BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF008L16

Length=623
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006357074.1|  PREDICTED: conserved oligomeric Golgi comple...    258   2e-77   Solanum tuberosum [potatoes]
ref|XP_004244508.1|  PREDICTED: conserved oligomeric Golgi comple...    257   3e-77   Solanum lycopersicum
ref|XP_009769044.1|  PREDICTED: conserved oligomeric Golgi comple...    257   3e-77   Nicotiana sylvestris
ref|XP_009602477.1|  PREDICTED: conserved oligomeric Golgi comple...    257   4e-77   Nicotiana tomentosiformis
ref|XP_011083848.1|  PREDICTED: conserved oligomeric Golgi comple...    243   7e-72   Sesamum indicum [beniseed]
gb|EYU23123.1|  hypothetical protein MIMGU_mgv1a001829mg                238   4e-70   Erythranthe guttata [common monkey flower]
emb|CDP04651.1|  unnamed protein product                                234   2e-68   Coffea canephora [robusta coffee]
ref|XP_007155537.1|  hypothetical protein PHAVU_003G210200g             232   1e-67   Phaseolus vulgaris [French bean]
ref|XP_008374256.1|  PREDICTED: conserved oligomeric Golgi comple...    231   3e-67   Malus domestica [apple tree]
ref|XP_010105239.1|  Conserved oligomeric Golgi complex subunit 2       229   5e-67   
ref|XP_003549849.1|  PREDICTED: conserved oligomeric Golgi comple...    229   1e-66   Glycine max [soybeans]
ref|XP_003525701.1|  PREDICTED: conserved oligomeric Golgi comple...    228   2e-66   Glycine max [soybeans]
ref|XP_009375225.1|  PREDICTED: conserved oligomeric Golgi comple...    228   3e-66   Pyrus x bretschneideri [bai li]
ref|XP_007210583.1|  hypothetical protein PRUPE_ppa015080mg             226   7e-66   
ref|XP_008239451.1|  PREDICTED: conserved oligomeric Golgi comple...    226   1e-65   Prunus mume [ume]
ref|XP_009359449.1|  PREDICTED: conserved oligomeric Golgi comple...    226   1e-65   Pyrus x bretschneideri [bai li]
ref|XP_004164803.1|  PREDICTED: conserved oligomeric Golgi comple...    221   3e-65   
ref|XP_008463108.1|  PREDICTED: conserved oligomeric Golgi comple...    224   9e-65   
ref|XP_004297537.1|  PREDICTED: conserved oligomeric Golgi comple...    223   4e-64   Fragaria vesca subsp. vesca
ref|XP_008351743.1|  PREDICTED: conserved oligomeric Golgi comple...    221   9e-64   
ref|XP_008392829.1|  PREDICTED: conserved oligomeric Golgi comple...    221   9e-64   
ref|XP_004138387.1|  PREDICTED: conserved oligomeric Golgi comple...    221   9e-64   Cucumis sativus [cucumbers]
ref|XP_002511204.1|  Conserved oligomeric Golgi complex component...    221   1e-63   Ricinus communis
ref|XP_004515820.1|  PREDICTED: conserved oligomeric Golgi comple...    220   2e-63   Cicer arietinum [garbanzo]
gb|KDP30933.1|  hypothetical protein JCGZ_11309                         220   3e-63   Jatropha curcas
ref|XP_010677897.1|  PREDICTED: conserved oligomeric Golgi comple...    219   4e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007023398.1|  Golgi organization, COG2 isoform 3                 214   7e-63   
ref|XP_007023399.1|  Golgi organization, COG2 isoform 4                 214   1e-62   
ref|XP_010250762.1|  PREDICTED: conserved oligomeric Golgi comple...    216   8e-62   Nelumbo nucifera [Indian lotus]
ref|XP_007023397.1|  Golgi organization, COG2 isoform 2                 215   8e-62   
ref|XP_007023396.1|  Golgi organization, COG2 isoform 1                 215   2e-61   
gb|EPS73270.1|  hypothetical protein M569_01480                         214   3e-61   Genlisea aurea
gb|KDO52635.1|  hypothetical protein CISIN_1g004390mg                   211   5e-61   Citrus sinensis [apfelsine]
ref|XP_002318717.1|  hypothetical protein POPTR_0012s09800g             214   5e-61   Populus trichocarpa [western balsam poplar]
ref|XP_010026579.1|  PREDICTED: conserved oligomeric Golgi comple...    213   8e-61   Eucalyptus grandis [rose gum]
ref|XP_003608845.1|  Conserved oligomeric Golgi complex subunit         211   9e-61   
ref|XP_010026586.1|  PREDICTED: conserved oligomeric Golgi comple...    213   1e-60   Eucalyptus grandis [rose gum]
ref|XP_003608844.1|  Conserved oligomeric Golgi complex subunit         212   2e-60   Medicago truncatula
ref|XP_011044173.1|  PREDICTED: conserved oligomeric Golgi comple...    212   2e-60   Populus euphratica
ref|XP_006440092.1|  hypothetical protein CICLE_v10018979mg             211   3e-60   Citrus clementina [clementine]
ref|XP_006477014.1|  PREDICTED: conserved oligomeric Golgi comple...    211   3e-60   Citrus sinensis [apfelsine]
gb|KDO52629.1|  hypothetical protein CISIN_1g004390mg                   211   3e-60   Citrus sinensis [apfelsine]
gb|KDO52630.1|  hypothetical protein CISIN_1g004390mg                   211   4e-60   Citrus sinensis [apfelsine]
emb|CAN71854.1|  hypothetical protein VITISV_007347                     211   5e-60   Vitis vinifera
ref|XP_002279916.1|  PREDICTED: conserved oligomeric Golgi comple...    211   5e-60   Vitis vinifera
ref|XP_006283181.1|  hypothetical protein CARUB_v10004211mg             211   7e-60   Capsella rubella
gb|KJB43171.1|  hypothetical protein B456_007G187600                    206   4e-58   Gossypium raimondii
ref|XP_010536632.1|  PREDICTED: conserved oligomeric Golgi comple...    206   4e-58   Tarenaya hassleriana [spider flower]
ref|XP_002322242.1|  hypothetical protein POPTR_0015s10610g             206   4e-58   Populus trichocarpa [western balsam poplar]
gb|KHG07418.1|  Conserved oligomeric Golgi complex subunit 2            205   5e-58   Gossypium arboreum [tree cotton]
gb|KJB43167.1|  hypothetical protein B456_007G187600                    205   6e-58   Gossypium raimondii
ref|XP_011024042.1|  PREDICTED: conserved oligomeric Golgi comple...    204   2e-57   Populus euphratica
ref|XP_008794572.1|  PREDICTED: conserved oligomeric Golgi comple...    203   2e-57   Phoenix dactylifera
gb|EYU23122.1|  hypothetical protein MIMGU_mgv1a024704mg                201   1e-56   Erythranthe guttata [common monkey flower]
ref|XP_010927713.1|  PREDICTED: conserved oligomeric Golgi comple...    200   5e-56   Elaeis guineensis
emb|CAB41124.1|  brefeldin A-sensitive Golgi protein-like               199   6e-56   Arabidopsis thaliana [mouse-ear cress]
gb|KFK29022.1|  hypothetical protein AALP_AA7G078500                    199   7e-56   Arabis alpina [alpine rockcress]
gb|AAK32887.1|AF367300_1  AT4g24840/F6I7_50                             199   7e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010926721.1|  PREDICTED: conserved oligomeric Golgi comple...    198   8e-56   
ref|NP_567710.1|  uncharacterized protein                               199   9e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433717.1|  PREDICTED: conserved oligomeric Golgi comple...    199   1e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010926719.1|  PREDICTED: conserved oligomeric Golgi comple...    198   2e-55   Elaeis guineensis
ref|XP_002867640.1|  hypothetical protein ARALYDRAFT_492352             198   2e-55   
ref|XP_009137478.1|  PREDICTED: conserved oligomeric Golgi comple...    198   2e-55   Brassica rapa
emb|CDX92658.1|  BnaC07g39160D                                          198   2e-55   
ref|XP_010438959.1|  PREDICTED: conserved oligomeric Golgi comple...    196   7e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010448510.1|  PREDICTED: conserved oligomeric Golgi comple...    196   9e-55   Camelina sativa [gold-of-pleasure]
emb|CDY11039.1|  BnaA03g46980D                                          196   9e-55   Brassica napus [oilseed rape]
ref|XP_006413377.1|  hypothetical protein EUTSA_v10024490mg             194   4e-54   Eutrema salsugineum [saltwater cress]
ref|XP_009385490.1|  PREDICTED: conserved oligomeric Golgi comple...    194   6e-54   
ref|XP_009385489.1|  PREDICTED: conserved oligomeric Golgi comple...    194   8e-54   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY03412.1|  BnaC01g16700D                                          192   4e-53   
emb|CDY34317.1|  BnaA01g14200D                                          191   4e-53   Brassica napus [oilseed rape]
ref|XP_010485902.1|  PREDICTED: conserved oligomeric Golgi comple...    191   5e-53   Camelina sativa [gold-of-pleasure]
gb|KHN34411.1|  Conserved oligomeric Golgi complex subunit 2            190   2e-52   Glycine soja [wild soybean]
ref|XP_006296685.1|  hypothetical protein CARUB_v10013037mg             190   2e-52   Capsella rubella
ref|XP_009138596.1|  PREDICTED: conserved oligomeric Golgi comple...    187   2e-51   Brassica rapa
ref|XP_010464008.1|  PREDICTED: conserved oligomeric Golgi comple...    187   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_006848427.1|  hypothetical protein AMTR_s00013p00234340          182   2e-49   
emb|CDY51233.1|  BnaA03g07050D                                          174   7e-47   Brassica napus [oilseed rape]
ref|XP_009131654.1|  PREDICTED: conserved oligomeric Golgi comple...    165   7e-44   Brassica rapa
emb|CDX70811.1|  BnaC03g08950D                                          164   1e-43   
ref|NP_001051898.1|  Os03g0849600                                       159   3e-41   
ref|XP_001761415.1|  predicted protein                                  152   3e-39   
gb|EEC76534.1|  hypothetical protein OsI_14326                          152   7e-39   Oryza sativa Indica Group [Indian rice]
dbj|BAK01513.1|  predicted protein                                      149   5e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002966110.1|  hypothetical protein SELMODRAFT_86129              148   1e-37   Selaginella moellendorffii
ref|XP_002982190.1|  hypothetical protein SELMODRAFT_115746             148   1e-37   Selaginella moellendorffii
ref|XP_001764075.1|  predicted protein                                  146   1e-36   
ref|XP_004981048.1|  PREDICTED: conserved oligomeric Golgi comple...    142   2e-35   Setaria italica
ref|NP_001169749.1|  uncharacterized protein LOC100383630               137   4e-34   
tpg|DAA52497.1|  TPA: hypothetical protein ZEAMMB73_788308              137   1e-33   
ref|XP_008645319.1|  PREDICTED: uncharacterized protein LOC100383...    137   2e-33   
ref|XP_002463519.1|  hypothetical protein SORBIDRAFT_01g001270          135   5e-33   Sorghum bicolor [broomcorn]
ref|XP_008644331.1|  PREDICTED: conserved oligomeric Golgi comple...    129   6e-31   
ref|XP_003562360.1|  PREDICTED: conserved oligomeric Golgi comple...    129   8e-31   Brachypodium distachyon [annual false brome]
ref|XP_005644140.1|  hypothetical protein COCSUDRAFT_48790              129   1e-30   Coccomyxa subellipsoidea C-169
ref|XP_002947088.1|  component of oligomeric golgi complex 2            129   1e-30   Volvox carteri f. nagariensis
ref|XP_001695227.1|  component of oligomeric golgi complex 2            122   1e-28   Chlamydomonas reinhardtii
gb|KEH35882.1|  oligomeric component, putative                          110   2e-26   Medicago truncatula
ref|XP_005848758.1|  hypothetical protein CHLNCDRAFT_57543              116   3e-26   Chlorella variabilis
gb|KHN14099.1|  Conserved oligomeric Golgi complex subunit 2            115   7e-26   Glycine soja [wild soybean]
ref|XP_003603203.1|  Conserved oligomeric Golgi complex subunit         110   7e-24   
ref|XP_007510910.1|  predicted protein                                93.2    5e-18   Bathycoccus prasinos
ref|XP_002969327.1|  hypothetical protein SELMODRAFT_7944             84.0    3e-17   
ref|XP_002970804.1|  hypothetical protein SELMODRAFT_7940             84.0    3e-17   
ref|XP_011431284.1|  PREDICTED: conserved oligomeric Golgi comple...  88.2    2e-16   Crassostrea gigas
ref|XP_011401872.1|  Conserved oligomeric Golgi complex subunit 2     87.4    3e-16   Auxenochlorella protothecoides
ref|XP_002158309.2|  PREDICTED: conserved oligomeric Golgi comple...  86.3    6e-16   
ref|XP_002113217.1|  hypothetical protein TRIADDRAFT_26404            84.3    3e-15   Trichoplax adhaerens
gb|KFO34216.1|  Conserved oligomeric Golgi complex subunit 2          84.0    6e-15   Fukomys damarensis [Damara mole rat]
ref|XP_010620223.1|  PREDICTED: conserved oligomeric Golgi comple...  83.2    7e-15   Fukomys damarensis [Damara mole rat]
ref|XP_004458735.1|  PREDICTED: conserved oligomeric Golgi comple...  79.0    9e-15   
ref|XP_004914700.1|  PREDICTED: conserved oligomeric Golgi comple...  82.4    1e-14   Xenopus tropicalis [western clawed frog]
ref|XP_002931527.2|  PREDICTED: conserved oligomeric Golgi comple...  82.4    1e-14   Xenopus tropicalis [western clawed frog]
ref|XP_005106374.1|  PREDICTED: conserved oligomeric Golgi comple...  82.0    2e-14   
ref|XP_010996258.1|  PREDICTED: conserved oligomeric Golgi comple...  81.6    3e-14   
ref|XP_006212446.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  81.3    4e-14   
ref|XP_007936688.1|  PREDICTED: conserved oligomeric Golgi comple...  80.9    4e-14   Orycteropus afer afer
ref|XP_003410940.1|  PREDICTED: conserved oligomeric Golgi comple...  80.9    4e-14   Loxodonta africana [African bush elephant]
ref|XP_007903669.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    4e-14   Callorhinchus milii [Australian ghost shark]
ref|XP_002613283.1|  hypothetical protein BRAFLDRAFT_113783           80.9    5e-14   Branchiostoma floridae
ref|XP_004898237.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    6e-14   
ref|XP_005405048.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    6e-14   Chinchilla lanigera
ref|XP_005405049.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    6e-14   
ref|XP_004690717.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    7e-14   
ref|XP_010852806.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    7e-14   Bison bison bison
ref|XP_002717435.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    7e-14   Oryctolagus cuniculus [domestic rabbit]
ref|XP_002809356.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    7e-14   
ref|XP_005226618.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    7e-14   Bos taurus [bovine]
ref|XP_004372879.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    7e-14   Trichechus manatus latirostris
ref|XP_010852805.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    7e-14   Bison bison bison
ref|NP_001070307.2|  conserved oligomeric Golgi complex subunit 2     80.5    7e-14   Bos taurus [bovine]
ref|XP_003993981.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    7e-14   Felis catus [cat]
ref|NP_001138508.1|  conserved oligomeric Golgi complex subunit 2...  80.1    7e-14   Homo sapiens [man]
ref|XP_001148147.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    7e-14   Pan troglodytes
ref|XP_006937851.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    8e-14   Felis catus [cat]
ref|XP_009439912.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    8e-14   Pan troglodytes
ref|NP_031383.1|  conserved oligomeric Golgi complex subunit 2 is...  80.1    8e-14   Homo sapiens [man]
ref|XP_008687757.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    8e-14   Ursus maritimus [white bear]
ref|XP_003791030.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    8e-14   Otolemur garnettii
ref|XP_004426945.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    8e-14   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_007903668.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    8e-14   Callorhinchus milii [Australian ghost shark]
ref|XP_004028611.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    8e-14   
ref|XP_010372342.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    8e-14   
ref|XP_008687758.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    8e-14   Ursus maritimus [white bear]
ref|XP_010372341.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    9e-14   Rhinopithecus roxellana
ref|XP_002927656.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    9e-14   Ailuropoda melanoleuca
ref|XP_004404911.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    9e-14   Odobenus rosmarus divergens
ref|XP_011233523.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    9e-14   Ailuropoda melanoleuca
ref|XP_006888781.1|  PREDICTED: conserved oligomeric Golgi comple...  79.7    1e-13   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_002760957.1|  PREDICTED: conserved oligomeric Golgi comple...  79.7    1e-13   Callithrix jacchus [common marmoset]
ref|XP_008984063.1|  PREDICTED: conserved oligomeric Golgi comple...  79.7    1e-13   Callithrix jacchus [common marmoset]
gb|EDL96730.1|  rCG50865, isoform CRA_a                               75.9    1e-13   Rattus norvegicus [brown rat]
ref|XP_004342492.2|  hypothetical protein CAOG_08237                  79.7    1e-13   Capsaspora owczarzaki ATCC 30864
ref|XP_003893831.1|  PREDICTED: conserved oligomeric Golgi comple...  79.7    1e-13   
ref|XP_005539861.1|  PREDICTED: conserved oligomeric Golgi comple...  79.7    1e-13   
ref|XP_003940815.1|  PREDICTED: conserved oligomeric Golgi comple...  79.7    1e-13   Saimiri boliviensis boliviensis
ref|XP_002808309.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  79.7    1e-13   Macaca mulatta [rhesus macaque]
ref|XP_007450662.1|  PREDICTED: conserved oligomeric Golgi comple...  79.7    1e-13   Lipotes vexillifer [baiji]
ref|XP_007450661.1|  PREDICTED: conserved oligomeric Golgi comple...  79.7    1e-13   Lipotes vexillifer [baiji]
ref|XP_004659682.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    1e-13   Jaculus jaculus
ref|XP_005320438.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    1e-13   Ictidomys tridecemlineatus
ref|XP_004310291.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    1e-13   
ref|XP_004640875.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    2e-13   Octodon degus
ref|XP_004640874.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    2e-13   Octodon degus
ref|XP_006065100.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    2e-13   Bubalus bubalis [domestic water buffalo]
ref|XP_006065101.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    2e-13   Bubalus bubalis [domestic water buffalo]
ref|XP_005958562.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    2e-13   
ref|XP_001497419.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    2e-13   Equus caballus [domestic horse]
ref|XP_005602674.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    2e-13   
ref|XP_005602673.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    2e-13   Equus caballus [domestic horse]
ref|XP_005958561.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    2e-13   
ref|XP_008844006.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    2e-13   Nannospalax galili
ref|XP_004281614.1|  PREDICTED: conserved oligomeric Golgi comple...  79.0    2e-13   Orcinus orca [Orca]
ref|XP_006146049.1|  PREDICTED: conserved oligomeric Golgi comple...  79.0    2e-13   Tupaia chinensis
ref|XP_005291293.1|  PREDICTED: conserved oligomeric Golgi comple...  79.0    2e-13   Chrysemys picta bellii
ref|XP_006106578.1|  PREDICTED: conserved oligomeric Golgi comple...  78.6    3e-13   Myotis lucifugus
ref|XP_010705329.1|  PREDICTED: conserved oligomeric Golgi comple...  78.6    3e-13   Meleagris gallopavo [common turkey]
ref|XP_419583.2|  PREDICTED: conserved oligomeric Golgi complex s...  78.6    3e-13   Gallus gallus [bantam]
ref|XP_004935546.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    3e-13   
ref|XP_005906657.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    3e-13   Bos mutus
gb|ELR48452.1|  Conserved oligomeric Golgi complex subunit 2          78.2    4e-13   Bos mutus
ref|XP_007987957.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    4e-13   Chlorocebus sabaeus
ref|XP_005699448.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  78.2    4e-13   
ref|XP_008156867.1|  PREDICTED: conserved oligomeric Golgi comple...  75.9    4e-13   
ref|XP_004021628.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  77.8    4e-13   
ref|XP_006255878.1|  PREDICTED: conserved oligomeric Golgi comple...  77.8    5e-13   Rattus norvegicus [brown rat]
ref|XP_007086077.1|  PREDICTED: conserved oligomeric Golgi comple...  77.8    5e-13   Panthera tigris altaica
ref|XP_010887016.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    6e-13   Esox lucius
ref|XP_546096.2|  PREDICTED: conserved oligomeric Golgi complex s...  77.4    6e-13   
gb|ERE80256.1|  conserved oligomeric Golgi complex subunit 2          77.4    6e-13   Cricetulus griseus [Chinese hamsters]
ref|XP_003496865.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    6e-13   Cricetulus griseus [Chinese hamsters]
ref|XP_006531536.1|  PREDICTED: conserved oligomeric Golgi comple...  77.0    6e-13   
ref|NP_001103964.1|  conserved oligomeric Golgi complex subunit 2     77.4    6e-13   Rattus norvegicus [brown rat]
dbj|BAE34057.1|  unnamed protein product                              77.0    7e-13   Mus musculus [mouse]
dbj|BAC40996.1|  unnamed protein product                              77.0    8e-13   Mus musculus [mouse]
ref|NP_084022.2|  conserved oligomeric Golgi complex subunit 2        77.0    8e-13   Mus musculus [mouse]
ref|XP_004619081.1|  PREDICTED: conserved oligomeric Golgi comple...  77.0    8e-13   Sorex araneus [Eurasian shrew]
gb|AAH11435.1|  Component of oligomeric golgi complex 2               77.0    8e-13   Mus musculus [mouse]
dbj|BAE42634.1|  unnamed protein product                              77.0    8e-13   Mus musculus [mouse]
gb|EDL11770.1|  component of oligomeric golgi complex 2               77.0    8e-13   Mus musculus [mouse]
ref|XP_010741537.1|  PREDICTED: conserved oligomeric Golgi comple...  77.0    9e-13   
ref|XP_005064728.1|  PREDICTED: conserved oligomeric Golgi comple...  77.0    1e-12   Mesocricetus auratus [Syrian golden hamster]
ref|XP_006992872.1|  PREDICTED: conserved oligomeric Golgi comple...  77.0    1e-12   Peromyscus maniculatus bairdii
ref|XP_004077119.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  76.6    1e-12   
ref|XP_007127671.1|  PREDICTED: conserved oligomeric Golgi comple...  76.6    1e-12   
ref|XP_007173849.1|  PREDICTED: conserved oligomeric Golgi comple...  76.6    1e-12   Balaenoptera acutorostrata scammoni
gb|EFB20161.1|  hypothetical protein PANDA_017452                     76.6    1e-12   Ailuropoda melanoleuca
ref|XP_005005280.1|  PREDICTED: conserved oligomeric Golgi comple...  76.6    1e-12   
ref|XP_008319780.1|  PREDICTED: conserved oligomeric Golgi comple...  76.3    1e-12   
ref|XP_005539862.1|  PREDICTED: conserved oligomeric Golgi comple...  76.6    1e-12   Macaca fascicularis [crab eating macaque]
ref|XP_003473537.1|  PREDICTED: conserved oligomeric Golgi comple...  76.6    1e-12   
ref|XP_010196213.1|  PREDICTED: conserved oligomeric Golgi comple...  76.6    1e-12   Colius striatus
ref|XP_010196214.1|  PREDICTED: conserved oligomeric Golgi comple...  76.6    1e-12   Colius striatus
ref|NP_998519.1|  conserved oligomeric Golgi complex subunit 2        76.6    1e-12   Danio rerio [leopard danio]
ref|XP_005539859.1|  PREDICTED: conserved oligomeric Golgi comple...  76.6    1e-12   Macaca fascicularis [crab eating macaque]
ref|XP_005345929.1|  PREDICTED: conserved oligomeric Golgi comple...  76.6    1e-12   Microtus ochrogaster [prairie voles]
emb|CDH54966.1|  conserved oligomeric golgi complex subunit 2         75.1    1e-12   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_003767876.1|  PREDICTED: conserved oligomeric Golgi comple...  76.6    1e-12   Sarcophilus harrisii
gb|ETE65446.1|  Conserved oligomeric Golgi complex subunit 2          76.3    1e-12   Ophiophagus hannah
ref|XP_006817460.1|  PREDICTED: conserved oligomeric Golgi comple...  76.3    1e-12   Saccoglossus kowalevskii
ref|XP_009055731.1|  hypothetical protein LOTGIDRAFT_232605           76.6    1e-12   Lottia gigantea
ref|XP_007256131.1|  PREDICTED: conserved oligomeric Golgi comple...  76.3    1e-12   
gb|ELK34853.1|  Conserved oligomeric Golgi complex subunit 2          76.3    1e-12   Myotis davidii
ref|XP_001369328.1|  PREDICTED: conserved oligomeric Golgi comple...  76.3    1e-12   Monodelphis domestica
ref|XP_004819666.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  76.3    1e-12   
ref|XP_007545451.1|  PREDICTED: conserved oligomeric Golgi comple...  76.3    2e-12   Poecilia formosa
ref|XP_005812226.1|  PREDICTED: conserved oligomeric Golgi comple...  76.3    2e-12   Xiphophorus maculatus
ref|XP_008427499.1|  PREDICTED: conserved oligomeric Golgi comple...  76.3    2e-12   Poecilia reticulata
emb|CDH54965.1|  conserved oligomeric golgi complex subunit 2         76.3    2e-12   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_006267974.1|  PREDICTED: conserved oligomeric Golgi comple...  75.9    2e-12   Alligator mississippiensis
ref|XP_006920806.1|  PREDICTED: conserved oligomeric Golgi comple...  75.9    2e-12   
emb|CDH54964.1|  conserved oligomeric golgi complex subunit 2         75.9    2e-12   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_004712259.1|  PREDICTED: conserved oligomeric Golgi comple...  75.9    2e-12   Echinops telfairi [lesser hedgehog tenrec]
dbj|GAN06528.1|  conserved oligomeric Golgi complex subunit 2         75.9    2e-12   Mucor ambiguus
ref|XP_007423722.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    2e-12   Python bivittatus
ref|XP_006017037.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    3e-12   Alligator sinensis
ref|XP_006017038.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    3e-12   
ref|XP_005518611.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    3e-12   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005518612.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    3e-12   
ref|XP_011379200.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    3e-12   
emb|CDQ63736.1|  unnamed protein product                              75.5    3e-12   Oncorhynchus mykiss
ref|NP_001133098.1|  conserved oligomeric Golgi complex subunit 2     75.5    3e-12   Salmo salar
ref|XP_006757736.1|  PREDICTED: conserved oligomeric Golgi comple...  75.1    3e-12   
emb|CDS10439.1|  hypothetical protein LRAMOSA03115                    75.1    3e-12   Lichtheimia ramosa
gb|ELU10240.1|  hypothetical protein CAPTEDRAFT_184924                73.9    4e-12   Capitella teleta
ref|XP_010787277.1|  PREDICTED: conserved oligomeric Golgi comple...  75.1    4e-12   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_005440304.1|  PREDICTED: conserved oligomeric Golgi comple...  75.1    4e-12   Falco cherrug
ref|XP_010560974.1|  PREDICTED: conserved oligomeric Golgi comple...  75.1    4e-12   Haliaeetus leucocephalus
ref|XP_009091144.1|  PREDICTED: conserved oligomeric Golgi comple...  75.1    4e-12   
ref|XP_010192959.1|  PREDICTED: conserved oligomeric Golgi comple...  75.1    4e-12   Mesitornis unicolor
ref|XP_005440305.1|  PREDICTED: conserved oligomeric Golgi comple...  75.1    4e-12   
ref|XP_010192960.1|  PREDICTED: conserved oligomeric Golgi comple...  74.7    4e-12   Mesitornis unicolor
ref|XP_005508687.1|  PREDICTED: conserved oligomeric Golgi comple...  74.7    4e-12   Columba livia [carrier pigeon]
ref|XP_005508688.1|  PREDICTED: conserved oligomeric Golgi comple...  74.7    4e-12   
ref|XP_005148647.1|  PREDICTED: conserved oligomeric Golgi comple...  74.7    5e-12   Melopsittacus undulatus
ref|XP_005148648.1|  PREDICTED: conserved oligomeric Golgi comple...  74.7    5e-12   
ref|XP_009565361.1|  PREDICTED: conserved oligomeric Golgi comple...  74.7    5e-12   Cuculus canorus
ref|XP_009565362.1|  PREDICTED: conserved oligomeric Golgi comple...  74.7    5e-12   Cuculus canorus
ref|XP_794127.3|  PREDICTED: conserved oligomeric Golgi complex s...  74.7    5e-12   
ref|XP_007535190.1|  PREDICTED: conserved oligomeric Golgi comple...  74.7    5e-12   Erinaceus europaeus [common hedgehog]
ref|XP_007535189.1|  PREDICTED: conserved oligomeric Golgi comple...  74.7    6e-12   Erinaceus europaeus [common hedgehog]
ref|XP_002190632.2|  PREDICTED: conserved oligomeric Golgi comple...  74.3    6e-12   
ref|XP_007535191.1|  PREDICTED: conserved oligomeric Golgi comple...  73.9    7e-12   Erinaceus europaeus [common hedgehog]
gb|ELT94120.1|  hypothetical protein CAPTEDRAFT_214095                73.9    8e-12   Capitella teleta
ref|XP_003230176.2|  PREDICTED: conserved oligomeric Golgi comple...  73.9    8e-12   Anolis carolinensis [Carolina anole]
ref|XP_010389860.1|  PREDICTED: conserved oligomeric Golgi comple...  73.9    8e-12   
gb|EMP25136.1|  Conserved oligomeric Golgi complex subunit 2          73.9    8e-12   Chelonia mydas [green seaturtle]
ref|XP_010961140.1|  PREDICTED: conserved oligomeric Golgi comple...  73.9    9e-12   Camelus bactrianus [camel]
ref|XP_005856448.1|  PREDICTED: conserved oligomeric Golgi comple...  73.9    1e-11   
ref|XP_010120051.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    1e-11   Chlamydotis macqueenii
ref|XP_008921823.1|  PREDICTED: conserved oligomeric Golgi comple...  73.6    1e-11   
ref|XP_008921822.1|  PREDICTED: conserved oligomeric Golgi comple...  73.6    1e-11   
ref|XP_010219183.1|  PREDICTED: conserved oligomeric Golgi comple...  73.6    1e-11   Tinamus guttatus
ref|XP_005994007.1|  PREDICTED: conserved oligomeric Golgi comple...  73.6    1e-11   
ref|XP_005020290.1|  PREDICTED: conserved oligomeric Golgi comple...  73.6    1e-11   
gb|EOB00851.1|  Conserved oligomeric Golgi complex subunit 2          73.6    1e-11   Anas platyrhynchos [duck]
ref|XP_006122076.1|  PREDICTED: conserved oligomeric Golgi comple...  73.6    1e-11   
ref|XP_005994005.1|  PREDICTED: conserved oligomeric Golgi comple...  73.6    1e-11   
ref|XP_009583051.1|  PREDICTED: conserved oligomeric Golgi comple...  71.6    1e-11   
ref|XP_009697273.1|  PREDICTED: conserved oligomeric Golgi comple...  73.2    2e-11   
ref|XP_009921343.1|  PREDICTED: conserved oligomeric Golgi comple...  73.2    2e-11   
gb|KFP64444.1|  Conserved oligomeric Golgi complex subunit 2          73.2    2e-11   
ref|XP_009904610.1|  PREDICTED: conserved oligomeric Golgi comple...  73.2    2e-11   
ref|XP_001176329.1|  PREDICTED: conserved oligomeric Golgi comple...  70.1    2e-11   
gb|KFQ34940.1|  Conserved oligomeric Golgi complex subunit 2          72.8    2e-11   
ref|XP_003438334.1|  PREDICTED: conserved oligomeric Golgi comple...  72.8    2e-11   
ref|XP_003963810.1|  PREDICTED: conserved oligomeric Golgi comple...  72.8    2e-11   
ref|XP_009642480.1|  PREDICTED: conserved oligomeric Golgi comple...  72.8    2e-11   
ref|XP_008944103.1|  PREDICTED: conserved oligomeric Golgi comple...  72.8    2e-11   
ref|XP_005658376.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    2e-11   
ref|XP_010285455.1|  PREDICTED: conserved oligomeric Golgi comple...  72.0    2e-11   
gb|KFW03254.1|  Conserved oligomeric Golgi complex subunit 2          72.8    2e-11   
ref|XP_006783764.1|  PREDICTED: conserved oligomeric Golgi comple...  72.8    2e-11   
ref|XP_005914260.1|  PREDICTED: conserved oligomeric Golgi comple...  72.8    2e-11   
ref|XP_005491190.1|  PREDICTED: conserved oligomeric Golgi comple...  72.8    2e-11   
ref|XP_009870043.1|  PREDICTED: conserved oligomeric Golgi comple...  72.8    2e-11   
gb|KFP90068.1|  Conserved oligomeric Golgi complex subunit 2          72.8    2e-11   
ref|XP_008289216.1|  PREDICTED: conserved oligomeric Golgi comple...  72.4    2e-11   
gb|KFQ83089.1|  Conserved oligomeric Golgi complex subunit 2          72.4    2e-11   
ref|XP_009889458.1|  PREDICTED: conserved oligomeric Golgi comple...  72.4    2e-11   
gb|KFP99616.1|  Conserved oligomeric Golgi complex subunit 2          72.0    2e-11   
ref|XP_009076851.1|  PREDICTED: conserved oligomeric Golgi comple...  70.1    3e-11   
dbj|BAB28112.1|  unnamed protein product                              68.2    3e-11   
ref|XP_009936334.1|  PREDICTED: conserved oligomeric Golgi comple...  72.8    3e-11   
ref|XP_009490364.1|  PREDICTED: conserved oligomeric Golgi comple...  72.4    3e-11   
gb|KFQ57781.1|  Conserved oligomeric Golgi complex subunit 2          72.4    3e-11   
gb|KFR13493.1|  Conserved oligomeric Golgi complex subunit 2          72.4    3e-11   
ref|XP_002501700.1|  predicted protein                                72.4    3e-11   
gb|KFV53940.1|  Conserved oligomeric Golgi complex subunit 2          72.0    3e-11   
gb|KFP94737.1|  Conserved oligomeric Golgi complex subunit 2          72.4    3e-11   
gb|KFO15367.1|  Conserved oligomeric Golgi complex subunit 2          72.4    3e-11   
ref|XP_009967210.1|  PREDICTED: conserved oligomeric Golgi comple...  72.0    3e-11   
ref|XP_010309769.1|  PREDICTED: conserved oligomeric Golgi comple...  72.4    3e-11   
gb|KFO92943.1|  Conserved oligomeric Golgi complex subunit 2          72.0    3e-11   
ref|XP_010139618.1|  PREDICTED: conserved oligomeric Golgi comple...  72.0    3e-11   
gb|KFZ60054.1|  Conserved oligomeric Golgi complex subunit 2          72.0    3e-11   
gb|KFW70739.1|  Conserved oligomeric Golgi complex subunit 2          72.0    3e-11   
gb|KFP20406.1|  Conserved oligomeric Golgi complex subunit 2          72.0    3e-11   
ref|XP_005239169.1|  PREDICTED: conserved oligomeric Golgi comple...  72.0    3e-11   
ref|XP_010147792.1|  PREDICTED: conserved oligomeric Golgi comple...  72.0    3e-11   
ref|XP_005423302.1|  PREDICTED: conserved oligomeric Golgi comple...  72.0    3e-11   
ref|XP_010002540.1|  PREDICTED: conserved oligomeric Golgi comple...  72.0    3e-11   
gb|KFU94611.1|  Conserved oligomeric Golgi complex subunit 2          72.0    3e-11   
ref|XP_009499491.1|  PREDICTED: conserved oligomeric Golgi comple...  72.0    4e-11   
gb|KFW89140.1|  Conserved oligomeric Golgi complex subunit 2          72.0    4e-11   
ref|XP_009327513.1|  PREDICTED: conserved oligomeric Golgi comple...  72.0    4e-11   
ref|XP_009469603.1|  PREDICTED: conserved oligomeric Golgi comple...  72.0    4e-11   
gb|KFQ91617.1|  Conserved oligomeric Golgi complex subunit 2          72.0    4e-11   
gb|KFM09209.1|  Conserved oligomeric Golgi complex subunit 2          72.0    4e-11   
gb|EXX78374.1|  hypothetical protein RirG_015560                      72.0    4e-11   
ref|XP_005727467.1|  PREDICTED: conserved oligomeric Golgi comple...  72.0    4e-11   
ref|XP_004551557.1|  PREDICTED: conserved oligomeric Golgi comple...  72.0    4e-11   
ref|XP_005043524.1|  PREDICTED: conserved oligomeric Golgi comple...  72.0    4e-11   
ref|XP_007662934.1|  PREDICTED: conserved oligomeric Golgi comple...  71.6    5e-11   
ref|XP_005833841.1|  component of oligomeric golgi complex 2          71.6    5e-11   
ref|XP_010019366.1|  PREDICTED: conserved oligomeric Golgi comple...  71.6    5e-11   
gb|KFQ55583.1|  Conserved oligomeric Golgi complex subunit 2          71.2    6e-11   
ref|XP_005833842.1|  hypothetical protein GUITHDRAFT_137858           71.6    6e-11   
gb|KFH70203.1|  hypothetical protein MVEG_05005                       71.2    6e-11   
ref|XP_008641602.1|  PREDICTED: conserved oligomeric Golgi comple...  71.2    7e-11   
ref|XP_009811854.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    8e-11   
gb|KFV39876.1|  Conserved oligomeric Golgi complex subunit 2          70.9    8e-11   
gb|KGL81598.1|  Conserved oligomeric Golgi complex subunit 2          70.9    8e-11   
gb|KFO53927.1|  Conserved oligomeric Golgi complex subunit 2          70.9    8e-11   
ref|XP_002994388.1|  hypothetical protein SELMODRAFT_138550           65.5    8e-11   
gb|KFV07773.1|  Conserved oligomeric Golgi complex subunit 2          70.9    8e-11   
ref|XP_010072831.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    8e-11   
gb|KGL98152.1|  Conserved oligomeric Golgi complex subunit 2          70.9    8e-11   
ref|XP_002991260.1|  hypothetical protein SELMODRAFT_133213           65.1    1e-10   
gb|KFW80703.1|  Conserved oligomeric Golgi complex subunit 2          70.5    1e-10   
emb|CEI90864.1|  hypothetical protein RMCBS344292_05174               70.1    1e-10   
ref|XP_003062630.1|  predicted protein                                70.5    1e-10   
emb|CBY15298.1|  unnamed protein product                              70.1    1e-10   
ref|XP_009952277.1|  PREDICTED: conserved oligomeric Golgi comple...  69.7    2e-10   
ref|XP_010168389.1|  PREDICTED: conserved oligomeric Golgi comple...  69.7    2e-10   
gb|KFZ60236.1|  Conserved oligomeric Golgi complex subunit 2          69.7    2e-10   
ref|XP_001746771.1|  hypothetical protein                             69.3    2e-10   
gb|KFV73661.1|  Conserved oligomeric Golgi complex subunit 2          69.3    3e-10   
ref|XP_009280091.1|  PREDICTED: conserved oligomeric Golgi comple...  69.3    3e-10   
ref|XP_009679359.1|  PREDICTED: conserved oligomeric Golgi comple...  68.9    3e-10   
emb|CDS32998.1|  oligomeric Golgi complex subunit 2                   68.6    5e-10   
ref|XP_001640558.1|  predicted protein                                68.6    5e-10   
gb|KIK99406.1|  hypothetical protein PAXRUDRAFT_822754                68.6    5e-10   
ref|XP_011065546.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    6e-10   
ref|XP_005727466.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    7e-10   
ref|XP_007006688.1|  hypothetical protein TREMEDRAFT_33755            67.4    1e-09   
gb|EPB84205.1|  hypothetical protein HMPREF1544_08997                 67.4    1e-09   
emb|CEI93171.1|  hypothetical protein RMCBS344292_07411               67.0    1e-09   
ref|XP_011310005.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    1e-09   
gb|EZA51235.1|  Conserved oligomeric Golgi complex subunit            67.0    2e-09   
ref|XP_011343716.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    2e-09   
gb|KDD72303.1|  hypothetical protein H632_c3541p0                     62.4    2e-09   
emb|CAG10093.1|  unnamed protein product                              66.2    3e-09   
ref|XP_002402131.1|  conserved oligomeric golgi complex subunit, ...  66.2    3e-09   
ref|XP_006183788.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    3e-09   
emb|CBN77515.1|  weakly similar to brefeldin A-sensitive Golgi pr...  65.9    4e-09   
ref|XP_002055957.1|  GJ10669                                          65.5    5e-09   
ref|XP_011265596.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    5e-09   
ref|XP_011404805.1|  PREDICTED: conserved oligomeric Golgi comple...  65.1    5e-09   
ref|XP_004028612.1|  PREDICTED: conserved oligomeric Golgi comple...  65.1    6e-09   
dbj|BAH12018.1|  unnamed protein product                              65.1    6e-09   
ref|XP_003267296.1|  PREDICTED: conserved oligomeric Golgi comple...  65.1    6e-09   
ref|XP_008072546.1|  PREDICTED: conserved oligomeric Golgi comple...  65.1    7e-09   
ref|XP_008589656.1|  PREDICTED: conserved oligomeric Golgi comple...  64.7    8e-09   
gb|EFX66827.1|  hypothetical protein DAPPUDRAFT_331703                64.7    8e-09   
ref|XP_005226619.1|  PREDICTED: conserved oligomeric Golgi comple...  64.7    9e-09   
ref|XP_002999266.1|  conserved oligomeric Golgi complex subunit, ...  64.3    1e-08   
ref|XP_002132051.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    1e-08   
emb|CEG65576.1|  hypothetical protein RMATCC62417_02333               63.9    1e-08   
ref|XP_006065102.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    2e-08   
gb|ETP19166.1|  hypothetical protein F441_06722                       63.9    2e-08   
gb|ETK89268.1|  hypothetical protein L915_06592                       63.9    2e-08   
gb|ETI49393.1|  hypothetical protein F443_06719                       63.9    2e-08   
gb|ETP47094.1|  hypothetical protein F442_06755                       63.9    2e-08   
gb|ETO78126.1|  hypothetical protein F444_06786                       63.9    2e-08   
ref|XP_007071120.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    2e-08   
ref|XP_011169059.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    2e-08   
ref|XP_008892343.1|  hypothetical protein PPTG_02808                  63.2    2e-08   
gb|ETL95872.1|  hypothetical protein L917_06400                       63.2    2e-08   
ref|XP_001604062.2|  PREDICTED: conserved oligomeric Golgi comple...  63.2    3e-08   
gb|KIY73086.1|  COG complex component                                 62.8    3e-08   
ref|XP_011505049.1|  PREDICTED: conserved oligomeric Golgi comple...  62.8    4e-08   
ref|XP_007327986.1|  hypothetical protein AGABI1DRAFT_36770           62.4    5e-08   
ref|XP_006461130.1|  hypothetical protein AGABI2DRAFT_68876           62.4    5e-08   
emb|CDR01100.1|  unnamed protein product                              58.2    6e-08   
gb|EUB58416.1|  Conserved oligomeric Golgi complex subunit 2          62.0    6e-08   
emb|CCO27036.1|  Conserved oligomeric Golgi complex subunit 2 Sho...  61.2    1e-07   
ref|XP_003700579.1|  PREDICTED: conserved oligomeric Golgi comple...  61.2    1e-07   
ref|XP_001877745.1|  predicted protein                                61.2    1e-07   
emb|CEL61003.1|  Conserved oligomeric Golgi complex subunit 2 OS=...  61.2    1e-07   
gb|ELU42478.1|  COG2 domain-containing protein                        60.8    1e-07   
ref|XP_002020009.1|  GL13754                                          60.8    2e-07   
ref|XP_003487887.1|  PREDICTED: conserved oligomeric Golgi comple...  60.8    2e-07   
gb|EKD00667.1|  hypothetical protein A1Q2_05027                       60.8    2e-07   
ref|XP_001357922.2|  GA19413                                          60.5    2e-07   
ref|XP_001830600.2|  hypothetical protein CC1G_06866                  60.5    2e-07   
ref|XP_011146882.1|  PREDICTED: conserved oligomeric Golgi comple...  60.5    2e-07   
ref|XP_011146883.1|  PREDICTED: conserved oligomeric Golgi comple...  60.5    2e-07   
ref|XP_006678760.1|  hypothetical protein BATDEDRAFT_88024            60.1    2e-07   
ref|XP_003399042.1|  PREDICTED: conserved oligomeric Golgi comple...  60.1    3e-07   
ref|XP_001416921.1|  predicted protein                                59.3    4e-07   
gb|AAX27255.2|  SJCHGC05960 protein                                   58.5    4e-07   
gb|KIW45904.1|  hypothetical protein PV06_01610                       58.5    5e-07   
ref|XP_005005281.1|  PREDICTED: conserved oligomeric Golgi comple...  59.3    5e-07   
gb|EPY81957.1|  hypothetical protein CB1_000692029                    58.5    5e-07   
gb|EJT49997.1|  hypothetical protein A1Q1_00838                       58.9    5e-07   
ref|XP_002001325.1|  GI10726                                          58.9    6e-07   
ref|XP_008551454.1|  PREDICTED: conserved oligomeric Golgi comple...  58.9    6e-07   
gb|KDN46181.1|  hypothetical protein RSAG8_04408                      58.5    7e-07   
gb|KDR75857.1|  hypothetical protein GALMADRAFT_248589                58.5    8e-07   
gb|KIK01394.1|  hypothetical protein K443DRAFT_98669                  58.5    8e-07   
ref|XP_773511.1|  hypothetical protein CNBI1250                       58.2    1e-06   
ref|XP_009025253.1|  hypothetical protein HELRODRAFT_95171            58.2    1e-06   
gb|AFR94326.1|  hypothetical protein CNAG_05062                       58.2    1e-06   
ref|XP_568093.1|  hypothetical protein                                58.2    1e-06   
ref|XP_006652018.1|  PREDICTED: conserved oligomeric Golgi comple...  57.8    1e-06   
gb|AAD31443.1|  ldlCp-related protein                                 57.8    2e-06   
ref|XP_009829212.1|  hypothetical protein H257_05897                  57.4    2e-06   
gb|KIM40094.1|  hypothetical protein M413DRAFT_28624                  57.4    2e-06   
emb|CEP12983.1|  hypothetical protein                                 57.0    2e-06   
ref|XP_007308237.1|  COG complex component                            57.0    2e-06   
ref|XP_010852807.1|  PREDICTED: conserved oligomeric Golgi comple...  57.0    2e-06   
gb|KDQ28122.1|  hypothetical protein PLEOSDRAFT_44979                 57.0    2e-06   
ref|XP_010819003.1|  PREDICTED: conserved oligomeric Golgi comple...  57.0    2e-06   
ref|XP_007843565.1|  conserved oligomeric golgi complex subunit 2...  57.0    3e-06   
ref|XP_001980050.1|  GG20618                                          57.0    3e-06   
ref|XP_002069920.1|  GK11309                                          56.6    3e-06   
ref|XP_310386.6|  AGAP003824-PA                                       56.6    3e-06   
ref|XP_002097746.1|  GE26383                                          56.6    3e-06   
ref|XP_002031072.1|  GM25778                                          56.6    3e-06   
ref|XP_009155418.1|  hypothetical protein HMPREF1120_03116            55.8    3e-06   
ref|NP_524366.1|  ldlCp-related protein                               56.6    4e-06   
gb|AAL48584.1|  RE06205p                                              56.2    4e-06   
gb|KIJ18679.1|  hypothetical protein PAXINDRAFT_71226                 56.2    5e-06   
emb|CCL98683.1|  predicted protein                                    55.8    7e-06   
dbj|GAA88227.1|  similar to An09g05990                                55.1    8e-06   
emb|CEG65575.1|  hypothetical protein RMATCC62417_02333               55.5    9e-06   
emb|CEG65577.1|  hypothetical protein RMATCC62417_02333               55.1    9e-06   
gb|KIJ67824.1|  hypothetical protein HYDPIDRAFT_37422                 55.5    9e-06   
ref|XP_004350660.1|  oligomeric Golgi complex component               55.1    1e-05   
ref|XP_747986.1|  conserved hypothetical protein                      54.7    1e-05   
gb|KIN96230.1|  hypothetical protein M404DRAFT_1006980                54.7    1e-05   
gb|EDP51206.1|  conserved hypothetical protein                        54.3    1e-05   
gb|EHA28546.1|  hypothetical protein ASPNIDRAFT_125515                54.3    1e-05   
ref|XP_001994381.1|  GH16862                                          54.7    1e-05   
gb|KDR16768.1|  Conserved oligomeric Golgi complex subunit 2          54.7    2e-05   
gb|KGB40811.1|  Conserved oligomeric Golgi complex subunit 2          54.3    2e-05   
gb|EMD37937.1|  hypothetical protein CERSUDRAFT_50066                 54.3    2e-05   
gb|EUC64334.1|  COG (oligomeric) complex component, COG2 protein      54.3    2e-05   
emb|CDJ03842.1|  oligomeric Golgi complex subunit 2                   53.9    2e-05   
gb|EHJ70342.1|  putative brefeldin A-sensitive peripheral Golgi p...  53.9    3e-05   
gb|KIO31284.1|  hypothetical protein M407DRAFT_68051                  53.9    3e-05   
gb|KEP55438.1|  hypothetical protein V565_005200                      53.9    3e-05   
emb|CDS16325.1|  oligomeric Golgi complex subunit 2                   53.9    3e-05   
dbj|GAA29452.2|  conserved oligomeric Golgi complex subunit 2         53.9    3e-05   
gb|KJA19881.1|  hypothetical protein HYPSUDRAFT_56318                 53.9    3e-05   
ref|XP_008875713.1|  hypothetical protein, variant 11                 53.5    3e-05   
ref|XP_005181173.2|  PREDICTED: conserved oligomeric Golgi comple...  53.5    3e-05   
ref|XP_008875708.1|  hypothetical protein, variant 6                  53.1    4e-05   
ref|XP_001216676.1|  conserved hypothetical protein                   53.1    4e-05   
ref|XP_001964533.1|  GF23234                                          53.5    4e-05   
gb|KFB36169.1|  AGAP003824-PA-like protein                            53.1    4e-05   
ref|XP_002475542.1|  predicted protein                                53.1    5e-05   
ref|XP_007342771.1|  COG complex component                            53.1    5e-05   
ref|XP_008875718.1|  hypothetical protein, variant 5                  53.1    5e-05   
gb|ADQ64546.1|  hypothetical protein                                  52.0    5e-05   
ref|XP_008875716.1|  hypothetical protein H310_10978                  53.1    5e-05   
ref|XP_008875717.1|  hypothetical protein, variant 1                  53.1    5e-05   
emb|CAK40407.1|  unnamed protein product                              52.8    5e-05   
ref|XP_011194794.1|  PREDICTED: conserved oligomeric Golgi comple...  53.1    5e-05   
gb|KIM75524.1|  hypothetical protein PILCRDRAFT_827237                53.1    5e-05   
ref|XP_001393911.2|  hypothetical protein ANI_1_1518084               52.8    6e-05   
ref|XP_008726234.1|  hypothetical protein G647_03667                  52.4    6e-05   
gb|KIS02438.1|  hypothetical protein L804_00706                       52.8    6e-05   
gb|KGB78784.1|  hypothetical protein CNBG_4622                        52.8    6e-05   
gb|KIR25199.1|  hypothetical protein I309_05956                       52.8    6e-05   
gb|KIR38972.1|  hypothetical protein I313_05119                       52.8    7e-05   
gb|KIR53924.1|  hypothetical protein I315_03541                       52.8    7e-05   



>ref|XP_006357074.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Solanum tuberosum]
Length=742

 Score =   258 bits (658),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +1

Query  67   APPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlss  246
            APPRSATDLFGDPTD NPPQWLNP LF S+DFD E+YISDLRTFVPL+TLRSELRSH +S
Sbjct  17   APPRSATDLFGDPTDPNPPQWLNPTLFQSQDFDPESYISDLRTFVPLETLRSELRSHFTS  76

Query  247  lqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHS  426
            LQRDLVDLINRDYADFVSLSTKLTDVDA+VVRMRAPL EIR KI  FR AVE SL+AL +
Sbjct  77   LQRDLVDLINRDYADFVSLSTKLTDVDASVVRMRAPLFEIREKIDGFRNAVEGSLAALQN  136

Query  427  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIAN  570
            RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSG T+     +N
Sbjct  137  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGQTDYVESGSN  184



>ref|XP_004244508.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Solanum 
lycopersicum]
Length=742

 Score =   257 bits (657),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 155/184 (84%), Gaps = 2/184 (1%)
 Frame = +1

Query  25   MTDLHS--PQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTF  198
            M DL S  P    +  APPRSATDLFGDPTD NPPQWLNP LF S+DFD E+YISDLRTF
Sbjct  1    MQDLQSLPPPSPQSTHAPPRSATDLFGDPTDPNPPQWLNPTLFQSQDFDPESYISDLRTF  60

Query  199  VPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKI  378
            VPL+TLRSELRSH +SLQRDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPL EIR KI
Sbjct  61   VPLETLRSELRSHFTSLQRDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLFEIREKI  120

Query  379  STFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLAN  558
              FR AVE SL+AL +RLKQRADA EAREVLELLLDTFHVVSKVEKLIKELPSG T+   
Sbjct  121  DGFRNAVEGSLAALQNRLKQRADAVEAREVLELLLDTFHVVSKVEKLIKELPSGQTDYVE  180

Query  559  GIAN  570
              +N
Sbjct  181  SGSN  184



>ref|XP_009769044.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Nicotiana 
sylvestris]
Length=751

 Score =   257 bits (657),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 160/188 (85%), Gaps = 4/188 (2%)
 Frame = +1

Query  25   MTDLHSPQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVP  204
            M DL SP   S   AP RSA DLFGDP+D NPPQWLNP LF S+DFD E+YISDLRTFVP
Sbjct  1    MQDLQSPPPQSAHAAP-RSAADLFGDPSDPNPPQWLNPTLFQSQDFDPESYISDLRTFVP  59

Query  205  LDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKIST  384
            L+TLRSELRSH +SLQRDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPL+EIR KI  
Sbjct  60   LETLRSELRSHFTSLQRDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLVEIRDKIDA  119

Query  385  FREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGI  564
            FR AVE SL+AL +RLKQRADA EAR+VLELLLDTFHVVSKVEKLIKELP  A +L+NG 
Sbjct  120  FRNAVEGSLAALQNRLKQRADAAEARQVLELLLDTFHVVSKVEKLIKELP--AADLSNGH  177

Query  565  -ANYADNG  585
              NYA+NG
Sbjct  178  DVNYAENG  185



>ref|XP_009602477.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Nicotiana 
tomentosiformis]
Length=751

 Score =   257 bits (656),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 164/200 (82%), Gaps = 5/200 (3%)
 Frame = +1

Query  25   MTDLHSPQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVP  204
            M DL SP   S   AP RSA DLFGDP+D NPPQWLNP LF S+DFD E+YISDLRTFVP
Sbjct  1    MQDLQSPPPQSAHAAP-RSAADLFGDPSDPNPPQWLNPTLFQSQDFDPESYISDLRTFVP  59

Query  205  LDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKIST  384
            L+TLRSELRSH +SLQRDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPL+EIR KI  
Sbjct  60   LETLRSELRSHFTSLQRDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLVEIRDKIDA  119

Query  385  FREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGI  564
            FR AVE SL+AL +RLKQRADA EAR+VLELLLDTFHVVSKVEKLIKELP  A +L+NG 
Sbjct  120  FRHAVEGSLAALQNRLKQRADAAEARQVLELLLDTFHVVSKVEKLIKELP--AADLSNGH  177

Query  565  -ANYADNGYLSNGVSFQHTE  621
              NYA+NG +  G S    E
Sbjct  178  DVNYAENG-IETGSSLSMRE  196



>ref|XP_011083848.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Sesamum 
indicum]
Length=757

 Score =   243 bits (620),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 154/198 (78%), Gaps = 8/198 (4%)
 Frame = +1

Query  28   TDLHSPQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPL  207
            TDLHSP         P+SATDLFGDP +   P WLNP  F   +FD E+YISDLRTFVP 
Sbjct  3    TDLHSPL--------PKSATDLFGDPIEDTHPLWLNPSKFSDPEFDPESYISDLRTFVPF  54

Query  208  DTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTF  387
            DTLRSELRSHL +L+ +LV+LINRDY DFVSLSTKL DVDAAVVRMRAPLLE++ KI  F
Sbjct  55   DTLRSELRSHLGALKHELVELINRDYVDFVSLSTKLVDVDAAVVRMRAPLLEVKEKILAF  114

Query  388  REAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIA  567
            R +VE SL+AL SRLKQRA A EAREVLELLLDTFHVVSKVEKLIKELP+   + ++G  
Sbjct  115  RGSVEGSLTALQSRLKQRAQANEAREVLELLLDTFHVVSKVEKLIKELPTVPADWSSGTL  174

Query  568  NYADNGYLSNGVSFQHTE  621
            N  + G LSNG+SFQH E
Sbjct  175  NSTEKGQLSNGISFQHAE  192



>gb|EYU23123.1| hypothetical protein MIMGU_mgv1a001829mg [Erythranthe guttata]
Length=753

 Score =   238 bits (608),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 156/198 (79%), Gaps = 8/198 (4%)
 Frame = +1

Query  28   TDLHSPQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPL  207
            TDLHSP         P+SATDLFGDP + + P WLNP  F   +FD E+YISDLRTFVP 
Sbjct  3    TDLHSP--------LPKSATDLFGDPIEDSHPLWLNPSKFTDAEFDPESYISDLRTFVPF  54

Query  208  DTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTF  387
            DTLRSELRSHL +L+ +LV+LINRDY DFVSLSTKL DV+AAVVRMRAPLLEI+ KI  F
Sbjct  55   DTLRSELRSHLGALKHELVELINRDYVDFVSLSTKLVDVEAAVVRMRAPLLEIKEKILDF  114

Query  388  REAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIA  567
            R +V+ SL+AL SRLKQR+ A EAREVLELLLDTFHVVSKVEKLIKELPS   + ++G  
Sbjct  115  RGSVDISLAALQSRLKQRSQANEAREVLELLLDTFHVVSKVEKLIKELPSVPADWSSGAM  174

Query  568  NYADNGYLSNGVSFQHTE  621
            +  + G LSNG+SFQH+E
Sbjct  175  SSTEKGQLSNGISFQHSE  192



>emb|CDP04651.1| unnamed protein product [Coffea canephora]
Length=763

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 150/178 (84%), Gaps = 1/178 (1%)
 Frame = +1

Query  88   DLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVD  267
            DLFGDP D+ PP WLNP  F+ ++FD E+YISDLRTFVP +TLRSEL+SHLSSLQR+LVD
Sbjct  24   DLFGDPVDSYPP-WLNPTAFVDQEFDPESYISDLRTFVPFETLRSELQSHLSSLQRELVD  82

Query  268  LINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRAD  447
            LINRDY+DFVSLSTKL D+DA+VVRMRAPLL+I+ KI  FR AV++SLSAL SRLKQRAD
Sbjct  83   LINRDYSDFVSLSTKLIDIDASVVRMRAPLLDIKEKILAFRGAVDASLSALKSRLKQRAD  142

Query  448  AGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTE  621
            A + REVLELLLDTFHVVSKVEKLIKELPS   + +NG  N A   +LSNG+S QH E
Sbjct  143  ANQTREVLELLLDTFHVVSKVEKLIKELPSIPVDWSNGYVNSASKDHLSNGISLQHIE  200



>ref|XP_007155537.1| hypothetical protein PHAVU_003G210200g [Phaseolus vulgaris]
 gb|ESW27531.1| hypothetical protein PHAVU_003G210200g [Phaseolus vulgaris]
Length=755

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 148/185 (80%), Gaps = 1/185 (1%)
 Frame = +1

Query  67   APPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlss  246
            APPRSATDLF DP DA+P  W  P  FLS DFD+E+YIS+LRTFVP DTLRSEL S+LSS
Sbjct  7    APPRSATDLFSDPLDAHP-LWFKPASFLSPDFDSESYISELRTFVPFDTLRSELNSYLSS  65

Query  247  lqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHS  426
            L  +L+DLINRDYADFV+LSTKL DVDA VVRMRAPL+E+R KI  FR +VE SL ++ +
Sbjct  66   LNHELIDLINRDYADFVNLSTKLVDVDAVVVRMRAPLVELRDKIEQFRGSVEVSLVSIKN  125

Query  427  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVS  606
            RL QR++A  ARE LELLLDTFHVVSKVEKLIKELPS  T+ +NG  N ++  YLSNGVS
Sbjct  126  RLNQRSEAASARETLELLLDTFHVVSKVEKLIKELPSVPTDWSNGDVNLSERNYLSNGVS  185

Query  607  FQHTE  621
             Q  E
Sbjct  186  VQQVE  190



>ref|XP_008374256.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Malus domestica]
Length=755

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 150/186 (81%), Gaps = 1/186 (1%)
 Frame = +1

Query  64   GAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshls  243
             AP RSA DLF DP D++P  W  P LFLS +FD+E+YISDLRTFVP DTLRSEL+ +L+
Sbjct  6    AAPHRSAADLFSDPLDSHP-LWFKPALFLSPEFDSESYISDLRTFVPFDTLRSELQCYLA  64

Query  244  slqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALH  423
            SL  +L+DLINRDYADFV+LSTKL DVD+AVVRMRAPL+E+R KI  FR +V++SL AL 
Sbjct  65   SLNHELIDLINRDYADFVNLSTKLVDVDSAVVRMRAPLVELREKIEQFRGSVQNSLVALT  124

Query  424  SRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGV  603
            + LKQR++A EAREVLELLLDTFHVVSKVEKLIKELPS   + +NG  N A+   +SNG 
Sbjct  125  NGLKQRSEAAEAREVLELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNLAEKNSISNGA  184

Query  604  SFQHTE  621
            S QHTE
Sbjct  185  SLQHTE  190



>ref|XP_010105239.1| Conserved oligomeric Golgi complex subunit 2 [Morus notabilis]
 gb|EXC04126.1| Conserved oligomeric Golgi complex subunit 2 [Morus notabilis]
Length=708

 Score =   229 bits (584),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 149/185 (81%), Gaps = 1/185 (1%)
 Frame = +1

Query  67   APPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlss  246
            A PRSATDLF DP D +P  W  P LFLS +FD+E+YIS+LRTFVP DTLRSEL+S+LSS
Sbjct  7    ALPRSATDLFADPLDGHP-LWFKPELFLSPNFDSESYISELRTFVPFDTLRSELQSYLSS  65

Query  247  lqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHS  426
            L  +L+DLINRDYADFV+LSTKL DVDAAVVRMRAPL+E+R KI  FR +VE +L AL +
Sbjct  66   LNHELIDLINRDYADFVNLSTKLVDVDAAVVRMRAPLVELREKIEQFRGSVEGALVALKN  125

Query  427  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVS  606
             LKQR+DA  AREVLELLLDTFHVVSKVEKLIKELP+  ++ +NG  N A+   LSNG S
Sbjct  126  GLKQRSDAASAREVLELLLDTFHVVSKVEKLIKELPTVPSDWSNGDDNLAEKNSLSNGTS  185

Query  607  FQHTE  621
             QH E
Sbjct  186  LQHAE  190



>ref|XP_003549849.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Glycine max]
Length=755

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 147/185 (79%), Gaps = 1/185 (1%)
 Frame = +1

Query  67   APPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlss  246
            APPRSATDLF DP DA+P  W  P  FLS DFD+E+YIS+LRTFVP DTLRSEL S+LSS
Sbjct  7    APPRSATDLFSDPLDAHP-LWFKPASFLSPDFDSESYISELRTFVPFDTLRSELNSYLSS  65

Query  247  lqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHS  426
            L  +L+DLINRDYADFV+LSTKL DVDA VVRMRAPL+E+R KI  FR +VE SL A+ +
Sbjct  66   LNHELIDLINRDYADFVNLSTKLVDVDAVVVRMRAPLVELRDKIEQFRGSVEVSLVAIKN  125

Query  427  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVS  606
            RL+QR++   ARE LELLLD FHVVSKVEKLIKELPS  T+ +NG  N ++   LSNGVS
Sbjct  126  RLRQRSEVASARETLELLLDAFHVVSKVEKLIKELPSVPTDWSNGDVNLSERNNLSNGVS  185

Query  607  FQHTE  621
             QH E
Sbjct  186  AQHVE  190



>ref|XP_003525701.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Glycine max]
Length=755

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 146/185 (79%), Gaps = 1/185 (1%)
 Frame = +1

Query  67   APPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlss  246
            APPRSAT+LF DP DA+P  W  P  FLS DFD+E+YIS+LRTFVP DTLRSEL S+LSS
Sbjct  7    APPRSATELFSDPLDAHP-LWFKPASFLSPDFDSESYISELRTFVPFDTLRSELNSYLSS  65

Query  247  lqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHS  426
            L  +L+DLINRDYADFV+LSTKL DVDA VVRMRAPL+E+R KI  FR +VE SL A+ S
Sbjct  66   LNHELIDLINRDYADFVNLSTKLVDVDAVVVRMRAPLVELRDKIEQFRGSVEVSLVAIKS  125

Query  427  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVS  606
            RL+QR++   ARE LELLLD FHVVSKVEKLIKELPS  T+ +NG  N ++    SNGVS
Sbjct  126  RLRQRSEVASARETLELLLDAFHVVSKVEKLIKELPSVPTDWSNGDVNLSERNNFSNGVS  185

Query  607  FQHTE  621
             QH E
Sbjct  186  VQHVE  190



>ref|XP_009375225.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Pyrus x bretschneideri]
 ref|XP_009375233.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Pyrus x bretschneideri]
Length=755

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 150/186 (81%), Gaps = 1/186 (1%)
 Frame = +1

Query  64   GAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshls  243
             AP RSA DLF DP D++P  W  P LFL  +FD+E+YISDLRTFVP DTLRSEL+S+L+
Sbjct  6    AAPHRSAADLFSDPLDSHP-LWFKPALFLWPEFDSESYISDLRTFVPFDTLRSELQSYLA  64

Query  244  slqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALH  423
            SL  +L+DLINRDYADFV+LSTKL DVD+AVVRMRAPL+E+R KI  FR +V++SL AL 
Sbjct  65   SLNHELIDLINRDYADFVNLSTKLVDVDSAVVRMRAPLVELREKIEQFRGSVQNSLVALT  124

Query  424  SRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGV  603
            + LKQR++A EAREVLELLLDTFHVVSKVEKLIKELPS   + +NG  N A+   +SNG 
Sbjct  125  NGLKQRSEAAEAREVLELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNLAEKNSISNGA  184

Query  604  SFQHTE  621
            S QHTE
Sbjct  185  SLQHTE  190



>ref|XP_007210583.1| hypothetical protein PRUPE_ppa015080mg, partial [Prunus persica]
 gb|EMJ11782.1| hypothetical protein PRUPE_ppa015080mg, partial [Prunus persica]
Length=718

 Score =   226 bits (577),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 150/185 (81%), Gaps = 1/185 (1%)
 Frame = +1

Query  67   APPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlss  246
            AP R+ATD F DP D++P  W  P LFLS +FD+E+YISDLRTFVP DTLRSEL+S+L+S
Sbjct  7    APHRTATDFFSDPLDSHP-LWFKPALFLSPEFDSESYISDLRTFVPFDTLRSELQSYLAS  65

Query  247  lqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHS  426
            L  +L+DLINRDYADFV+LSTKL DVD+AVVRMRAPL+E+R KI  FR +V++SL AL +
Sbjct  66   LNHELIDLINRDYADFVNLSTKLVDVDSAVVRMRAPLVELREKIEQFRGSVQNSLVALTN  125

Query  427  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVS  606
             LKQR++A EAREVLELLLDTFHVVSKVEKLI+ELPS   +  NG  N A+  +++NG S
Sbjct  126  GLKQRSEANEAREVLELLLDTFHVVSKVEKLIQELPSVPADWLNGDVNLAEKNFITNGTS  185

Query  607  FQHTE  621
             QH E
Sbjct  186  LQHVE  190



>ref|XP_008239451.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Prunus 
mume]
Length=755

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 150/185 (81%), Gaps = 1/185 (1%)
 Frame = +1

Query  67   APPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlss  246
            AP R+ATD F DP D++P  W  P LFLS +FD+E+YISDLRTFVP DTLRSEL+S+L+S
Sbjct  7    APHRTATDFFSDPLDSHP-LWFKPALFLSPEFDSESYISDLRTFVPFDTLRSELQSYLAS  65

Query  247  lqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHS  426
            L  +L+DLINRDYADFV+LSTKL DVD+AVVRMRAPL+E+R KI  FR +V++SL AL +
Sbjct  66   LNHELIDLINRDYADFVNLSTKLVDVDSAVVRMRAPLVELREKIEHFRGSVQNSLVALTN  125

Query  427  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVS  606
             LKQR++A EAREVLELLLDTFHVVSKVEKLI+ELPS   +  NG  N A+  +++NG S
Sbjct  126  GLKQRSEANEAREVLELLLDTFHVVSKVEKLIQELPSVPADWLNGDVNLAEKNFITNGTS  185

Query  607  FQHTE  621
             QH E
Sbjct  186  LQHVE  190



>ref|XP_009359449.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Pyrus x bretschneideri]
Length=755

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 149/186 (80%), Gaps = 1/186 (1%)
 Frame = +1

Query  64   GAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshls  243
             AP RSA +LF DP D++P  W  P LFLS +FD+E+YISDLRTFVP DTLRSEL+S+L+
Sbjct  6    AAPHRSAANLFSDPLDSHP-LWFKPALFLSPEFDSESYISDLRTFVPFDTLRSELQSYLA  64

Query  244  slqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALH  423
            SL  +L+DLINRDYADFV+LSTKL DVD+AVVRMRAPL+E+R KI  FR +V++SL AL 
Sbjct  65   SLNHELIDLINRDYADFVNLSTKLVDVDSAVVRMRAPLVELREKIEQFRGSVQNSLVALT  124

Query  424  SRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGV  603
            + LKQR +A EAREVLELLLDTFHVVSKVEKLIKELPS   + +NG  N A+   +SNG 
Sbjct  125  NGLKQRLEAAEAREVLELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNLAEKNSVSNGT  184

Query  604  SFQHTE  621
            S QH E
Sbjct  185  SLQHAE  190



>ref|XP_004164803.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like, 
partial [Cucumis sativus]
Length=513

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 145/184 (79%), Gaps = 1/184 (1%)
 Frame = +1

Query  70   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  249
            P RSA DLF DP D++P  W  P LFLS +FD+E+YIS+LRTFVP DTLRS+L SHLS+L
Sbjct  8    PHRSANDLFSDPLDSHP-LWFKPDLFLSPNFDSESYISELRTFVPFDTLRSQLHSHLSAL  66

Query  250  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  429
             R+L+DLINRDY DFV+LSTKL DV+AAVVRMRAPL+E+R KI  FR +VE SLSAL + 
Sbjct  67   NRELIDLINRDYTDFVNLSTKLVDVEAAVVRMRAPLVELREKIEQFRGSVEFSLSALQNG  126

Query  430  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  609
            L+QR++A  AREVLELLLDTFHVVSKVEKLIKELPS   + +NG  N  D   LSNG S 
Sbjct  127  LRQRSEAASAREVLELLLDTFHVVSKVEKLIKELPSAPADGSNGTMNLTDKSGLSNGASL  186

Query  610  QHTE  621
             H E
Sbjct  187  PHIE  190



>ref|XP_008463108.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Cucumis 
melo]
 ref|XP_008463109.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Cucumis 
melo]
Length=754

 Score =   224 bits (570),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 146/184 (79%), Gaps = 1/184 (1%)
 Frame = +1

Query  70   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  249
            P RSA DLF DP D++P  W  P LFLS +FD+E+YIS+LRTFVP DTLRS+L SHLS+L
Sbjct  8    PHRSANDLFSDPLDSHP-LWFKPNLFLSPNFDSESYISELRTFVPFDTLRSQLHSHLSAL  66

Query  250  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  429
             R+L+DLINRDY DFV+LSTKL DV+AAVVRMRAPL+E+R KI  FR +VE SLSAL + 
Sbjct  67   NRELIDLINRDYTDFVNLSTKLVDVEAAVVRMRAPLVELREKIEQFRASVEFSLSALQNG  126

Query  430  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  609
            L+QR++A  AREVLELLLDTFHVVSKVEKLIKELPS   + +NG  N  DN  LSNG S 
Sbjct  127  LRQRSEAASAREVLELLLDTFHVVSKVEKLIKELPSAPADGSNGTTNLTDNSGLSNGASL  186

Query  610  QHTE  621
             H E
Sbjct  187  PHME  190



>ref|XP_004297537.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Fragaria 
vesca subsp. vesca]
Length=768

 Score =   223 bits (567),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 145/181 (80%), Gaps = 1/181 (1%)
 Frame = +1

Query  64   GAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshls  243
             AP RS TD F DP D++P  W  P LFLS DFD+E YISDLRTFVP DTLRSEL+S+L+
Sbjct  8    AAPHRSNTDFFSDPLDSHP-LWFKPSLFLSPDFDSEAYISDLRTFVPFDTLRSELQSYLA  66

Query  244  slqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALH  423
            SL  DL+DLINRDYADFV+LSTKL DVD+AVVRMRAPL+E+R KI  FR +V+ SL AL 
Sbjct  67   SLNHDLIDLINRDYADFVNLSTKLVDVDSAVVRMRAPLVELREKIEQFRGSVQGSLVALT  126

Query  424  SRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGV  603
            + LKQR++A EARE+LELLLDTFHVVSKVEKLIKELPS   + +NG  N A+  ++SNG 
Sbjct  127  NGLKQRSEAAEAREILELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNLAEKNFISNGT  186

Query  604  S  606
            +
Sbjct  187  A  187



>ref|XP_008351743.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Malus domestica]
Length=755

 Score =   221 bits (564),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 146/186 (78%), Gaps = 1/186 (1%)
 Frame = +1

Query  64   GAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshls  243
             AP RSA +LF DP D++P  W  P LFL  +FD+E+YISDLRTFVP DTLRSEL+S+L+
Sbjct  6    AAPHRSAANLFSDPLDSHP-LWFKPALFLXPEFDSESYISDLRTFVPFDTLRSELQSYLA  64

Query  244  slqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALH  423
            SL  +L+DLINRDYADFV+LSTKL DVD+AVVRMRAPL+E+R KI  FR +V+ SL AL 
Sbjct  65   SLNHELIDLINRDYADFVNLSTKLVDVDSAVVRMRAPLVELREKIEQFRGSVQDSLVALT  124

Query  424  SRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGV  603
            + L QR +A EAREVLELLLDTFHVVSKVEKLIKELPS   + +NG  N A+   +SNG 
Sbjct  125  NGLXQRLEAAEAREVLELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNLAEKNSVSNGT  184

Query  604  SFQHTE  621
            S QH E
Sbjct  185  SLQHAE  190



>ref|XP_008392829.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Malus domestica]
Length=755

 Score =   221 bits (564),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 146/186 (78%), Gaps = 1/186 (1%)
 Frame = +1

Query  64   GAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshls  243
             AP RSA +LF DP D++P  W  P LFL  +FD+E+YISDLRTFVP DTLRSEL+S+L+
Sbjct  6    AAPHRSAANLFSDPLDSHP-LWFKPALFLXPEFDSESYISDLRTFVPFDTLRSELQSYLA  64

Query  244  slqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALH  423
            SL  +L+DLINRDYADFV+LSTKL DVD+AVVRMRAPL+E+R KI  FR +V+ SL AL 
Sbjct  65   SLNHELIDLINRDYADFVNLSTKLVDVDSAVVRMRAPLVELREKIEQFRGSVQDSLVALT  124

Query  424  SRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGV  603
            + L QR +A EAREVLELLLDTFHVVSKVEKLIKELPS   + +NG  N A+   +SNG 
Sbjct  125  NGLXQRLEAAEAREVLELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNLAEKNSVSNGT  184

Query  604  SFQHTE  621
            S QH E
Sbjct  185  SLQHAE  190



>ref|XP_004138387.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Cucumis sativus]
 gb|KGN45847.1| hypothetical protein Csa_6G014670 [Cucumis sativus]
Length=754

 Score =   221 bits (563),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 145/184 (79%), Gaps = 1/184 (1%)
 Frame = +1

Query  70   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  249
            P RSA DLF DP D++P  W  P LFLS +FD+E+YIS+LRTFVP DTLRS+L SHLS+L
Sbjct  8    PHRSANDLFSDPLDSHP-LWFKPDLFLSPNFDSESYISELRTFVPFDTLRSQLHSHLSAL  66

Query  250  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  429
             R+L+DLINRDY DFV+LSTKL DV+AAVVRMRAPL+E+R KI  FR +VE SLSAL + 
Sbjct  67   NRELIDLINRDYTDFVNLSTKLVDVEAAVVRMRAPLVELREKIEQFRGSVEFSLSALQNG  126

Query  430  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  609
            L+QR++A  AREVLELLLDTFHVVSKVEKLIKELPS   + +NG  N  D   LSNG S 
Sbjct  127  LRQRSEAASAREVLELLLDTFHVVSKVEKLIKELPSAPADGSNGTMNLTDKSGLSNGASL  186

Query  610  QHTE  621
             H E
Sbjct  187  PHIE  190



>ref|XP_002511204.1| Conserved oligomeric Golgi complex component, putative [Ricinus 
communis]
 gb|EEF51806.1| Conserved oligomeric Golgi complex component, putative [Ricinus 
communis]
Length=756

 Score =   221 bits (562),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 145/183 (79%), Gaps = 1/183 (1%)
 Frame = +1

Query  73   PRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslq  252
            PRSATDLF DP D++P  W  P LFLS  FD+E+YIS+LRTFVP DTLRSEL++HLSSL 
Sbjct  10   PRSATDLFSDPLDSHP-LWFKPNLFLSPTFDSESYISELRTFVPFDTLRSELQAHLSSLN  68

Query  253  rDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRL  432
             +L+DLINRDYADFV+LSTKL DVDAAVVRMRAPLLE+R KI  FR +VE SL AL + L
Sbjct  69   HELIDLINRDYADFVNLSTKLVDVDAAVVRMRAPLLELREKIEGFRGSVEGSLVALRNGL  128

Query  433  KQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQ  612
            +QR++A  ARE+LELLLDTFHVVSKVEKLIKELPS   + +NG  N      +SNG+S Q
Sbjct  129  QQRSEAASAREILELLLDTFHVVSKVEKLIKELPSLPADWSNGDVNSTVKNAMSNGISLQ  188

Query  613  HTE  621
              E
Sbjct  189  SIE  191



>ref|XP_004515820.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Cicer arietinum]
Length=755

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 146/182 (80%), Gaps = 1/182 (1%)
 Frame = +1

Query  76   RSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqr  255
            RSAT+LF DP D++P  W  P  FLS DFD+E+YIS+LRTFVP DTLRSEL ++LSSL  
Sbjct  10   RSATNLFSDPLDSHP-LWFKPASFLSPDFDSESYISELRTFVPFDTLRSELNNYLSSLNH  68

Query  256  DLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLK  435
            +L+DLINRDYADFV+LSTKL DVDAAVVRMRAPL+E+R KI  FR +V+ SL A+ + LK
Sbjct  69   ELIDLINRDYADFVNLSTKLVDVDAAVVRMRAPLVELREKIEQFRGSVDVSLIAIKNGLK  128

Query  436  QRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQH  615
            QR++A  ARE LELLLDTFHVVSKVEKLIKELPS  ++ +NG  N ++   LSNGVS QH
Sbjct  129  QRSEAASARETLELLLDTFHVVSKVEKLIKELPSVPSDWSNGDVNSSEKNSLSNGVSVQH  188

Query  616  TE  621
             E
Sbjct  189  VE  190



>gb|KDP30933.1| hypothetical protein JCGZ_11309 [Jatropha curcas]
Length=756

 Score =   220 bits (560),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 148/189 (78%), Gaps = 3/189 (2%)
 Frame = +1

Query  55   STPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrs  234
            STP  PPRSATDLF DP D++P  W  P LFLS  FD+E+YIS+LRTFVP DTLRSEL++
Sbjct  6    STP--PPRSATDLFSDPLDSHP-LWFKPNLFLSPTFDSESYISELRTFVPFDTLRSELQA  62

Query  235  hlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLS  414
            +L+SL  DL+DLINRDYADFV+LSTKL DVDAAVVRMRAPLLE+R KI  FR +VE  L 
Sbjct  63   YLASLNHDLIDLINRDYADFVNLSTKLVDVDAAVVRMRAPLLELREKIEGFRRSVEGLLV  122

Query  415  ALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLS  594
            AL + L+QR++A  AREVLELLLDTFHVVSKVEKLIKELPS   + +NG  + +    +S
Sbjct  123  ALRNGLQQRSEAAAAREVLELLLDTFHVVSKVEKLIKELPSVPADWSNGDLSSSVKNAMS  182

Query  595  NGVSFQHTE  621
            NG S Q  E
Sbjct  183  NGNSVQSIE  191



>ref|XP_010677897.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Beta 
vulgaris subsp. vulgaris]
Length=759

 Score =   219 bits (559),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 144/189 (76%), Gaps = 0/189 (0%)
 Frame = +1

Query  55   STPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrs  234
            + P  PPRS TD+FGDP + + P W    LFLS  FD+ETYISDLRTFVP DTLRS+L S
Sbjct  7    AQPSPPPRSHTDVFGDPFEDSSPLWFKKDLFLSPKFDSETYISDLRTFVPFDTLRSQLHS  66

Query  235  hlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLS  414
            HLSSL+  LVDLINRDY DFV+LST L DVD++V RMRAPL ++R KIS FR+ V+ SL 
Sbjct  67   HLSSLKHQLVDLINRDYNDFVNLSTNLVDVDSSVARMRAPLSDLREKISAFRDCVQDSLV  126

Query  415  ALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLS  594
            +L + L QRA A  AREVLELLLDTFHVVSKVEKLIKELPS   + +NG  N ++  +LS
Sbjct  127  SLQNGLNQRAQAANAREVLELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNSSEKSHLS  186

Query  595  NGVSFQHTE  621
            NG+S Q +E
Sbjct  187  NGLSLQQSE  195



>ref|XP_007023398.1| Golgi organization, COG2 isoform 3 [Theobroma cacao]
 gb|EOY26020.1| Golgi organization, COG2 isoform 3 [Theobroma cacao]
Length=517

 Score =   214 bits (546),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 147/193 (76%), Gaps = 6/193 (3%)
 Frame = +1

Query  43   PQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrs  222
            P + S+P   PRSATDLF DP D++P  W  P LFLS +FD+E+YI++LRTFVP DTLRS
Sbjct  2    PDQISSPA--PRSATDLFSDPLDSHP-LWFKPSLFLSPNFDSESYITELRTFVPFDTLRS  58

Query  223  elrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVE  402
            EL++HLSSL  +L+DLINRDYADFV+LSTKL DVD+AV+RMRAPLLE+R KI  FR AVE
Sbjct  59   ELQAHLSSLNHELIDLINRDYADFVNLSTKLVDVDSAVLRMRAPLLELRDKIQGFRGAVE  118

Query  403  SSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADN  582
             SL AL   L QRA+A  AREVLELLLDTFHVVSKVEKLIKELPS A++ +NG  N    
Sbjct  119  GSLLALKDGLSQRAEATAAREVLELLLDTFHVVSKVEKLIKELPSVASDWSNGDVNPVQK  178

Query  583  GYLSNGVSFQHTE  621
                N    QH E
Sbjct  179  ---KNASGLQHVE  188



>ref|XP_007023399.1| Golgi organization, COG2 isoform 4 [Theobroma cacao]
 gb|EOY26021.1| Golgi organization, COG2 isoform 4 [Theobroma cacao]
Length=533

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 147/193 (76%), Gaps = 6/193 (3%)
 Frame = +1

Query  43   PQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrs  222
            P + S+P   PRSATDLF DP D++P  W  P LFLS +FD+E+YI++LRTFVP DTLRS
Sbjct  2    PDQISSPA--PRSATDLFSDPLDSHP-LWFKPSLFLSPNFDSESYITELRTFVPFDTLRS  58

Query  223  elrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVE  402
            EL++HLSSL  +L+DLINRDYADFV+LSTKL DVD+AV+RMRAPLLE+R KI  FR AVE
Sbjct  59   ELQAHLSSLNHELIDLINRDYADFVNLSTKLVDVDSAVLRMRAPLLELRDKIQGFRGAVE  118

Query  403  SSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADN  582
             SL AL   L QRA+A  AREVLELLLDTFHVVSKVEKLIKELPS A++ +NG  N    
Sbjct  119  GSLLALKDGLSQRAEATAAREVLELLLDTFHVVSKVEKLIKELPSVASDWSNGDVNPVQK  178

Query  583  GYLSNGVSFQHTE  621
                N    QH E
Sbjct  179  ---KNASGLQHVE  188



>ref|XP_010250762.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Nelumbo 
nucifera]
Length=747

 Score =   216 bits (549),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 146/187 (78%), Gaps = 4/187 (2%)
 Frame = +1

Query  70   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  249
            PPRS TDLFGDP D+ P  W     FL E+FD+E YI+DLRTFVP D LRSEL++HLSSL
Sbjct  6    PPRSPTDLFGDPIDSQP-LWFKKNAFLEENFDSEAYITDLRTFVPFDNLRSELQTHLSSL  64

Query  250  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  429
            + +LV+LINRDYADFV+LSTKL DVD  ++RMRAPL E+R KIS FR +VESSL+AL + 
Sbjct  65   KHELVELINRDYADFVNLSTKLVDVDGTILRMRAPLTELREKISQFRGSVESSLAALQNG  124

Query  430  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLS---NG  600
            L+QRA+A  AREVLELLLDTFHVVSKVEKLIKELPS  ++ +NG  N  + G L    NG
Sbjct  125  LRQRAEASAAREVLELLLDTFHVVSKVEKLIKELPSVPSDWSNGDVNSTEKGSLQHTENG  184

Query  601  VSFQHTE  621
             +F+ T+
Sbjct  185  TNFRETQ  191



>ref|XP_007023397.1| Golgi organization, COG2 isoform 2 [Theobroma cacao]
 gb|EOY26019.1| Golgi organization, COG2 isoform 2 [Theobroma cacao]
Length=674

 Score =   215 bits (547),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 147/193 (76%), Gaps = 6/193 (3%)
 Frame = +1

Query  43   PQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrs  222
            P + S+P   PRSATDLF DP D++P  W  P LFLS +FD+E+YI++LRTFVP DTLRS
Sbjct  2    PDQISSPA--PRSATDLFSDPLDSHP-LWFKPSLFLSPNFDSESYITELRTFVPFDTLRS  58

Query  223  elrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVE  402
            EL++HLSSL  +L+DLINRDYADFV+LSTKL DVD+AV+RMRAPLLE+R KI  FR AVE
Sbjct  59   ELQAHLSSLNHELIDLINRDYADFVNLSTKLVDVDSAVLRMRAPLLELRDKIQGFRGAVE  118

Query  403  SSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADN  582
             SL AL   L QRA+A  AREVLELLLDTFHVVSKVEKLIKELPS A++ +NG  N    
Sbjct  119  GSLLALKDGLSQRAEATAAREVLELLLDTFHVVSKVEKLIKELPSVASDWSNGDVNPVQK  178

Query  583  GYLSNGVSFQHTE  621
                N    QH E
Sbjct  179  ---KNASGLQHVE  188



>ref|XP_007023396.1| Golgi organization, COG2 isoform 1 [Theobroma cacao]
 gb|EOY26018.1| Golgi organization, COG2 isoform 1 [Theobroma cacao]
Length=754

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 147/193 (76%), Gaps = 6/193 (3%)
 Frame = +1

Query  43   PQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrs  222
            P + S+P   PRSATDLF DP D++P  W  P LFLS +FD+E+YI++LRTFVP DTLRS
Sbjct  2    PDQISSPA--PRSATDLFSDPLDSHP-LWFKPSLFLSPNFDSESYITELRTFVPFDTLRS  58

Query  223  elrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVE  402
            EL++HLSSL  +L+DLINRDYADFV+LSTKL DVD+AV+RMRAPLLE+R KI  FR AVE
Sbjct  59   ELQAHLSSLNHELIDLINRDYADFVNLSTKLVDVDSAVLRMRAPLLELRDKIQGFRGAVE  118

Query  403  SSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADN  582
             SL AL   L QRA+A  AREVLELLLDTFHVVSKVEKLIKELPS A++ +NG  N    
Sbjct  119  GSLLALKDGLSQRAEATAAREVLELLLDTFHVVSKVEKLIKELPSVASDWSNGDVNPVQK  178

Query  583  GYLSNGVSFQHTE  621
                N    QH E
Sbjct  179  ---KNASGLQHVE  188



>gb|EPS73270.1| hypothetical protein M569_01480, partial [Genlisea aurea]
Length=757

 Score =   214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 153/201 (76%), Gaps = 13/201 (6%)
 Frame = +1

Query  34   LHSPQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDT  213
            LHSP         P+SATDLFGDP + + P WL P  F   DFD E+YISDLRTFVP DT
Sbjct  6    LHSPL--------PKSATDLFGDPVEDSRPLWLKPSKFSDLDFDPESYISDLRTFVPFDT  57

Query  214  lrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFRE  393
            LRSELRSHL+SL+ +LV+LINRDYADFVSLSTKL DVD+AVVRM APLLEI+ KI  +R 
Sbjct  58   LRSELRSHLASLKNELVELINRDYADFVSLSTKLVDVDSAVVRMWAPLLEIKEKILVYRA  117

Query  394  AVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANY  573
            +V++SL+A+ SRLKQR+ A  AR++LELLLDTFHVVSK+EKLIKELPS  ++  +G A  
Sbjct  118  SVDTSLAAMQSRLKQRSQASGARDMLELLLDTFHVVSKIEKLIKELPSVPSDWPSGPAKS  177

Query  574  AD-----NGYLSNGVSFQHTE  621
            AD     NG++ NG + + T+
Sbjct  178  ADKDQLSNGHVENGTTMRETQ  198



>gb|KDO52635.1| hypothetical protein CISIN_1g004390mg [Citrus sinensis]
Length=546

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 145/184 (79%), Gaps = 1/184 (1%)
 Frame = +1

Query  70   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  249
            PPRSATDLF DP D++P  W    LFLS +FD+E+YIS+LRTFVP +TLRSEL++HLSSL
Sbjct  10   PPRSATDLFSDPADSHP-LWFKSNLFLSPNFDSESYISELRTFVPFETLRSELQAHLSSL  68

Query  250  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  429
              +L+DLINRDYADFV+LSTKL DVDAAVVRMRAPLLE+R KI  FR A+E SL AL + 
Sbjct  69   NHELIDLINRDYADFVNLSTKLVDVDAAVVRMRAPLLELREKIDGFRGALEGSLVALQNG  128

Query  430  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  609
            LKQR++A  AREVLELLLDTFHVVSKVEKLIKELPS   + ++   N  +   +S+  +F
Sbjct  129  LKQRSEAASAREVLELLLDTFHVVSKVEKLIKELPSLPADGSDFDVNLEERKSMSSATTF  188

Query  610  QHTE  621
            Q  E
Sbjct  189  QPVE  192



>ref|XP_002318717.1| hypothetical protein POPTR_0012s09800g [Populus trichocarpa]
 gb|EEE96937.1| hypothetical protein POPTR_0012s09800g [Populus trichocarpa]
Length=755

 Score =   214 bits (544),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 147/189 (78%), Gaps = 6/189 (3%)
 Frame = +1

Query  70   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  249
            PPRSATD F DP D +P  W  P LFLS +FD+++YIS+LRTFVP DTLRSEL++HL+SL
Sbjct  11   PPRSATDFFSDPLDFHP-LWFKPDLFLSPNFDSDSYISELRTFVPFDTLRSELQAHLTSL  69

Query  250  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  429
              +L+DLINRDYADFV+LSTKL DVD+AVVRMRAPLLE+R KI  FR +VESSL AL + 
Sbjct  70   NHELIDLINRDYADFVNLSTKLVDVDSAVVRMRAPLLELREKIEGFRGSVESSLVALKNG  129

Query  430  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANY-----ADNGYLS  594
            L+QR++A   REVLELLLDTFHVVSKVEKLIKELPS   + +NG  N      A NG + 
Sbjct  130  LEQRSEATATREVLELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNLTEKNAASNGSIE  189

Query  595  NGVSFQHTE  621
            NG + + T+
Sbjct  190  NGTNVRETQ  198



>ref|XP_010026579.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Eucalyptus grandis]
Length=776

 Score =   213 bits (543),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 142/177 (80%), Gaps = 2/177 (1%)
 Frame = +1

Query  88   DLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVD  267
            DLF DP D++P  W  P  FLS DFD+E+YIS+LRTFVP DTLRSELRSHLSSL  +L+D
Sbjct  22   DLFSDPQDSHP-LWFKPSAFLSGDFDSESYISELRTFVPFDTLRSELRSHLSSLNHELID  80

Query  268  LINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRAD  447
            LINRDY DFV+LSTKL DVDAA+VRMRAPLLE+R KI  FR +VE SL AL + L+QR++
Sbjct  81   LINRDYNDFVNLSTKLVDVDAAIVRMRAPLLELRDKIEGFRGSVEGSLVALRNGLRQRSE  140

Query  448  AGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGY-LSNGVSFQH  615
            A  AREVLELLLDTFHVVSKVEKLIKELPS   + +NG  N A+NG  LSNGVS  H
Sbjct  141  AASAREVLELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNPAENGSPLSNGVSLSH  197



>ref|XP_003608845.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
 gb|AES91042.1| oligomeric subunit-like protein [Medicago truncatula]
Length=636

 Score =   211 bits (538),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 144/185 (78%), Gaps = 1/185 (1%)
 Frame = +1

Query  67   APPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlss  246
            A  RS T+LF DP D++P  W  P  FLS DFD+E+YIS+LRTFVP DTLRSEL ++LSS
Sbjct  7    AHHRSTTNLFSDPLDSHP-LWFKPTSFLSPDFDSESYISELRTFVPFDTLRSELNNYLSS  65

Query  247  lqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHS  426
            L  +L+DLINRDYADFV+LSTKL DVDAAVVRMRAPL+E+R KI  FR +V+ SL A+ +
Sbjct  66   LNHELIDLINRDYADFVNLSTKLVDVDAAVVRMRAPLVELREKIEQFRGSVDVSLVAIKN  125

Query  427  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVS  606
             LKQR++A  ARE LELLLDTFHVVSKVEKLIKELPS  ++ +NG  N ++    SNGVS
Sbjct  126  GLKQRSEAASARETLELLLDTFHVVSKVEKLIKELPSVPSDWSNGDVNLSEKNPSSNGVS  185

Query  607  FQHTE  621
             Q  E
Sbjct  186  VQQVE  190



>ref|XP_010026586.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Eucalyptus grandis]
 gb|KCW83168.1| hypothetical protein EUGRSUZ_B00121 [Eucalyptus grandis]
Length=760

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 142/177 (80%), Gaps = 2/177 (1%)
 Frame = +1

Query  88   DLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVD  267
            DLF DP D++P  W  P  FLS DFD+E+YIS+LRTFVP DTLRSELRSHLSSL  +L+D
Sbjct  22   DLFSDPQDSHP-LWFKPSAFLSGDFDSESYISELRTFVPFDTLRSELRSHLSSLNHELID  80

Query  268  LINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRAD  447
            LINRDY DFV+LSTKL DVDAA+VRMRAPLLE+R KI  FR +VE SL AL + L+QR++
Sbjct  81   LINRDYNDFVNLSTKLVDVDAAIVRMRAPLLELRDKIEGFRGSVEGSLVALRNGLRQRSE  140

Query  448  AGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGY-LSNGVSFQH  615
            A  AREVLELLLDTFHVVSKVEKLIKELPS   + +NG  N A+NG  LSNGVS  H
Sbjct  141  AASAREVLELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNPAENGSPLSNGVSLSH  197



>ref|XP_003608844.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
 gb|AES91041.1| oligomeric subunit-like protein [Medicago truncatula]
Length=754

 Score =   212 bits (540),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 144/185 (78%), Gaps = 1/185 (1%)
 Frame = +1

Query  67   APPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlss  246
            A  RS T+LF DP D++P  W  P  FLS DFD+E+YIS+LRTFVP DTLRSEL ++LSS
Sbjct  7    AHHRSTTNLFSDPLDSHP-LWFKPTSFLSPDFDSESYISELRTFVPFDTLRSELNNYLSS  65

Query  247  lqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHS  426
            L  +L+DLINRDYADFV+LSTKL DVDAAVVRMRAPL+E+R KI  FR +V+ SL A+ +
Sbjct  66   LNHELIDLINRDYADFVNLSTKLVDVDAAVVRMRAPLVELREKIEQFRGSVDVSLVAIKN  125

Query  427  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVS  606
             LKQR++A  ARE LELLLDTFHVVSKVEKLIKELPS  ++ +NG  N ++    SNGVS
Sbjct  126  GLKQRSEAASARETLELLLDTFHVVSKVEKLIKELPSVPSDWSNGDVNLSEKNPSSNGVS  185

Query  607  FQHTE  621
             Q  E
Sbjct  186  VQQVE  190



>ref|XP_011044173.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Populus euphratica]
Length=755

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 146/189 (77%), Gaps = 6/189 (3%)
 Frame = +1

Query  70   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  249
            PPRSA D F DP D +P  W  P LFLS +FD+++YIS+LRTFVP DTLRSEL++HL+SL
Sbjct  11   PPRSANDFFSDPLDFHP-LWFKPNLFLSPNFDSDSYISELRTFVPFDTLRSELQAHLASL  69

Query  250  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  429
              +L+DLINRDYADFV+LSTKL DVD+AVVRMRAPLLE+R KI  FR +VESSL AL + 
Sbjct  70   NHELIDLINRDYADFVNLSTKLVDVDSAVVRMRAPLLELREKIEGFRGSVESSLVALKNG  129

Query  430  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIA-----NYADNGYLS  594
            L+QR++A   REVLELLLDTFHVVSKVEKLIKELPS   + +NG       N A NG + 
Sbjct  130  LEQRSEAAVTREVLELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNSTEKNAASNGSIE  189

Query  595  NGVSFQHTE  621
            NG + + T+
Sbjct  190  NGTNVRETQ  198



>ref|XP_006440092.1| hypothetical protein CICLE_v10018979mg [Citrus clementina]
 gb|ESR53332.1| hypothetical protein CICLE_v10018979mg [Citrus clementina]
Length=757

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 145/184 (79%), Gaps = 1/184 (1%)
 Frame = +1

Query  70   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  249
            PPRSATDLF DP D++P  W    LFLS +FD+E+YIS+LRTFVP +TLRSEL++HLSSL
Sbjct  10   PPRSATDLFSDPADSHP-LWFKSNLFLSPNFDSESYISELRTFVPFETLRSELQAHLSSL  68

Query  250  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  429
              +L+DLINRDYADFV+LSTKL DVDAAVVRMRAPLLE+R KI  FR A+E SL AL + 
Sbjct  69   NHELIDLINRDYADFVNLSTKLVDVDAAVVRMRAPLLELREKIDGFRGALEGSLVALQNG  128

Query  430  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  609
            LKQR++A  AREVLELLLDTFHVVSKVEKLIKELPS   + ++   N  +   +S+  +F
Sbjct  129  LKQRSEAASAREVLELLLDTFHVVSKVEKLIKELPSLPADGSDVDVNLEERKSMSSATTF  188

Query  610  QHTE  621
            Q  E
Sbjct  189  QPVE  192



>ref|XP_006477014.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Citrus sinensis]
Length=757

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 145/184 (79%), Gaps = 1/184 (1%)
 Frame = +1

Query  70   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  249
            PPRSATDLF DP D++P  W    LFLS +FD+E+YIS+LRTFVP +TLRSEL++HLSSL
Sbjct  10   PPRSATDLFSDPADSHP-LWFKSNLFLSPNFDSESYISELRTFVPFETLRSELQAHLSSL  68

Query  250  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  429
              +L+DLINRDYADFV+LSTKL DVDAAVVRMRAPLLE+R KI  FR A+E SL AL + 
Sbjct  69   NHELIDLINRDYADFVNLSTKLVDVDAAVVRMRAPLLELREKIDGFRGALEGSLVALQNG  128

Query  430  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  609
            LKQR++A  AREVLELLLDTFHVVSKVEKLIKELPS   + ++   N  +   +S+  +F
Sbjct  129  LKQRSEAASAREVLELLLDTFHVVSKVEKLIKELPSVPADGSDFDVNLEERKSMSSATTF  188

Query  610  QHTE  621
            Q  E
Sbjct  189  QPVE  192



>gb|KDO52629.1| hypothetical protein CISIN_1g004390mg [Citrus sinensis]
Length=756

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 145/184 (79%), Gaps = 1/184 (1%)
 Frame = +1

Query  70   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  249
            PPRSATDLF DP D++P  W    LFLS +FD+E+YIS+LRTFVP +TLRSEL++HLSSL
Sbjct  10   PPRSATDLFSDPADSHP-LWFKSNLFLSPNFDSESYISELRTFVPFETLRSELQAHLSSL  68

Query  250  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  429
              +L+DLINRDYADFV+LSTKL DVDAAVVRMRAPLLE+R KI  FR A+E SL AL + 
Sbjct  69   NHELIDLINRDYADFVNLSTKLVDVDAAVVRMRAPLLELREKIDGFRGALEGSLVALQNG  128

Query  430  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  609
            LKQR++A  AREVLELLLDTFHVVSKVEKLIKELPS   + ++   N  +   +S+  +F
Sbjct  129  LKQRSEAASAREVLELLLDTFHVVSKVEKLIKELPSLPADGSDFDVNLEERKSMSSATTF  188

Query  610  QHTE  621
            Q  E
Sbjct  189  QPVE  192



>gb|KDO52630.1| hypothetical protein CISIN_1g004390mg [Citrus sinensis]
Length=757

 Score =   211 bits (538),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 145/184 (79%), Gaps = 1/184 (1%)
 Frame = +1

Query  70   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  249
            PPRSATDLF DP D++P  W    LFLS +FD+E+YIS+LRTFVP +TLRSEL++HLSSL
Sbjct  10   PPRSATDLFSDPADSHP-LWFKSNLFLSPNFDSESYISELRTFVPFETLRSELQAHLSSL  68

Query  250  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  429
              +L+DLINRDYADFV+LSTKL DVDAAVVRMRAPLLE+R KI  FR A+E SL AL + 
Sbjct  69   NHELIDLINRDYADFVNLSTKLVDVDAAVVRMRAPLLELREKIDGFRGALEGSLVALQNG  128

Query  430  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  609
            LKQR++A  AREVLELLLDTFHVVSKVEKLIKELPS   + ++   N  +   +S+  +F
Sbjct  129  LKQRSEAASAREVLELLLDTFHVVSKVEKLIKELPSLPADGSDFDVNLEERKSMSSATTF  188

Query  610  QHTE  621
            Q  E
Sbjct  189  QPVE  192



>emb|CAN71854.1| hypothetical protein VITISV_007347 [Vitis vinifera]
Length=777

 Score =   211 bits (537),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = +1

Query  70   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  249
            P RSATDLF DP D+ P  W     FL  +FD+E YISDLRT V  DTLRSEL++HL+SL
Sbjct  6    PTRSATDLFSDPIDSQPL-WFKKSSFLQPEFDSEAYISDLRTLVSFDTLRSELQTHLASL  64

Query  250  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  429
            + +L+DLINRDYADFV+LSTKL DVD A+VRMRAPL E+R KI  FRE+VES+L A+ + 
Sbjct  65   KHELIDLINRDYADFVNLSTKLVDVDGAIVRMRAPLTELREKILGFRESVESTLVAVQNG  124

Query  430  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  609
            L+QR++A  ARE+LELLLDTFHVVSKVEKLIKELPS   + +NG  N      L+NG+S 
Sbjct  125  LRQRSEASAAREILELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNSMARSSLNNGISL  184

Query  610  QHTE  621
            QH E
Sbjct  185  QHAE  188



>ref|XP_002279916.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Vitis 
vinifera]
 emb|CBI15649.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   211 bits (537),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = +1

Query  70   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  249
            P RSATDLF DP D+ P  W     FL  +FD+E YISDLRT V  DTLRSEL++HL+SL
Sbjct  6    PTRSATDLFSDPIDSQP-LWFKKSSFLQPEFDSEAYISDLRTLVSFDTLRSELQTHLASL  64

Query  250  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  429
            + +L+DLINRDYADFV+LSTKL DVD A+VRMRAPL E+R KI  FRE+VES+L A+ + 
Sbjct  65   KHELIDLINRDYADFVNLSTKLVDVDGAIVRMRAPLTELREKILGFRESVESTLVAVQNG  124

Query  430  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  609
            L+QR++A  ARE+LELLLDTFHVVSKVEKLIKELPS   + +NG  N      L+NG+S 
Sbjct  125  LRQRSEASAAREILELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNSMARSSLNNGISL  184

Query  610  QHTE  621
            QH E
Sbjct  185  QHAE  188



>ref|XP_006283181.1| hypothetical protein CARUB_v10004211mg [Capsella rubella]
 gb|EOA16079.1| hypothetical protein CARUB_v10004211mg [Capsella rubella]
Length=754

 Score =   211 bits (536),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 142/173 (82%), Gaps = 1/173 (1%)
 Frame = +1

Query  52   SSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselr  231
            +++P   PRSATD F DP D++P  W  P LFLS  FD+E+YIS+LRTFVP DTLRSELR
Sbjct  6    ATSPSQAPRSATDFFSDPYDSHP-LWFKPSLFLSPGFDSESYISELRTFVPFDTLRSELR  64

Query  232  shlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSL  411
            SHL+SL R+LVDLINRDYADFV+LSTKL D+DAAVVRMRAPLLE+R KI+ FR +VE++L
Sbjct  65   SHLASLNRELVDLINRDYADFVNLSTKLVDIDAAVVRMRAPLLELREKITAFRGSVEAAL  124

Query  412  SALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIAN  570
             AL + L+QR+DA  AREVLELLLDTFHVVSKVEKLIK LPS  ++  N  AN
Sbjct  125  FALRNGLQQRSDAAAAREVLELLLDTFHVVSKVEKLIKVLPSTPSDWQNEDAN  177



>gb|KJB43171.1| hypothetical protein B456_007G187600 [Gossypium raimondii]
Length=748

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 148/187 (79%), Gaps = 4/187 (2%)
 Frame = +1

Query  61   PGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshl  240
            P   PRSATDLF DP D++P  W  P LFLS DFD+E+YI++LRTFVP DTLRSEL++HL
Sbjct  6    PSPAPRSATDLFSDPLDSHP-MWFKPSLFLSPDFDSESYIAELRTFVPFDTLRSELQAHL  64

Query  241  sslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSAL  420
            SSL  +L+DLINRDYADFV+LSTKL DVD+AV+RMRAPLLE+R KI  FR AVE SL++L
Sbjct  65   SSLNHELIDLINRDYADFVNLSTKLVDVDSAVLRMRAPLLELRDKIQGFRGAVEGSLTSL  124

Query  421  HSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNG  600
             + L QRA+A  AREVLELLLDTFHVVSKVEKLIKELPS +++ +NG  N       SN 
Sbjct  125  KNGLSQRAEAAAAREVLELLLDTFHVVSKVEKLIKELPSVSSDWSNGDVNSMQK---SNA  181

Query  601  VSFQHTE  621
            +S QH E
Sbjct  182  LSSQHVE  188



>ref|XP_010536632.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Tarenaya 
hassleriana]
 ref|XP_010536633.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Tarenaya 
hassleriana]
Length=757

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 144/187 (77%), Gaps = 1/187 (1%)
 Frame = +1

Query  55   STPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrs  234
            +T   PPRSATDLF DP D++P  W  P LFLS +FD+E+YIS+LRTFVP DTLRSELRS
Sbjct  6    TTASPPPRSATDLFSDPQDSHP-LWFKPSLFLSPNFDSESYISELRTFVPFDTLRSELRS  64

Query  235  hlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLS  414
            HL+SL R+LVDLINRDYADFV+LSTKL DVDAAVVRMRAPLLE+R KI  FR +VE+ L 
Sbjct  65   HLASLNRELVDLINRDYADFVNLSTKLVDVDAAVVRMRAPLLELREKIVGFRGSVEAVLF  124

Query  415  ALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLS  594
            AL S L+QR+DA  ARE LE LL+TFH+VSKVEKLIK LPS  ++     AN      ++
Sbjct  125  ALRSGLQQRSDAAAAREDLESLLNTFHLVSKVEKLIKGLPSSPSDWPKDDANLIVKSSMN  184

Query  595  NGVSFQH  615
            +G S Q 
Sbjct  185  DGNSLQQ  191



>ref|XP_002322242.1| hypothetical protein POPTR_0015s10610g [Populus trichocarpa]
 gb|EEF06369.1| hypothetical protein POPTR_0015s10610g [Populus trichocarpa]
Length=757

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 140/175 (80%), Gaps = 1/175 (1%)
 Frame = +1

Query  76   RSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqr  255
            RS   LF DP D++P  W  P LFLS +FD+++YIS+LRTFVP DTLRSEL++HL+SL  
Sbjct  15   RSNAYLFSDPLDSHP-LWFKPDLFLSPNFDSDSYISELRTFVPFDTLRSELQAHLTSLNH  73

Query  256  DLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLK  435
            +L+DLINRDYADFV+LSTKL DVD+AVVRMRAPLLE+R KI  FR +VESSL AL + L+
Sbjct  74   ELIDLINRDYADFVNLSTKLVDVDSAVVRMRAPLLELREKIEGFRGSVESSLVALKNGLE  133

Query  436  QRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNG  600
            QR++A   REVLELLLDTFHVVSKVEKLIKELPS   + +NG  N A+   +SNG
Sbjct  134  QRSEAAATREVLELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNLAEKNVVSNG  188



>gb|KHG07418.1| Conserved oligomeric Golgi complex subunit 2 [Gossypium arboreum]
Length=754

 Score =   205 bits (522),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 148/187 (79%), Gaps = 4/187 (2%)
 Frame = +1

Query  61   PGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshl  240
            P   PRSATDLF DP D++P  W  P LFLS DFD+E+YI++LRTFVP DTLRSEL++HL
Sbjct  6    PSPAPRSATDLFSDPLDSHP-MWFKPSLFLSPDFDSESYIAELRTFVPFDTLRSELQAHL  64

Query  241  sslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSAL  420
            SSL  +L+DLINRDYADFV+LSTKL DVD+AV+RMRAPLLE+R KI  FR AVE SL++L
Sbjct  65   SSLNHELIDLINRDYADFVNLSTKLVDVDSAVLRMRAPLLELRDKIQGFRGAVEGSLTSL  124

Query  421  HSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNG  600
             + L QRA+A  AREVLELLLDTFHVVSKVEKLIKELPS +++ +NG  N       SN 
Sbjct  125  KNGLSQRAEAAAAREVLELLLDTFHVVSKVEKLIKELPSVSSDWSNGDVNSMQK---SNA  181

Query  601  VSFQHTE  621
            +S QH E
Sbjct  182  LSSQHVE  188



>gb|KJB43167.1| hypothetical protein B456_007G187600 [Gossypium raimondii]
 gb|KJB43168.1| hypothetical protein B456_007G187600 [Gossypium raimondii]
 gb|KJB43169.1| hypothetical protein B456_007G187600 [Gossypium raimondii]
 gb|KJB43170.1| hypothetical protein B456_007G187600 [Gossypium raimondii]
Length=754

 Score =   205 bits (522),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 148/187 (79%), Gaps = 4/187 (2%)
 Frame = +1

Query  61   PGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshl  240
            P   PRSATDLF DP D++P  W  P LFLS DFD+E+YI++LRTFVP DTLRSEL++HL
Sbjct  6    PSPAPRSATDLFSDPLDSHP-MWFKPSLFLSPDFDSESYIAELRTFVPFDTLRSELQAHL  64

Query  241  sslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSAL  420
            SSL  +L+DLINRDYADFV+LSTKL DVD+AV+RMRAPLLE+R KI  FR AVE SL++L
Sbjct  65   SSLNHELIDLINRDYADFVNLSTKLVDVDSAVLRMRAPLLELRDKIQGFRGAVEGSLTSL  124

Query  421  HSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNG  600
             + L QRA+A  AREVLELLLDTFHVVSKVEKLIKELPS +++ +NG  N       SN 
Sbjct  125  KNGLSQRAEAAAAREVLELLLDTFHVVSKVEKLIKELPSVSSDWSNGDVNSMQK---SNA  181

Query  601  VSFQHTE  621
            +S QH E
Sbjct  182  LSSQHVE  188



>ref|XP_011024042.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Populus euphratica]
Length=757

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 139/175 (79%), Gaps = 1/175 (1%)
 Frame = +1

Query  76   RSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqr  255
            RS   LF DP D++P  W  P LFLS +FD+++YIS+LRTFVP DTLRSEL++HL+SL  
Sbjct  15   RSNAYLFSDPLDSHP-LWFKPDLFLSPNFDSDSYISELRTFVPFDTLRSELQAHLTSLNH  73

Query  256  DLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLK  435
            +L+DLINRDYADFV+LSTKL DVD+AVVRMRAPLLE+R KI  FR +VESSL AL + L+
Sbjct  74   ELIDLINRDYADFVNLSTKLVDVDSAVVRMRAPLLELREKIEGFRGSVESSLVALKNGLE  133

Query  436  QRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNG  600
            QR++A   REVLELLLDTFHVVSKVEKLIKELPS   + +NG  N  +   +SNG
Sbjct  134  QRSEAAATREVLELLLDTFHVVSKVEKLIKELPSVPADWSNGDVNLVEKNVVSNG  188



>ref|XP_008794572.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Phoenix 
dactylifera]
 ref|XP_008794573.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Phoenix 
dactylifera]
Length=751

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 142/184 (77%), Gaps = 1/184 (1%)
 Frame = +1

Query  70   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  249
            PPRSATDLFGDP ++ P  W     F   DFD E+YI+DLR+FVPL++L +ELR+HLSSL
Sbjct  6    PPRSATDLFGDPIESQP-LWFKASSFHRPDFDPESYIADLRSFVPLESLAAELRAHLSSL  64

Query  250  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  429
            + +LVDLINRDYADFVSLST+L DVD+AV RMRAPL E R K++ FR  V+SSLS L S 
Sbjct  65   KAELVDLINRDYADFVSLSTRLVDVDSAVARMRAPLAEFRDKVAAFRAVVDSSLSNLRSG  124

Query  430  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  609
            L+QRA+A  ARE+LELLLDTFHVVSKVEKLIKELP+ A++L++      +    ++G S 
Sbjct  125  LRQRAEASAAREILELLLDTFHVVSKVEKLIKELPTTASDLSSADIASIEKNSPNSGNSL  184

Query  610  QHTE  621
            QH E
Sbjct  185  QHIE  188



>gb|EYU23122.1| hypothetical protein MIMGU_mgv1a024704mg [Erythranthe guttata]
Length=739

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 135/180 (75%), Gaps = 3/180 (2%)
 Frame = +1

Query  82   ATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDL  261
            ATDLFGDP + +    LNP  F   +FD E+YISDLRTFVP DTLRSELRSHL +L+ +L
Sbjct  2    ATDLFGDPIEDSH---LNPSKFSDPEFDPESYISDLRTFVPFDTLRSELRSHLGALKHEL  58

Query  262  VDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQR  441
            VDLINRDY DFVSLSTKL DVDAAVVRMRAPLLEI+ KI  FR +V+ SL+AL SR KQR
Sbjct  59   VDLINRDYVDFVSLSTKLVDVDAAVVRMRAPLLEIKEKILNFRGSVDFSLAALQSRRKQR  118

Query  442  ADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTE  621
            + A E REVLELLLDTFH VSKVEK+I ELPS    L NG     +   L N + FQH+E
Sbjct  119  SQADETREVLELLLDTFHAVSKVEKMINELPSVPAELPNGTTGSTEKDRLRNSIPFQHSE  178



>ref|XP_010927713.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Elaeis guineensis]
Length=751

 Score =   200 bits (508),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = +1

Query  70   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  249
            PPR ATDLFGDP ++ P  W     F S DFD E+YI+DLR+FVPL++L +ELR+HLS+L
Sbjct  6    PPRLATDLFGDPIESQP-LWFKASSFHSPDFDPESYIADLRSFVPLESLAAELRAHLSAL  64

Query  250  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  429
            + +LVDLINRDYADFVSLST+L DVD+AV RMR PL E R K++ FR  V+SSLS L S 
Sbjct  65   KAELVDLINRDYADFVSLSTRLVDVDSAVARMRDPLAEFRDKVAAFRTVVDSSLSNLRSG  124

Query  430  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  609
            L+QRA+A  ARE+LELLLDTFHVVSKVEKLIKELP+ A++L++      +    ++G S 
Sbjct  125  LRQRAEASAAREILELLLDTFHVVSKVEKLIKELPTTASDLSSADIASIEKSSPNSGNSL  184

Query  610  QHTE  621
            QH E
Sbjct  185  QHIE  188



>emb|CAB41124.1| brefeldin A-sensitive Golgi protein-like [Arabidopsis thaliana]
 emb|CAB79394.1| brefeldin A-sensitive Golgi protein-like [Arabidopsis thaliana]
Length=724

 Score =   199 bits (507),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 135/162 (83%), Gaps = 1/162 (1%)
 Frame = +1

Query  85   TDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLV  264
            TD F DP D++P  W  P LFLS +FD+E+YIS+LRTFVP DTLRSELRSHL+SL R+LV
Sbjct  19   TDFFSDPYDSHPL-WFKPSLFLSPNFDSESYISELRTFVPFDTLRSELRSHLASLNRELV  77

Query  265  DLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRA  444
            DLINRDYADFV+LSTKL D+DAAVVRMRAPLLE+R KI+ FR +VE++L AL + L+QR+
Sbjct  78   DLINRDYADFVNLSTKLVDIDAAVVRMRAPLLELREKITGFRGSVEAALFALRNGLQQRS  137

Query  445  DAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIAN  570
            DA  AREVLELLLDTFHVVSKVEKLIK LPS  ++  N  AN
Sbjct  138  DAAAAREVLELLLDTFHVVSKVEKLIKVLPSTPSDWQNEDAN  179



>gb|KFK29022.1| hypothetical protein AALP_AA7G078500 [Arabis alpina]
Length=756

 Score =   199 bits (507),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 142/181 (78%), Gaps = 1/181 (1%)
 Frame = +1

Query  73   PRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslq  252
            PRSATD F DP D++P  W  P LFLS DFD+E+YIS+LRTFVP DTLRSELRSHL+SL 
Sbjct  11   PRSATDFFSDPYDSHP-LWFKPSLFLSPDFDSESYISELRTFVPFDTLRSELRSHLASLN  69

Query  253  rDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRL  432
            R+LVDLINRDYADFV+LSTKL D+D AV RMRAPLL++R KI+ FR +V+S+L +L S L
Sbjct  70   RELVDLINRDYADFVNLSTKLVDIDTAVARMRAPLLDLREKITGFRGSVDSALFSLRSGL  129

Query  433  KQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQ  612
            +QR+DA  AREVLELLLDTFHVVSKVEKLIK L +  ++  N  AN      L++  S Q
Sbjct  130  QQRSDAAAAREVLELLLDTFHVVSKVEKLIKVLQTTPSDWQNEDANSMGRSSLNDENSAQ  189

Query  613  H  615
            +
Sbjct  190  N  190



>gb|AAK32887.1|AF367300_1 AT4g24840/F6I7_50 [Arabidopsis thaliana]
 gb|AAM10288.1| AT4g24840/F6I7_50 [Arabidopsis thaliana]
Length=756

 Score =   199 bits (506),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 135/162 (83%), Gaps = 1/162 (1%)
 Frame = +1

Query  85   TDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLV  264
            TD F DP D++P  W  P LFLS +FD+E+YIS+LRTFVP DTLRSELRSHL+SL R+LV
Sbjct  19   TDFFSDPYDSHP-LWFKPSLFLSPNFDSESYISELRTFVPFDTLRSELRSHLASLNRELV  77

Query  265  DLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRA  444
            DLINRDYADFV+LSTKL D+DAAVVRMRAPLLE+R KI+ FR +VE++L AL + L+QR+
Sbjct  78   DLINRDYADFVNLSTKLVDIDAAVVRMRAPLLELREKITGFRGSVEAALFALRNGLQQRS  137

Query  445  DAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIAN  570
            DA  AREVLELLLDTFHVVSKVEKLIK LPS  ++  N  AN
Sbjct  138  DAAAAREVLELLLDTFHVVSKVEKLIKVLPSTPSDWQNEDAN  179



>ref|XP_010926721.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
isoform X2 [Elaeis guineensis]
Length=631

 Score =   198 bits (503),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = +1

Query  70   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  249
            PPRSATDLFGDP ++ P  W     FL  DF+ E+YI+DLR+FVPL++L +ELR+HL++L
Sbjct  6    PPRSATDLFGDPIESQP-LWFKAASFLRPDFEPESYIADLRSFVPLESLAAELRAHLAAL  64

Query  250  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  429
            + +LVDLINRDYADFVSLST+L DVD+AV RMRAPL E R K++ F   V+SSL+ L S 
Sbjct  65   KAELVDLINRDYADFVSLSTRLVDVDSAVARMRAPLAEFRDKVAAFHAVVDSSLANLCSG  124

Query  430  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  609
            L+QRA+A  ARE+LELLLDTFHVVSKVEKLIKELP+ A++L+       D+   ++  + 
Sbjct  125  LRQRAEASAAREILELLLDTFHVVSKVEKLIKELPTTASDLSTADMASIDSSAPNSENAL  184

Query  610  QHTE  621
            QH E
Sbjct  185  QHIE  188



>ref|NP_567710.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE84970.1| uncharacterized protein AT4G24840 [Arabidopsis thaliana]
Length=756

 Score =   199 bits (506),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 135/162 (83%), Gaps = 1/162 (1%)
 Frame = +1

Query  85   TDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLV  264
            TD F DP D++P  W  P LFLS +FD+E+YIS+LRTFVP DTLRSELRSHL+SL R+LV
Sbjct  19   TDFFSDPYDSHP-LWFKPSLFLSPNFDSESYISELRTFVPFDTLRSELRSHLASLNRELV  77

Query  265  DLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRA  444
            DLINRDYADFV+LSTKL D+DAAVVRMRAPLLE+R KI+ FR +VE++L AL + L+QR+
Sbjct  78   DLINRDYADFVNLSTKLVDIDAAVVRMRAPLLELREKITGFRGSVEAALFALRNGLQQRS  137

Query  445  DAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIAN  570
            DA  AREVLELLLDTFHVVSKVEKLIK LPS  ++  N  AN
Sbjct  138  DAAAAREVLELLLDTFHVVSKVEKLIKVLPSTPSDWQNEDAN  179



>ref|XP_010433717.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Camelina sativa]
Length=757

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 130/151 (86%), Gaps = 1/151 (1%)
 Frame = +1

Query  85   TDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLV  264
            TD F DP D++P  W  P LFLS  FD+E+YIS+LRTFVP DTLRSELRSHL+SL R+LV
Sbjct  20   TDFFSDPYDSHP-LWFKPSLFLSPGFDSESYISELRTFVPFDTLRSELRSHLASLNRELV  78

Query  265  DLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRA  444
            DLINRDYADFV+LSTKL D+DAAVVRMRAPLLE+R KI+ FR +VE++L AL + L+QR+
Sbjct  79   DLINRDYADFVNLSTKLVDIDAAVVRMRAPLLELREKITAFRGSVEAALFALRNGLQQRS  138

Query  445  DAGEAREVLELLLDTFHVVSKVEKLIKELPS  537
            DAG AREVLELLLDTFHVVSKVEKLIK LPS
Sbjct  139  DAGAAREVLELLLDTFHVVSKVEKLIKVLPS  169



>ref|XP_010926719.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010926720.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
isoform X1 [Elaeis guineensis]
Length=753

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = +1

Query  70   PPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlssl  249
            PPRSATDLFGDP ++ P  W     FL  DF+ E+YI+DLR+FVPL++L +ELR+HL++L
Sbjct  6    PPRSATDLFGDPIESQP-LWFKAASFLRPDFEPESYIADLRSFVPLESLAAELRAHLAAL  64

Query  250  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  429
            + +LVDLINRDYADFVSLST+L DVD+AV RMRAPL E R K++ F   V+SSL+ L S 
Sbjct  65   KAELVDLINRDYADFVSLSTRLVDVDSAVARMRAPLAEFRDKVAAFHAVVDSSLANLCSG  124

Query  430  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSF  609
            L+QRA+A  ARE+LELLLDTFHVVSKVEKLIKELP+ A++L+       D+   ++  + 
Sbjct  125  LRQRAEASAAREILELLLDTFHVVSKVEKLIKELPTTASDLSTADMASIDSSAPNSENAL  184

Query  610  QHTE  621
            QH E
Sbjct  185  QHIE  188



>ref|XP_002867640.1| hypothetical protein ARALYDRAFT_492352 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43899.1| hypothetical protein ARALYDRAFT_492352 [Arabidopsis lyrata subsp. 
lyrata]
Length=756

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 135/162 (83%), Gaps = 1/162 (1%)
 Frame = +1

Query  85   TDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLV  264
            TD F DP D++P  W  P LFLS +FD+E+YIS+LRTFVP DTLRSELRSHL+SL R+LV
Sbjct  19   TDFFSDPYDSHP-LWFKPSLFLSPNFDSESYISELRTFVPFDTLRSELRSHLASLNRELV  77

Query  265  DLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRA  444
            DLINRDYADFV+LSTKL D+DAAVVRMRAPLLE+R KI+ FR +VE++L +L + L+QR+
Sbjct  78   DLINRDYADFVNLSTKLVDIDAAVVRMRAPLLELREKITGFRGSVEAALFSLRNGLQQRS  137

Query  445  DAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIAN  570
            DA  AREVLELLLDTFHVVSKVEKLIK LPS  ++  N  AN
Sbjct  138  DAAAAREVLELLLDTFHVVSKVEKLIKVLPSTPSDWQNEDAN  179



>ref|XP_009137478.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Brassica rapa]
Length=757

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 130/157 (83%), Gaps = 1/157 (1%)
 Frame = +1

Query  88   DLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVD  267
            D F DP D++P  W  P LFLS DFD+E+YIS+LRTFVP DTLRSE+RSHL+SL R+LVD
Sbjct  20   DFFSDPYDSHP-LWFKPSLFLSPDFDSESYISELRTFVPFDTLRSEIRSHLASLNRELVD  78

Query  268  LINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRAD  447
            LINRDYADFVSLSTKL D+D AVVRMRAPLL IR KI+ FR +VE++L AL S L+QR+D
Sbjct  79   LINRDYADFVSLSTKLVDIDEAVVRMRAPLLGIREKIAAFRGSVEAALFALRSGLQQRSD  138

Query  448  AGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLAN  558
            A  AREVLELLLDTFHVVSKVEKLIK LPS  ++  N
Sbjct  139  AAAAREVLELLLDTFHVVSKVEKLIKVLPSAPSDWKN  175



>emb|CDX92658.1| BnaC07g39160D [Brassica napus]
Length=757

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 130/157 (83%), Gaps = 1/157 (1%)
 Frame = +1

Query  88   DLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVD  267
            D F DP D++P  W  P LFLS DFD+E+YIS+LRTFVP DTLRSELRSHL+SL R+LVD
Sbjct  20   DFFSDPYDSHP-LWFKPSLFLSPDFDSESYISELRTFVPFDTLRSELRSHLASLNRELVD  78

Query  268  LINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRAD  447
            LINRDYADFVSLSTKL D+D AVVRMRAPLL IR KI+ FR +VE++L AL S L+QR+D
Sbjct  79   LINRDYADFVSLSTKLVDIDEAVVRMRAPLLGIREKIAAFRGSVEAALFALRSGLQQRSD  138

Query  448  AGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLAN  558
            A  AREVLELLLDTFHVVSKVEKLIK LPS  ++  N
Sbjct  139  AAAAREVLELLLDTFHVVSKVEKLIKVLPSAPSDWKN  175



>ref|XP_010438959.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Camelina sativa]
Length=756

 Score =   196 bits (499),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 129/151 (85%), Gaps = 1/151 (1%)
 Frame = +1

Query  85   TDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLV  264
            TD F DP D++P  W  P LFLS  FD+E+YIS+LRTFVP DTLRSELRSHL+SL R+LV
Sbjct  19   TDFFSDPYDSHP-LWFKPSLFLSPGFDSESYISELRTFVPFDTLRSELRSHLASLNRELV  77

Query  265  DLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRA  444
            DLINRDYADFV+LSTKL D+DAAVVRMRAPLLE+R KI+ FR +VE++L AL + L+QR+
Sbjct  78   DLINRDYADFVNLSTKLVDIDAAVVRMRAPLLELREKITAFRGSVEAALFALRNGLQQRS  137

Query  445  DAGEAREVLELLLDTFHVVSKVEKLIKELPS  537
            DA  AREVLELLLDTFHVVSKVEKLIK LPS
Sbjct  138  DAAAAREVLELLLDTFHVVSKVEKLIKVLPS  168



>ref|XP_010448510.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Camelina sativa]
Length=756

 Score =   196 bits (498),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 129/151 (85%), Gaps = 1/151 (1%)
 Frame = +1

Query  85   TDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLV  264
            TD F DP D++P  W  P LFLS  FD+E+YIS+LRTFVP DTLRSELRSHL+SL R+LV
Sbjct  19   TDFFSDPYDSHP-LWFKPSLFLSPGFDSESYISELRTFVPFDTLRSELRSHLASLNRELV  77

Query  265  DLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRA  444
            DLINRDYADFV+LSTKL D+DAAVVRMRAPLLE+R KI+ FR +VE++L AL + L+QR+
Sbjct  78   DLINRDYADFVNLSTKLVDIDAAVVRMRAPLLELREKITAFRGSVEAALFALRNGLQQRS  137

Query  445  DAGEAREVLELLLDTFHVVSKVEKLIKELPS  537
            DA  AREVLELLLDTFHVVSKVEKLIK LPS
Sbjct  138  DAAAAREVLELLLDTFHVVSKVEKLIKVLPS  168



>emb|CDY11039.1| BnaA03g46980D [Brassica napus]
Length=757

 Score =   196 bits (498),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 127/151 (84%), Gaps = 1/151 (1%)
 Frame = +1

Query  88   DLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVD  267
            D F DP D++P  W  P LFLS DFD+E+YIS+LRTFVP DTLRSELRSHL+SL R+LVD
Sbjct  20   DFFSDPYDSHPL-WFKPSLFLSPDFDSESYISELRTFVPFDTLRSELRSHLASLNRELVD  78

Query  268  LINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRAD  447
            LINRDYADFVSLSTKL D+D AVVRMRAPLL IR KI+ FR +VE++L AL S L+QR+D
Sbjct  79   LINRDYADFVSLSTKLVDIDEAVVRMRAPLLGIREKIAAFRGSVEAALFALRSGLQQRSD  138

Query  448  AGEAREVLELLLDTFHVVSKVEKLIKELPSG  540
            A  AREVLELLLDTFHVVSKVEKLIK LPS 
Sbjct  139  AAAAREVLELLLDTFHVVSKVEKLIKVLPSA  169



>ref|XP_006413377.1| hypothetical protein EUTSA_v10024490mg [Eutrema salsugineum]
 gb|ESQ54830.1| hypothetical protein EUTSA_v10024490mg [Eutrema salsugineum]
Length=759

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 136/176 (77%), Gaps = 1/176 (1%)
 Frame = +1

Query  88   DLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVD  267
            D F DP D++P  W  P LFLS  FD+E+YIS+LRTFVP DTLRSELRSHL+SL R+LVD
Sbjct  20   DFFSDPYDSHP-LWFKPSLFLSPGFDSESYISELRTFVPFDTLRSELRSHLASLNRELVD  78

Query  268  LINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRAD  447
            LINRDYADFV+LSTKL D+DAAVVRMRAPLL++R KI+ FR +VE++L AL S L+QR+ 
Sbjct  79   LINRDYADFVNLSTKLVDIDAAVVRMRAPLLDLREKITGFRGSVEAALFALRSGLQQRSH  138

Query  448  AGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQH  615
            A  AREVLELLLDTFHVVSKVEKLIK LPS  ++  N  AN      +S   S Q 
Sbjct  139  AAAAREVLELLLDTFHVVSKVEKLIKVLPSAPSDWQNEDANSLGRSSMSVETSTQQ  194



>ref|XP_009385490.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=716

 Score =   194 bits (492),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 145/199 (73%), Gaps = 10/199 (5%)
 Frame = +1

Query  25   MTDLHSPQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVP  204
            MTDL       TP +P   ATDLFGDP DA PP W     FL  DF  E Y++DLR+FVP
Sbjct  1    MTDL------VTPRSP---ATDLFGDPIDAKPP-WFKSSSFLRPDFVPEFYVADLRSFVP  50

Query  205  LDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKIST  384
            L++L +ELRSHL+ L+ +LVDLINRDYADFV LST+L DVDAA  RMRAPL+E R K+++
Sbjct  51   LESLAAELRSHLADLKAELVDLINRDYADFVGLSTRLVDVDAAAGRMRAPLVEFRDKVAS  110

Query  385  FREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGI  564
            FR  V+++L A+ S L+QR++A  ARE+L+LLLDTFHVVSKVEKLIKELP+  +N ++  
Sbjct  111  FRAVVDAALVAIRSGLRQRSEASAAREILQLLLDTFHVVSKVEKLIKELPTTHSNQSSPD  170

Query  565  ANYADNGYLSNGVSFQHTE  621
               ++ G L+N  S Q+ E
Sbjct  171  TVSSEKGSLTNANSIQNVE  189



>ref|XP_009385489.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=750

 Score =   194 bits (492),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 145/199 (73%), Gaps = 10/199 (5%)
 Frame = +1

Query  25   MTDLHSPQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVP  204
            MTDL       TP +P   ATDLFGDP DA PP W     FL  DF  E Y++DLR+FVP
Sbjct  1    MTDL------VTPRSP---ATDLFGDPIDAKPP-WFKSSSFLRPDFVPEFYVADLRSFVP  50

Query  205  LDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKIST  384
            L++L +ELRSHL+ L+ +LVDLINRDYADFV LST+L DVDAA  RMRAPL+E R K+++
Sbjct  51   LESLAAELRSHLADLKAELVDLINRDYADFVGLSTRLVDVDAAAGRMRAPLVEFRDKVAS  110

Query  385  FREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGI  564
            FR  V+++L A+ S L+QR++A  ARE+L+LLLDTFHVVSKVEKLIKELP+  +N ++  
Sbjct  111  FRAVVDAALVAIRSGLRQRSEASAAREILQLLLDTFHVVSKVEKLIKELPTTHSNQSSPD  170

Query  565  ANYADNGYLSNGVSFQHTE  621
               ++ G L+N  S Q+ E
Sbjct  171  TVSSEKGSLTNANSIQNVE  189



>emb|CDY03412.1| BnaC01g16700D [Brassica napus]
Length=760

 Score =   192 bits (487),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 140/172 (81%), Gaps = 1/172 (1%)
 Frame = +1

Query  25   MTDLHSPQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVP  204
            M+DL +   S +P + PRSA+D F DP D++P  W  P LFLS  FD+E+YIS+LRTFVP
Sbjct  1    MSDLVATSPSPSPSSAPRSASDFFSDPYDSHP-LWFKPSLFLSPVFDSESYISELRTFVP  59

Query  205  LDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKIST  384
             DTLRSELRSHL+SL R+LVDLINRDYADFVSLSTKL D+D AVVRMRAPLL +R KI+ 
Sbjct  60   FDTLRSELRSHLASLNRELVDLINRDYADFVSLSTKLVDIDEAVVRMRAPLLGLREKIAA  119

Query  385  FREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSG  540
            FR +VE++L AL S L+QR+DA  AREVLELLLDTFHVVSKVEKLIK LPS 
Sbjct  120  FRGSVEAALFALRSGLQQRSDAASAREVLELLLDTFHVVSKVEKLIKVLPSA  171



>emb|CDY34317.1| BnaA01g14200D [Brassica napus]
Length=758

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 140/187 (75%), Gaps = 12/187 (6%)
 Frame = +1

Query  88   DLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVD  267
            D F DP D++P  W  P LFLS  FD+E+YIS+LRTFVP DTLRSELRSHL+SL R+LVD
Sbjct  20   DFFSDPYDSHP-LWFKPSLFLSPVFDSESYISELRTFVPFDTLRSELRSHLASLNRELVD  78

Query  268  LINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRAD  447
            LINRDYADFVSLSTKL D+D AVVRMRAPLL +R KI+ FR +VE++L AL S L+QR+D
Sbjct  79   LINRDYADFVSLSTKLVDIDEAVVRMRAPLLGLREKIAAFRGSVEAALFALRSGLQQRSD  138

Query  448  AGEAREVLELLLDTFHVVSKVEKLIKELPS---------GATNLANGIANYADNGYLSNG  600
            A  AREVLELLLDTFHVVSKVEKLIK LPS         G  +L + ++   +N    +G
Sbjct  139  AASAREVLELLLDTFHVVSKVEKLIKVLPSAPSDWQKEDGGVSLRSSVS--VENSTQQDG  196

Query  601  VSFQHTE  621
             + + T+
Sbjct  197  TTMRETQ  203



>ref|XP_010485902.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Camelina sativa]
Length=760

 Score =   191 bits (486),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 136/176 (77%), Gaps = 1/176 (1%)
 Frame = +1

Query  88   DLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVD  267
            + F DP D +P  W  P LFLS  FD+E+YIS+LRTFVP DTLRS+L+SHL+SL R+LVD
Sbjct  22   EFFSDPYDPHP-LWFKPSLFLSPGFDSESYISELRTFVPFDTLRSQLQSHLASLNRELVD  80

Query  268  LINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRAD  447
            LINRDYADFV+LSTKL D+DAAV+RMRAPLLE+R KI+ FR +VE++L AL + L QR+D
Sbjct  81   LINRDYADFVNLSTKLVDIDAAVIRMRAPLLELREKITRFRGSVEAALFALRNALHQRSD  140

Query  448  AGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQH  615
            A  +REVLELLL+TFHVVSKVEKLIK LP+   +  N  AN    G +S+ +  Q 
Sbjct  141  AAASREVLELLLNTFHVVSKVEKLIKVLPNTPCDWQNEDANSLVRGSMSDEIPTQQ  196



>gb|KHN34411.1| Conserved oligomeric Golgi complex subunit 2 [Glycine soja]
Length=735

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 130/185 (70%), Gaps = 21/185 (11%)
 Frame = +1

Query  67   APPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlss  246
            APPRSATDLF DP DA+P  W  P  FLS DFD+E+YIS+LRTFVP DTLRSEL S+LSS
Sbjct  7    APPRSATDLFSDPLDAHP-LWFKPASFLSPDFDSESYISELRTFVPFDTLRSELNSYLSS  65

Query  247  lqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHS  426
            L  +L+DLINRDYADFV+LSTKL DVDA                     +VE SL A+ S
Sbjct  66   LNHELIDLINRDYADFVNLSTKLVDVDAG--------------------SVEVSLVAIKS  105

Query  427  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVS  606
            RL+QR++   ARE LELLLD FHVVSKVEKLIKELPS  T+ +NG  N ++    SNGVS
Sbjct  106  RLRQRSEVASARETLELLLDAFHVVSKVEKLIKELPSVPTDWSNGDVNLSERNNFSNGVS  165

Query  607  FQHTE  621
             QH E
Sbjct  166  VQHVE  170



>ref|XP_006296685.1| hypothetical protein CARUB_v10013037mg [Capsella rubella]
 gb|EOA29583.1| hypothetical protein CARUB_v10013037mg [Capsella rubella]
Length=760

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 137/176 (78%), Gaps = 1/176 (1%)
 Frame = +1

Query  88   DLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVD  267
            + F DP +++P  W  P LFLS  FD+E+YIS+LRTFVP DTLRS+LRSHL+SL  +LVD
Sbjct  22   EFFSDPFESHP-LWFKPSLFLSPGFDSESYISELRTFVPFDTLRSQLRSHLASLNGELVD  80

Query  268  LINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRAD  447
            LINRDYADFV+LSTKL D+DAAV+RMRAPLLE+R KI+ FR ++E+SL +L + L QR+D
Sbjct  81   LINRDYADFVNLSTKLVDIDAAVIRMRAPLLELREKITGFRGSLEASLFSLSNGLHQRSD  140

Query  448  AGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQH  615
            A  AREVL+LLL+TFHVVSKVEKLIK LP+  ++  N  AN     ++S+ +  Q 
Sbjct  141  AAAAREVLDLLLNTFHVVSKVEKLIKVLPTAPSDWQNEGANSLGRSFMSDDIPTQQ  196



>ref|XP_009138596.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Brassica 
rapa]
Length=758

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 139/187 (74%), Gaps = 12/187 (6%)
 Frame = +1

Query  88   DLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVD  267
            D F DP D++P  W  P LFLS  FD+E+YIS+LRT VP DTLRSELRSHL+SL R+LVD
Sbjct  20   DFFSDPYDSHP-LWFKPFLFLSPVFDSESYISELRTSVPFDTLRSELRSHLASLNRELVD  78

Query  268  LINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRAD  447
            LINRDYADFVSLSTKL D+D AVVRMRAPLL +R KI+ FR +VE++L AL S L+QR+D
Sbjct  79   LINRDYADFVSLSTKLVDIDEAVVRMRAPLLGLREKIAAFRGSVEAALFALRSGLQQRSD  138

Query  448  AGEAREVLELLLDTFHVVSKVEKLIKELPS---------GATNLANGIANYADNGYLSNG  600
            A  AREVLELLLDTFHVVSKVEKLIK LPS         G  +L + ++   +N    +G
Sbjct  139  AASAREVLELLLDTFHVVSKVEKLIKVLPSAPSDWQKEDGGVSLRSSVS--VENSTQQDG  196

Query  601  VSFQHTE  621
             + + T+
Sbjct  197  TTMRETQ  203



>ref|XP_010464008.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Camelina sativa]
Length=764

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 129/157 (82%), Gaps = 1/157 (1%)
 Frame = +1

Query  88   DLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVD  267
            + F DP D++P  W  P LFLS  FD+E+YIS+LRTFVP DTLRS+LRSHL+SL R+LVD
Sbjct  26   EFFSDPYDSHP-LWFKPSLFLSPGFDSESYISELRTFVPFDTLRSQLRSHLASLNRELVD  84

Query  268  LINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRAD  447
            LINRDYADFV+LSTKL D+DAAV+RMRAPLLE+R KI+ FR +VE++L +L + L QR+D
Sbjct  85   LINRDYADFVNLSTKLVDIDAAVIRMRAPLLELREKITGFRGSVEAALFSLRNGLHQRSD  144

Query  448  AGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLAN  558
            A  +REVLELLL+TFHVVSKVEKLIK LP+   +  N
Sbjct  145  AAASREVLELLLNTFHVVSKVEKLIKVLPTTPCHWQN  181



>ref|XP_006848427.1| hypothetical protein AMTR_s00013p00234340 [Amborella trichopoda]
 gb|ERN10008.1| hypothetical protein AMTR_s00013p00234340 [Amborella trichopoda]
Length=805

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 134/183 (73%), Gaps = 1/183 (1%)
 Frame = +1

Query  73   PRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslq  252
            PRS +DLFGDP D+ P  W    +F  +DFD + Y++DLR FVPL++LR+ELR+HLS+L+
Sbjct  12   PRSTSDLFGDPHDSQP-LWFKKEVFSQQDFDPDAYVADLRRFVPLESLRAELRAHLSTLK  70

Query  253  rDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRL  432
             +LV+LINRDYADFVSLSTKL DVD AV+RMRAPL E+R +IS FR +VE+S ++L   L
Sbjct  71   SELVELINRDYADFVSLSTKLVDVDGAVLRMRAPLNELRARISQFRASVEASFTSLRDGL  130

Query  433  KQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQ  612
            ++RADA  +REVLE LLDT HVVSKVEKLI ELPS   + +N      +    SN  S Q
Sbjct  131  QKRADAAASREVLERLLDTSHVVSKVEKLILELPSTPADWSNPDIAPTNKSLFSNDASLQ  190

Query  613  HTE  621
              E
Sbjct  191  PVE  193



>emb|CDY51233.1| BnaA03g07050D [Brassica napus]
Length=724

 Score =   174 bits (440),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 119/158 (75%), Gaps = 2/158 (1%)
 Frame = +1

Query  73   PRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslq  252
            PRSA D+F D  D+ PP W NP LFLS  FD+E++ISDLRTFVP DTLRSELRSHLSSL 
Sbjct  11   PRSAADVFWD--DSRPPLWFNPSLFLSPVFDSESFISDLRTFVPFDTLRSELRSHLSSLN  68

Query  253  rDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRL  432
             +LVD INRDYADFV+LS KL D+D   VRMRAPLLE+R +IS FR +VE +  A  S L
Sbjct  69   GELVDHINRDYADFVNLSAKLVDIDETAVRMRAPLLELREEISAFRGSVEDAHVARASGL  128

Query  433  KQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGAT  546
             QR D G AREVLE  LD F VVSKVEKL++E   GAT
Sbjct  129  NQRNDTGAAREVLESSLDAFRVVSKVEKLLQEQQDGAT  166



>ref|XP_009131654.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Brassica rapa]
Length=724

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  73   PRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslq  252
            PRSA D+F D  D+ PP W NP LFLS  FD+E++ISDLRTFVP DTLRSELRSHLSSL 
Sbjct  11   PRSAADVFWD--DSRPPLWFNPSLFLSPVFDSESFISDLRTFVPFDTLRSELRSHLSSLN  68

Query  253  rDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRL  432
             +LV  INRDYADF +LS KL D+D   VRMRAP LE+R +IS FR +VE +  A  S L
Sbjct  69   GELVGHINRDYADFGNLSAKLVDIDETAVRMRAPPLELREEISAFRGSVEDAHVARASGL  128

Query  433  KQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGAT  546
             QR D G AREVLE  LD F VVSKVEKL++E   GAT
Sbjct  129  NQRNDTGAAREVLESSLDAFRVVSKVEKLLQEQQDGAT  166



>emb|CDX70811.1| BnaC03g08950D [Brassica napus]
Length=725

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 120/159 (75%), Gaps = 3/159 (2%)
 Frame = +1

Query  73   PRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDL-RTFVPLDTlrselrshlssl  249
            PRSA D+F D  D+ PP W NP  FLS  FD+E++ISDL RTFVP DTLRSELRSH++SL
Sbjct  11   PRSAADVFWD--DSRPPLWFNPSPFLSPVFDSESFISDLLRTFVPFDTLRSELRSHVTSL  68

Query  250  qrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSR  429
              +L+D INRDYADFV LSTKL D+DA   RMRAPLLE+R +I+TFR +VE++  A  S 
Sbjct  69   NSELLDRINRDYADFVDLSTKLVDIDATATRMRAPLLELRDEINTFRGSVEAARVARASG  128

Query  430  LKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGAT  546
            L QR DA  AREVLE  L+ F VVSKVEKLI+E   GA+
Sbjct  129  LNQRYDAEAAREVLESSLEAFRVVSKVEKLIQEQQDGAS  167



>ref|NP_001051898.1| Os03g0849600 [Oryza sativa Japonica Group]
 gb|AAO37946.1| putative conserved oligomeric Golgi complex component [Oryza 
sativa Japonica Group]
 gb|ABF99909.1| brefeldin A-sensitive Golgi protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13812.1| Os03g0849600 [Oryza sativa Japonica Group]
 gb|EAZ29309.1| hypothetical protein OsJ_13370 [Oryza sativa Japonica Group]
Length=754

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 131/178 (74%), Gaps = 3/178 (2%)
 Frame = +1

Query  64   GAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshls  243
             APP   TDLFG+P +A+PP W  P  FL  DFD + Y++DLR++VPLD+L +ELRSHL+
Sbjct  7    AAPP--PTDLFGEPIEAHPP-WFKPDSFLRPDFDPDAYVADLRSYVPLDSLAAELRSHLA  63

Query  244  slqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALH  423
            SL+ +LV LINRDYADFV LS +L  VDAA  RMR PL E+R K+++FR A  + L+AL 
Sbjct  64   SLRAELVGLINRDYADFVGLSARLKGVDAAAARMRPPLAELRDKVASFRAAAAAGLAALR  123

Query  424  SRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSN  597
            S L+QRA A  ARE+LELLLDT HVVSKVEKLIKELPS  ++ +N  A   D GY  N
Sbjct  124  SGLEQRAAATAARELLELLLDTSHVVSKVEKLIKELPSAPSDSSNVEAVSGDKGYSGN  181



>ref|XP_001761415.1| predicted protein [Physcomitrella patens]
 gb|EDQ73804.1| predicted protein [Physcomitrella patens]
Length=678

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 112/154 (73%), Gaps = 2/154 (1%)
 Frame = +1

Query  76   RSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqr  255
            +S   LF D  D++ P W     FLS  FDAE YISDLR FVP +TLR+ELR HL  L+ 
Sbjct  20   KSVASLFQD--DSSGPLWFKKDAFLSGSFDAEAYISDLRRFVPFETLRAELRDHLGGLKS  77

Query  256  DLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLK  435
            +LV+LINRDYADFV+L+TKL DVD AV+RMR PL E+R K+   R+ V S+L  L   LK
Sbjct  78   ELVELINRDYADFVNLTTKLVDVDGAVLRMRMPLNELRGKLVVVRDNVNSTLLLLQDGLK  137

Query  436  QRADAGEAREVLELLLDTFHVVSKVEKLIKELPS  537
            +RADA  +RE+L+LLLDT HVVSKVEKL+ EL S
Sbjct  138  RRADASASREMLDLLLDTSHVVSKVEKLLLELQS  171



>gb|EEC76534.1| hypothetical protein OsI_14326 [Oryza sativa Indica Group]
Length=754

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 131/178 (74%), Gaps = 3/178 (2%)
 Frame = +1

Query  64   GAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshls  243
             APP   TDLFG+P +A+PP W  P  FL  DFD + Y++DLR++VPLD+L +ELRSHL+
Sbjct  7    AAPP--PTDLFGEPIEAHPP-WFKPDSFLRPDFDPDAYVADLRSYVPLDSLAAELRSHLA  63

Query  244  slqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALH  423
            SL+ +LV LINRDYADFV LS +L  VDAA  RMR PL E+R K+++FR A  + L+AL 
Sbjct  64   SLRAELVGLINRDYADFVGLSARLKGVDAAAARMRPPLAELRDKVASFRAAAAAGLAALR  123

Query  424  SRLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSN  597
            + L+QRA A  ARE+LELLLDT HVVSKVEKLIKELPS  ++ +N  A   D GY  N
Sbjct  124  AGLEQRAAATAARELLELLLDTSHVVSKVEKLIKELPSAPSDSSNVEAVSGDKGYSGN  181



>dbj|BAK01513.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=767

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 126/170 (74%), Gaps = 1/170 (1%)
 Frame = +1

Query  88   DLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVD  267
            DLFG+  +A+PP W  P  FL   FD + Y+++LR++VPL++L +ELRSHL++L+ +LV 
Sbjct  26   DLFGETIEAHPP-WFRPEAFLRAGFDPDAYVAELRSYVPLESLAAELRSHLAALRAELVG  84

Query  268  LINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRAD  447
            LINRDYADFV LS +L  VDAA  RMRAPL ++R K++ FR A  ++L+AL + L+QRA 
Sbjct  85   LINRDYADFVGLSARLKGVDAAAARMRAPLADLRDKVAAFRAAASAALAALRAGLEQRAA  144

Query  448  AGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSN  597
            A +ARE+LELLLDT HVVSKVEKLIKELP+  ++ ++      D GY  N
Sbjct  145  ATQARELLELLLDTSHVVSKVEKLIKELPTAPSDSSDVEVRSVDKGYSGN  194



>ref|XP_002966110.1| hypothetical protein SELMODRAFT_86129 [Selaginella moellendorffii]
 gb|EFJ32137.1| hypothetical protein SELMODRAFT_86129 [Selaginella moellendorffii]
Length=714

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 120/174 (69%), Gaps = 13/174 (7%)
 Frame = +1

Query  82   ATDLFGDPTDANP-PQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrD  258
            A+ LFGD  D +P P W     F+  DFD + +IS LR+FVPL+ LR ELRSHL++L+ +
Sbjct  2    ASMLFGD--DPDPLPLWFKKDAFMDPDFDCDAHISSLRSFVPLEALRGELRSHLAALKNE  59

Query  259  LVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQ  438
            LV+LINRDY DFVSLST+L DVD AV+RMR PL E+R K+ T R+ V+ +L AL   LK+
Sbjct  60   LVELINRDYNDFVSLSTQLVDVDGAVLRMRTPLQELRGKLVTVRDGVDGALLALQDALKR  119

Query  439  RADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNG  600
            R++A  +RE+LELLLDT HVVSK+EKL+ EL            N   NG L +G
Sbjct  120  RSEASASREILELLLDTSHVVSKIEKLLLELKE----------NRISNGNLVSG  163



>ref|XP_002982190.1| hypothetical protein SELMODRAFT_115746 [Selaginella moellendorffii]
 gb|EFJ16858.1| hypothetical protein SELMODRAFT_115746 [Selaginella moellendorffii]
Length=714

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 120/174 (69%), Gaps = 13/174 (7%)
 Frame = +1

Query  82   ATDLFGDPTDANP-PQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrD  258
            A+ LFGD  D +P P W     F+  DFD + +IS LR+FVPL+ LR ELRSHL++L+ +
Sbjct  2    ASMLFGD--DPDPLPLWFKKDAFMDPDFDCDAHISSLRSFVPLEALRGELRSHLAALKNE  59

Query  259  LVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQ  438
            LV+LINRDY DFVSLST+L DVD AV+RMR PL E+R K+ T R+ V+ +L AL   LK+
Sbjct  60   LVELINRDYNDFVSLSTQLVDVDGAVLRMRTPLQELRGKLVTVRDGVDGALLALQDALKR  119

Query  439  RADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNG  600
            R++A  +RE+LELLLDT HVVSK+EKL+ EL            N   NG L +G
Sbjct  120  RSEASASREILELLLDTSHVVSKIEKLLLELKE----------NRISNGNLVSG  163



>ref|XP_001764075.1| predicted protein [Physcomitrella patens]
 gb|EDQ71214.1| predicted protein [Physcomitrella patens]
Length=761

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = +1

Query  76   RSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqr  255
            +S   LF D  D + P W     F +  FD E YISDLR FVP +TLR+ELR HL  L+ 
Sbjct  20   KSVAFLFED--DTSGPLWFKKDAFSNASFDPEAYISDLRRFVPFETLRAELRDHLGGLKS  77

Query  256  DLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLK  435
            +LV+LINRDYADFV+LSTKL DVD AV+RMR PL E+R K+ + R+ V S+L  L   LK
Sbjct  78   ELVELINRDYADFVNLSTKLVDVDGAVLRMRMPLNELRGKLVSVRDNVNSTLLLLQDGLK  137

Query  436  QRADAGEAREVLELLLDTFHVVSKVEKLIKEL  531
            +R+DA  +RE LELLLDT HVVSKVEKL+ EL
Sbjct  138  RRSDASASRETLELLLDTCHVVSKVEKLLLEL  169



>ref|XP_004981048.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Setaria italica]
Length=751

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 129/179 (72%), Gaps = 1/179 (1%)
 Frame = +1

Query  85   TDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLV  264
            TDLFG+P +A+PP W  P  FL  DFD + Y+++LR++VPL++L +ELR+HL++L+ +LV
Sbjct  20   TDLFGEPIEAHPP-WFKPDSFLRADFDPDAYVAELRSYVPLESLAAELRAHLAALRAELV  78

Query  265  DLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRA  444
             LINRDYADFV LS +L  VDAA  RMRAPL ++R K++ FR    ++L+AL + L+QRA
Sbjct  79   GLINRDYADFVGLSARLKGVDAAAARMRAPLADLRDKVAGFRAGASAALAALRAGLEQRA  138

Query  445  DAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTE  621
             A  ARE+LELLLDT HVVSKVEKLIKELPS  ++ +N      D   +  G   + T+
Sbjct  139  AATAARELLELLLDTSHVVSKVEKLIKELPSAPSDSSNAEVPSIDAQNVEAGTGVRETQ  197



>ref|NP_001169749.1| uncharacterized protein LOC100383630 [Zea mays]
 gb|ACN34776.1| unknown [Zea mays]
Length=522

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 126/173 (73%), Gaps = 2/173 (1%)
 Frame = +1

Query  67   APPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlss  246
            APP  A DLFG+P +A+PP W  P  FL   FDA+ Y+++LR++VPLD+L +ELR+HL++
Sbjct  2    APP-PAMDLFGEPIEAHPP-WFKPDAFLRAGFDADAYVAELRSYVPLDSLAAELRAHLAA  59

Query  247  lqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHS  426
            L+ +LV LINRDYADFV LS  L  VDAA  RMRAPL ++R K++ FR    ++L+AL  
Sbjct  60   LRAELVGLINRDYADFVGLSAHLKGVDAAAARMRAPLADLRDKVAAFRAGASAALAALRE  119

Query  427  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNG  585
             L+QRA A  ARE+LELLLDT HVVSKVEKLIKELP+  ++ +N      D G
Sbjct  120  GLQQRAAATAARELLELLLDTSHVVSKVEKLIKELPTAPSDSSNAEIPINDTG  172



>tpg|DAA52497.1| TPA: hypothetical protein ZEAMMB73_788308 [Zea mays]
Length=691

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 126/173 (73%), Gaps = 2/173 (1%)
 Frame = +1

Query  67   APPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlss  246
            APP  A DLFG+P +A+PP W  P  FL   FDA+ Y+++LR++VPLD+L +ELR+HL++
Sbjct  7    APP-PAMDLFGEPIEAHPP-WFKPDAFLRAGFDADAYVAELRSYVPLDSLAAELRAHLAA  64

Query  247  lqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHS  426
            L+ +LV LINRDYADFV LS  L  VDAA  RMRAPL ++R K++ FR    ++L+AL  
Sbjct  65   LRAELVGLINRDYADFVGLSAHLKGVDAAAARMRAPLADLRDKVAAFRAGASAALAALRE  124

Query  427  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNG  585
             L+QRA A  ARE+LELLLDT HVVSKVEKLIKELP+  ++ +N      D G
Sbjct  125  GLQQRAAATAARELLELLLDTSHVVSKVEKLIKELPTAPSDSSNAEIPINDTG  177



>ref|XP_008645319.1| PREDICTED: uncharacterized protein LOC100383630 isoform X1 [Zea 
mays]
 tpg|DAA52498.1| TPA: hypothetical protein ZEAMMB73_788308 [Zea mays]
Length=745

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 126/173 (73%), Gaps = 2/173 (1%)
 Frame = +1

Query  67   APPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlss  246
            APP  A DLFG+P +A+PP W  P  FL   FDA+ Y+++LR++VPLD+L +ELR+HL++
Sbjct  7    APP-PAMDLFGEPIEAHPP-WFKPDAFLRAGFDADAYVAELRSYVPLDSLAAELRAHLAA  64

Query  247  lqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHS  426
            L+ +LV LINRDYADFV LS  L  VDAA  RMRAPL ++R K++ FR    ++L+AL  
Sbjct  65   LRAELVGLINRDYADFVGLSAHLKGVDAAAARMRAPLADLRDKVAAFRAGASAALAALRE  124

Query  427  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNG  585
             L+QRA A  ARE+LELLLDT HVVSKVEKLIKELP+  ++ +N      D G
Sbjct  125  GLQQRAAATAARELLELLLDTSHVVSKVEKLIKELPTAPSDSSNAEIPINDTG  177



>ref|XP_002463519.1| hypothetical protein SORBIDRAFT_01g001270 [Sorghum bicolor]
 gb|EER90517.1| hypothetical protein SORBIDRAFT_01g001270 [Sorghum bicolor]
Length=748

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 127/172 (74%), Gaps = 2/172 (1%)
 Frame = +1

Query  85   TDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLV  264
            TDLFG+P +A+PP W  P  FL   FD + Y+++LR++VPL++L +ELR+HL++L+ +LV
Sbjct  15   TDLFGEPIEAHPP-WFKPDAFLRAGFDPDAYVAELRSYVPLESLAAELRAHLAALRAELV  73

Query  265  DLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRA  444
             LINRDYADFV LS +L  VDAA  RMRAPL ++R K++ FR    ++L+AL + L+QRA
Sbjct  74   GLINRDYADFVGLSARLKGVDAAAARMRAPLADLRDKVAAFRAGASAALAALRAGLEQRA  133

Query  445  DAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNG  600
             A  ARE+LELLLDT HVVSKVEKLIKELP+  ++ +N      D G + NG
Sbjct  134  AATAARELLELLLDTSHVVSKVEKLIKELPTAPSDSSNAEVPNNDTG-MPNG  184



>ref|XP_008644331.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Zea mays]
 gb|AFW66981.1| hypothetical protein ZEAMMB73_946461 [Zea mays]
Length=739

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 130/179 (73%), Gaps = 5/179 (3%)
 Frame = +1

Query  82   ATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDL  261
            ATDLFG+P +A+PP W  P  FL   FD + Y+++LR++VPL++L +ELR+HL +L+ +L
Sbjct  5    ATDLFGEPIEAHPP-WFKPDAFLRASFDPDAYVAELRSYVPLESLAAELRAHLDALRAEL  63

Query  262  VDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQR  441
            V LINRDYADFV LS +L  VDAA  RMRAPL ++R K++ FR    ++L+AL + L+QR
Sbjct  64   VGLINRDYADFVGLSARLKGVDAAAARMRAPLADLRDKVAAFRAGASAALAALRAGLEQR  123

Query  442  ADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYAD----NGYLSNGVS  606
            A A  ARE+LELLLD FHVVSKVEKLIKELP+  ++L+N     +D    NG    GVS
Sbjct  124  AAAAAARELLELLLDAFHVVSKVEKLIKELPTAPSDLSNAEVPNSDTGTPNGVAGTGVS  182



>ref|XP_003562360.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Brachypodium 
distachyon]
Length=759

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 131/179 (73%), Gaps = 1/179 (1%)
 Frame = +1

Query  85   TDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLV  264
            TDLFG+P +A+PP W  P  FL   FD + Y+++LR++VPL++L +ELR+HL++L+ +LV
Sbjct  17   TDLFGEPIEAHPP-WFRPDAFLRAGFDPDAYVTELRSYVPLESLAAELRAHLAALRAELV  75

Query  265  DLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRA  444
             LINRDYADFV LS +L  VDAA  RMRAPL E+R K++ FR A  ++L+AL + L+QRA
Sbjct  76   GLINRDYADFVGLSARLKGVDAAAARMRAPLAELRDKVAAFRAAASAALAALRAGLEQRA  135

Query  445  DAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTE  621
             A  ARE+LELLLDT HVVSKVEKLIKELP+  ++ +N      D GY  N V+  + E
Sbjct  136  AAAAARELLELLLDTSHVVSKVEKLIKELPTAPSDSSNAEVVSVDKGYSGNDVTPSNVE  194



>ref|XP_005644140.1| hypothetical protein COCSUDRAFT_48790 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19596.1| hypothetical protein COCSUDRAFT_48790 [Coccomyxa subellipsoidea 
C-169]
Length=752

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 96/137 (70%), Gaps = 0/137 (0%)
 Frame = +1

Query  121  PQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVS  300
            P W NP  F+   FDAETY++DLR +VPL+ L SEL +HL  L+  LV++IN  Y DFVS
Sbjct  24   PHWFNPERFVEPQFDAETYVADLRRYVPLEALSSELEAHLQVLRNRLVEVINEHYGDFVS  83

Query  301  LSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELL  480
            LS+KL +VD+AV+RM+ PL EI+ K+   R  V ++L AL   L++R     A+ +LEL+
Sbjct  84   LSSKLVNVDSAVIRMQKPLTEIKEKLLGVRGEVTAALDALREGLERRQSVASAKALLELM  143

Query  481  LDTFHVVSKVEKLIKEL  531
             DT HV+SKVEKL+ E+
Sbjct  144  QDTAHVMSKVEKLLAEI  160



>ref|XP_002947088.1| component of oligomeric golgi complex 2 [Volvox carteri f. nagariensis]
 gb|EFJ51678.1| component of oligomeric golgi complex 2 [Volvox carteri f. nagariensis]
Length=1174

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = +1

Query  112  ANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYAD  291
            A  P WLNP  FL+ DF+A+  ++DLR +VPL TL++EL S+L++L+  LV++IN DYAD
Sbjct  22   AGCPVWLNPERFLAPDFNADACVADLRRYVPLATLQNELSSYLATLKTKLVEVINEDYAD  81

Query  292  FVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVL  471
            +V LS +L +V+ +VVRMR PLL++R K+   +EAV S L++L+  L++R +    R +L
Sbjct  82   YVGLSGRLANVEGSVVRMRKPLLDLRDKLHAVQEAVRSELNSLNQGLRKRKEVATQRALL  141

Query  472  ELLLDTFHVVSKVEKLIKEL  531
            EL+L+  HV +KV+KL++EL
Sbjct  142  ELILEVSHVAAKVDKLLEEL  161



>ref|XP_001695227.1| component of oligomeric golgi complex 2 [Chlamydomonas reinhardtii]
 gb|EDP01935.1| component of oligomeric golgi complex 2 [Chlamydomonas reinhardtii]
Length=567

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = +1

Query  112  ANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYAD  291
            A  P WLNP  FL ++F+A+  ++DLR +VPL TL++EL S+L++L+  LV++IN DYAD
Sbjct  23   AACPVWLNPERFLEQEFNADACVADLRRYVPLATLQNELSSYLATLKTKLVEVINEDYAD  82

Query  292  FVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVL  471
            +V LS +L +V+ AVVRMR PLLE+R K+   +EAV + L++L+  L++R +    R +L
Sbjct  83   YVGLSGRLANVEGAVVRMRKPLLELRDKLHAVQEAVRTELNSLNQGLRKRKEVATQRALL  142

Query  472  ELLLDTFHVVSKVEKLIKELPSGATNLA  555
            EL+L+  HV +K  +L++ + +  + LA
Sbjct  143  ELILEVAHVAAKC-RLLERVAAEVSRLA  169



>gb|KEH35882.1| oligomeric component, putative [Medicago truncatula]
Length=179

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 102/182 (56%), Gaps = 28/182 (15%)
 Frame = +1

Query  76   RSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqr  255
            R+ T+LF DP       W  P  FLS +FD+E+YIS L TFVP  TLRS+L ++LSSL  
Sbjct  10   RTVTNLFSDPL------WFKPEPFLSPNFDSESYISQLPTFVPFHTLRSQLNNYLSSLNH  63

Query  256  DLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLK  435
             L+ LINRDY+DF +L+  + DVD  VV       E   K                    
Sbjct  64   QLIHLINRDYSDFANLTANIVDVDDVVVPACGAAGEYSAK--------------------  103

Query  436  QRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQH  615
              + A  ARE LE LL +FH+VSKVEKLIKELP+  ++ +NG  N      LSNGV+ QH
Sbjct  104  --SQAASARETLEFLLYSFHLVSKVEKLIKELPTVHSDWSNGGVNLLKKSSLSNGVTVQH  161

Query  616  TE  621
             E
Sbjct  162  VE  163



>ref|XP_005848758.1| hypothetical protein CHLNCDRAFT_57543 [Chlorella variabilis]
 gb|EFN56656.1| hypothetical protein CHLNCDRAFT_57543 [Chlorella variabilis]
Length=767

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 91/135 (67%), Gaps = 0/135 (0%)
 Frame = +1

Query  127  WLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLS  306
            W  P LF   +F    Y+SDL+ +VPL+TL SEL SHL +L+  LV++IN DY DFVSLS
Sbjct  31   WFKPELFTEPEFSPVGYVSDLKRYVPLETLSSELHSHLGALKNKLVEVINDDYNDFVSLS  90

Query  307  TKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLD  486
            TKL +VD A+ RM+ PLLE++ K+   R  +    + L S L++R     AR +LEL+ D
Sbjct  91   TKLVNVDGALTRMQKPLLELQEKLEAARGGIAGQAAELQSGLQRRQTVAAARALLELMQD  150

Query  487  TFHVVSKVEKLIKEL  531
            T HV+SKV+KL+ E+
Sbjct  151  TAHVMSKVDKLLGEV  165



>gb|KHN14099.1| Conserved oligomeric Golgi complex subunit 2 [Glycine soja]
Length=658

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = +1

Query  343  MRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLI  522
            MRAPL+E+R KI  FR +VE SL A+ +RL+QR++   ARE LELLLD FHVVSKVEKLI
Sbjct  1    MRAPLVELRDKIEQFRGSVEVSLVAIKNRLRQRSEVASARETLELLLDAFHVVSKVEKLI  60

Query  523  KELPSGATNLANGIANYADNGYLSNGVSFQHTE  621
            KELPS  T+ +NG  N ++   LSNGVS QH E
Sbjct  61   KELPSVPTDWSNGDVNLSERNNLSNGVSAQHVE  93



>ref|XP_003603203.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
Length=798

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 103/185 (56%), Gaps = 28/185 (15%)
 Frame = +1

Query  67   APPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlss  246
            A  R+ T+LF DP       W  P  FLS +FD+E+YIS L TFVP  TLRS+L ++LSS
Sbjct  7    AHNRTVTNLFSDPL------WFKPEPFLSPNFDSESYISQLPTFVPFHTLRSQLNNYLSS  60

Query  247  lqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHS  426
            L   L+ LINRDY+DF +L+  + DVD  VV       E   K                 
Sbjct  61   LNHQLIHLINRDYSDFANLTANIVDVDDVVVPACGAAGEYSAK-----------------  103

Query  427  RLKQRADAGEAREVLELLLDTFHVVSKVEKLIKELPSGATNLANGIANYADNGYLSNGVS  606
                 + A  ARE LE LL +FH+VSKVEKLIKELP+  ++ +NG  N      LSNGV+
Sbjct  104  -----SQAASARETLEFLLYSFHLVSKVEKLIKELPTVHSDWSNGGVNLLKKSSLSNGVT  158

Query  607  FQHTE  621
             QH E
Sbjct  159  VQHVE  163



>ref|XP_007510910.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66470.1| predicted protein [Bathycoccus prasinos]
Length=955

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 83/137 (61%), Gaps = 0/137 (0%)
 Frame = +1

Query  121  PQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVS  300
            P W +P +F  +DF+ + YI ++  FV  + L  E+  +   LQ  LV+++NRDY DFV+
Sbjct  61   PAWFDPHVFEKDDFNPDVYIDEMSPFVTPEDLAVEVEKYADDLQNKLVEMVNRDYKDFVA  120

Query  301  LSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELL  480
            L+T L DVDA V  ++ PL  ++ ++   R+ V+  L  L + L +R +    RE LEL+
Sbjct  121  LTTDLVDVDAYVKDIKEPLEVLKGEVEEARDVVKKELEKLQNALDRRDELARERESLELI  180

Query  481  LDTFHVVSKVEKLIKEL  531
            ++   V SKVE+L++E 
Sbjct  181  MEATTVCSKVERLLEEF  197



>ref|XP_002969327.1| hypothetical protein SELMODRAFT_7944, partial [Selaginella moellendorffii]
 gb|EFJ29415.1| hypothetical protein SELMODRAFT_7944, partial [Selaginella moellendorffii]
Length=98

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 70/98 (71%), Gaps = 0/98 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ + FD +T+IS L +F+PL+ L  ELRSHL++L+ +L++LIN+DY DF+SLST+L DV
Sbjct  1    FIFQGFDCDTHISSLCSFMPLEALHDELRSHLATLKNELIELINKDYKDFMSLSTQLVDV  60

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQ  438
            D AV+ M  PL E+R K+ T R  V+  L  L   LKQ
Sbjct  61   DGAVLWMCTPLQELRGKLVTMRNGVDGVLLVLQDALKQ  98



>ref|XP_002970804.1| hypothetical protein SELMODRAFT_7940, partial [Selaginella moellendorffii]
 gb|EFJ28130.1| hypothetical protein SELMODRAFT_7940, partial [Selaginella moellendorffii]
Length=98

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 68/98 (69%), Gaps = 0/98 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ + FD +T+IS L +F+PL  L  ELRSHL++L+ +L++LIN+DY DFVSLS +L DV
Sbjct  1    FIFQGFDCDTHISSLCSFMPLKALHGELRSHLAALKNELIELINKDYKDFVSLSMQLVDV  60

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQ  438
            D AV+RM  PL E+R K+ T R  V+  L  L    KQ
Sbjct  61   DGAVLRMCTPLQELRGKLVTVRNGVDGVLLVLQDAFKQ  98



>ref|XP_011431284.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Crassostrea gigas]
 gb|EKC22030.1| Conserved oligomeric Golgi complex subunit 2 [Crassostrea gigas]
Length=735

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 88/148 (59%), Gaps = 6/148 (4%)
 Frame = +1

Query  97   GDPTDANP------PQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrD  258
            GDP    P          +  +F+ E+FD + ++ + R  VPL+ LR +L ++L  L+  
Sbjct  3    GDPNKGLPLPSGPASLCFDKDVFMQENFDVDQFVMECRRRVPLENLRDDLNTYLKILRSA  62

Query  259  LVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQ  438
            +++LIN+DYADFV+LST L  +D A+  +  PL  ++ +I T + A+E ++ A+  +LK+
Sbjct  63   MIELINKDYADFVNLSTNLVGMDKAIGNLTTPLEHLKEEIMTVKTAMEDAILAVEEKLKK  122

Query  439  RADAGEAREVLELLLDTFHVVSKVEKLI  522
            R    + +  L+ L++  H V K+EKL+
Sbjct  123  REQIRQKKASLQRLMNIIHSVEKIEKLL  150



>ref|XP_011401872.1| Conserved oligomeric Golgi complex subunit 2 [Auxenochlorella 
protothecoides]
 gb|KFM28823.1| Conserved oligomeric Golgi complex subunit 2 [Auxenochlorella 
protothecoides]
Length=745

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 82/138 (59%), Gaps = 7/138 (5%)
 Frame = +1

Query  121  PQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVS  300
            P W  P  F    F A TY++DL+ +V          +HLS L  DLV++IN+DY  F+ 
Sbjct  14   PAWFKPGEFADPAFSAATYVADLQQYV-------RGSAHLSVLHGDLVEVINKDYEGFLH  66

Query  301  LSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELL  480
            L+++LT V  AV R+  PL  ++ + S  R+A+ +   AL   L  RADA  +R +LEL+
Sbjct  67   LTSRLTSVQGAVKRIEGPLAVVKARASATRDALLAESHALTRGLAARADAAASRGLLELM  126

Query  481  LDTFHVVSKVEKLIKELP  534
             D  HV+SKV+KL+ ELP
Sbjct  127  QDLTHVLSKVDKLLAELP  144



>ref|XP_002158309.2| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Hydra vulgaris]
Length=677

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 49/126 (39%), Positives = 80/126 (63%), Gaps = 0/126 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            FL  +F+ + ++S  +   PL TLR +L +H  ++Q  LV+LINRDYADFVSLS+ L   
Sbjct  23   FLDTNFNVDKFVSKYKDLFPLSTLREDLETHYKNIQLALVELINRDYADFVSLSSNLIGT  82

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D  +  ++ PLLEI+ K++  R+ V + L +L  +L++R    E +  L+ L++  H V 
Sbjct  83   DKTIESLKEPLLEIKSKVAVVRDDVSTVLQSLKEKLEKRKLVREKKLYLKHLMNLVHSVE  142

Query  505  KVEKLI  522
            K+EK++
Sbjct  143  KIEKIL  148



>ref|XP_002113217.1| hypothetical protein TRIADDRAFT_26404 [Trichoplax adhaerens]
 gb|EDV23691.1| hypothetical protein TRIADDRAFT_26404 [Trichoplax adhaerens]
Length=723

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 48/159 (30%), Positives = 99/159 (62%), Gaps = 0/159 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+SE+F+ + +I+  R+ V  + LR++L+++   L+  +V+LIN+DYADFV+LST L  +
Sbjct  36   FVSEEFNVDGFITSCRSSVSPEVLRNDLKTYFDILKSSMVELINKDYADFVNLSTNLVGL  95

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+  + APL +I+ ++ + ++ +  +++ ++ RLK+R +  E +  L+ LL+    V 
Sbjct  96   DKAISNISAPLEQIKTEVGSVKDCIGQAMNGINRRLKKRTELREKKARLQRLLNISDSVD  155

Query  505  KVEKLIKELPSGATNLANGIANYADNGYLSNGVSFQHTE  621
            K+EKL++   +   N+ +  +   + G+L   V+ +  +
Sbjct  156  KIEKLLQISSTSPQNMMSASSEEENYGHLIERVAIEFNQ  194



>gb|KFO34216.1| Conserved oligomeric Golgi complex subunit 2 [Fukomys damarensis]
Length=925

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 82/136 (60%), Gaps = 0/136 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  VPL+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  209  FMKEDFDVDHFVSDCRKRVPLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  268

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  269  DRALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  328

Query  505  KVEKLIKELPSGATNL  552
            K+EK++    S  T++
Sbjct  329  KIEKILNSQTSKETSV  344



>ref|XP_010620223.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Fukomys 
damarensis]
Length=738

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 82/136 (60%), Gaps = 0/136 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  VPL+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVPLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATNL  552
            K+EK++    S  T++
Sbjct  142  KIEKILNSQTSKETSV  157



>ref|XP_004458735.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like, 
partial [Dasypus novemcinctus]
Length=161

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 77/126 (61%), Gaps = 0/126 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYRLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  E +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIREKKMCVLRLIQVIRSVE  141

Query  505  KVEKLI  522
            K+EK++
Sbjct  142  KIEKIL  147



>ref|XP_004914700.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Xenopus (Silurana) tropicalis]
Length=735

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 85/147 (58%), Gaps = 0/147 (0%)
 Frame = +1

Query  112  ANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYAD  291
             +P    +   F+ + FD + ++S+ R  V L+TLR +L  +   L+  +V+LIN+DYAD
Sbjct  11   GSPSMCFDKDEFMKDGFDVDVFVSECRKRVQLETLRDDLELYYRLLKTAMVELINKDYAD  70

Query  292  FVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVL  471
            FV+LST L  +D A+ ++  PL ++R ++ + + +V   + A+ SRL ++ D    +  +
Sbjct  71   FVNLSTNLVGMDKALSQLSVPLGQLREEVLSLKTSVNEVIQAVDSRLAKQEDVRRKKMCV  130

Query  472  ELLLDTFHVVSKVEKLIKELPSGATNL  552
              +++  H V K+EK++    S  T L
Sbjct  131  LTMMEVIHSVEKIEKILHSQNSKETAL  157



>ref|XP_002931527.2| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Xenopus (Silurana) tropicalis]
Length=734

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 85/147 (58%), Gaps = 0/147 (0%)
 Frame = +1

Query  112  ANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYAD  291
             +P    +   F+ + FD + ++S+ R  V L+TLR +L  +   L+  +V+LIN+DYAD
Sbjct  11   GSPSMCFDKDEFMKDGFDVDVFVSECRKRVQLETLRDDLELYYRLLKTAMVELINKDYAD  70

Query  292  FVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVL  471
            FV+LST L  +D A+ ++  PL ++R ++ + + +V   + A+ SRL ++ D    +  +
Sbjct  71   FVNLSTNLVGMDKALSQLSVPLGQLREEVLSLKTSVNEVIQAVDSRLAKQEDVRRKKMCV  130

Query  472  ELLLDTFHVVSKVEKLIKELPSGATNL  552
              +++  H V K+EK++    S  T L
Sbjct  131  LTMMEVIHSVEKIEKILHSQNSKETAL  157



>ref|XP_005106374.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Aplysia californica]
Length=795

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 90/139 (65%), Gaps = 1/139 (1%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ +DF+ + +I + +  VPL+TLR +L  +L  ++  +++LIN+DYADFV+LST L  +
Sbjct  26   FMKKDFEVDKFILECKKKVPLETLRDDLDLYLKVVRSAMIELINKDYADFVNLSTNLVGM  85

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+  +  PL +++ ++ + + A++ ++ A+  +++Q+ +    + +L+ L++  H V 
Sbjct  86   DKAITNLTVPLGQLKEEVLSVQTAMDEAILAVQEKIRQQQEIQRKKTMLQRLMNITHSVE  145

Query  505  KVEKLIKELPSGATNLANG  561
            K+E+L+  +  GA  L+ G
Sbjct  146  KIERLLG-IQQGAEPLSPG  163



>ref|XP_010996258.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Camelus 
dromedarius]
Length=740

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 81/135 (60%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR++L  +   L+  +V+LINRDYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRADLELYYKLLKTAMVELINRDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQNSKETS  156



>ref|XP_006212446.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 2 [Vicugna pacos]
Length=712

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 81/135 (60%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            +L EDFD + ++SD R  V L+ LR++L  +   L+  +V+LINRDYADFV+LST L  +
Sbjct  22   YLQEDFDVDHFVSDCRKRVQLEELRADLELYYKLLKTAMVELINRDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQNSKETS  156



>ref|XP_007936688.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Orycteropus 
afer afer]
Length=738

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 81/139 (58%), Gaps = 0/139 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +++LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMIELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIQAVEERMSKQEDIRKKKMSVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATNLANG  561
            K+EK++    S  T+   G
Sbjct  142  KIEKILNSQSSKETSALEG  160



>ref|XP_003410940.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Loxodonta 
africana]
Length=738

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  RL ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERLSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_007903669.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Callorhinchus milii]
Length=592

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 84/141 (60%), Gaps = 5/141 (4%)
 Frame = +1

Query  130  LNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLST  309
             N   F+ ++FD + ++S+ R  V L+TLR +L  +   L+  +V+LIN+DYADFV+LST
Sbjct  18   FNKEEFMKDNFDVDHFVSECRKHVQLETLRDDLELYYKLLKTAMVELINKDYADFVNLST  77

Query  310  KLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDT  489
             L  +D A+ ++  PL ++R ++ + + AV   + A+ +RL ++ D  + +  +  L   
Sbjct  78   NLVGMDRALNQLTVPLGQLREEVLSLKFAVSEGIQAIDNRLVKQEDVRKKKMCVLRLFQV  137

Query  490  FHVVSKVEKLI-----KELPS  537
               V K+EK++     +ELPS
Sbjct  138  IRSVEKIEKILHSQSSRELPS  158



>ref|XP_002613283.1| hypothetical protein BRAFLDRAFT_113783 [Branchiostoma floridae]
 gb|EEN69292.1| hypothetical protein BRAFLDRAFT_113783 [Branchiostoma floridae]
Length=651

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 83/128 (65%), Gaps = 1/128 (1%)
 Frame = +1

Query  142  LFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTD  321
            +F+ E+FD + ++++ R  V L+TLR +L  +   L+  +++LIN+DYADFV+LST L  
Sbjct  19   VFMKENFDVDQFVAECRRRVSLETLREDLEVYYKLLRSAMIELINKDYADFVNLSTNLVG  78

Query  322  VDAAVVRMRAPLLEIRHKI-STFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHV  498
            +D A+  +  PL ++R ++  T R A+++++  + +RL  R+   + +  L+ L++  H 
Sbjct  79   MDKAINNLSVPLGQLREEVMQTVRTAMDTAVQEIENRLATRSAIRDKKACLQRLMNITHS  138

Query  499  VSKVEKLI  522
            V K+EK++
Sbjct  139  VEKIEKIL  146



>ref|XP_004898237.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Heterocephalus 
glaber]
 ref|XP_004854734.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Heterocephalus 
glaber]
 gb|EHB11545.1| Conserved oligomeric Golgi complex subunit 2 [Heterocephalus 
glaber]
Length=738

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 81/136 (60%), Gaps = 0/136 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATNL  552
            K+EK++    S  T++
Sbjct  142  KIEKILNSQTSKETSV  157



>ref|XP_005405048.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Chinchilla lanigera]
Length=738

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIQSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_005405049.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Chinchilla lanigera]
Length=737

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIQSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_004690717.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Condylura 
cristata]
Length=680

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMYKQEDIRKKKMCVLRLMQVLQSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_010852806.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Bison bison bison]
Length=738

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  RL ++ D  + +  +  L+     V 
Sbjct  82   DKALSQLSVPLGQLREEVLSLRSSVSEGIRAVDERLSKQEDIRKKKICVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQHSKETS  156



>ref|XP_002717435.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Oryctolagus 
cuniculus]
Length=738

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            FL EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FLKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQNSKETS  156



>ref|XP_002809356.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Pongo 
abelii]
Length=738

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_005226618.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Bos taurus]
Length=738

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  RL ++ D  + +  +  L+     V 
Sbjct  82   DKALSQLSVPLGQLREEVLSLRSSVSEGIRAVDERLSKQEDIRKKKICVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQHSKETS  156



>ref|XP_004372879.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Trichechus 
manatus latirostris]
Length=738

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_010852805.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Bison bison bison]
Length=739

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  RL ++ D  + +  +  L+     V 
Sbjct  82   DKALSQLSVPLGQLREEVLSLRSSVSEGIRAVDERLSKQEDIRKKKICVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQHSKETS  156



>ref|NP_001070307.2| conserved oligomeric Golgi complex subunit 2 [Bos taurus]
 tpg|DAA14114.1| TPA: component of oligomeric golgi complex 2 [Bos taurus]
Length=739

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  RL ++ D  + +  +  L+     V 
Sbjct  82   DKALSQLSVPLGQLREEVLSLRSSVSEGIRAVDERLSKQEDIRKKKICVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQHSKETS  156



>ref|XP_003993981.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Felis catus]
Length=738

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 81/136 (60%), Gaps = 0/136 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRGDLELYYRLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMCKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATNL  552
            K+EK++    S  T++
Sbjct  142  KIEKILNSQSSKETSV  157



>ref|NP_001138508.1| conserved oligomeric Golgi complex subunit 2 isoform 2 [Homo 
sapiens]
 gb|AAH51906.1| Component of oligomeric golgi complex 2 [Homo sapiens]
 gb|EAW69916.1| component of oligomeric golgi complex 2, isoform CRA_b [Homo 
sapiens]
Length=737

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_001148147.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Pan troglodytes]
Length=738

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_006937851.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Felis catus]
Length=737

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 81/136 (60%), Gaps = 0/136 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRGDLELYYRLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMCKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATNL  552
            K+EK++    S  T++
Sbjct  142  KIEKILNSQSSKETSV  157



>ref|XP_009439912.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Pan troglodytes]
Length=737

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|NP_031383.1| conserved oligomeric Golgi complex subunit 2 isoform 1 [Homo 
sapiens]
 sp|Q14746.1|COG2_HUMAN RecName: Full=Conserved oligomeric Golgi complex subunit 2; Short=COG 
complex subunit 2; AltName: Full=Component of oligomeric 
Golgi complex 2; AltName: Full=Low density lipoprotein 
receptor defect C-complementing protein [Homo sapiens]
 emb|CAA84427.1| Cog2 protein [Homo sapiens]
 gb|AAH14960.1| Component of oligomeric golgi complex 2 [Homo sapiens]
 gb|EAW69915.1| component of oligomeric golgi complex 2, isoform CRA_a [Homo 
sapiens]
 gb|ABM83170.1| component of oligomeric golgi complex 2 [synthetic construct]
 gb|ABM86371.1| component of oligomeric golgi complex 2 [synthetic construct]
 gb|ABW03786.1| component of oligomeric golgi complex 2 [synthetic construct]
 dbj|BAG35559.1| unnamed protein product [Homo sapiens]
 gb|AIC50874.1| COG2, partial [synthetic construct]
Length=738

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_008687757.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Ursus maritimus]
Length=740

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRGDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMCKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_003791030.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Otolemur 
garnettii]
Length=738

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 79/134 (59%), Gaps = 0/134 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYRLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGAT  546
            K+EK++    S  T
Sbjct  142  KIEKILNSQSSKET  155



>ref|XP_004426945.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Ceratotherium 
simum simum]
Length=739

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 79/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++   R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLNLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_007903668.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Callorhinchus milii]
Length=749

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 84/141 (60%), Gaps = 5/141 (4%)
 Frame = +1

Query  130  LNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLST  309
             N   F+ ++FD + ++S+ R  V L+TLR +L  +   L+  +V+LIN+DYADFV+LST
Sbjct  18   FNKEEFMKDNFDVDHFVSECRKHVQLETLRDDLELYYKLLKTAMVELINKDYADFVNLST  77

Query  310  KLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDT  489
             L  +D A+ ++  PL ++R ++ + + AV   + A+ +RL ++ D  + +  +  L   
Sbjct  78   NLVGMDRALNQLTVPLGQLREEVLSLKFAVSEGIQAIDNRLVKQEDVRKKKMCVLRLFQV  137

Query  490  FHVVSKVEKLI-----KELPS  537
               V K+EK++     +ELPS
Sbjct  138  IRSVEKIEKILHSQSSRELPS  158



>ref|XP_004028611.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
1 [Gorilla gorilla gorilla]
Length=738

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_010372342.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Rhinopithecus roxellana]
Length=737

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIQAVDERVSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_008687758.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Ursus maritimus]
Length=739

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRGDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMCKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_010372341.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Rhinopithecus roxellana]
Length=738

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIQAVDERVSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_002927656.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Ailuropoda melanoleuca]
Length=739

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRGDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMCKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_004404911.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Odobenus 
rosmarus divergens]
Length=739

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRGDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMCKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_011233523.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Ailuropoda melanoleuca]
Length=740

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRGDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMCKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_006888781.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Elephantulus edwardii]
Length=738

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIQAVDERMSKQDDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILTSQSSKETS  156



>ref|XP_002760957.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Callithrix jacchus]
Length=738

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMCKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_008984063.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Callithrix jacchus]
Length=737

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMCKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>gb|EDL96730.1| rCG50865, isoform CRA_a [Rattus norvegicus]
Length=173

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 77/126 (61%), Gaps = 0/126 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGILAVEERMSKQDDIRKKKMSVLRLIQVIRSVE  141

Query  505  KVEKLI  522
            K+EK++
Sbjct  142  KIEKIL  147



>ref|XP_004342492.2| hypothetical protein CAOG_08237 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE98244.1| hypothetical protein CAOG_008237 [Capsaspora owczarzaki ATCC 
30864]
Length=805

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 85/159 (53%), Gaps = 15/159 (9%)
 Frame = +1

Query  43   PQRSSTPGAPPRSATDLFGDPTDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrs  222
            P   + PG+ P +A     D   A               F  E +++  R  V L+ L +
Sbjct  65   PSHPNQPGSAPPTANAATSDAGAA---------------FHVEEFVAQCRQRVSLELLLA  109

Query  223  elrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVE  402
            +L+  L+SL  +LV+LINRDYADFV+LS+ L  +D A+  +RAPL  +R +++  R  VE
Sbjct  110  DLQVFLASLHSELVELINRDYADFVNLSSNLVGMDKAISDIRAPLWLMREEVTNVRAVVE  169

Query  403  SSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVEKL  519
             S+  + ++L QRA   E +  L L ++    + K+EKL
Sbjct  170  DSVMTVQAKLDQRAAVREKKATLTLFINVSASLEKIEKL  208



>ref|XP_003893831.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Papio 
anubis]
Length=738

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERVSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_005539861.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X3 [Macaca fascicularis]
Length=737

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERVSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_003940815.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Saimiri 
boliviensis boliviensis]
Length=738

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSRETS  156



>ref|XP_002808309.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 2-like [Macaca mulatta]
 ref|XP_005539860.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Macaca fascicularis]
 gb|EHH15962.1| hypothetical protein EGK_02145 [Macaca mulatta]
 gb|EHH61454.1| hypothetical protein EGM_20105 [Macaca fascicularis]
Length=738

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERVSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_007450662.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Lipotes vexillifer]
Length=738

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALSQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKICVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQHSKETS  156



>ref|XP_007450661.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Lipotes vexillifer]
Length=739

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALSQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKICVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQHSKETS  156



>ref|XP_004659682.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Jaculus 
jaculus]
Length=738

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_005320438.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Ictidomys 
tridecemlineatus]
Length=738

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 79/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYRLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D    +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRNKKMCVLRLMQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_004310291.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Tursiops 
truncatus]
Length=739

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALSQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKICVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQHSKETS  156



>ref|XP_004640875.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Octodon degus]
Length=737

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR++L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRNDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D    +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRGKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_004640874.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Octodon degus]
Length=738

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR++L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRNDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D    +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRGKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_006065100.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Bubalus bubalis]
Length=739

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  RL ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRLSVSEGIRAVDERLSKQEDIRKKKICVLRLIQVIQSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQHSKETS  156



>ref|XP_006065101.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Bubalus bubalis]
Length=738

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  RL ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRLSVSEGIRAVDERLSKQEDIRKKKICVLRLIQVIQSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQHSKETS  156



>ref|XP_005958562.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Pantholops hodgsonii]
Length=738

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 79/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFVSLS  L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKAAMVELINKDYADFVSLSANLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  RL ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERLSKQEDIRKKKICVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQHSKETS  156



>ref|XP_001497419.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Equus caballus]
 ref|XP_008533779.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Equus przewalskii]
Length=740

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVIEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_005602674.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X3 [Equus caballus]
Length=739

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVIEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_005602673.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Equus caballus]
 ref|XP_008533778.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Equus przewalskii]
Length=741

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVIEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_005958561.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Pantholops hodgsonii]
Length=739

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 79/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFVSLS  L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKAAMVELINKDYADFVSLSANLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  RL ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERLSKQEDIRKKKICVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQHSKETS  156



>ref|XP_008844006.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Nannospalax 
galili]
Length=737

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 79/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLEQYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL + R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALNQLSVPLGQFREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLSLIQVIQSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKDTS  156



>ref|XP_004281614.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Orcinus 
orca]
Length=739

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 79/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D    +  +  L+     V 
Sbjct  82   DRALSQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRRKKICVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQHSKETS  156



>ref|XP_006146049.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Tupaia 
chinensis]
 gb|ELW68164.1| Conserved oligomeric Golgi complex subunit 2 [Tupaia chinensis]
Length=737

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 76/126 (60%), Gaps = 0/126 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D    +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRRKKMCVLRLIQVIRSVE  141

Query  505  KVEKLI  522
            K+EK++
Sbjct  142  KIEKIL  147



>ref|XP_005291293.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Chrysemys 
picta bellii]
Length=767

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 83/155 (54%), Gaps = 1/155 (1%)
 Frame = +1

Query  61   PGAPPRSATDLFGDPTDANPPQ-WLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrsh  237
            PGA PR+  +  G      P     +   F+  DFD + ++SD R  V L+ LR +L  +
Sbjct  21   PGAGPRAGMEARGMCLPRGPGNLCFDKDEFMKPDFDVDHFVSDCRKRVQLEELRDDLELY  80

Query  238  lsslqrDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSA  417
               L+  +V+LIN+DYADFV+LST L  +D A+ ++  PL ++R ++ + +  V   + A
Sbjct  81   YKLLKTAMVELINKDYADFVNLSTNLVGMDKALNQLSVPLGQLREEVMSLKSCVSEGIRA  140

Query  418  LHSRLKQRADAGEAREVLELLLDTFHVVSKVEKLI  522
            +   + ++ D    +  +  L+     V K+EK++
Sbjct  141  VDEHMSKQEDIRRKKMCVLRLIQVIQSVEKIEKIL  175



>ref|XP_006106578.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Myotis 
lucifugus]
Length=757

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 79/139 (57%), Gaps = 0/139 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D  + ++  PL ++R ++ + R +V   + A+  R+ ++ D    +  +  L+     V 
Sbjct  82   DKVLNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRGKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATNLANG  561
            K+EK++    S  T+   G
Sbjct  142  KIEKILNSQSSKETSALEG  160



>ref|XP_010705329.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Meleagris 
gallopavo]
Length=739

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 79/135 (59%), Gaps = 3/135 (2%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+  DFD + ++S+ R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKPDFDVDHFVSECRKRVQLEELREDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R  V   + A+  RL ++ D    R+    +L   HV+ 
Sbjct  82   DKALNQLSVPLGQLREEVMSLRSCVSEGIQAIDDRLSKQED---IRKKKVCVLRLIHVIQ  138

Query  505  KVEKLIKELPSGATN  549
             VEK+ K L S  TN
Sbjct  139  SVEKIEKILHSQGTN  153



>ref|XP_419583.2| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Gallus gallus]
Length=739

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 79/135 (59%), Gaps = 3/135 (2%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+  DFD + ++S+ R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKPDFDVDHFVSECRKRVQLEELREDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R  V   + A+  RL ++ D    R+    +L   HV+ 
Sbjct  82   DKALNQLSVPLGQLREEVMSLRSCVSEGIQAIDDRLSKQED---IRKKKVCVLRLIHVIQ  138

Query  505  KVEKLIKELPSGATN  549
             VEK+ K L S  TN
Sbjct  139  SVEKIEKILHSQGTN  153



>ref|XP_004935546.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X3 [Gallus gallus]
Length=738

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 79/135 (59%), Gaps = 3/135 (2%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+  DFD + ++S+ R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKPDFDVDHFVSECRKRVQLEELREDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R  V   + A+  RL ++ D    R+    +L   HV+ 
Sbjct  82   DKALNQLSVPLGQLREEVMSLRSCVSEGIQAIDDRLSKQED---IRKKKVCVLRLIHVIQ  138

Query  505  KVEKLIKELPSGATN  549
             VEK+ K L S  TN
Sbjct  139  SVEKIEKILHSQGTN  153



>ref|XP_005906657.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Bos 
mutus]
Length=740

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 79/133 (59%), Gaps = 0/133 (0%)
 Frame = +1

Query  151  SEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVDA  330
            SEDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +D 
Sbjct  25   SEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMDK  84

Query  331  AVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKV  510
            A+ ++  PL ++R ++ + R +V   + A+  RL ++ D  + +  +  L+     V K+
Sbjct  85   ALSQLSVPLGQLREEVLSLRSSVSEGIRAVDERLSKQEDIRKKKICVLRLIQVIRSVEKI  144

Query  511  EKLIKELPSGATN  549
            EK++    S  T+
Sbjct  145  EKILNSQHSKETS  157



>gb|ELR48452.1| Conserved oligomeric Golgi complex subunit 2, partial [Bos mutus]
Length=718

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 79/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            +  EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  1    YFQEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  60

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  RL ++ D  + +  +  L+     V 
Sbjct  61   DKALSQLSVPLGQLREEVLSLRSSVSEGIRAVDERLSKQEDIRKKKICVLRLIQVIRSVE  120

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  121  KIEKILNSQHSKETS  135



>ref|XP_007987957.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Chlorocebus 
sabaeus]
Length=738

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ E+FD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKENFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERVSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_005699448.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 2 [Capra hircus]
Length=908

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 77/125 (62%), Gaps = 0/125 (0%)
 Frame = +1

Query  148  LSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVD  327
            L+EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +D
Sbjct  192  LNEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKAAMVELINKDYADFVNLSTNLVGMD  251

Query  328  AAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSK  507
             A+ ++  PL ++R ++ + R +V   + A+  RL ++ D  + +  +  L+     V K
Sbjct  252  KALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERLSKQEDIRKKKICVLRLIQVIRSVEK  311

Query  508  VEKLI  522
            +EK++
Sbjct  312  IEKIL  316



>ref|XP_008156867.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Eptesicus 
fuscus]
Length=303

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D  + ++  PL ++R ++ + R +V   + A+  R+ ++ D    +  +  L+     V 
Sbjct  82   DKVLNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRGKKMCVLRLIQVIRSVE  141

Query  505  KVEKLI  522
            K+EK++
Sbjct  142  KIEKIL  147



>ref|XP_004021628.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 2 [Ovis aries]
Length=736

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKAAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + + +V   + A+  RL ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLQSSVSEGIRAVDERLSKQEDIRKKKICVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQHSKETS  156



>ref|XP_006255878.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Rattus norvegicus]
Length=741

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 77/126 (61%), Gaps = 0/126 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGILAVEERMSKQDDIRKKKMSVLRLIQVIRSVE  141

Query  505  KVEKLI  522
            K+EK++
Sbjct  142  KIEKIL  147



>ref|XP_007086077.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Panthera 
tigris altaica]
Length=716

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 81/135 (60%), Gaps = 0/135 (0%)
 Frame = +1

Query  148  LSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVD  327
            ++EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +D
Sbjct  1    MNEDFDVDHFVSDCRKRVQLEELRGDLELYYRLLKTAMVELINKDYADFVNLSTNLVGMD  60

Query  328  AAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSK  507
             A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V K
Sbjct  61   KALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMCKQEDIRKKKMCVLRLIQVIRSVEK  120

Query  508  VEKLIKELPSGATNL  552
            +EK++    S  T++
Sbjct  121  IEKILNSQSSKETSV  135



>ref|XP_010887016.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Esox 
lucius]
Length=731

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 79/127 (62%), Gaps = 0/127 (0%)
 Frame = +1

Query  142  LFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTD  321
            +F+ +DFD + +++D R  V L+ +R +L  +   L+  +V+LIN+DYADFV+LST L  
Sbjct  16   VFMKDDFDVDQFVADCRKHVQLEEMREDLEMYYKLLKTAMVELINKDYADFVNLSTNLVG  75

Query  322  VDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVV  501
            +D A+ ++  PL ++R ++ + R +V   + A+ ++L ++ D  + +  +  L+     V
Sbjct  76   MDKALNQLSVPLGQLREEVLSLRTSVSEVIQAIDNQLSKQDDLQKKKMCVMRLIQVVRSV  135

Query  502  SKVEKLI  522
             K+EK++
Sbjct  136  EKIEKIL  142



>ref|XP_546096.2| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Canis 
lupus familiaris]
Length=715

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 79/134 (59%), Gaps = 0/134 (0%)
 Frame = +1

Query  148  LSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVD  327
            + EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +D
Sbjct  1    MKEDFDVDHFVSDCRKRVQLEELRGDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMD  60

Query  328  AAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSK  507
             A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V K
Sbjct  61   KALNQLSVPLGQLREEVLSLRSSVSEGIQAVDERMCKQEDIRKKKMCVLRLIQVIRSVEK  120

Query  508  VEKLIKELPSGATN  549
            +EK++    S  T+
Sbjct  121  IEKILNSQNSKETS  134



>gb|ERE80256.1| conserved oligomeric Golgi complex subunit 2 [Cricetulus griseus]
Length=725

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 77/126 (61%), Gaps = 0/126 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  17   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  76

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  77   DRALNQLSVPLGQLREEVMSLRSSVSEGILAVDERMSKQEDIRKKKMSVLRLIQVIRSVE  136

Query  505  KVEKLI  522
            K+EK++
Sbjct  137  KIEKIL  142



>ref|XP_003496865.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Cricetulus 
griseus]
 ref|XP_007611385.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Cricetulus 
griseus]
Length=730

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 77/126 (61%), Gaps = 0/126 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALNQLSVPLGQLREEVMSLRSSVSEGILAVDERMSKQEDIRKKKMSVLRLIQVIRSVE  141

Query  505  KVEKLI  522
            K+EK++
Sbjct  142  KIEKIL  147



>ref|XP_006531536.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Mus musculus]
Length=574

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 77/126 (61%), Gaps = 0/126 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALNQLSVPLGQLREEVLSLRSSVSEGILAVDERMSKQEDIRKKKMSVLRLIQVIRSVE  141

Query  505  KVEKLI  522
            K+EK++
Sbjct  142  KIEKIL  147



>ref|NP_001103964.1| conserved oligomeric Golgi complex subunit 2 [Rattus norvegicus]
 gb|EDL96731.1| rCG50865, isoform CRA_b [Rattus norvegicus]
Length=730

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 77/126 (61%), Gaps = 0/126 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGILAVEERMSKQDDIRKKKMSVLRLIQVIRSVE  141

Query  505  KVEKLI  522
            K+EK++
Sbjct  142  KIEKIL  147



>dbj|BAE34057.1| unnamed protein product [Mus musculus]
Length=553

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 77/126 (61%), Gaps = 0/126 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALNQLSVPLGQLREEVLSLRSSVSEGILAVDERMSKQEDIRKKKMSVLRLIQVIRSVE  141

Query  505  KVEKLI  522
            K+EK++
Sbjct  142  KIEKIL  147



>dbj|BAC40996.1| unnamed protein product [Mus musculus]
Length=732

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 77/126 (61%), Gaps = 0/126 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALNQLSVPLGQLREEVLSLRSSVSEGILAVDERMSKQEDIRKKKMSVLRLIQVIRSVE  141

Query  505  KVEKLI  522
            K+EK++
Sbjct  142  KIEKIL  147



>ref|NP_084022.2| conserved oligomeric Golgi complex subunit 2 [Mus musculus]
 sp|Q921L5.2|COG2_MOUSE RecName: Full=Conserved oligomeric Golgi complex subunit 2; Short=COG 
complex subunit 2; AltName: Full=Component of oligomeric 
Golgi complex 2; AltName: Full=Low density lipoprotein 
receptor defect C-complementing protein [Mus musculus]
 dbj|BAE41054.1| unnamed protein product [Mus musculus]
Length=731

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 77/126 (61%), Gaps = 0/126 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALNQLSVPLGQLREEVLSLRSSVSEGILAVDERMSKQEDIRKKKMSVLRLIQVIRSVE  141

Query  505  KVEKLI  522
            K+EK++
Sbjct  142  KIEKIL  147



>ref|XP_004619081.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Sorex 
araneus]
Length=667

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 79/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR  L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELREHLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMFKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQNSKETS  156



>gb|AAH11435.1| Component of oligomeric golgi complex 2 [Mus musculus]
Length=731

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 77/126 (61%), Gaps = 0/126 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALNQLSVPLGQLREEVLSLRSSVSEGILAVDERMSKQEDIRKKKMSVLRLIQVIRSVE  141

Query  505  KVEKLI  522
            K+EK++
Sbjct  142  KIEKIL  147



>dbj|BAE42634.1| unnamed protein product [Mus musculus]
Length=731

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 77/126 (61%), Gaps = 0/126 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALNQLSVPLGQLREEVLSLRSSVSEGILAVDERMSKQEDIRKKKMSVLRLIQVIRSVE  141

Query  505  KVEKLI  522
            K+EK++
Sbjct  142  KIEKIL  147



>gb|EDL11770.1| component of oligomeric golgi complex 2 [Mus musculus]
Length=731

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 77/126 (61%), Gaps = 0/126 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALNQLSVPLGQLREEVLSLRSSVSEGILAVDERMSKQEDIRKKKMSVLRLIQVIRSVE  141

Query  505  KVEKLI  522
            K+EK++
Sbjct  142  KIEKIL  147



>ref|XP_010741537.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Larimichthys crocea]
Length=729

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 78/127 (61%), Gaps = 0/127 (0%)
 Frame = +1

Query  142  LFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTD  321
            +F+ +DFD + ++++ R  V L+ +R +L  +   L+  +V+LIN+DYADFV+LST L  
Sbjct  16   VFMKDDFDVDQFVAECRKQVQLEEMREDLELYYKLLKTAMVELINKDYADFVNLSTNLVG  75

Query  322  VDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVV  501
            +D A+ ++  PL ++R ++ + R  V   + A+ S+L ++ D  + +  +  L+     V
Sbjct  76   MDKALNQLSVPLGQLREEVMSLRSCVSEVIQAIDSQLSKQEDLQKKKVCVLRLIQVVRSV  135

Query  502  SKVEKLI  522
             K+EK++
Sbjct  136  EKIEKIL  142



>ref|XP_005064728.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Mesocricetus 
auratus]
Length=730

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 77/126 (61%), Gaps = 0/126 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALNQLSVPLGQLREEVLSLRSSVSEGILAVDERMSKQEDIRKKKMSVLRLIQVIRSVE  141

Query  505  KVEKLI  522
            K+EK++
Sbjct  142  KIEKIL  147



>ref|XP_006992872.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Peromyscus 
maniculatus bairdii]
Length=730

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 77/126 (61%), Gaps = 0/126 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRALNQLSVPLGQLREEVLSLRSSVSEGILAVDERMSKQEDIRKKKMSVLRLIQVIRSVE  141

Query  505  KVEKLI  522
            K+EK++
Sbjct  142  KIEKIL  147



>ref|XP_004077119.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 2 [Oryzias latipes]
Length=733

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 81/136 (60%), Gaps = 0/136 (0%)
 Frame = +1

Query  142  LFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTD  321
            +F+ +DFD + ++++ R  V L+ +R +L  +   L+  +V+LIN+DYADFV+LST L  
Sbjct  16   VFMKDDFDVDQFVAECRKQVQLEEMREDLELYYKLLKTAMVELINKDYADFVNLSTNLVG  75

Query  322  VDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVV  501
            +D A+ ++  PL ++R ++ + R  V   + A+ + L ++ D  + ++ +  L+     V
Sbjct  76   MDKALNQLSVPLGQLREEVMSLRSCVSEVIQAIDNELSKQDDIQKKKDCVLRLIQVVRSV  135

Query  502  SKVEKLIKELPSGATN  549
             K+EK++    S  +N
Sbjct  136  EKIEKILHSQNSKESN  151



>ref|XP_007127671.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Physeter 
catodon]
Length=717

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 79/134 (59%), Gaps = 0/134 (0%)
 Frame = +1

Query  148  LSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVD  327
            + EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +D
Sbjct  1    MKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMD  60

Query  328  AAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSK  507
             A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V K
Sbjct  61   RALSQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKICVLRLIQVIRSVEK  120

Query  508  VEKLIKELPSGATN  549
            +EK++    S  T+
Sbjct  121  IEKILNSQHSKETS  134



>ref|XP_007173849.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Balaenoptera acutorostrata scammoni]
Length=717

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 79/134 (59%), Gaps = 0/134 (0%)
 Frame = +1

Query  148  LSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVD  327
            + EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +D
Sbjct  1    MKEDFDVDHFVSDCRKRVQLEALRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMD  60

Query  328  AAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSK  507
             A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V K
Sbjct  61   RALSQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKICVLRLIQVIRSVEK  120

Query  508  VEKLIKELPSGATN  549
            +EK++    S  T+
Sbjct  121  IEKILNSQHSKETS  134



>gb|EFB20161.1| hypothetical protein PANDA_017452 [Ailuropoda melanoleuca]
Length=685

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 78/134 (58%), Gaps = 0/134 (0%)
 Frame = +1

Query  148  LSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVD  327
              EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +D
Sbjct  1    FQEDFDVDHFVSDCRKRVQLEELRGDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMD  60

Query  328  AAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSK  507
             A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V K
Sbjct  61   KALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMCKQEDIRKKKMCVLRLIQVIRSVEK  120

Query  508  VEKLIKELPSGATN  549
            +EK++    S  T+
Sbjct  121  IEKILNSQSSKETS  134



>ref|XP_005005280.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Cavia porcellus]
Length=737

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 81/135 (60%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ E+FD + ++SD R  V L+ LR++L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKENFDVDHFVSDCRKRVQLEDLRNDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  ++ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDEQMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_008319780.1| PREDICTED: conserved oligomeric Golgi complex subunit 2, partial 
[Cynoglossus semilaevis]
Length=468

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 77/127 (61%), Gaps = 0/127 (0%)
 Frame = +1

Query  142  LFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTD  321
            +F+ +DFD + ++S+ R  V L+ +R +L  +   L+  +V+LIN+DYADFV+LST L  
Sbjct  16   VFMKDDFDVDQFVSECRKKVQLEEMREDLELYYMLLKTAMVELINKDYADFVNLSTNLVG  75

Query  322  VDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVV  501
            +D A+ ++  PL ++R ++   R  V   + A+ S+L ++ D  + +  +  L+     V
Sbjct  76   MDKALNQLSVPLGQLREEVLGLRTCVSEVIQAIDSQLSKQEDLQKKKVCVLRLIQVVRSV  135

Query  502  SKVEKLI  522
             K+EK++
Sbjct  136  EKIEKIL  142



>ref|XP_005539862.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X4 [Macaca fascicularis]
Length=680

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 79/133 (59%), Gaps = 0/133 (0%)
 Frame = +1

Query  151  SEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVDA  330
            +EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +D 
Sbjct  26   TEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMDK  85

Query  331  AVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKV  510
            A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V K+
Sbjct  86   ALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERVSKQEDIRKKKMCVLRLIQVIRSVEKI  145

Query  511  EKLIKELPSGATN  549
            EK++    S  T+
Sbjct  146  EKILNSQSSKETS  158



>ref|XP_003473537.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Cavia porcellus]
Length=738

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 81/135 (60%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ E+FD + ++SD R  V L+ LR++L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKENFDVDHFVSDCRKRVQLEDLRNDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+  ++ ++ D  + +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDEQMSKQEDIRKKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQSSKETS  156



>ref|XP_010196213.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Colius striatus]
 gb|KFP30106.1| Conserved oligomeric Golgi complex subunit 2 [Colius striatus]
Length=740

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/146 (33%), Positives = 84/146 (58%), Gaps = 7/146 (5%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+  DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKPDFDVDQFVSDCRKRVQLEELREDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + +  V   + A+  R+ ++ D    +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVMSLKSCVSEGIQAVDDRMAKQEDIRRKKVCVLRLIHVIQSVE  141

Query  505  KVEKLI-----KELPS--GATNLANG  561
            K+EK++     KEL S  G ++L+ G
Sbjct  142  KIEKILHSQGTKELSSLEGNSSLSTG  167



>ref|XP_010196214.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Colius striatus]
Length=739

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/146 (33%), Positives = 84/146 (58%), Gaps = 7/146 (5%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+  DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKPDFDVDQFVSDCRKRVQLEELREDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + +  V   + A+  R+ ++ D    +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVMSLKSCVSEGIQAVDDRMAKQEDIRRKKVCVLRLIHVIQSVE  141

Query  505  KVEKLI-----KELPS--GATNLANG  561
            K+EK++     KEL S  G ++L+ G
Sbjct  142  KIEKILHSQGTKELSSLEGNSSLSTG  167



>ref|NP_998519.1| conserved oligomeric Golgi complex subunit 2 [Danio rerio]
 gb|AAH49314.1| Component of oligomeric golgi complex 2 [Danio rerio]
Length=730

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 82/136 (60%), Gaps = 0/136 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ +DFD + +++D R  V L+ +R +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  18   FMKDDFDVDKFVADCRKRVQLEEMREDLEQYYRLLKTAMVELINKDYADFVNLSTNLVGM  77

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R +V   + A+ ++L ++ D  + +  +  L+     V 
Sbjct  78   DKALNQLSIPLGQLREEVLSLRSSVNEVIEAIDTQLSKQDDIQKKKLCVLRLIQVVRSVE  137

Query  505  KVEKLIKELPSGATNL  552
            K+EK++ +     T+L
Sbjct  138  KIEKILHQNTKDTTSL  153



>ref|XP_005539859.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Macaca fascicularis]
Length=740

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 79/133 (59%), Gaps = 0/133 (0%)
 Frame = +1

Query  151  SEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVDA  330
            +EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +D 
Sbjct  26   TEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMDK  85

Query  331  AVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKV  510
            A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V K+
Sbjct  86   ALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERVSKQEDIRKKKMCVLRLIQVIRSVEKI  145

Query  511  EKLIKELPSGATN  549
            EK++    S  T+
Sbjct  146  EKILNSQSSKETS  158



>ref|XP_005345929.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Microtus 
ochrogaster]
Length=730

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 77/126 (61%), Gaps = 0/126 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D ++ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V 
Sbjct  82   DRSLNQLSVPLGQLREEVLSLRSSVSEGILAVEERMSKQEDIRKKKMSVLRLIQVIRSVE  141

Query  505  KVEKLI  522
            K+EK++
Sbjct  142  KIEKIL  147



>emb|CDH54966.1| conserved oligomeric golgi complex subunit 2 [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=368

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 78/127 (61%), Gaps = 1/127 (1%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F++ +FD + +++  R  + L+ L+ E  +HL  L+ +L++LINRDY DF+ LST L  V
Sbjct  42   FIAPNFDTDRFLAS-RRHLGLERLKVEFNNHLKFLKTELIELINRDYQDFIDLSTNLKGV  100

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+  +R PL  + H+    R   +SS+  L S+L  RA+  E +  L+L+L+    V+
Sbjct  101  DKAISNIRGPLKRMEHEALDIRINCQSSIDQLESQLLHRAELREKKTCLKLMLNIHESVT  160

Query  505  KVEKLIK  525
            KVE L++
Sbjct  161  KVEDLLE  167



>ref|XP_003767876.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Sarcophilus 
harrisii]
Length=739

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 78/135 (58%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ +DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKDDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + +  V   + A+  R+ ++ D    +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVMSLKSTVSEGIRAVDERMSKQEDIRRKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQNSKETS  156



>gb|ETE65446.1| Conserved oligomeric Golgi complex subunit 2 [Ophiophagus hannah]
Length=716

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 79/136 (58%), Gaps = 0/136 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+  DFD + ++S+ R  V L+ LR +L  +   L+  +++LIN+DYADFV+LST L  +
Sbjct  17   FMKPDFDVDHFVSECRKRVQLEELRDDLELYYKLLKTAMIELINKDYADFVNLSTNLVGM  76

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + +  V   + A+  RL ++ D  + +  +  L+     V 
Sbjct  77   DKALNQLSVPLGQLREEVMSLKSCVSEEIRAIDDRLSKQEDIRKKKMCVLRLIQVIKSVE  136

Query  505  KVEKLIKELPSGATNL  552
            K+EK++    S  T+L
Sbjct  137  KIEKILHSQNSKETSL  152



>ref|XP_006817460.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Saccoglossus kowalevskii]
Length=672

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 41/127 (32%), Positives = 79/127 (62%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+  DFD + ++++ R  VPL+TLR +L ++  SL+  +V+LIN+DYADFV+LS+ L  +
Sbjct  24   FMQVDFDVDQFVAECRRHVPLETLRDDLDTYFKSLKSAMVELINKDYADFVNLSSNLVGM  83

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+  +  PL ++R ++   R ++  ++  +  +L  R +  + +  L+ L +    V 
Sbjct  84   DKAINNLSVPLGQLREEVLAVRNSMTDAMQVVEKKLIARTEIRKKKATLQRLQNIIQSVD  143

Query  505  KVEKLIK  525
            K+EK+++
Sbjct  144  KMEKILQ  150



>ref|XP_009055731.1| hypothetical protein LOTGIDRAFT_232605 [Lottia gigantea]
 gb|ESO93530.1| hypothetical protein LOTGIDRAFT_232605 [Lottia gigantea]
Length=744

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 44/147 (30%), Positives = 88/147 (60%), Gaps = 8/147 (5%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+   FD + ++ + R  V L+TLR +L  +L  L+  +++LIN+DYADFV+LST L  +
Sbjct  25   FMKPGFDVDQFVLECRRRVQLETLRDDLNIYLKILKSAMIELINKDYADFVNLSTNLVGM  84

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+  +  PL +++ ++ + R A++ ++  +  +LKQ+ D    +  L+ L++    V 
Sbjct  85   DKAIGHLTVPLGQLKEEVMSVRSAMDEAIEIVEQKLKQQKDIQHKKACLQRLMNITESVE  144

Query  505  KVEKLIKELPSGATNLANGIANYADNG  585
            K+EKL+         + +G++++++ G
Sbjct  145  KIEKLL--------GIHSGLSDHSEGG  163



>ref|XP_007256131.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Astyanax 
mexicanus]
Length=731

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 82/132 (62%), Gaps = 5/132 (4%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ +DFD + ++++ R  V L+ +R +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  18   FMKDDFDVDRFVAECRKHVQLEQMREDLEQYYRLLKTAMVELINKDYADFVNLSTNLVGM  77

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAR-EVLELLLDTFHVV  501
            D A+ ++  PL ++R ++ + R AV   + A+ ++L ++ D  + +  VL L+    HVV
Sbjct  78   DKALNQLSVPLGQLREEVLSLRSAVNEVIQAIDTQLSKQDDIQKKKISVLRLI----HVV  133

Query  502  SKVEKLIKELPS  537
              VEK+ K L S
Sbjct  134  RSVEKIEKILHS  145



>gb|ELK34853.1| Conserved oligomeric Golgi complex subunit 2 [Myotis davidii]
Length=815

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 82/152 (54%), Gaps = 0/152 (0%)
 Frame = +1

Query  106  TDANPPQWLNPPLFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDY  285
            T  NP       + L EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DY
Sbjct  13   TTRNPSSAQISCIGLLEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDY  72

Query  286  ADFVSLSTKLTDVDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEARE  465
            ADFV+LST L  +D  + ++  PL ++R ++ + R +V   + A+  R+ ++ D    + 
Sbjct  73   ADFVNLSTNLVGMDKVLNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRGKKM  132

Query  466  VLELLLDTFHVVSKVEKLIKELPSGATNLANG  561
             +  L+     V K+EK++    S  T+   G
Sbjct  133  CVLRLIQVIRSVEKIEKILNSQSSKETSALEG  164



>ref|XP_001369328.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Monodelphis 
domestica]
Length=739

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 78/135 (58%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+ +DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKDDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + +  V   + A+  R+ ++ D    +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVMSLKSTVSDGIRAVDERMSKQEDIRRKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILNSQNSKETS  156



>ref|XP_004819666.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 2 [Mustela putorius furo]
Length=751

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 79/134 (59%), Gaps = 0/134 (0%)
 Frame = +1

Query  148  LSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVD  327
              EDFD + ++SD R  V L+ LR++L  +   L+  +V+LIN+DYADFV+LST L  +D
Sbjct  35   FQEDFDVDHFVSDCRKRVQLEELRADLELYYKLLKTAMVELINKDYADFVNLSTNLVGMD  94

Query  328  AAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSK  507
             A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  + +  +  L+     V K
Sbjct  95   KALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMCKQEDIRKKKMCVLRLIQVIXSVEK  154

Query  508  VEKLIKELPSGATN  549
            +EK++    S  T+
Sbjct  155  IEKILNSQSSKETS  168



>ref|XP_007545451.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Poecilia 
formosa]
Length=729

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 78/127 (61%), Gaps = 0/127 (0%)
 Frame = +1

Query  142  LFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTD  321
            +F+ +DFD + ++++ R  V L+ +R +L  +   L+  +V+LIN+DYADFV+LST L  
Sbjct  16   VFMKDDFDVDQFVAECRKQVQLEEMREDLEMYYKLLKTAMVELINKDYADFVNLSTNLVG  75

Query  322  VDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVV  501
            +D A+ ++  PL ++R ++ + R  V   + A+ ++L ++ D  + +  +  L+     V
Sbjct  76   MDKALNQLSVPLGQLREEVMSLRSCVSEVIQAIDNQLSKQEDLQKKKVCVLRLIQVVRSV  135

Query  502  SKVEKLI  522
             K+EK++
Sbjct  136  EKIEKIL  142



>ref|XP_005812226.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Xiphophorus maculatus]
Length=729

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 78/127 (61%), Gaps = 0/127 (0%)
 Frame = +1

Query  142  LFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTD  321
            +F+ +DFD + ++++ R  V L+ +R +L  +   L+  +V+LIN+DYADFV+LST L  
Sbjct  16   VFMKDDFDVDQFVAECRKQVQLEEMREDLEMYYKLLKTAMVELINKDYADFVNLSTNLVG  75

Query  322  VDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVV  501
            +D A+ ++  PL ++R ++ + R  V   + A+ ++L ++ D  + +  +  L+     V
Sbjct  76   MDKALNQLSVPLGQLREEVMSLRSCVSEVIQAIDNQLSKQEDLQKKKVCVLRLIQVVRSV  135

Query  502  SKVEKLI  522
             K+EK++
Sbjct  136  EKIEKIL  142



>ref|XP_008427499.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Poecilia reticulata]
Length=729

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 78/127 (61%), Gaps = 0/127 (0%)
 Frame = +1

Query  142  LFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTD  321
            +F+ +DFD + ++++ R  V L+ +R +L  +   L+  +V+LIN+DYADFV+LST L  
Sbjct  16   VFMKDDFDVDQFVAECRKQVQLEEMREDLEMYYKLLKTAMVELINKDYADFVNLSTNLVG  75

Query  322  VDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVV  501
            +D A+ ++  PL ++R ++ + R  V   + A+ ++L ++ D  + +  +  L+     V
Sbjct  76   MDKALNQLSVPLGQLREEVMSLRSCVSEVIQAIDNQLSKQEDLQKKKVCVLRLIQVVRSV  135

Query  502  SKVEKLI  522
             K+EK++
Sbjct  136  EKIEKIL  142



>emb|CDH54965.1| conserved oligomeric golgi complex subunit 2 [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=735

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 78/127 (61%), Gaps = 1/127 (1%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F++ +FD + +++  R  + L+ L+ E  +HL  L+ +L++LINRDY DF+ LST L  V
Sbjct  42   FIAPNFDTDRFLAS-RRHLGLERLKVEFNNHLKFLKTELIELINRDYQDFIDLSTNLKGV  100

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+  +R PL  + H+    R   +SS+  L S+L  RA+  E +  L+L+L+    V+
Sbjct  101  DKAISNIRGPLKRMEHEALDIRINCQSSIDQLESQLLHRAELREKKTCLKLMLNIHESVT  160

Query  505  KVEKLIK  525
            KVE L++
Sbjct  161  KVEDLLE  167



>ref|XP_006267974.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Alligator 
mississippiensis]
Length=737

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 78/140 (56%), Gaps = 5/140 (4%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+  DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKPDFDVDRFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R  V   + A+   + ++ D    +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVMSLRSCVSEGIQAVDEHMSKQEDIRRKKMCVLRLIHVIQSVE  141

Query  505  KVEKLI-----KELPSGATN  549
            K+EK++     KEL S   N
Sbjct  142  KIEKILHSQNSKELSSLEAN  161



>ref|XP_006920806.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Pteropus 
alecto]
Length=664

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 80/136 (59%), Gaps = 0/136 (0%)
 Frame = +1

Query  142  LFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTD  321
            L + +DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  
Sbjct  13   LLVLDDFDVDRFVSDCRKRVQLEELREDLELYYRLLKTAMVELINQDYADFVNLSTNLVG  72

Query  322  VDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVV  501
            VD A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  E +  +  L+     V
Sbjct  73   VDKALSQLSVPLGQLREEVLSLRASVSEGIRAVDERISKQEDIREKKMCVLRLIQVIRSV  132

Query  502  SKVEKLIKELPSGATN  549
             K+EK++    S  T+
Sbjct  133  EKIEKILNSQSSKETS  148



>emb|CDH54964.1| conserved oligomeric golgi complex subunit 2 [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=752

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 78/127 (61%), Gaps = 1/127 (1%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F++ +FD + +++  R  + L+ L+ E  +HL  L+ +L++LINRDY DF+ LST L  V
Sbjct  42   FIAPNFDTDRFLAS-RRHLGLERLKVEFNNHLKFLKTELIELINRDYQDFIDLSTNLKGV  100

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+  +R PL  + H+    R   +SS+  L S+L  RA+  E +  L+L+L+    V+
Sbjct  101  DKAISNIRGPLKRMEHEALDIRINCQSSIDQLESQLLHRAELREKKTCLKLMLNIHESVT  160

Query  505  KVEKLIK  525
            KVE L++
Sbjct  161  KVEDLLE  167



>ref|XP_004712259.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Echinops 
telfairi]
Length=710

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 77/135 (57%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F  EDFD + ++S+ R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FTKEDFDVDHFVSECRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++   R +V   + A+  RL ++ D    +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVLNLRSSVSEGIRAVDERLSKQEDIRGKKMCVLRLIQVIRSVE  141

Query  505  KVEKLIKELPSGATN  549
            K+EK++    S  T+
Sbjct  142  KIEKILSAQSSKETS  156



>dbj|GAN06528.1| conserved oligomeric Golgi complex subunit 2 [Mucor ambiguus]
Length=744

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 82/126 (65%), Gaps = 1/126 (1%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F + DFD +T++S  R  + L+ +++EL +HL  L+ +LV+LINRDY DF++LST L  V
Sbjct  42   FTAPDFDPDTFLSS-RRHLGLERMKAELNTHLKQLKTELVELINRDYQDFINLSTNLKGV  100

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D  +  ++APL ++  ++ + RE  +  + +L  +L+ RA   + + VL+LLL+    V+
Sbjct  101  DKDIEELKAPLADMEIQVKSVREHFQGVIDSLELQLQSRAQLRDKKSVLKLLLNIHDSVT  160

Query  505  KVEKLI  522
            KVE L+
Sbjct  161  KVEDLL  166



>ref|XP_007423722.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Python bivittatus]
Length=729

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 78/136 (57%), Gaps = 0/136 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+  DFD + ++S+ R  V L+ LR +L  +   L+  +++LIN+DYADFV+LST L  +
Sbjct  17   FMKPDFDVDHFVSECRKRVQLEELRDDLELYYKLLKTAMIELINKDYADFVNLSTNLVGM  76

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + +  +   + A+  RL ++ D    +  +  L+     V 
Sbjct  77   DKALNQLSVPLGQLREEVMSLKSCISEEIRAIDDRLSKQEDIRRKKMCVLRLIQVIKSVE  136

Query  505  KVEKLIKELPSGATNL  552
            K+EK++    S  T+L
Sbjct  137  KIEKILHSQNSKETSL  152



>ref|XP_006017037.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Alligator sinensis]
Length=737

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 78/140 (56%), Gaps = 5/140 (4%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+  DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKPDFDVDRFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R  V   + A+   + ++ D    +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVMSLRSCVSEGIRAVDEHMSKQEDIRRKKMCVLRLIHVIQSVE  141

Query  505  KVEKLI-----KELPSGATN  549
            K+EK++     KEL S   N
Sbjct  142  KIEKILHSQNSKELSSLEAN  161



>ref|XP_006017038.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Alligator sinensis]
Length=736

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 78/140 (56%), Gaps = 5/140 (4%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+  DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKPDFDVDRFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + R  V   + A+   + ++ D    +  +  L+     V 
Sbjct  82   DKALNQLSVPLGQLREEVMSLRSCVSEGIRAVDEHMSKQEDIRRKKMCVLRLIHVIQSVE  141

Query  505  KVEKLI-----KELPSGATN  549
            K+EK++     KEL S   N
Sbjct  142  KIEKILHSQNSKELSSLEAN  161



>ref|XP_005518611.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Pseudopodoces humilis]
Length=738

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 77/135 (57%), Gaps = 3/135 (2%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+  DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  21   FMKADFDVDHFVSDCRKRVQLEELREDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  80

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + +  V   + A+  R+ ++ D    R     +L   HV+ 
Sbjct  81   DKALNQLSVPLGQLREEVMSLKSCVSEGIQAIDDRMTKQED---IRRKKMCVLRLIHVIQ  137

Query  505  KVEKLIKELPSGATN  549
             VEK+ K L S  T 
Sbjct  138  SVEKIEKILHSQGTK  152



>ref|XP_005518612.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Pseudopodoces humilis]
Length=737

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 77/135 (57%), Gaps = 3/135 (2%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+  DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  21   FMKADFDVDHFVSDCRKRVQLEELREDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  80

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + +  V   + A+  R+ ++ D    R     +L   HV+ 
Sbjct  81   DKALNQLSVPLGQLREEVMSLKSCVSEGIQAIDDRMTKQED---IRRKKMCVLRLIHVIQ  137

Query  505  KVEKLIKELPSGATN  549
             VEK+ K L S  T 
Sbjct  138  SVEKIEKILHSQGTK  152



>ref|XP_011379200.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Pteropus 
vampyrus]
Length=765

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 79/136 (58%), Gaps = 0/136 (0%)
 Frame = +1

Query  142  LFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTD  321
            L   +DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  
Sbjct  48   LLSEDDFDVDRFVSDCRKRVQLEELREDLELYYRLLKTAMVELINQDYADFVNLSTNLVG  107

Query  322  VDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVV  501
            VD A+ ++  PL ++R ++ + R +V   + A+  R+ ++ D  E +  +  L+     V
Sbjct  108  VDKALSQLSVPLGQLREEVLSLRASVSEGIRAVDERISKQEDIREKKMCVLRLIQVIRSV  167

Query  502  SKVEKLIKELPSGATN  549
             K+EK++    S  T+
Sbjct  168  EKIEKILNSQSSKETS  183



>emb|CDQ63736.1| unnamed protein product [Oncorhynchus mykiss]
Length=731

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 78/127 (61%), Gaps = 0/127 (0%)
 Frame = +1

Query  142  LFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTD  321
            +F+ +DFD + +++D R  V L+ +R +L  +   L+  +V+LIN+DYADFV+LST L  
Sbjct  16   VFMKDDFDVDQFVADCRKHVQLEEMREDLEMYYKLLKTAMVELINKDYADFVNLSTNLVG  75

Query  322  VDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVV  501
            +D A+ ++  PL +++ ++ + R +V   + A+ ++L ++ D    +  +  L+     V
Sbjct  76   MDKALNQLSVPLGQLQEEVLSLRTSVSEVIQAIDNQLSKQDDLQNKKMCVTRLIQVVRSV  135

Query  502  SKVEKLI  522
             K+EK++
Sbjct  136  EKIEKIL  142



>ref|NP_001133098.1| conserved oligomeric Golgi complex subunit 2 [Salmo salar]
 gb|ACH70688.1| component of oligomeric golgi complex 2 [Salmo salar]
Length=731

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 78/127 (61%), Gaps = 0/127 (0%)
 Frame = +1

Query  142  LFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTD  321
            +F+ +DFD + +++D R  V L+ +R +L  +   L+  +V+LIN+DYADFV+LST L  
Sbjct  16   VFMKDDFDVDQFVADCRKHVQLEEMREDLEMYYKLLKTAMVELINKDYADFVNLSTNLVG  75

Query  322  VDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVV  501
            +D A+ ++  PL +++ ++ + R +V   + A+ ++L ++ D    +  +  L+     V
Sbjct  76   MDKALNQLSVPLGQLQEEVLSLRTSVSEVIQAIDNQLSKQDDLQNKKMCVTRLIQVVRSV  135

Query  502  SKVEKLI  522
             K+EK++
Sbjct  136  EKIEKIL  142



>ref|XP_006757736.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Myotis davidii]
Length=703

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 77/136 (57%), Gaps = 0/136 (0%)
 Frame = +1

Query  154  EDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDVDAA  333
            EDFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +D  
Sbjct  19   EDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMDKV  78

Query  334  VVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVSKVE  513
            + ++  PL ++R ++ + R +V   + A+  R+ ++ D    +  +  L+     V K+E
Sbjct  79   LNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRGKKMCVLRLIQVIRSVEKIE  138

Query  514  KLIKELPSGATNLANG  561
            K++    S  T+   G
Sbjct  139  KILNSQSSKETSALEG  154



>emb|CDS10439.1| hypothetical protein LRAMOSA03115 [Absidia idahoensis var. thermophila]
Length=747

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 77/127 (61%), Gaps = 1/127 (1%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F++  FD + +++  R  + L+ L+ E  +HL  L+ +L++LINRDY DF+ LST L  V
Sbjct  42   FIAPTFDTDRFLAS-RRHLGLERLKVEFNNHLKFLKTELIELINRDYQDFIDLSTNLKGV  100

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+  +R PL  + H+    R   +SS+  L S+L  RA+  E +  L+L+L+    V+
Sbjct  101  DKAISNIRGPLKRMEHEALDIRANCQSSIDQLESQLLHRAELREKKTCLKLMLNIHESVT  160

Query  505  KVEKLIK  525
            KVE L++
Sbjct  161  KVEDLLE  167



>gb|ELU10240.1| hypothetical protein CAPTEDRAFT_184924 [Capitella teleta]
Length=394

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 79/126 (63%), Gaps = 0/126 (0%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+  DF+ E +I + R  V L+TLR +L  +L  LQ  +++LIN+DYADFV+LST L  +
Sbjct  23   FMRPDFNVELFIVECRRRVQLETLRDDLALYLKILQSAMIELINKDYADFVNLSTNLVGM  82

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+  +  PL +++ +I   R A++ +++A+  ++  +A   + +  L+ L++    V+
Sbjct  83   DKAINTLVTPLDQLKSEIQNVRGALDDAIAAVEVKMTHQAKIRQKKVCLQRLMNIVQSVA  142

Query  505  KVEKLI  522
             +EKL+
Sbjct  143  TMEKLL  148



>ref|XP_010787277.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Notothenia 
coriiceps]
Length=724

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 78/127 (61%), Gaps = 0/127 (0%)
 Frame = +1

Query  142  LFLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTD  321
            +F+ +DFD + ++++ R  V ++ +R +L  +   L+  +V+LIN+DYADFV+LST L  
Sbjct  16   VFMKDDFDVDQFVAECRKQVQMEEMREDLELYYKLLKTAMVELINKDYADFVNLSTNLVG  75

Query  322  VDAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVV  501
            +D A+ ++  PL ++R ++ + R  V   + A+ ++L ++ D  + +  +  L+     V
Sbjct  76   MDKALNQLSVPLGQLREEVMSLRSCVSEVIQAIDNQLTKQEDLQKKKVCVLRLIQVVRSV  135

Query  502  SKVEKLI  522
             K+EK++
Sbjct  136  EKIEKIL  142



>ref|XP_005440304.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Falco cherrug]
Length=739

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 77/135 (57%), Gaps = 3/135 (2%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+  DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  22   FMKPDFDVDHFVSDCRKRVQLEELREDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  81

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + +  V   + A+  R+ ++ D    R     +L   HV+ 
Sbjct  82   DKALNQLSVPLGQLREEVMSLKSCVSEGIQAVDDRMTKQED---IRRKKMCVLRLIHVIQ  138

Query  505  KVEKLIKELPSGATN  549
             VEK+ K L S  T 
Sbjct  139  SVEKIEKILHSQGTK  153



>ref|XP_010560974.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Haliaeetus leucocephalus]
Length=734

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 77/135 (57%), Gaps = 3/135 (2%)
 Frame = +1

Query  145  FLSEDFDAETYISDLRTFVPLDTlrselrshlsslqrDLVDLINRDYADFVSLSTKLTDV  324
            F+  DFD + ++SD R  V L+ LR +L  +   L+  +V+LIN+DYADFV+LST L  +
Sbjct  17   FMKPDFDVDHFVSDCRKRVQLEELREDLELYYKLLKTAMVELINKDYADFVNLSTNLVGM  76

Query  325  DAAVVRMRAPLLEIRHKISTFREAVESSLSALHSRLKQRADAGEAREVLELLLDTFHVVS  504
            D A+ ++  PL ++R ++ + +  V   + A+  R+ ++ D    R     +L   HV+ 
Sbjct  77   DKALNQLSVPLGQLREEVMSLKSCVSEGIQAVDDRMAKQED---IRRKKMCVLRLIHVIQ  133

Query  505  KVEKLIKELPSGATN  549
             VEK+ K L S  T 
Sbjct  134  SVEKIEKILHSQGTK  148



Lambda      K        H        a         alpha
   0.315    0.132    0.372    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950