFSGLR+S  + F  + +  F  V+A Q +  A G+   G       AKLKVAINGFGR
Sbjct  21   SEFSGLRNSASLPFGRKSSDDFHSVIALQTS--ALGSSSSGYRKVAAQAKLKVAINGFGR  78

Query  294  IGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDG  473
            IGRNFLRCWHGRKDSPLEV+ +ND+ GVK A+HLLKYDS LG F+ADVK V  + ISVDG
Sbjct  79   IGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDG  138

Query  474  KPIKVVS  494
            K I+VVS
Sbjct  139  KVIQVVS  145



>ref|XP_006446865.1| hypothetical protein CICLE_v10015476mg [Citrus clementina]
 gb|ESR60105.1| hypothetical protein CICLE_v10015476mg [Citrus clementina]
Length=403

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 92/127 (72%), Gaps = 7/127 (6%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREAS-FSDVVAAQLTPKATGAPVKG----VTVAKLKVAINGFGR  293
            +EFSGLR+S  + F  + +  F  V+A Q +  A G+   G       AKLKVAINGFGR
Sbjct  21   SEFSGLRNSASLPFGRKSSDDFHSVIALQTS--ALGSSSSGYRKVAAQAKLKVAINGFGR  78

Query  294  IGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDG  473
            IGRNFLRCWHGRKDSPLEV+ +ND+ GVK A+HLLKYDS LG F+ADVK V  + ISVDG
Sbjct  79   IGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDG  138

Query  474  KPIKVVS  494
            K I+VVS
Sbjct  139  KVIQVVS  145



>ref|XP_002875330.1| gapa [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51589.1| gapa [Arabidopsis lyrata subsp. lyrata]
Length=396

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 97/138 (70%), Gaps = 10/138 (7%)
 Frame = +3

Query  93   STPQCFSKRLEVAEFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVA  260
            S P+ F+      EFSGLRSS   + F  + +S  F  +V+ Q +   ++G   KGVT A
Sbjct  7    SVPKGFT------EFSGLRSSSASLPFGKKLSSDEFVSIVSFQTSAMGSSGGYRKGVTEA  60

Query  261  KLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVK  440
            KLKVAINGFGRIGRNFLRCWHGRKDSPL++I +ND+ GVK A+HLLKYDS LG F ADVK
Sbjct  61   KLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDSTLGIFDADVK  120

Query  441  VVDNETISVDGKPIKVVS  494
                  ISVDGK I+VVS
Sbjct  121  PSGETAISVDGKIIQVVS  138



>gb|ACV32597.1| putative glyceraldehyde-3-phosphate dehydrogenase [Medicago sativa]
Length=404

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 94/126 (75%), Gaps = 4/126 (3%)
 Frame = +3

Query  129  AEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTP-KATGAPVKGVTV-AKLKVAINGFGRI  296
            +EFSGLR SSG + FS + +  F  V++ Q     ++G   KGV V AK+KVAINGFGR 
Sbjct  21   SEFSGLRNSSGYLPFSRKTSDDFHSVISVQTNAVGSSGRSRKGVVVEAKIKVAINGFGRT  80

Query  297  GRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  476
            GRNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V  + ISVDGK
Sbjct  81   GRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGK  140

Query  477  PIKVVS  494
             IKVVS
Sbjct  141  VIKVVS  146



>ref|NP_566796.2| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
 sp|P25856.3|G3PA1_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA1, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL16200.1|AF428431_1 AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 dbj|BAB01730.1| glyceralehyde-3-phosphate dehydrogenase subunit [Arabidopsis 
thaliana]
 gb|AAL24215.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL25556.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL91645.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAM98317.1| At3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AEE77191.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=396

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 97/138 (70%), Gaps = 10/138 (7%)
 Frame = +3

Query  93   STPQCFSKRLEVAEFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVA  260
            S P+ F+      EFSGLRSS   + F  + +S  F  +V+ Q +   ++G   KGVT A
Sbjct  7    SVPKGFT------EFSGLRSSSASLPFGKKLSSDEFVSIVSFQTSAMGSSGGYRKGVTEA  60

Query  261  KLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVK  440
            KLKVAINGFGRIGRNFLRCWHGRKDSPL++I +ND+ GVK A+HLLKYDS LG F ADVK
Sbjct  61   KLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDSTLGIFDADVK  120

Query  441  VVDNETISVDGKPIKVVS  494
                  ISVDGK I+VVS
Sbjct  121  PSGETAISVDGKIIQVVS  138



>gb|AAA32793.1| glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana]
 emb|CAA66816.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=396

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 97/138 (70%), Gaps = 10/138 (7%)
 Frame = +3

Query  93   STPQCFSKRLEVAEFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVA  260
            S P+ F+      EFSGLRSS   + F  + +S  F  +V+ Q +   ++G   KGVT A
Sbjct  7    SVPKGFT------EFSGLRSSSASLPFGKKLSSDEFVSIVSFQTSAMGSSGGYRKGVTEA  60

Query  261  KLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVK  440
            KLKVAINGFGRIGRNFLRCWHGRKDSPL++I +ND+ GVK A+HLLKYDS LG F ADVK
Sbjct  61   KLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDSTLGIFDADVK  120

Query  441  VVDNETISVDGKPIKVVS  494
                  ISVDGK I+VVS
Sbjct  121  PSGETAISVDGKIIQVVS  138



>ref|XP_006291258.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
 gb|EOA24156.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
Length=400

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 92/125 (74%), Gaps = 4/125 (3%)
 Frame = +3

Query  132  EFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  299
            EFSGLRSS   + F  + +S  F  +V+ Q +   ++G   KGVT AKLKVAINGFGRIG
Sbjct  18   EFSGLRSSSASLPFGKKLSSDEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIG  77

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK      ISVDGK 
Sbjct  78   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKI  137

Query  480  IKVVS  494
            I+VVS
Sbjct  138  IQVVS  142



>ref|XP_004493116.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cicer arietinum]
Length=405

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 94/127 (74%), Gaps = 5/127 (4%)
 Frame = +3

Query  129  AEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTPKATGAPVK--GVTV-AKLKVAINGFGR  293
            +EFSGLR S+G + FS + +  F  VV+ Q     +    K  GV V AKLKVAINGFGR
Sbjct  21   SEFSGLRNSTGYLPFSRKTSDDFHSVVSFQTNAVGSNGGYKRGGVVVEAKLKVAINGFGR  80

Query  294  IGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDG  473
            IGRNFLRCWHGRK+SPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V N+ ISVDG
Sbjct  81   IGRNFLRCWHGRKESPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGNDAISVDG  140

Query  474  KPIKVVS  494
            K I+VVS
Sbjct  141  KVIQVVS  147



>ref|XP_010514317.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010514318.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X2 [Camelina sativa]
 ref|XP_010514319.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=400

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 92/125 (74%), Gaps = 4/125 (3%)
 Frame = +3

Query  132  EFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  299
            EFSGLRSS   + F  + +S  F  +V+ Q +   ++G   KGVT AKLKVAINGFGRIG
Sbjct  18   EFSGLRSSSAFLPFGKKLSSDEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIG  77

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK      ISVDGK 
Sbjct  78   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKI  137

Query  480  IKVVS  494
            I+VVS
Sbjct  138  IQVVS  142



>ref|XP_011033706.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Populus euphratica]
Length=404

 Score =   145 bits (366),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 88/125 (70%), Gaps = 4/125 (3%)
 Frame = +3

Query  132  EFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPV----KGVTVAKLKVAINGFGRIG  299
            +FSGLRSS       ++ S   V A  L   A G+      KG   AKLKVAINGFGRIG
Sbjct  22   DFSGLRSSSAFLPFTKKTSDDFVSAVSLQTSALGSSSGGYRKGAAEAKLKVAINGFGRIG  81

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F+ADVK V +  ISVDGK 
Sbjct  82   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFEADVKPVGDNGISVDGKV  141

Query  480  IKVVS  494
            IKVVS
Sbjct  142  IKVVS  146



>ref|XP_010694632.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=401

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 91/124 (73%), Gaps = 3/124 (2%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATG--APVKGVTVAKLKVAINGFGRIGR  302
            +EF+GL +S  + F+ R +     + A  T    G  +   GV  AKLKVAINGFGRIGR
Sbjct  21   SEFAGLHTS-SLPFARRGSDDLVALVAFQTNALAGKRSTQNGVVEAKLKVAINGFGRIGR  79

Query  303  NFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPI  482
            NFLRCWHGRKDSPLEV+V+NDS GVK A+HLLKYDS+LGTF ADVK   N+ ISVDGK I
Sbjct  80   NFLRCWHGRKDSPLEVVVINDSGGVKQASHLLKYDSILGTFDADVKPEGNDAISVDGKVI  139

Query  483  KVVS  494
            KVVS
Sbjct  140  KVVS  143



>gb|KDO63477.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=416

 Score =   145 bits (366),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 92/127 (72%), Gaps = 7/127 (6%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREAS-FSDVVAAQLTPKATGAPVKG----VTVAKLKVAINGFGR  293
            +EFSGLR+S  + F  + +  F  V+A Q +  A G+   G       AKLKVAINGFGR
Sbjct  21   SEFSGLRNSASLPFGRKSSDDFHSVIALQTS--ALGSSSSGYRKVAAQAKLKVAINGFGR  78

Query  294  IGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDG  473
            IGRNFLRCWHGRKDSPLEV+ +ND+ GVK A+HLLKYDS LG F+ADVK V  + ISVDG
Sbjct  79   IGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDG  138

Query  474  KPIKVVS  494
            K I+VVS
Sbjct  139  KVIQVVS  145



>gb|KDO63476.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=442

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 92/127 (72%), Gaps = 7/127 (6%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREAS-FSDVVAAQLTPKATGAPVKG----VTVAKLKVAINGFGR  293
            +EFSGLR+S  + F  + +  F  V+A Q +  A G+   G       AKLKVAINGFGR
Sbjct  21   SEFSGLRNSASLPFGRKSSDDFHSVIALQTS--ALGSSSSGYRKVAAQAKLKVAINGFGR  78

Query  294  IGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDG  473
            IGRNFLRCWHGRKDSPLEV+ +ND+ GVK A+HLLKYDS LG F+ADVK V  + ISVDG
Sbjct  79   IGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDG  138

Query  474  KPIKVVS  494
            K I+VVS
Sbjct  139  KVIQVVS  145



>ref|XP_007161788.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
 gb|ESW33782.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
Length=403

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 93/125 (74%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKATGAPVKGVTV-AKLKVAINGFGRIG  299
            ++FSGLRSS      +R+ S  F+ V+A Q +        K V V AKLKVAINGFGRIG
Sbjct  21   SDFSGLRSSSSYLPFSRKTSEDFNSVIAFQTSAVGNSGGYKKVVVEAKLKVAINGFGRIG  80

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRK+SPL+VI +ND+ GVK A+HLLKYDS+LGTF A VK V ++ ISVDGK 
Sbjct  81   RNFLRCWHGRKESPLDVIAINDTGGVKQASHLLKYDSILGTFDAVVKPVGSDIISVDGKE  140

Query  480  IKVVS  494
            IKVVS
Sbjct  141  IKVVS  145



>ref|XP_010425375.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic 
isoform X1 [Camelina sativa]
Length=400

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 92/125 (74%), Gaps = 4/125 (3%)
 Frame = +3

Query  132  EFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  299
            EFSGLRSS   + F  + +S  F  +V+ Q +   ++G   KGVT AKLKVAINGFGRIG
Sbjct  18   EFSGLRSSSASLPFGKKLSSDEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIG  77

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL++I +ND+ GVK A+HLLKYDS LG F ADVK      ISVDGK 
Sbjct  78   RNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKI  137

Query  480  IKVVS  494
            I+VVS
Sbjct  138  IQVVS  142



>gb|KFK33590.1| hypothetical protein AALP_AA5G033500 [Arabis alpina]
Length=400

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 92/125 (74%), Gaps = 4/125 (3%)
 Frame = +3

Query  132  EFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  299
            EFSGLRSS   + F  + +S  F  VV  Q +   ++G   KGVT AKLKVAINGFGRIG
Sbjct  18   EFSGLRSSSASLPFGKKFSSDEFVSVVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIG  77

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  78   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGDSALSVDGKI  137

Query  480  IKVVS  494
            I+VVS
Sbjct  138  IQVVS  142



>gb|AHA84230.1| glyceraldehyde-3-phosphate dehydrogenase A [Phaseolus vulgaris]
Length=402

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 93/125 (74%), Gaps = 3/125 (2%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKATGAPVKGVTV-AKLKVAINGFGRIG  299
            ++FSGLRSS      +R+ S  F+ V+A Q +        K V V AKLKVAINGFGRIG
Sbjct  21   SDFSGLRSSSSYLPFSRKTSEDFNSVIAFQTSAVGNSGGYKKVVVEAKLKVAINGFGRIG  80

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRK+SPL+VI +ND+ GVK A+HLLKYDS+LGTF A VK V ++ ISVDGK 
Sbjct  81   RNFLRCWHGRKESPLDVIAINDTGGVKQASHLLKYDSILGTFDAVVKPVGSDIISVDGKE  140

Query  480  IKVVS  494
            IKVVS
Sbjct  141  IKVVS  145



>ref|XP_006395535.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
 gb|ESQ32821.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
Length=400

 Score =   144 bits (364),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 92/125 (74%), Gaps = 4/125 (3%)
 Frame = +3

Query  132  EFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  299
            EFSGLRSS   + F  + +S  F  VV  Q +   ++G   KGVT AKLKVAINGFGRIG
Sbjct  18   EFSGLRSSSASLPFGKKLSSDEFVSVVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIG  77

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  78   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKI  137

Query  480  IKVVS  494
            I+VVS
Sbjct  138  IQVVS  142



>gb|KJB70723.1| hypothetical protein B456_011G088800 [Gossypium raimondii]
Length=408

 Score =   144 bits (364),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 95/135 (70%), Gaps = 4/135 (3%)
 Frame = +3

Query  102  QCFSKRLEVAEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTPKAT--GAPVKGVTVAKLK  269
            Q   K +  A+FSGL  SS  + F+ + +  F  +VA Q +   +  G   KG+  AKLK
Sbjct  16   QAKGKGVGFADFSGLHNSSTSLPFARKTSDDFHSLVAFQTSALGSNNGGYRKGMAEAKLK  75

Query  270  VAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVD  449
            VAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V 
Sbjct  76   VAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFAADVKPVG  135

Query  450  NETISVDGKPIKVVS  494
             + ISVDGK IKVVS
Sbjct  136  TDGISVDGKVIKVVS  150



>gb|KHG21941.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Gossypium 
arboreum]
Length=363

 Score =   144 bits (362),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 95/135 (70%), Gaps = 4/135 (3%)
 Frame = +3

Query  102  QCFSKRLEVAEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTPKAT--GAPVKGVTVAKLK  269
            Q   K +  A+FSGL  SS  + F+ + +  F  +VA Q +   +  G   KG+  AK+K
Sbjct  16   QAKGKGVGFADFSGLHNSSTSLPFARKTSDDFHSLVAFQTSALGSNNGGYRKGMAEAKVK  75

Query  270  VAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVD  449
            VAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V 
Sbjct  76   VAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFAADVKPVG  135

Query  450  NETISVDGKPIKVVS  494
             + ISVDGK IKVVS
Sbjct  136  TDGISVDGKVIKVVS  150



>ref|XP_002512790.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF49293.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=404

 Score =   144 bits (364),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 91/125 (73%), Gaps = 4/125 (3%)
 Frame = +3

Query  132  EFSGLR-SSGCVTFSNREAS-FSDVVAAQLTP--KATGAPVKGVTVAKLKVAINGFGRIG  299
            EFSGLR SS  + FS + +  F  VVA Q +    + G   K V  AKLKVAINGFGRIG
Sbjct  22   EFSGLRNSSAFLPFSKKTSDDFLSVVAFQTSAVGSSNGGYRKTVAEAKLKVAINGFGRIG  81

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V  + ISVDGK 
Sbjct  82   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGKV  141

Query  480  IKVVS  494
            I+VVS
Sbjct  142  IQVVS  146



>gb|ACN41006.1| unknown [Picea sitchensis]
Length=471

 Score =   145 bits (365),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 99/139 (71%), Gaps = 12/139 (9%)
 Frame = +3

Query  114  KRLEVAEFSGLRS-SGCVTFSN--REASFS--DVVAAQLTPKA-TGAPVKGVTVAKLKVA  275
            K +E++EF+GL+S SGC+T+    RE+S    D +A+Q+  KA     VKG TVAK+KVA
Sbjct  38   KSVEISEFAGLKSTSGCITYGRQVRESSLGLFDALASQVIAKAGNSGAVKGETVAKMKVA  97

Query  276  INGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVV---  446
            INGFGRIGRNFLRCWHG K SPLEV+ VND  GV+NAAHLLKYDS  G F+ADV  V   
Sbjct  98   INGFGRIGRNFLRCWHGHKRSPLEVVAVNDIIGVENAAHLLKYDSTHGKFQADVDGVFKA  157

Query  447  ---DNETISVDGKPIKVVS  494
                ++ + VDGK I V+S
Sbjct  158  EGNGHKFMKVDGKHISVLS  176



>gb|AGJ50596.1| GAPDH [Pericallis cruenta]
Length=399

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 88/123 (72%), Gaps = 1/123 (1%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREASFSDVVA-AQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  305
            +EF+GLRSS     + +  S  D V+   L     G   KG   AKLKVAINGFGRIGRN
Sbjct  18   SEFAGLRSSSASLPAFQMKSCDDFVSMVALQTSFVGKNSKGPVEAKLKVAINGFGRIGRN  77

Query  306  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  485
            FLRCWHGRKDSPL+VIV+ND+ GVK A+HLLKYDS LG F ADVK   ++ ISVDGK IK
Sbjct  78   FLRCWHGRKDSPLDVIVINDTGGVKQASHLLKYDSTLGIFDADVKPSGDQAISVDGKIIK  137

Query  486  VVS  494
            VVS
Sbjct  138  VVS  140



>gb|AEO45783.1| glyceraldehyde-3-phosphate dehydrogenase A [Scoparia dulcis]
Length=398

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 91/124 (73%), Gaps = 3/124 (2%)
 Frame = +3

Query  129  AEFSGLRSS-GCVTFSNRE-ASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGR  302
            +EF+GLRSS   + F+ ++   F  V+A Q T        +GV  AKLKVAINGFGRIGR
Sbjct  18   SEFAGLRSSSAALPFARKQNEDFLSVIAFQ-TSAIDSKNKRGVVEAKLKVAINGFGRIGR  76

Query  303  NFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPI  482
            NFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  ISVDGK I
Sbjct  77   NFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVI  136

Query  483  KVVS  494
            +VVS
Sbjct  137  QVVS  140



>ref|XP_010502597.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=400

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 91/125 (73%), Gaps = 4/125 (3%)
 Frame = +3

Query  132  EFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  299
            EFSGLRSS   + F  + +S  F   V+ Q +   ++G   KGVT AKLKVAINGFGRIG
Sbjct  18   EFSGLRSSSAFLPFGKKLSSDEFVSFVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIG  77

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK      ISVDGK 
Sbjct  78   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKI  137

Query  480  IKVVS  494
            I+VVS
Sbjct  138  IQVVS  142



>ref|XP_011003600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Populus euphratica]
Length=404

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 91/125 (73%), Gaps = 4/125 (3%)
 Frame = +3

Query  132  EFSGLRSSGC-VTFSNREAS-FSDVVAAQL--TPKATGAPVKGVTVAKLKVAINGFGRIG  299
            +FSGLRSS   + F+ + +  F  VVA Q   T  ++G   K    AK+KVAINGFGRIG
Sbjct  22   DFSGLRSSSAFLPFTKKTSDDFVSVVAFQTSATGNSSGGYRKSAAEAKIKVAINGFGRIG  81

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  ISVDGK 
Sbjct  82   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKV  141

Query  480  IKVVS  494
            IKVVS
Sbjct  142  IKVVS  146



>emb|CDY28536.1| BnaC02g36240D [Brassica napus]
Length=380

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 88/125 (70%), Gaps = 4/125 (3%)
 Frame = +3

Query  132  EFSGLRSSGC-VTFSNREASFSDVVAAQLTPKATGAP---VKGVTVAKLKVAINGFGRIG  299
            EFSGLRSS   + F  + +S   V A      A G+     KGVT AKLKVAINGFGRIG
Sbjct  18   EFSGLRSSSASLPFGKKLSSDEFVSAITFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIG  77

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSP +VI +ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  78   RNFLRCWHGRKDSPFDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKI  137

Query  480  IKVVS  494
            IKVVS
Sbjct  138  IKVVS  142



>ref|XP_004236849.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Solanum lycopersicum]
Length=399

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 87/123 (71%), Gaps = 1/123 (1%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKG-VTVAKLKVAINGFGRIGRN  305
            +EFSGLR+S  V F  +       VA   T    G   K  VT AKLKVAINGFGRIGRN
Sbjct  19   SEFSGLRTSSAVPFGRKTNDDLFSVAGLQTSAIGGRKNKRIVTEAKLKVAINGFGRIGRN  78

Query  306  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  485
            FLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V  + ISVDGK I+
Sbjct  79   FLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGKVIQ  138

Query  486  VVS  494
            VVS
Sbjct  139  VVS  141



>ref|XP_006359279.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum tuberosum]
Length=399

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 87/123 (71%), Gaps = 1/123 (1%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKG-VTVAKLKVAINGFGRIGRN  305
            +EFSGLR+S  V F  +       VA   T    G   K  VT AKLKVAINGFGRIGRN
Sbjct  19   SEFSGLRTSSAVPFGRKTNDDLFSVAGLQTSAIGGRKNKRIVTEAKLKVAINGFGRIGRN  78

Query  306  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  485
            FLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V  + ISVDGK I+
Sbjct  79   FLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGKIIQ  138

Query  486  VVS  494
            VVS
Sbjct  139  VVS  141



>gb|ACN40537.1| unknown [Picea sitchensis]
Length=410

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 88/123 (72%), Gaps = 1/123 (1%)
 Frame = +3

Query  129  AEFSGLRSS-GCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  305
            +E+SGL+SS G  +          VVA Q     +    +GV  AK+KVAINGFGRIGRN
Sbjct  29   SEYSGLKSSIGFPSLRKYNEDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRN  88

Query  306  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  485
            FLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS+LGTF  +VK+   + ISV GK IK
Sbjct  89   FLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDTEVKIAGTDGISVGGKVIK  148

Query  486  VVS  494
            VVS
Sbjct  149  VVS  151



>emb|CDX83635.1| BnaC07g23750D [Brassica napus]
Length=380

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 89/125 (71%), Gaps = 4/125 (3%)
 Frame = +3

Query  132  EFSGLRSSGC-VTFSNREASFSDVVAAQLTPKATGAPV---KGVTVAKLKVAINGFGRIG  299
            +FSGLRSS   + F+ + +S   V A      A G+     KGVT AKLKVAINGFGRIG
Sbjct  18   DFSGLRSSSASLPFAKKLSSDEFVSAVSFQTSAMGSSSGYRKGVTEAKLKVAINGFGRIG  77

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSP ++I +ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  78   RNFLRCWHGRKDSPFDIIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKI  137

Query  480  IKVVS  494
            IKVVS
Sbjct  138  IKVVS  142



>gb|ABK25233.1| unknown [Picea sitchensis]
 gb|ABK26169.1| unknown [Picea sitchensis]
 gb|ACN40026.1| unknown [Picea sitchensis]
 gb|ACN40459.1| unknown [Picea sitchensis]
Length=410

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 88/123 (72%), Gaps = 1/123 (1%)
 Frame = +3

Query  129  AEFSGLRSS-GCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  305
            +E+SGL+SS G  +          VVA Q     +    +GV  AK+KVAINGFGRIGRN
Sbjct  29   SEYSGLKSSIGFPSLRKYNEDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRN  88

Query  306  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  485
            FLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS+LGTF  +VK+   + ISV GK IK
Sbjct  89   FLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDTEVKIAGTDGISVGGKVIK  148

Query  486  VVS  494
            VVS
Sbjct  149  VVS  151



>gb|ACN40000.1| unknown [Picea sitchensis]
Length=410

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 88/123 (72%), Gaps = 1/123 (1%)
 Frame = +3

Query  129  AEFSGLRSS-GCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  305
            +E+SGL+SS G  +          VVA Q     +    +GV  AK+KVAINGFGRIGRN
Sbjct  29   SEYSGLKSSIGFPSLRKYNEDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRN  88

Query  306  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  485
            FLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS+LGTF  +VK+   + ISV GK IK
Sbjct  89   FLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDTEVKIAGTDGISVGGKVIK  148

Query  486  VVS  494
            VVS
Sbjct  149  VVS  151



>gb|ABK24313.1| unknown [Picea sitchensis]
Length=410

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 88/123 (72%), Gaps = 1/123 (1%)
 Frame = +3

Query  129  AEFSGLRSS-GCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  305
            +E+SGL+SS G  +          VVA Q     +    +GV  AK+KVAINGFGRIGRN
Sbjct  29   SEYSGLKSSIGFPSLRKYNEDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRN  88

Query  306  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  485
            FLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS+LGTF  +VK+   + ISV GK IK
Sbjct  89   FLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDTEVKIAGTDGISVGGKVIK  148

Query  486  VVS  494
            VVS
Sbjct  149  VVS  151



>gb|ABK96233.1| unknown [Populus trichocarpa x Populus deltoides]
Length=404

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 91/125 (73%), Gaps = 4/125 (3%)
 Frame = +3

Query  132  EFSGLRSSGC-VTFSNREAS-FSDVVAAQLTP--KATGAPVKGVTVAKLKVAINGFGRIG  299
            +FSGLRSS   + F+ + +  F  VVA Q +    ++G   K    AK+KVAINGFGRIG
Sbjct  22   DFSGLRSSSAFLPFTKKTSDDFVSVVAFQTSAMGNSSGGYRKSAAEAKIKVAINGFGRIG  81

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  ISVDGK 
Sbjct  82   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKV  141

Query  480  IKVVS  494
            IKVVS
Sbjct  142  IKVVS  146



>gb|ABK96725.1| unknown [Populus trichocarpa x Populus deltoides]
Length=404

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 91/125 (73%), Gaps = 4/125 (3%)
 Frame = +3

Query  132  EFSGLRSSGC-VTFSNREAS-FSDVVAAQLTP--KATGAPVKGVTVAKLKVAINGFGRIG  299
            +FSGLRSS   + F+ + +  F  VVA Q +    ++G   K    AK+KVAINGFGRIG
Sbjct  22   DFSGLRSSSAFLPFTKKTSDDFVSVVAFQTSAMGNSSGGYRKSAAEAKIKVAINGFGRIG  81

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  ISVDGK 
Sbjct  82   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKV  141

Query  480  IKVVS  494
            IKVVS
Sbjct  142  IKVVS  146



>dbj|BAJ34149.1| unnamed protein product [Thellungiella halophila]
Length=400

 Score =   142 bits (358),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 92/125 (74%), Gaps = 4/125 (3%)
 Frame = +3

Query  132  EFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  299
            EFSGLRSS   + F  + +S  F  VV  Q +   ++G   KGVT AKLKVAI+GFGRIG
Sbjct  18   EFSGLRSSSASLPFGKKLSSDEFVSVVTFQTSAMGSSGGYRKGVTEAKLKVAISGFGRIG  77

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  78   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKI  137

Query  480  IKVVS  494
            I+VVS
Sbjct  138  IQVVS  142



>ref|XP_006386825.1| hypothetical protein POPTR_0002s22600g [Populus trichocarpa]
 gb|ERP64622.1| hypothetical protein POPTR_0002s22600g [Populus trichocarpa]
Length=403

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 91/124 (73%), Gaps = 3/124 (2%)
 Frame = +3

Query  132  EFSGLRSSGC-VTFSNREAS-FSDVVAAQLT-PKATGAPVKGVTVAKLKVAINGFGRIGR  302
            +FSGLRSS   + F+ + +  F  VVA Q +   ++G   K    AK+KVAINGFGRIGR
Sbjct  22   DFSGLRSSSAFLPFTKKTSDDFVSVVAFQTSMGNSSGGYRKSAAEAKIKVAINGFGRIGR  81

Query  303  NFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPI  482
            NFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  ISVDGK I
Sbjct  82   NFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVI  141

Query  483  KVVS  494
            KVVS
Sbjct  142  KVVS  145



>gb|ABK94956.1| unknown [Populus trichocarpa]
Length=403

 Score =   142 bits (358),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 91/124 (73%), Gaps = 3/124 (2%)
 Frame = +3

Query  132  EFSGLRSSGC-VTFSNREAS-FSDVVAAQLT-PKATGAPVKGVTVAKLKVAINGFGRIGR  302
            +FSGLRSS   + F+ + +  F  VVA Q +   ++G   K    AK+KVAINGFGRIGR
Sbjct  22   DFSGLRSSSAFLPFTKKTSDDFVSVVAFQTSMGNSSGGYRKSAAEAKIKVAINGFGRIGR  81

Query  303  NFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPI  482
            NFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  ISVDGK I
Sbjct  82   NFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVI  141

Query  483  KVVS  494
            KVVS
Sbjct  142  KVVS  145



>ref|XP_002321065.2| hypothetical protein POPTR_0014s13660g [Populus trichocarpa]
 gb|ABK96062.1| unknown [Populus trichocarpa]
 gb|ABK96120.1| unknown [Populus trichocarpa]
 gb|EEE99380.2| hypothetical protein POPTR_0014s13660g [Populus trichocarpa]
Length=404

 Score =   142 bits (358),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 86/125 (69%), Gaps = 4/125 (3%)
 Frame = +3

Query  132  EFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKG----VTVAKLKVAINGFGRIG  299
            +FSGLRSS       ++ S   V A  L   A G+   G       AKLKVAINGFGRIG
Sbjct  22   DFSGLRSSSAFLPFTKKTSDDFVSAVSLQTSALGSSSGGYRKSAAEAKLKVAINGFGRIG  81

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  ISVDGK 
Sbjct  82   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFAADVKPVGDNGISVDGKV  141

Query  480  IKVVS  494
            IKVVS
Sbjct  142  IKVVS  146



>gb|ABK00057.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Mesostigma 
viride]
Length=384

 Score =   141 bits (356),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 82/97 (85%), Gaps = 1/97 (1%)
 Frame = +3

Query  207  AQLTP-KATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKN  383
            A+L P +ATG+  K VT AKLKVAINGFGRIGRNFLRCW GR++SPLEV+ +NDS GVK 
Sbjct  1    ARLAPVQATGSSQKQVTEAKLKVAINGFGRIGRNFLRCWVGRENSPLEVVAINDSGGVKQ  60

Query  384  AAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVS  494
            AAHLLKYDSMLGTFKADVKV+    ++V+GK I++VS
Sbjct  61   AAHLLKYDSMLGTFKADVKVISETALAVNGKTIEIVS  97



>emb|CDY13649.1| BnaA06g32740D [Brassica napus]
Length=380

 Score =   141 bits (356),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 88/125 (70%), Gaps = 4/125 (3%)
 Frame = +3

Query  132  EFSGLRSSGC-VTFSNREASFSDVVAAQLTPKATGAP---VKGVTVAKLKVAINGFGRIG  299
            +FSGLRSS   + F  + +S   V A      A G+     KGVT AKLKVAINGFGRIG
Sbjct  18   DFSGLRSSSASLPFGKKLSSDEFVSAVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIG  77

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSP +VI +ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  78   RNFLRCWHGRKDSPFDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKI  137

Query  480  IKVVS  494
            IK+VS
Sbjct  138  IKIVS  142



>ref|XP_009152035.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
GAPA1, chloroplastic [Brassica rapa]
Length=400

 Score =   142 bits (357),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 88/125 (70%), Gaps = 4/125 (3%)
 Frame = +3

Query  132  EFSGLRSSGC-VTFSNREASFSDVVAAQLTPKATGAP---VKGVTVAKLKVAINGFGRIG  299
            +FSGLRSS   + F  + +S   V A      A G+     KGVT AKLKVAINGFGRIG
Sbjct  18   DFSGLRSSSASLPFGKKLSSDEFVSAVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIG  77

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSP +VI +ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  78   RNFLRCWHGRKDSPFDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKI  137

Query  480  IKVVS  494
            IKVVS
Sbjct  138  IKVVS  142



>sp|P19866.2|G3PA_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Spinacia oleracea]
 gb|AAD10217.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
A [Spinacia oleracea]
Length=401

 Score =   141 bits (356),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 89/125 (71%), Gaps = 5/125 (4%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATG---APVKGVTVAKLKVAINGFGRIG  299
            +EFSGL +S  + F  R+ S   +        A G   +   GV  AKLKVAINGFGRIG
Sbjct  21   SEFSGLHTS-SLPFG-RKGSDDLMAFVSFQTNAVGGKRSSQNGVVEAKLKVAINGFGRIG  78

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS+LGTF ADVK   +  ISVDGK 
Sbjct  79   RNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVKTAGDSAISVDGKV  138

Query  480  IKVVS  494
            IKVVS
Sbjct  139  IKVVS  143



>gb|ACT21568.1| glyceraldehyde-3-phosphate dehydrogenase [Bruguiera gymnorhiza]
Length=405

 Score =   141 bits (356),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 90/125 (72%), Gaps = 4/125 (3%)
 Frame = +3

Query  132  EFSGLR-SSGCVTFSNREAS-FSDVVAAQLTPKAT--GAPVKGVTVAKLKVAINGFGRIG  299
            EFSGLR SS  + F+ + +  F  VVA Q +  A+  G   +    AKLKVAINGFGRIG
Sbjct  23   EFSGLRNSSAFLPFAKKTSDDFLSVVAFQTSALASSSGGYRRAAAEAKLKVAINGFGRIG  82

Query  300  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  479
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F+ADVK   +  ISVDGK 
Sbjct  83   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFEADVKPAGDSAISVDGKI  142

Query  480  IKVVS  494
            IKV S
Sbjct  143  IKVAS  147



>gb|KDP41897.1| hypothetical protein JCGZ_26915 [Jatropha curcas]
Length=411

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 91/132 (69%), Gaps = 11/132 (8%)
 Frame = +3

Query  132  EFSGLR-SSGCVTFSNREAS-FSDVVAAQLTPK---------ATGAPVKGVTVAKLKVAI  278
            EFSGLR SS  + F+ + +  F  VVA Q + K           G   K    AKLKVAI
Sbjct  22   EFSGLRNSSAFLPFAKKTSDDFLSVVAFQTSAKRILTVKVGSNNGGYRKTAAEAKLKVAI  81

Query  279  NGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNET  458
            NGFGRIGRNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F+ADVK V +  
Sbjct  82   NGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFEADVKPVGDNG  141

Query  459  ISVDGKPIKVVS  494
            ISVDGK IKVVS
Sbjct  142  ISVDGKVIKVVS  153



>tpg|DAA37468.1| TPA: glyceraldehyde-3-phosphate dehydrogenase1 [Zea mays]
Length=252

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 89/128 (70%), Gaps = 6/128 (5%)
 Frame = +3

Query  126  VAEFSGLRSSGCVTFSNREASFSDVVAA----QLTPKATGAPVKGVTVAKLKVAINGFGR  293
            ++EFSGLRSS  +    R A+  D ++A          +G   +  T AKLKVAINGFGR
Sbjct  19   LSEFSGLRSSASLPM-RRNATSDDFMSAVSFRTHAVGTSGGSRRAPTEAKLKVAINGFGR  77

Query  294  IGRNFLRCWHGRKD-SPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVD  470
            IGRNFLRCWHGR D SPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  ISVD
Sbjct  78   IGRNFLRCWHGRGDASPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVD  137

Query  471  GKPIKVVS  494
            GK IKVVS
Sbjct  138  GKVIKVVS  145



>ref|XP_004231523.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum lycopersicum]
Length=409

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 90/129 (70%), Gaps = 7/129 (5%)
 Frame = +3

Query  129  AEFSGLRSSGCVTFSNREASFSDVVA--AQLTPKATGAPVKG-----VTVAKLKVAINGF  287
            +EF+GLR+S  V F     +  D+++  A  T   +GA         V  AKLKVAINGF
Sbjct  23   SEFTGLRTSSAVPFGVGWKTNVDLLSLVAYQTSVISGAGKNNNNNSRVVEAKLKVAINGF  82

Query  288  GRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISV  467
            GRIGRNFLRCWHGRKDSPL+VI +NDS GVK A+HLLKYDS LG F ADVK V  + ISV
Sbjct  83   GRIGRNFLRCWHGRKDSPLDVIAINDSGGVKQASHLLKYDSTLGIFDADVKPVGTDGISV  142

Query  468  DGKPIKVVS  494
            DGK IKVVS
Sbjct  143  DGKIIKVVS  151



>ref|NP_001105414.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic precursor 
[Zea mays]
 sp|P09315.1|G3PA_MAIZE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Zea mays]
 gb|AAA33464.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
 emb|CAA33455.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
Length=403

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 90/128 (70%), Gaps = 6/128 (5%)
 Frame = +3

Query  126  VAEFSGLRSSGCVTFSNREASFSDVVAA----QLTPKATGAPVKGVTVAKLKVAINGFGR  293
            ++EFSGLRSS  +    R A+  D ++A          +G P +  T AKLKVAINGFGR
Sbjct  19   LSEFSGLRSSASLPM-RRNATSDDFMSAVSFRTHAVGTSGGPRRAPTEAKLKVAINGFGR  77

Query  294  IGRNFLRCWHGRKD-SPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVD  470
            IGRNFLRCWHGR D SPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  ISVD
Sbjct  78   IGRNFLRCWHGRGDASPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVD  137

Query  471  GKPIKVVS  494
            GK IKVVS
Sbjct  138  GKVIKVVS  145



>dbj|BAJ90885.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08149.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 87/126 (69%), Gaps = 6/126 (5%)
 Frame = +3

Query  132  EFSGLRSSGCVTFSNREASFSDVVAA----QLTPKATGAPVKGVTVAKLKVAINGFGRIG  299
            EFSGLRSS  +    R A+  D ++A          +G   K  T AKLKVAINGFGRIG
Sbjct  19   EFSGLRSSSSLPL-RRNATSDDFMSAVSFRTYAVSTSGGSRKAPTEAKLKVAINGFGRIG  77

Query  300  RNFLRCWHGRKDS-PLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  476
            RNFLRCWHGR DS PLEVI +ND+ GVK A+HLLKYDS LG F ADVK V +  ISVDGK
Sbjct  78   RNFLRCWHGRGDSSPLEVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGK  137

Query  477  PIKVVS  494
             IKVVS
Sbjct  138  VIKVVS  143



>gb|EMS61784.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Triticum 
urartu]
Length=365

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 87/126 (69%), Gaps = 6/126 (5%)
 Frame = +3

Query  132  EFSGLRSSGCVTFSNREASFSDVVAA----QLTPKATGAPVKGVTVAKLKVAINGFGRIG  299
            EFSGLRSS  +    R A+  D ++A          +G   K  T AKLKVAINGFGRIG
Sbjct  10   EFSGLRSSSSLPL-RRNATSDDFMSAVSFRTYAVSTSGGSRKAPTEAKLKVAINGFGRIG  68

Query  300  RNFLRCWHGRKDS-PLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  476
            RNFLRCWHGR DS PLEVI +ND+ GVK A+HLLKYDS LG F ADVK V +  ISVDGK
Sbjct  69   RNFLRCWHGRGDSSPLEVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGK  128

Query  477  PIKVVS  494
             IKVVS
Sbjct  129  VIKVVS  134



>ref|XP_009404713.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=404

 Score =   139 bits (351),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 86/126 (68%), Gaps = 4/126 (3%)
 Frame = +3

Query  129  AEFSGLRSSGCVT----FSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRI  296
            ++FSGLRS+ C        + +   S V        ++G   KG   AK+KVAINGFGRI
Sbjct  21   SDFSGLRSASCSIPLRKIHSSDDFLSTVAFRTAAESSSGGYRKGAAEAKIKVAINGFGRI  80

Query  297  GRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  476
            GRNFLRCWHGRKDSPL+V+ +ND+ G+K A+HLLKYDS LG F+ADVK      ISVDGK
Sbjct  81   GRNFLRCWHGRKDSPLDVVAINDTGGIKQASHLLKYDSTLGIFEADVKPEGQSAISVDGK  140

Query  477  PIKVVS  494
             IKVVS
Sbjct  141  VIKVVS  146



>gb|EYU35565.1| hypothetical protein MIMGU_mgv1a005886mg [Erythranthe guttata]
Length=466

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 88/126 (70%), Gaps = 4/126 (3%)
 Frame = +3

Query  129  AEFSGLRSSG-CVTF---SNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRI  296
            +EFSGLRSS   + F   +N  A F   V+ Q +        K V  AKLKVAINGFGRI
Sbjct  83   SEFSGLRSSSSALPFGKRANSNADFVSFVSFQTSLVGGEKNQKVVVEAKLKVAINGFGRI  142

Query  297  GRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  476
            GRNFLRCWHGRKDSPL+VI +ND+ GVK AAHLLKYDS LG F A VK V  + ISVDGK
Sbjct  143  GRNFLRCWHGRKDSPLDVIAINDTGGVKQAAHLLKYDSTLGIFDAVVKPVGTDAISVDGK  202

Query  477  PIKVVS  494
             I+VVS
Sbjct  203  IIQVVS  208



>emb|CAA30152.1| GADPH (383 AA) [Zea mays]
Length=383

 Score =   139 bits (350),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 88/126 (70%), Gaps = 6/126 (5%)
 Frame = +3

Query  132  EFSGLRSSGCVTFSNREASFSDVVAA----QLTPKATGAPVKGVTVAKLKVAINGFGRIG  299
            EFSGLRSS  +    R A+  D ++A          +G P +  T AKLKVAINGFGRIG
Sbjct  1    EFSGLRSSASLPM-RRNATSDDFMSAVSFRTHAVGTSGGPRRAPTEAKLKVAINGFGRIG  59

Query  300  RNFLRCWHGRKD-SPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  476
            RNFLRCWHGR D SPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  ISVDGK
Sbjct  60   RNFLRCWHGRGDASPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGK  119

Query  477  PIKVVS  494
             IKVVS
Sbjct  120  VIKVVS  125



>gb|AHZ94971.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Lilium regale]
Length=344

 Score =   138 bits (348),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +3

Query  243  KGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGT  422
            KG   AK+KVAINGFGRIGRNFLRCWHGRKDSPLE+I +ND+ GVK A+HLLKYDS LG 
Sbjct  3    KGPAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLEIIAINDTGGVKQASHLLKYDSTLGI  62

Query  423  FKADVKVVDNETISVDGKPIKVVS  494
            F ADVK V ++ ISVDGKPI+VVS
Sbjct  63   FGADVKAVGDDVISVDGKPIQVVS  86



>ref|XP_006652372.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X1 [Oryza brachyantha]
Length=403

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 90/131 (69%), Gaps = 6/131 (5%)
 Frame = +3

Query  117  RLEVAEFSGLRSSGCVTFSNREASFSDVVAA----QLTPKATGAPVKGVTVAKLKVAING  284
            R  ++EFSGLRSS  +    R A+  D ++A          +G   +  T AKLKVAING
Sbjct  16   RGGLSEFSGLRSSASLPL-RRNANSDDFMSAVSFRTHAVGTSGGARRAPTEAKLKVAING  74

Query  285  FGRIGRNFLRCWHGRKDS-PLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETI  461
            FGRIGRNFLRCWHGR DS PLEVI +ND+ GVK A+HLLKYDS LG F ADVK V +  I
Sbjct  75   FGRIGRNFLRCWHGRGDSSPLEVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAI  134

Query  462  SVDGKPIKVVS  494
            SVDGK IKVVS
Sbjct  135  SVDGKVIKVVS  145



>ref|XP_006652373.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Oryza brachyantha]
Length=401

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 89/128 (70%), Gaps = 6/128 (5%)
 Frame = +3

Query  126  VAEFSGLRSSGCVTFSNREASFSDVVAA----QLTPKATGAPVKGVTVAKLKVAINGFGR  293
            ++EFSGLRSS  +    R A+  D ++A          +G   +  T AKLKVAINGFGR
Sbjct  17   LSEFSGLRSSASLPL-RRNANSDDFMSAVSFRTHAVGTSGGARRAPTEAKLKVAINGFGR  75

Query  294  IGRNFLRCWHGRKDS-PLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVD  470
            IGRNFLRCWHGR DS PLEVI +ND+ GVK A+HLLKYDS LG F ADVK V +  ISVD
Sbjct  76   IGRNFLRCWHGRGDSSPLEVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVD  135

Query  471  GKPIKVVS  494
            GK IKVVS
Sbjct  136  GKVIKVVS  143



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552737873190