BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF008L05

Length=605
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP04035.1|  unnamed protein product                                146   3e-53   Coffea canephora [robusta coffee]
ref|XP_011089543.1|  PREDICTED: root phototropism protein 2-like        145   6e-53   Sesamum indicum [beniseed]
gb|KJB26284.1|  hypothetical protein B456_004G235100                    145   7e-53   Gossypium raimondii
gb|KHG08105.1|  Root phototropism 2 -like protein                       145   9e-53   Gossypium arboreum [tree cotton]
ref|XP_004243653.1|  PREDICTED: root phototropism protein 2             146   4e-52   Solanum lycopersicum
ref|XP_006353728.1|  PREDICTED: root phototropism protein 2-like        146   4e-52   Solanum tuberosum [potatoes]
ref|XP_010023564.1|  PREDICTED: root phototropism protein 2             141   6e-51   Eucalyptus grandis [rose gum]
ref|XP_002264896.1|  PREDICTED: root phototropism protein 2 isofo...    142   6e-51   Vitis vinifera
ref|XP_009611218.1|  PREDICTED: root phototropism protein 2             142   2e-50   Nicotiana tomentosiformis
gb|KDP45678.1|  hypothetical protein JCGZ_17285                         139   2e-50   Jatropha curcas
ref|XP_009777101.1|  PREDICTED: root phototropism protein 2             141   3e-50   Nicotiana sylvestris
ref|XP_007017103.1|  Phototropic-responsive NPH3 family protein         140   4e-50   
ref|XP_006432046.1|  hypothetical protein CICLE_v10000673mg             137   3e-49   Citrus clementina [clementine]
gb|KDO54917.1|  hypothetical protein CISIN_1g007944mg                   137   3e-49   Citrus sinensis [apfelsine]
ref|XP_010094443.1|  Root phototropism protein 2                        140   3e-49   Morus notabilis
emb|CBI15801.3|  unnamed protein product                                132   2e-47   Vitis vinifera
ref|XP_011011776.1|  PREDICTED: root phototropism protein 2-like        129   3e-46   Populus euphratica
gb|EYU36889.1|  hypothetical protein MIMGU_mgv1a003487mg                141   4e-46   Erythranthe guttata [common monkey flower]
ref|XP_002319980.1|  ROOT PHOTOTROPISM 2 family protein                 127   7e-46   
ref|XP_006293884.1|  hypothetical protein CARUB_v10022870mg             130   7e-46   Capsella rubella
ref|XP_006591739.1|  PREDICTED: root phototropism protein 2-like        134   7e-46   Glycine max [soybeans]
gb|AAB63085.1|  unknown protein                                         129   1e-45   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850147.1|  Root phototropism protein 2                           129   1e-45   Arabidopsis thaliana [mouse-ear cress]
gb|AAF33112.1|AF181683_1  RPT2                                          129   1e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010414259.1|  PREDICTED: root phototropism protein 2-like        129   1e-45   Camelina sativa [gold-of-pleasure]
dbj|BAF02185.1|  hypothetical protein                                   129   1e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004500391.1|  PREDICTED: root phototropism protein 2-like        132   2e-45   Cicer arietinum [garbanzo]
ref|XP_002881117.1|  hypothetical protein ARALYDRAFT_481966             129   2e-45   
dbj|BAJ33924.1|  unnamed protein product                                128   3e-45   Eutrema halophilum
ref|XP_009144295.1|  PREDICTED: root phototropism protein 2             128   3e-45   Brassica rapa
gb|KFK22949.1|  root phototropism protein 2                             128   3e-45   Arabis alpina [alpine rockcress]
emb|CDY10743.1|  BnaA05g11930D                                          128   3e-45   Brassica napus [oilseed rape]
ref|XP_010677799.1|  PREDICTED: root phototropism protein 2             127   4e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010244564.1|  PREDICTED: root phototropism protein 2             134   4e-45   Nelumbo nucifera [Indian lotus]
ref|XP_003600550.1|  Root phototropism protein                          129   5e-45   Medicago truncatula
dbj|BAF01791.1|  hypothetical protein                                   127   7e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006410156.1|  hypothetical protein EUTSA_v10016728mg             127   7e-45   
gb|AFK45576.1|  unknown                                                 128   9e-45   Medicago truncatula
ref|XP_010469846.1|  PREDICTED: root phototropism protein 2 isofo...    126   1e-44   
emb|CDY02075.1|  BnaC04g14260D                                          126   1e-44   
ref|XP_008239637.1|  PREDICTED: root phototropism protein 2 isofo...    134   1e-44   Prunus mume [ume]
ref|XP_010510344.1|  PREDICTED: root phototropism protein 2-like        128   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_008239576.1|  PREDICTED: root phototropism protein 2 isofo...    134   1e-44   Prunus mume [ume]
ref|XP_007206420.1|  hypothetical protein PRUPE_ppa003347mg             134   2e-44   Prunus persica
ref|XP_003553189.1|  PREDICTED: root phototropism protein 2-like        129   2e-44   Glycine max [soybeans]
ref|XP_008349518.1|  PREDICTED: LOW QUALITY PROTEIN: root phototr...    136   4e-44   
gb|ADL36608.1|  BZIP domain class transcription factor                  136   4e-44   Malus domestica [apple tree]
ref|XP_009374407.1|  PREDICTED: root phototropism protein 2-like        137   4e-44   Pyrus x bretschneideri [bai li]
ref|XP_008366216.1|  PREDICTED: root phototropism protein 2-like        136   4e-44   
gb|KJB26282.1|  hypothetical protein B456_004G235100                    115   4e-44   Gossypium raimondii
ref|XP_010557176.1|  PREDICTED: root phototropism protein 2             126   5e-44   Tarenaya hassleriana [spider flower]
gb|KHN18647.1|  Root phototropism protein 2                             130   1e-43   Glycine soja [wild soybean]
ref|XP_008358916.1|  PREDICTED: root phototropism protein 2-like        135   1e-43   
ref|NP_001280845.1|  root phototropism protein 2-like                   134   1e-43   Malus domestica [apple tree]
ref|XP_007146905.1|  hypothetical protein PHAVU_006G080400g             130   2e-43   Phaseolus vulgaris [French bean]
ref|XP_004294714.1|  PREDICTED: root phototropism protein 2             132   3e-43   Fragaria vesca subsp. vesca
ref|XP_008451887.1|  PREDICTED: root phototropism protein 2 isofo...    133   4e-43   
ref|XP_008451888.1|  PREDICTED: root phototropism protein 2 isofo...    134   4e-43   Cucumis melo [Oriental melon]
ref|XP_002325631.1|  ROOT PHOTOTROPISM 2 family protein                 130   4e-43   Populus trichocarpa [western balsam poplar]
ref|XP_004147730.1|  PREDICTED: root phototropism protein 2-like        134   1e-42   Cucumis sativus [cucumbers]
ref|XP_011015900.1|  PREDICTED: root phototropism protein 2-like        128   4e-42   Populus euphratica
ref|NP_001280895.1|  root phototropism protein 2-like                   133   5e-42   Malus domestica [apple tree]
ref|XP_009355145.1|  PREDICTED: root phototropism protein 2-like        133   8e-42   Pyrus x bretschneideri [bai li]
gb|KGN53487.1|  hypothetical protein Csa_4G056750                       130   1e-41   
ref|XP_011041764.1|  PREDICTED: root phototropism protein 2-like        128   3e-41   Populus euphratica
emb|CDY23992.1|  BnaC03g16990D                                          125   2e-40   Brassica napus [oilseed rape]
ref|XP_003544940.2|  PREDICTED: root phototropism protein 2-like        127   2e-39   Glycine max [soybeans]
ref|XP_010044625.1|  PREDICTED: root phototropism protein 2-like        119   3e-39   Eucalyptus grandis [rose gum]
gb|KCW86718.1|  hypothetical protein EUGRSUZ_B03325                     118   3e-39   Eucalyptus grandis [rose gum]
ref|XP_003616056.1|  Root phototropism protein                          131   4e-39   Medicago truncatula
ref|XP_011080638.1|  PREDICTED: root phototropism protein 2             120   6e-39   Sesamum indicum [beniseed]
ref|XP_007142019.1|  hypothetical protein PHAVU_008G245700g             126   2e-38   Phaseolus vulgaris [French bean]
ref|XP_003519296.1|  PREDICTED: root phototropism protein 2             124   2e-38   
ref|XP_006842585.1|  hypothetical protein AMTR_s00077p00161250          134   2e-38   Amborella trichopoda
ref|XP_010522018.1|  PREDICTED: root phototropism protein 2-like        115   3e-38   Tarenaya hassleriana [spider flower]
emb|CDX84827.1|  BnaA03g14030D                                          119   7e-38   
ref|XP_009132742.1|  PREDICTED: root phototropism protein 2-like        118   7e-38   Brassica rapa
ref|XP_004490729.1|  PREDICTED: root phototropism protein 2-like        126   2e-37   Cicer arietinum [garbanzo]
gb|EPS73802.1|  hypothetical protein M569_00954                         110   1e-35   Genlisea aurea
gb|ABI34691.1|  bZIP transcription factor bZIP84                        110   4e-34   Glycine max [soybeans]
gb|KJB26283.1|  hypothetical protein B456_004G235100                  75.9    3e-32   Gossypium raimondii
ref|XP_009384759.1|  PREDICTED: root phototropism protein 2-like ...  94.4    3e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006432045.1|  hypothetical protein CICLE_v10000673mg           73.9    1e-30   
gb|KDO54918.1|  hypothetical protein CISIN_1g007944mg                 73.9    2e-30   Citrus sinensis [apfelsine]
ref|XP_010650806.1|  PREDICTED: root phototropism protein 2 isofo...  72.8    3e-30   
ref|XP_008803009.1|  PREDICTED: root phototropism protein 2           97.4    3e-30   Phoenix dactylifera
ref|XP_007156731.1|  hypothetical protein PHAVU_002G012500g           98.6    7e-29   Phaseolus vulgaris [French bean]
ref|NP_001031446.1|  Root phototropism protein 2                      72.4    1e-28   Arabidopsis thaliana [mouse-ear cress]
gb|EYU44474.1|  hypothetical protein MIMGU_mgv1a027075mg              92.4    5e-28   Erythranthe guttata [common monkey flower]
ref|XP_004166154.1|  PREDICTED: BTB/POZ domain-containing protein...  95.9    6e-28   
ref|XP_004149698.1|  PREDICTED: BTB/POZ domain-containing protein...  96.3    6e-28   
ref|XP_003538794.2|  PREDICTED: BTB/POZ domain-containing protein...  96.7    7e-28   Glycine max [soybeans]
ref|XP_002284242.2|  PREDICTED: BTB/POZ domain-containing protein...  96.7    7e-28   Vitis vinifera
ref|XP_010277089.1|  PREDICTED: BTB/POZ domain-containing protein...  91.3    8e-28   
ref|XP_008457766.1|  PREDICTED: BTB/POZ domain-containing protein...  95.9    8e-28   
ref|XP_008457767.1|  PREDICTED: BTB/POZ domain-containing protein...  95.9    8e-28   Cucumis melo [Oriental melon]
ref|XP_002978505.1|  hypothetical protein SELMODRAFT_443843           85.1    8e-28   Selaginella moellendorffii
ref|XP_010086959.1|  BTB/POZ domain-containing protein                94.0    1e-27   
ref|XP_007047478.1|  Phototropic-responsive NPH3 family protein       91.3    1e-27   
emb|CAN71562.1|  hypothetical protein VITISV_007563                   95.9    1e-27   Vitis vinifera
gb|KGN61975.1|  hypothetical protein Csa_2G277660                     95.9    1e-27   
ref|XP_002963864.1|  hypothetical protein SELMODRAFT_141980           82.0    2e-27   Selaginella moellendorffii
ref|XP_002988267.1|  hypothetical protein SELMODRAFT_447227           82.0    2e-27   Selaginella moellendorffii
ref|XP_006466487.1|  PREDICTED: BTB/POZ domain-containing protein...  95.1    2e-27   Citrus sinensis [apfelsine]
ref|XP_006841959.1|  hypothetical protein AMTR_s00144p00020600        94.4    3e-27   Amborella trichopoda
ref|XP_011099322.1|  PREDICTED: BTB/POZ domain-containing protein...  93.2    4e-27   Sesamum indicum [beniseed]
emb|CBI33715.3|  unnamed protein product                              95.5    4e-27   Vitis vinifera
ref|XP_009402205.1|  PREDICTED: root phototropism protein 2 isofo...    102   4e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003517336.1|  PREDICTED: BTB/POZ domain-containing protein...  97.4    4e-27   Glycine max [soybeans]
gb|KHN36285.1|  BTB/POZ domain-containing protein                     97.1    5e-27   Glycine soja [wild soybean]
ref|XP_003597110.1|  Root phototropism protein                        94.7    5e-27   
gb|KJB48677.1|  hypothetical protein B456_008G080700                  87.8    7e-27   Gossypium raimondii
ref|XP_009628088.1|  PREDICTED: BTB/POZ domain-containing protein...  91.3    7e-27   Nicotiana tomentosiformis
gb|KDO78972.1|  hypothetical protein CISIN_1g006971mg                 93.2    8e-27   Citrus sinensis [apfelsine]
ref|XP_006426057.1|  hypothetical protein CICLE_v10025164mg           93.2    8e-27   Citrus clementina [clementine]
ref|XP_009782405.1|  PREDICTED: BTB/POZ domain-containing protein...  90.9    1e-26   Nicotiana sylvestris
ref|XP_006380639.1|  hypothetical protein POPTR_0007s10060g           95.1    1e-26   Populus trichocarpa [western balsam poplar]
ref|XP_006339816.1|  PREDICTED: BTB/POZ domain-containing protein...  94.7    1e-26   Solanum tuberosum [potatoes]
ref|XP_011006799.1|  PREDICTED: BTB/POZ domain-containing protein...  94.7    2e-26   Populus euphratica
ref|XP_002970426.1|  hypothetical protein SELMODRAFT_231529           83.2    2e-26   
ref|XP_011012051.1|  PREDICTED: BTB/POZ domain-containing protein...  94.7    2e-26   Populus euphratica
emb|CDP02580.1|  unnamed protein product                              94.7    2e-26   Coffea canephora [robusta coffee]
gb|KDO78973.1|  hypothetical protein CISIN_1g006971mg                 92.8    3e-26   Citrus sinensis [apfelsine]
gb|KJB48680.1|  hypothetical protein B456_008G080700                  87.4    3e-26   Gossypium raimondii
ref|XP_002533158.1|  Root phototropism protein, putative              92.8    4e-26   Ricinus communis
ref|XP_010559030.1|  PREDICTED: BTB/POZ domain-containing protein...  88.6    5e-26   Tarenaya hassleriana [spider flower]
ref|XP_010272171.1|  PREDICTED: BTB/POZ domain-containing protein...  85.9    6e-26   Nelumbo nucifera [Indian lotus]
gb|KDP32052.1|  hypothetical protein JCGZ_12513                       92.0    1e-25   Jatropha curcas
ref|XP_010679598.1|  PREDICTED: BTB/POZ domain-containing protein...  87.0    1e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004231910.1|  PREDICTED: BTB/POZ domain-containing protein...  93.2    1e-25   Solanum lycopersicum
ref|XP_010679597.1|  PREDICTED: BTB/POZ domain-containing protein...  86.7    1e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008238282.1|  PREDICTED: BTB/POZ domain-containing protein...  92.4    2e-25   
ref|XP_006590635.1|  PREDICTED: BTB/POZ domain-containing protein...  88.6    2e-25   Glycine max [soybeans]
gb|KJB43880.1|  hypothetical protein B456_007G221600                  87.0    2e-25   Gossypium raimondii
gb|AES70802.2|  root phototropism-like protein                        63.5    2e-25   Medicago truncatula
ref|XP_004288469.1|  PREDICTED: BTB/POZ domain-containing protein...  90.5    2e-25   Fragaria vesca subsp. vesca
ref|XP_007208165.1|  hypothetical protein PRUPE_ppa002888mg           92.4    5e-25   Prunus persica
gb|AES90666.2|  phototropic-responsive NPH3 family protein            84.3    5e-25   Medicago truncatula
ref|XP_010905282.1|  PREDICTED: BTB/POZ domain-containing protein...  80.9    7e-25   Elaeis guineensis
gb|KJB43881.1|  hypothetical protein B456_007G221600                  86.7    7e-25   Gossypium raimondii
ref|XP_004511862.1|  PREDICTED: BTB/POZ domain-containing protein...  96.7    8e-25   Cicer arietinum [garbanzo]
ref|XP_004511860.1|  PREDICTED: BTB/POZ domain-containing protein...  96.7    8e-25   Cicer arietinum [garbanzo]
ref|XP_010559028.1|  PREDICTED: BTB/POZ domain-containing protein...  83.6    1e-24   Tarenaya hassleriana [spider flower]
ref|XP_002866705.1|  signal transducer                                88.2    2e-24   Arabidopsis lyrata subsp. lyrata
ref|XP_009342777.1|  PREDICTED: BTB/POZ domain-containing protein...  88.6    2e-24   Pyrus x bretschneideri [bai li]
gb|KHN12984.1|  BTB/POZ domain-containing protein                     84.0    4e-24   Glycine soja [wild soybean]
ref|XP_004233453.1|  PREDICTED: BTB/POZ domain-containing protein...  86.7    5e-24   
ref|XP_004509079.1|  PREDICTED: BTB/POZ domain-containing protein...  80.9    7e-24   Cicer arietinum [garbanzo]
gb|KHG27515.1|  hypothetical protein F383_13864                       90.5    7e-24   Gossypium arboreum [tree cotton]
ref|XP_008354715.1|  PREDICTED: BTB/POZ domain-containing protein...  87.8    7e-24   
ref|XP_010922790.1|  PREDICTED: root phototropism protein 2           77.4    1e-23   Elaeis guineensis
ref|XP_006364419.1|  PREDICTED: BTB/POZ domain-containing protein...  84.7    1e-23   Solanum tuberosum [potatoes]
ref|XP_010939121.1|  PREDICTED: BTB/POZ domain-containing protein...  77.8    2e-23   Elaeis guineensis
ref|XP_010028106.1|  PREDICTED: BTB/POZ domain-containing protein...  89.0    4e-23   Eucalyptus grandis [rose gum]
ref|XP_010028107.1|  PREDICTED: BTB/POZ domain-containing protein...  89.0    4e-23   Eucalyptus grandis [rose gum]
gb|KFK28391.1|  hypothetical protein AALP_AA8G509000                  82.4    5e-23   Arabis alpina [alpine rockcress]
ref|NP_680473.2|  phototropic-responsive NPH3-like protein            84.7    7e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AAU05485.1|  At5g67385                                             84.7    7e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010277091.1|  PREDICTED: BTB/POZ domain-containing protein...  75.5    7e-23   
ref|XP_007155848.1|  hypothetical protein PHAVU_003G236800g           81.6    9e-23   Phaseolus vulgaris [French bean]
ref|XP_006380638.1|  hypothetical protein POPTR_0007s10060g           80.9    9e-23   
ref|XP_006280202.1|  hypothetical protein CARUB_v10026107mg           82.4    1e-22   Capsella rubella
ref|XP_002983725.1|  hypothetical protein SELMODRAFT_228979           82.4    8e-22   Selaginella moellendorffii
ref|XP_002989054.1|  hypothetical protein SELMODRAFT_272040           82.4    9e-22   Selaginella moellendorffii
ref|XP_008787157.1|  PREDICTED: BTB/POZ domain-containing protein...  73.6    1e-21   Phoenix dactylifera
ref|XP_007050812.1|  Phototropic-responsive NPH3 family protein i...  73.6    3e-21   Theobroma cacao [chocolate]
ref|XP_006600924.1|  PREDICTED: BTB/POZ domain-containing protein...  76.3    3e-21   Glycine max [soybeans]
ref|XP_003608469.1|  BTB/POZ domain-containing protein                84.0    3e-21   
ref|XP_007050813.1|  Phototropic-responsive NPH3 family protein i...  72.8    6e-21   Theobroma cacao [chocolate]
ref|XP_004247086.1|  PREDICTED: BTB/POZ domain-containing protein...  68.2    7e-21   Solanum lycopersicum
ref|XP_006579934.1|  PREDICTED: BTB/POZ domain-containing protein...  75.5    8e-21   Glycine max [soybeans]
ref|XP_009630229.1|  PREDICTED: BTB/POZ domain-containing protein...  87.0    8e-21   Nicotiana tomentosiformis
gb|KHG21965.1|  hypothetical protein F383_08186                       71.2    2e-20   Gossypium arboreum [tree cotton]
ref|XP_009630230.1|  PREDICTED: BTB/POZ domain-containing protein...  84.3    2e-20   
gb|EPS72379.1|  hypothetical protein M569_02379                       84.7    2e-20   Genlisea aurea
ref|XP_004511857.1|  PREDICTED: BTB/POZ domain-containing protein...  81.3    3e-20   
ref|XP_004511859.1|  PREDICTED: BTB/POZ domain-containing protein...  81.3    3e-20   
gb|KHG21966.1|  hypothetical protein F383_08186                       70.1    4e-20   Gossypium arboreum [tree cotton]
gb|KJB23203.1|  hypothetical protein B456_004G086600                  70.1    4e-20   Gossypium raimondii
ref|XP_009411062.1|  PREDICTED: BTB/POZ domain-containing protein...  73.9    4e-20   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB41979.1|  hypothetical protein B456_007G130600                  69.7    5e-20   Gossypium raimondii
ref|XP_006393938.1|  hypothetical protein EUTSA_v10003858mg           82.8    5e-20   Eutrema salsugineum [saltwater cress]
dbj|BAJ34215.1|  unnamed protein product                              82.4    5e-20   Eutrema halophilum
gb|KJB26098.1|  hypothetical protein B456_004G225600                  67.4    8e-20   Gossypium raimondii
ref|XP_008352542.1|  PREDICTED: BTB/POZ domain-containing protein...  84.7    9e-20   
ref|XP_010112756.1|  BTB/POZ domain-containing protein                73.2    1e-19   Morus notabilis
ref|XP_008372448.1|  PREDICTED: BTB/POZ domain-containing protein...  84.0    1e-19   
ref|XP_009780159.1|  PREDICTED: BTB/POZ domain-containing protein...  81.3    1e-19   Nicotiana sylvestris
ref|XP_010484507.1|  PREDICTED: BTB/POZ domain-containing protein...  79.0    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010241864.1|  PREDICTED: BTB/POZ domain-containing protein...  66.2    2e-19   Nelumbo nucifera [Indian lotus]
gb|KHG21232.1|  hypothetical protein F383_08117                       66.2    2e-19   Gossypium arboreum [tree cotton]
ref|XP_010464139.1|  PREDICTED: BTB/POZ domain-containing protein...  80.5    2e-19   Camelina sativa [gold-of-pleasure]
gb|KJB41980.1|  hypothetical protein B456_007G130600                  67.4    2e-19   Gossypium raimondii
ref|XP_010028108.1|  PREDICTED: BTB/POZ domain-containing protein...  74.7    3e-19   Eucalyptus grandis [rose gum]
gb|KHG27924.1|  hypothetical protein F383_10949                       69.7    4e-19   Gossypium arboreum [tree cotton]
gb|KEH28209.1|  root phototropism-like protein                        63.9    5e-19   Medicago truncatula
ref|XP_001770455.1|  predicted protein                                55.8    6e-19   
ref|XP_009757790.1|  PREDICTED: BTB/POZ domain-containing protein...  65.5    6e-19   Nicotiana sylvestris
ref|XP_010241873.1|  PREDICTED: BTB/POZ domain-containing protein...  64.3    7e-19   Nelumbo nucifera [Indian lotus]
ref|XP_011468065.1|  PREDICTED: BTB/POZ domain-containing protein...  68.9    7e-19   Fragaria vesca subsp. vesca
ref|XP_007133999.1|  hypothetical protein PHAVU_010G010500g           68.6    9e-19   Phaseolus vulgaris [French bean]
ref|XP_006479889.1|  PREDICTED: BTB/POZ domain-containing protein...  68.9    9e-19   Citrus sinensis [apfelsine]
ref|XP_002320358.1|  hypothetical protein POPTR_0014s12800g           70.1    1e-18   Populus trichocarpa [western balsam poplar]
gb|KJB47066.1|  hypothetical protein B456_008G009400                  69.7    1e-18   Gossypium raimondii
ref|XP_002267241.2|  PREDICTED: BTB/POZ domain-containing protein...  65.1    1e-18   Vitis vinifera
ref|XP_010317168.1|  PREDICTED: BTB/POZ domain-containing protein...  68.2    1e-18   
gb|KJB47067.1|  hypothetical protein B456_008G009400                  70.1    1e-18   Gossypium raimondii
emb|CAN74119.1|  hypothetical protein VITISV_002050                   64.7    1e-18   Vitis vinifera
ref|XP_001763717.1|  predicted protein                                55.5    1e-18   
ref|XP_011033592.1|  PREDICTED: BTB/POZ domain-containing protein...  70.5    1e-18   Populus euphratica
ref|XP_006855474.1|  hypothetical protein AMTR_s00057p00189750        63.9    2e-18   
ref|XP_010652066.1|  PREDICTED: BTB/POZ domain-containing protein...  64.7    2e-18   Vitis vinifera
ref|XP_006479890.1|  PREDICTED: BTB/POZ domain-containing protein...  68.2    2e-18   Citrus sinensis [apfelsine]
ref|XP_009379310.1|  PREDICTED: BTB/POZ domain-containing protein...  83.2    2e-18   Pyrus x bretschneideri [bai li]
ref|XP_008389180.1|  PREDICTED: BTB/POZ domain-containing protein...  68.9    2e-18   
ref|XP_009130549.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  77.8    2e-18   Brassica rapa
emb|CDY37857.1|  BnaAnng05180D                                        77.8    2e-18   Brassica napus [oilseed rape]
dbj|BAJ96209.1|  predicted protein                                    59.7    2e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY57436.1|  BnaAnng14510D                                        79.3    2e-18   Brassica napus [oilseed rape]
ref|XP_009414870.1|  PREDICTED: BTB/POZ domain-containing protein...  74.3    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009378916.1|  PREDICTED: BTB/POZ domain-containing protein...  68.6    3e-18   Pyrus x bretschneideri [bai li]
emb|CDY43566.1|  BnaC02g16630D                                        75.5    4e-18   Brassica napus [oilseed rape]
gb|KDP28100.1|  hypothetical protein JCGZ_13871                       66.2    4e-18   Jatropha curcas
emb|CDY68489.1|  BnaCnng59210D                                        75.9    4e-18   Brassica napus [oilseed rape]
ref|XP_011033590.1|  PREDICTED: BTB/POZ domain-containing protein...  68.9    5e-18   Populus euphratica
ref|XP_009103425.1|  PREDICTED: BTB/POZ domain-containing protein...  78.6    5e-18   Brassica rapa
ref|XP_003600551.1|  Root phototropism protein                        63.5    5e-18   
ref|XP_010685004.1|  PREDICTED: BTB/POZ domain-containing protein...  66.6    5e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006844655.1|  hypothetical protein AMTR_s00016p00237490        76.3    5e-18   Amborella trichopoda
ref|XP_008386633.1|  PREDICTED: BTB/POZ domain-containing protein...  63.9    5e-18   Malus domestica [apple tree]
gb|EYU46717.1|  hypothetical protein MIMGU_mgv1a003257mg              75.9    7e-18   Erythranthe guttata [common monkey flower]
ref|XP_006444252.1|  hypothetical protein CICLE_v10019309mg           68.2    7e-18   
gb|EYU39234.1|  hypothetical protein MIMGU_mgv1a003527mg              66.2    8e-18   Erythranthe guttata [common monkey flower]
dbj|BAK07863.1|  predicted protein                                    73.2    8e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY12841.1|  BnaC07g15920D                                        74.7    1e-17   Brassica napus [oilseed rape]
ref|XP_006429637.1|  hypothetical protein CICLE_v10011315mg           57.8    1e-17   Citrus clementina [clementine]
ref|XP_010069979.1|  PREDICTED: BTB/POZ domain-containing protein...  63.5    1e-17   Eucalyptus grandis [rose gum]
ref|XP_009783326.1|  PREDICTED: BTB/POZ domain-containing protein...  58.2    1e-17   Nicotiana sylvestris
ref|XP_009605134.1|  PREDICTED: BTB/POZ domain-containing protein...  55.1    1e-17   
ref|XP_003558544.1|  PREDICTED: BTB/POZ domain-containing protein...  74.3    1e-17   Brachypodium distachyon [annual false brome]
ref|XP_002877714.1|  predicted protein                                79.7    1e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_008386634.1|  PREDICTED: BTB/POZ domain-containing protein...  63.2    2e-17   Malus domestica [apple tree]
ref|XP_011468062.1|  PREDICTED: BTB/POZ domain-containing protein...  63.9    2e-17   Fragaria vesca subsp. vesca
ref|XP_006389692.1|  hypothetical protein POPTR_0020s00510g           67.4    2e-17   Populus trichocarpa [western balsam poplar]
ref|XP_002465671.1|  hypothetical protein SORBIDRAFT_01g043470        72.8    2e-17   
ref|XP_010684491.1|  PREDICTED: BTB/POZ domain-containing protein...  60.1    2e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011015142.1|  PREDICTED: BTB/POZ domain-containing protein...  67.0    2e-17   Populus euphratica
ref|XP_003528390.2|  PREDICTED: root phototropism protein 3-like ...  71.2    2e-17   Glycine max [soybeans]
gb|KDO87367.1|  hypothetical protein CISIN_1g038941mg                 68.9    2e-17   Citrus sinensis [apfelsine]
ref|NP_182307.1|  phototropic-responsive NPH3 family protein SETH6    66.6    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003608415.1|  Root phototropism protein                        71.2    3e-17   
ref|XP_010684492.1|  PREDICTED: BTB/POZ domain-containing protein...  59.7    3e-17   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN09117.1|  Root phototropism protein 3                           71.2    3e-17   Glycine soja [wild soybean]
ref|XP_011089686.1|  PREDICTED: BTB/POZ domain-containing protein...  71.2    3e-17   Sesamum indicum [beniseed]
ref|XP_007159131.1|  hypothetical protein PHAVU_002G211400g           71.6    4e-17   Phaseolus vulgaris [French bean]
ref|XP_006583767.1|  PREDICTED: root phototropism protein 3-like ...  71.2    4e-17   
ref|XP_006845260.1|  hypothetical protein AMTR_s00005p00262560        60.1    4e-17   
ref|XP_011089687.1|  PREDICTED: BTB/POZ domain-containing protein...  71.2    4e-17   Sesamum indicum [beniseed]
gb|KHG22134.1|  hypothetical protein F383_09600                       68.9    4e-17   Gossypium arboreum [tree cotton]
ref|XP_006651150.1|  PREDICTED: BTB/POZ domain-containing protein...  72.0    4e-17   
ref|XP_006481239.1|  PREDICTED: BTB/POZ domain-containing protein...  57.4    5e-17   
ref|XP_010426528.1|  PREDICTED: putative BTB/POZ domain-containin...  75.5    5e-17   Camelina sativa [gold-of-pleasure]
ref|XP_004985270.1|  PREDICTED: BTB/POZ domain-containing protein...  70.9    5e-17   Setaria italica
ref|XP_007163074.1|  hypothetical protein PHAVU_001G203800g           62.8    5e-17   Phaseolus vulgaris [French bean]
gb|KDO64171.1|  hypothetical protein CISIN_1g035818mg                 57.4    5e-17   Citrus sinensis [apfelsine]
ref|XP_002520669.1|  protein binding protein, putative                63.5    5e-17   Ricinus communis
ref|XP_006841237.1|  hypothetical protein AMTR_s00135p00069650        67.8    5e-17   Amborella trichopoda
gb|ADV56692.1|  NPH3 family protein                                   62.8    6e-17   Phaseolus vulgaris [French bean]
ref|XP_011095171.1|  PREDICTED: BTB/POZ domain-containing protein...  60.5    6e-17   
ref|XP_002521098.1|  protein binding protein, putative                75.1    6e-17   Ricinus communis
ref|XP_009384760.1|  PREDICTED: root phototropism protein 2-like ...  54.7    6e-17   
ref|XP_011015143.1|  PREDICTED: BTB/POZ domain-containing protein...  65.5    6e-17   Populus euphratica
ref|XP_009419048.1|  PREDICTED: BTB/POZ domain-containing protein...  52.0    7e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002533880.1|  Root phototropism protein, putative              68.9    7e-17   
ref|XP_006404279.1|  hypothetical protein EUTSA_v10010186mg           67.8    8e-17   Eutrema salsugineum [saltwater cress]
ref|XP_011001651.1|  PREDICTED: BTB/POZ domain-containing protein...  57.4    8e-17   Populus euphratica
ref|XP_006404081.1|  hypothetical protein EUTSA_v10010248mg           75.9    9e-17   Eutrema salsugineum [saltwater cress]
gb|KHN28223.1|  BTB/POZ domain-containing protein                     64.7    9e-17   Glycine soja [wild soybean]
ref|XP_011092443.1|  PREDICTED: root phototropism protein 3           69.3    9e-17   Sesamum indicum [beniseed]
ref|XP_009605138.1|  PREDICTED: BTB/POZ domain-containing protein...  55.1    9e-17   
ref|XP_011079726.1|  PREDICTED: BTB/POZ domain-containing protein...  69.3    1e-16   
ref|XP_009611132.1|  PREDICTED: BTB/POZ domain-containing protein...  71.6    1e-16   
ref|XP_009595976.1|  PREDICTED: BTB/POZ domain-containing protein...  68.6    1e-16   
ref|XP_004136051.1|  PREDICTED: BTB/POZ domain-containing protein...  67.4    1e-16   
ref|XP_004309683.1|  PREDICTED: BTB/POZ domain-containing protein...  61.6    1e-16   
ref|XP_004247452.1|  PREDICTED: BTB/POZ domain-containing protein...  70.5    1e-16   
gb|KEH31205.1|  phototropic-responsive NPH3 family protein            70.9    1e-16   
ref|XP_006842579.1|  hypothetical protein AMTR_s00077p00157280        52.0    1e-16   
ref|XP_009620326.1|  PREDICTED: BTB/POZ domain-containing protein...  59.3    1e-16   
ref|XP_004170411.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  67.0    1e-16   
ref|XP_006604703.1|  PREDICTED: BTB/POZ domain-containing protein...  66.6    1e-16   
ref|XP_006363693.1|  PREDICTED: BTB/POZ domain-containing protein...  58.9    1e-16   
ref|XP_002522618.1|  hypothetical protein RCOM_0884570                67.8    1e-16   
ref|XP_004247004.1|  PREDICTED: BTB/POZ domain-containing protein...  56.2    1e-16   
gb|EYU42051.1|  hypothetical protein MIMGU_mgv1a003173mg              57.0    1e-16   
ref|XP_010503666.1|  PREDICTED: putative BTB/POZ domain-containin...  75.5    1e-16   
gb|KHN43539.1|  BTB/POZ domain-containing protein                     66.2    1e-16   
ref|XP_008451623.1|  PREDICTED: BTB/POZ domain-containing protein...  67.0    2e-16   
emb|CDX89922.1|  BnaA10g01600D                                        57.4    2e-16   
ref|XP_007201187.1|  hypothetical protein PRUPE_ppa002993mg           72.0    2e-16   
ref|XP_009119585.1|  PREDICTED: BTB/POZ domain-containing protein...  57.4    2e-16   
ref|XP_004485981.1|  PREDICTED: BTB/POZ domain-containing protein...  59.3    2e-16   
ref|XP_011470995.1|  PREDICTED: BTB/POZ domain-containing protein...  61.2    2e-16   
ref|XP_002323684.2|  hypothetical protein POPTR_0016s14670g           57.4    2e-16   
ref|XP_009334929.1|  PREDICTED: BTB/POZ domain-containing protein...  68.9    2e-16   
gb|EMT21744.1|  BTB/POZ domain-containing protein                     69.7    2e-16   
ref|XP_009405608.1|  PREDICTED: BTB/POZ domain-containing protein...  72.0    2e-16   
ref|XP_011082488.1|  PREDICTED: BTB/POZ domain-containing protein...  68.2    2e-16   
ref|XP_003518959.1|  PREDICTED: BTB/POZ domain-containing protein...  63.2    2e-16   
ref|XP_006356774.1|  PREDICTED: BTB/POZ domain-containing protein...  67.4    2e-16   
ref|XP_003577427.1|  PREDICTED: BTB/POZ domain-containing protein...  62.4    2e-16   
ref|XP_008235484.1|  PREDICTED: BTB/POZ domain-containing protein...  71.6    2e-16   
gb|EYU40606.1|  hypothetical protein MIMGU_mgv1a003057mg              70.5    2e-16   
ref|XP_004249834.1|  PREDICTED: BTB/POZ domain-containing protein...  59.3    2e-16   
ref|XP_009631478.1|  PREDICTED: root phototropism protein 3-like      68.6    3e-16   
ref|XP_008451624.1|  PREDICTED: BTB/POZ domain-containing protein...  66.2    3e-16   
ref|XP_010326604.1|  PREDICTED: BTB/POZ domain-containing protein...  69.7    3e-16   
ref|XP_003521542.1|  PREDICTED: BTB/POZ domain-containing protein...  64.7    3e-16   
ref|XP_001769248.1|  predicted protein                                53.9    3e-16   
ref|XP_008382632.1|  PREDICTED: BTB/POZ domain-containing protein...  68.6    3e-16   
ref|XP_003593245.1|  Root phototropism protein                        65.5    3e-16   
ref|XP_011082489.1|  PREDICTED: BTB/POZ domain-containing protein...  67.4    3e-16   
ref|XP_006494598.1|  PREDICTED: root phototropism protein 3-like ...  66.6    4e-16   
gb|KDP40950.1|  hypothetical protein JCGZ_24949                       66.6    4e-16   
gb|KDO42273.1|  hypothetical protein CISIN_1g005842mg                 66.2    4e-16   
ref|XP_006359421.1|  PREDICTED: BTB/POZ domain-containing protein...  70.1    4e-16   
ref|XP_006359422.1|  PREDICTED: BTB/POZ domain-containing protein...  69.7    4e-16   
ref|XP_006420844.1|  hypothetical protein CICLE_v10004479mg           66.2    4e-16   
ref|XP_007144554.1|  hypothetical protein PHAVU_007G165600g           63.5    4e-16   
ref|XP_004504832.1|  PREDICTED: root phototropism protein 3-like ...  68.9    4e-16   
ref|XP_004504830.1|  PREDICTED: root phototropism protein 3-like ...  68.9    4e-16   
ref|XP_004495986.1|  PREDICTED: BTB/POZ domain-containing protein...  60.5    4e-16   
ref|XP_006846819.1|  hypothetical protein AMTR_s00148p00085230        60.8    4e-16   
ref|XP_004504829.1|  PREDICTED: root phototropism protein 3-like ...  68.9    4e-16   
ref|XP_009803877.1|  PREDICTED: root phototropism protein 3-like      69.3    4e-16   
ref|XP_008225559.1|  PREDICTED: BTB/POZ domain-containing protein...  57.8    5e-16   
ref|XP_011023032.1|  PREDICTED: root phototropism protein 3-like      67.4    5e-16   
ref|XP_011089103.1|  PREDICTED: BTB/POZ domain-containing protein...  71.6    5e-16   
ref|XP_006351743.1|  PREDICTED: root phototropism protein 3-like      66.6    5e-16   
ref|XP_002880327.1|  phototropic-responsive NPH3 family protein       65.1    5e-16   
ref|XP_011012727.1|  PREDICTED: root phototropism protein 3-like      67.4    5e-16   
ref|XP_002310495.1|  hypothetical protein POPTR_0007s03550g           67.4    5e-16   
ref|XP_002863056.1|  phototropic-responsive NPH3 family protein       65.1    5e-16   
ref|XP_010038174.1|  PREDICTED: BTB/POZ domain-containing protein...  60.8    6e-16   
ref|XP_010065706.1|  PREDICTED: root phototropism protein 3           65.5    6e-16   
emb|CAN60915.1|  hypothetical protein VITISV_002200                   65.5    6e-16   
gb|KCW63332.1|  hypothetical protein EUGRSUZ_G00960                   65.5    6e-16   
ref|XP_011089690.1|  PREDICTED: BTB/POZ domain-containing protein...  71.2    6e-16   
ref|XP_002269380.1|  PREDICTED: root phototropism protein 3           65.5    6e-16   
ref|XP_009775884.1|  PREDICTED: BTB/POZ domain-containing protein...  57.8    6e-16   
ref|XP_004230550.1|  PREDICTED: root phototropism protein 3-like      66.2    6e-16   
ref|XP_001764279.1|  predicted protein                                52.8    6e-16   
gb|KEH43247.1|  phototropic-responsive NPH3 family protein            59.7    7e-16   
gb|KDO42274.1|  hypothetical protein CISIN_1g005842mg                 66.2    7e-16   
ref|XP_011089689.1|  PREDICTED: BTB/POZ domain-containing protein...  71.2    7e-16   
gb|KDP34960.1|  hypothetical protein JCGZ_09248                       61.2    7e-16   
gb|KHG29755.1|  Root phototropism 3 -like protein                     65.1    7e-16   
emb|CDY57361.1|  BnaC08g48680D                                        74.7    7e-16   
emb|CDY30615.1|  BnaAnng03900D                                        74.7    8e-16   
ref|XP_010921839.1|  PREDICTED: BTB/POZ domain-containing protein...  65.9    8e-16   
ref|XP_011014241.1|  PREDICTED: root phototropism protein 3-like ...  64.7    8e-16   
ref|XP_010518503.1|  PREDICTED: BTB/POZ domain-containing protein...  64.3    9e-16   
ref|XP_011024680.1|  PREDICTED: BTB/POZ domain-containing protein...  71.2    9e-16   
ref|XP_010524688.1|  PREDICTED: BTB/POZ domain-containing protein...  68.6    9e-16   
gb|KJB79558.1|  hypothetical protein B456_013G057300                  64.7    9e-16   
ref|XP_009766094.1|  PREDICTED: root phototropism protein 3-like ...  65.9    9e-16   
ref|XP_002301784.2|  hypothetical protein POPTR_0002s24380g           71.2    9e-16   
ref|NP_001280859.1|  BTB/POZ domain-containing protein At1g30440-...  58.2    9e-16   
gb|KJB47065.1|  hypothetical protein B456_008G009400                  69.3    9e-16   
ref|XP_004246916.1|  PREDICTED: BTB/POZ domain-containing protein...  53.9    9e-16   
ref|XP_004495987.1|  PREDICTED: BTB/POZ domain-containing protein...  59.7    9e-16   
gb|KFK34271.1|  hypothetical protein AALP_AA5G123300                  70.5    9e-16   
ref|XP_004248794.1|  PREDICTED: root phototropism protein 3-like      64.3    1e-15   
ref|XP_004495988.1|  PREDICTED: BTB/POZ domain-containing protein...  59.7    1e-15   
ref|XP_009792130.1|  PREDICTED: BTB/POZ domain-containing protein...  68.2    1e-15   
ref|XP_009362255.1|  PREDICTED: BTB/POZ domain-containing protein...  58.2    1e-15   
ref|XP_007144555.1|  hypothetical protein PHAVU_007G165600g           62.4    1e-15   
ref|XP_009115683.1|  PREDICTED: BTB/POZ domain-containing protein...  73.9    1e-15   
ref|XP_009115684.1|  PREDICTED: BTB/POZ domain-containing protein...  73.9    1e-15   
ref|XP_002961348.1|  hypothetical protein SELMODRAFT_74933            63.5    1e-15   
ref|XP_003545709.1|  PREDICTED: root phototropism protein 3-like      65.9    1e-15   
ref|XP_003541674.1|  PREDICTED: BTB/POZ domain-containing protein...  56.2    1e-15   
ref|XP_010038175.1|  PREDICTED: BTB/POZ domain-containing protein...  60.1    1e-15   
ref|XP_008660160.1|  PREDICTED: BTB/POZ domain-containing protein...  64.3    1e-15   
gb|EEC74727.1|  hypothetical protein OsI_10455                        67.8    1e-15   
ref|XP_004485603.1|  PREDICTED: root phototropism protein 3-like      63.9    1e-15   
gb|AAN77296.1|  Hypothetical protein                                  67.8    1e-15   
tpg|DAA43883.1|  TPA: putative phototropic-responsive NPH3 family...  67.0    1e-15   
ref|XP_003551322.2|  PREDICTED: BTB/POZ domain-containing protein...  71.2    1e-15   
emb|CBI38224.3|  unnamed protein product                              65.5    1e-15   
ref|XP_004294000.1|  PREDICTED: BTB/POZ domain-containing protein...  58.9    1e-15   
gb|KHN19000.1|  Root phototropism protein 3                           66.2    2e-15   
gb|KHN33549.1|  Root phototropism protein 3                           65.9    2e-15   
ref|XP_006594679.1|  PREDICTED: root phototropism protein 3-like      66.2    2e-15   
gb|KCW49991.1|  hypothetical protein EUGRSUZ_K03448                   60.1    2e-15   
gb|KDP26391.1|  hypothetical protein JCGZ_17549                       70.1    2e-15   
ref|XP_009119586.1|  PREDICTED: BTB/POZ domain-containing protein...  53.9    2e-15   
ref|XP_010545039.1|  PREDICTED: BTB/POZ domain-containing protein...  60.8    2e-15   
ref|XP_011014242.1|  PREDICTED: root phototropism protein 3-like ...  65.1    2e-15   
ref|XP_006443605.1|  hypothetical protein CICLE_v10019330mg           70.9    2e-15   
ref|XP_010506827.1|  PREDICTED: BTB/POZ domain-containing protein...  62.8    2e-15   
ref|XP_009419001.1|  PREDICTED: BTB/POZ domain-containing protein...  57.8    2e-15   
ref|XP_002531804.1|  Root phototropism protein, putative              57.4    2e-15   
gb|KHN03742.1|  BTB/POZ domain-containing protein                     62.0    2e-15   
ref|XP_003593874.1|  BTB/POZ domain-containing protein                58.5    2e-15   
ref|XP_007200957.1|  hypothetical protein PRUPE_ppa002411mg           63.2    2e-15   
ref|XP_003536250.1|  PREDICTED: BTB/POZ domain-containing protein...  62.4    2e-15   
ref|XP_009766095.1|  PREDICTED: root phototropism protein 3-like ...  65.5    2e-15   
gb|KHN13450.1|  BTB/POZ domain-containing protein                     70.1    2e-15   
ref|XP_007049780.1|  Phototropic-responsive NPH3 family protein       68.6    2e-15   
ref|XP_010094827.1|  Root phototropism protein 3                      63.5    2e-15   
dbj|BAJ33928.1|  unnamed protein product                              67.4    3e-15   
ref|XP_002323955.2|  hypothetical protein POPTR_0017s07540g           62.8    3e-15   
ref|XP_004506596.1|  PREDICTED: BTB/POZ domain-containing protein...  70.9    3e-15   
ref|XP_008803011.1|  PREDICTED: BTB/POZ domain-containing protein...  53.1    3e-15   
ref|XP_006395119.1|  hypothetical protein EUTSA_v10003813mg           67.4    3e-15   
ref|XP_011087936.1|  PREDICTED: root phototropism protein 3-like      62.8    3e-15   
ref|XP_009608443.1|  PREDICTED: root phototropism protein 3 isofo...  63.9    3e-15   
ref|XP_010036820.1|  PREDICTED: BTB/POZ domain-containing protein...  68.6    3e-15   
gb|EYU39117.1|  hypothetical protein MIMGU_mgv1a002358mg              62.8    3e-15   
ref|XP_006595174.1|  PREDICTED: root phototropism protein 3-like ...  65.9    3e-15   
ref|XP_006595180.1|  PREDICTED: root phototropism protein 3-like ...  65.9    3e-15   
ref|XP_007214533.1|  hypothetical protein PRUPE_ppa002754mg           58.5    4e-15   
ref|XP_002442755.1|  hypothetical protein SORBIDRAFT_08g002310        56.6    4e-15   
gb|KHN31896.1|  Root phototropism protein 3                           65.9    4e-15   
ref|XP_010507839.1|  PREDICTED: BTB/POZ domain-containing protein...  62.8    4e-15   
ref|XP_009344395.1|  PREDICTED: BTB/POZ domain-containing protein...  53.9    4e-15   
ref|NP_001152299.1|  transposon protein Mutator sub-class             67.0    4e-15   
ref|XP_006359786.1|  PREDICTED: root phototropism protein 3-like      62.8    4e-15   
gb|ACL52494.1|  unknown                                               67.0    5e-15   
ref|XP_003520918.1|  PREDICTED: BTB/POZ domain-containing protein...  69.3    5e-15   
ref|XP_007148380.1|  hypothetical protein PHAVU_006G203600g           63.2    5e-15   
ref|XP_008237216.1|  PREDICTED: root phototropism protein 3           62.4    5e-15   
ref|XP_006588602.1|  PREDICTED: BTB/POZ domain-containing protein...  61.2    5e-15   
ref|XP_007199752.1|  hypothetical protein PRUPE_ppa002803mg           68.2    5e-15   
ref|XP_010922793.1|  PREDICTED: BTB/POZ domain-containing protein...  53.1    5e-15   
gb|ABF97835.1|  transposon protein, putative, Mutator sub-class, ...  60.1    5e-15   
ref|XP_009368293.1|  PREDICTED: root phototropism protein 3-like      62.4    5e-15   
ref|NP_001049321.2|  Os03g0206700                                     66.6    5e-15   
emb|CDX83030.1|  BnaA01g20300D                                        68.2    5e-15   
ref|XP_002988207.1|  hypothetical protein SELMODRAFT_183709           65.9    5e-15   
ref|XP_008358392.1|  PREDICTED: root phototropism protein 3-like      62.4    5e-15   
ref|XP_002963496.1|  hypothetical protein SELMODRAFT_166345           65.9    5e-15   
emb|CDO97399.1|  unnamed protein product                              63.9    5e-15   
ref|XP_007042874.1|  Phototropic-responsive NPH3 family protein i...  62.4    5e-15   
ref|XP_010412682.1|  PREDICTED: putative BTB/POZ domain-containin...  73.6    5e-15   
ref|XP_008465052.1|  PREDICTED: BTB/POZ domain-containing protein...  67.8    5e-15   
ref|XP_006588603.1|  PREDICTED: BTB/POZ domain-containing protein...  61.2    6e-15   
emb|CAN72130.1|  hypothetical protein VITISV_002335                   58.2    6e-15   
ref|XP_010109730.1|  BTB/POZ domain-containing protein                67.0    6e-15   
ref|XP_004301628.1|  PREDICTED: root phototropism protein 3           62.4    6e-15   
ref|XP_004978519.1|  PREDICTED: BTB/POZ domain-containing protein...  55.8    7e-15   
gb|KHG00255.1|  hypothetical protein F383_19997                       67.8    7e-15   
gb|KJB42465.1|  hypothetical protein B456_007G154300                  67.8    7e-15   
ref|XP_003561994.1|  PREDICTED: BTB/POZ domain-containing protein...  60.5    8e-15   
gb|KJB32104.1|  hypothetical protein B456_005G224200                  61.6    8e-15   
emb|CDP03534.1|  unnamed protein product                              66.2    8e-15   
gb|AAO16690.1|  hypothetical protein-like protein                     55.5    8e-15   
ref|XP_003604967.1|  BTB/POZ domain-containing protein                68.2    8e-15   
ref|XP_011459733.1|  PREDICTED: BTB/POZ domain-containing protein...  69.3    8e-15   
gb|EMT33147.1|  BTB/POZ domain-containing protein                     56.6    8e-15   
ref|XP_009608450.1|  PREDICTED: root phototropism protein 3 isofo...  63.5    9e-15   
gb|KDP21845.1|  hypothetical protein JCGZ_00632                       53.9    9e-15   
ref|XP_010905431.1|  PREDICTED: BTB/POZ domain-containing protein...  55.8    9e-15   
ref|XP_006650337.1|  PREDICTED: BTB/POZ domain-containing protein...  58.9    1e-14   
ref|XP_009150509.1|  PREDICTED: root phototropism protein 3 isofo...  62.0    1e-14   
ref|XP_009776597.1|  PREDICTED: BTB/POZ domain-containing protein...  67.8    1e-14   
ref|XP_010051973.1|  PREDICTED: BTB/POZ domain-containing protein...  54.7    1e-14   
ref|XP_009599429.1|  PREDICTED: BTB/POZ domain-containing protein...  69.7    1e-14   
ref|XP_009781651.1|  PREDICTED: BTB/POZ domain-containing protein...  57.4    1e-14   
emb|CDX84515.1|  BnaC03g49850D                                        61.6    1e-14   
gb|KFK28125.1|  hypothetical protein AALP_AA8G475700                  61.6    1e-14   
gb|EPS73600.1|  hypothetical protein M569_01153                       56.2    1e-14   
ref|XP_009626458.1|  PREDICTED: BTB/POZ domain-containing protein...  68.2    1e-14   
emb|CDX86278.1|  BnaA06g29950D                                        65.5    1e-14   
ref|XP_009150508.1|  PREDICTED: root phototropism protein 3 isofo...  61.6    1e-14   
ref|XP_010909562.1|  PREDICTED: BTB/POZ domain-containing protein...  48.1    1e-14   
ref|XP_009151678.1|  PREDICTED: BTB/POZ domain-containing protein...  65.5    1e-14   
emb|CDX85365.1|  BnaC07g26760D                                        65.5    1e-14   
gb|EMT10715.1|  BTB/POZ domain-containing protein                     63.5    1e-14   
ref|XP_010691413.1|  PREDICTED: root phototropism protein 3           62.4    1e-14   
ref|XP_006280132.1|  hypothetical protein CARUB_v10026027mg           61.6    1e-14   
ref|XP_009151299.1|  PREDICTED: BTB/POZ domain-containing protein...  66.6    1e-14   
ref|XP_008383422.1|  PREDICTED: BTB/POZ domain-containing protein...  54.7    1e-14   
ref|XP_004155495.1|  PREDICTED: uncharacterized LOC101202983          57.4    1e-14   
gb|EYU34459.1|  hypothetical protein MIMGU_mgv1a003106mg              52.0    1e-14   
ref|XP_010461672.1|  PREDICTED: root phototropism protein 3 isofo...  61.2    2e-14   
ref|XP_009626459.1|  PREDICTED: BTB/POZ domain-containing protein...  67.8    2e-14   
dbj|BAB09864.1|  non-phototropic hypocotyl 3                          61.2    2e-14   
ref|XP_010461680.1|  PREDICTED: root phototropism protein 3 isofo...  61.6    2e-14   
gb|AAF05914.1|AF180390_1  non-phototropic hypocotyl 3                 61.2    2e-14   
ref|NP_568989.1|  root phototropism protein 3                         61.2    2e-14   
ref|XP_002526612.1|  Root phototropism protein, putative              61.6    2e-14   
ref|XP_002863924.1|  phototropic-responsive NPH3 family protein       65.5    2e-14   
emb|CDY52208.1|  BnaC01g42530D                                        66.6    2e-14   
ref|XP_009776604.1|  PREDICTED: BTB/POZ domain-containing protein...  67.4    2e-14   
ref|NP_199691.1|  phototropic-responsive NPH3 protein                 65.5    2e-14   
ref|XP_004136895.1|  PREDICTED: root phototropism protein 3-like      57.4    2e-14   
gb|EYU18437.1|  hypothetical protein MIMGU_mgv1a002339mg              61.6    2e-14   
ref|XP_008373205.1|  PREDICTED: root phototropism protein 3           60.1    2e-14   



>emb|CDP04035.1| unnamed protein product [Coffea canephora]
Length=573

 Score =   146 bits (368),  Expect(3) = 3e-53, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MASPL + ++RLSLAMERTGQWVFSQEIPTDV+V VG+A+FSLHKFMLVAKSN IRKLI+
Sbjct  1    MASPLVNNSSRLSLAMERTGQWVFSQEIPTDVLVEVGKATFSLHKFMLVAKSNCIRKLIL  60

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +SKEADLTRI+LS IPGGPEIFE+  +
Sbjct  61   ESKEADLTRIDLSDIPGGPEIFEKAAK  87


 Score = 73.6 bits (179),  Expect(3) = 3e-53, Method: Compositional matrix adjust.
 Identities = 51/54 (94%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQVAL SLSGA+VVLKSCE+LLP
Sbjct  100  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQVALPSLSGAVVVLKSCEDLLP  153


 Score = 37.0 bits (84),  Expect(3) = 3e-53, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  85   AAKFCYGVNFEITVH  99



>ref|XP_011089543.1| PREDICTED: root phototropism protein 2-like [Sesamum indicum]
Length=563

 Score =   145 bits (366),  Expect(3) = 6e-53, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +1

Query  169  ATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  348
            A RLSLAMERTGQWVFSQEIPTDVIV VGEA+FSLHKFMLVAKSN+IRKLI+DSKEADLT
Sbjct  2    ANRLSLAMERTGQWVFSQEIPTDVIVEVGEANFSLHKFMLVAKSNHIRKLILDSKEADLT  61

Query  349  RINLSGIPGGPEIFERGGE  405
            RI+LS IPGGPEIFE+  +
Sbjct  62   RIDLSDIPGGPEIFEKAAK  80


 Score = 73.2 bits (178),  Expect(3) = 6e-53, Method: Compositional matrix adjust.
 Identities = 52/54 (96%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQVAL+SLSGALVVLKSCE+LLP
Sbjct  93   NVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQVALTSLSGALVVLKSCEDLLP  146


 Score = 37.0 bits (84),  Expect(3) = 6e-53, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  78   AAKFCYGVNFEITVH  92



>gb|KJB26284.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=574

 Score =   145 bits (366),  Expect(3) = 7e-53, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 79/87 (91%), Gaps = 1/87 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+PL+S  +RLS AMERTGQWVFSQEIPTDVIV VGEA+F+LHKFMLVAKSNYIRKLIM
Sbjct  1    MATPLRSN-SRLSTAMERTGQWVFSQEIPTDVIVEVGEANFNLHKFMLVAKSNYIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            ++ EADLTRINLS IPGGPEIFE+  +
Sbjct  60   ETNEADLTRINLSEIPGGPEIFEKAAK  86


 Score = 73.6 bits (179),  Expect(3) = 7e-53, Method: Compositional matrix adjust.
 Identities = 52/54 (96%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQVALSSLSGA+VVLKSCE+LLP
Sbjct  99   NVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQVALSSLSGAVVVLKSCEDLLP  152


 Score = 36.6 bits (83),  Expect(3) = 7e-53, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  84   AAKFCYGVNFEITVH  98



>gb|KHG08105.1| Root phototropism 2 -like protein [Gossypium arboreum]
Length=507

 Score =   145 bits (365),  Expect(3) = 9e-53, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 79/87 (91%), Gaps = 1/87 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+PL+S  +RLS AMERTGQWVFSQEIPTDVIV VGEA+F+LHKFMLVAKSNYIRKLIM
Sbjct  1    MATPLRSN-SRLSTAMERTGQWVFSQEIPTDVIVEVGEANFNLHKFMLVAKSNYIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            ++ EADLTRINLS IPGGPEIFE+  +
Sbjct  60   ETNEADLTRINLSEIPGGPEIFEKAAK  86


 Score = 73.6 bits (179),  Expect(3) = 9e-53, Method: Compositional matrix adjust.
 Identities = 52/54 (96%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQVALSSLSGA+VVLKSCE+LLP
Sbjct  99   NVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQVALSSLSGAVVVLKSCEDLLP  152


 Score = 36.6 bits (83),  Expect(3) = 9e-53, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  84   AAKFCYGVNFEITVH  98



>ref|XP_004243653.1| PREDICTED: root phototropism protein 2 [Solanum lycopersicum]
Length=576

 Score =   146 bits (368),  Expect(3) = 4e-52, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 80/87 (92%), Gaps = 1/87 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+PLK+   RLSLAMERTGQWVFSQEIPTDVIV VGEA+F+LHKFMLVAKSNYIRKLI+
Sbjct  1    MATPLKNT-NRLSLAMERTGQWVFSQEIPTDVIVEVGEANFNLHKFMLVAKSNYIRKLIL  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            D+KE+D++RINLS IPGGPE+FE+  +
Sbjct  60   DTKESDVSRINLSDIPGGPEMFEKAAK  86


 Score = 70.1 bits (170),  Expect(3) = 4e-52, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYLQMTDKYCDNNLA RTEDFL+QVAL+SLSGALVVLKSCE LLP
Sbjct  99   NVAALRCAAEYLQMTDKYCDNNLASRTEDFLAQVALTSLSGALVVLKSCENLLP  152


 Score = 36.6 bits (83),  Expect(3) = 4e-52, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  84   AAKFCYGVNFEITVH  98



>ref|XP_006353728.1| PREDICTED: root phototropism protein 2-like [Solanum tuberosum]
Length=576

 Score =   146 bits (368),  Expect(3) = 4e-52, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 80/87 (92%), Gaps = 1/87 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+PLK+   RLSLAMERTGQWVFSQEIPTDVIV VGEA+F+LHKFMLVAKSNYIRKLI+
Sbjct  1    MATPLKNT-NRLSLAMERTGQWVFSQEIPTDVIVEVGEANFNLHKFMLVAKSNYIRKLIL  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            D+KE+D++RINLS IPGGPE+FE+  +
Sbjct  60   DTKESDVSRINLSDIPGGPEMFEKAAK  86


 Score = 70.1 bits (170),  Expect(3) = 4e-52, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYLQMTDKYCDNNLA RTEDFL+QVAL+SLSGALVVLKSCE LLP
Sbjct  99   NVAALRCAAEYLQMTDKYCDNNLASRTEDFLAQVALTSLSGALVVLKSCENLLP  152


 Score = 36.6 bits (83),  Expect(3) = 4e-52, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  84   AAKFCYGVNFEITVH  98



>ref|XP_010023564.1| PREDICTED: root phototropism protein 2 [Eucalyptus grandis]
 gb|KCW59867.1| hypothetical protein EUGRSUZ_H02604 [Eucalyptus grandis]
Length=570

 Score =   141 bits (356),  Expect(3) = 6e-51, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 79/87 (91%), Gaps = 1/87 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+P++ A  RLS+AMERTGQWVFSQEIPTDV+V VGEA+FSLHKFML+AKSNYIRKLI+
Sbjct  1    MATPVR-ANERLSIAMERTGQWVFSQEIPTDVVVRVGEANFSLHKFMLLAKSNYIRKLII  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            ++KEADL RI+LS IPGGPEIFE+  +
Sbjct  60   ETKEADLARIDLSNIPGGPEIFEKAAK  86


 Score = 70.9 bits (172),  Expect(3) = 6e-51, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYLQMTD+YCDNNLAGRT+DFL+QVALSSLSGA+VVLKSCE+LLP
Sbjct  99   NVAALRCAAEYLQMTDQYCDNNLAGRTDDFLTQVALSSLSGAIVVLKSCEDLLP  152


 Score = 36.6 bits (83),  Expect(3) = 6e-51, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  84   AAKFCYGVNFEITVH  98



>ref|XP_002264896.1| PREDICTED: root phototropism protein 2 isoform X1 [Vitis vinifera]
Length=572

 Score =   142 bits (357),  Expect(3) = 6e-51, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+ LK    R SLAMERTGQWVFSQEIPTDV+V VGEA+FSLHKFMLVAKSNYIRKLIM
Sbjct  1    MAASLK-GNNRRSLAMERTGQWVFSQEIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +SKEADLT I+LS IPGGPEIFE+  +
Sbjct  60   ESKEADLTNIDLSDIPGGPEIFEKAAK  86


 Score = 70.1 bits (170),  Expect(3) = 6e-51, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYLQMTDKYCD NL+GRTEDFL QVAL+SLSGA+VVLKSCE+LLP
Sbjct  99   NVAALRCAAEYLQMTDKYCDGNLSGRTEDFLKQVALTSLSGAVVVLKSCEDLLP  152


 Score = 36.6 bits (83),  Expect(3) = 6e-51, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  84   AAKFCYGVNFEITVH  98



>ref|XP_009611218.1| PREDICTED: root phototropism protein 2 [Nicotiana tomentosiformis]
Length=575

 Score =   142 bits (358),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 79/87 (91%), Gaps = 1/87 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+P+K+   RLSLAMERTGQWVFSQEIPTDV+V VGEA+F+LHKFMLVAKSNYIRKLI+
Sbjct  1    MAAPIKNT-NRLSLAMERTGQWVFSQEIPTDVVVEVGEANFNLHKFMLVAKSNYIRKLIL  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +SKE ++TRINLS IPGGPE+FE+  +
Sbjct  60   ESKETEVTRINLSEIPGGPEMFEKAAK  86


 Score = 68.6 bits (166),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAA+YLQMTDKYCDNNLA RTEDFL+QVAL+SLSGALVVLKSCE LLP
Sbjct  99   NVAALRCAADYLQMTDKYCDNNLASRTEDFLAQVALTSLSGALVVLKSCENLLP  152


 Score = 36.6 bits (83),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  84   AAKFCYGVNFEITVH  98



>gb|KDP45678.1| hypothetical protein JCGZ_17285 [Jatropha curcas]
Length=575

 Score =   139 bits (351),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 79/87 (91%), Gaps = 1/87 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+PL++  +RLS+AMERTGQWVFSQEIPTDV+V VGEA+FSLHKFMLV+KSN IRKLIM
Sbjct  1    MATPLRNN-SRLSIAMERTGQWVFSQEIPTDVVVVVGEANFSLHKFMLVSKSNRIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +SKE DLTRI+LS IPGGPEIFE+  +
Sbjct  60   ESKEPDLTRIDLSDIPGGPEIFEKAAK  86


 Score = 70.9 bits (172),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 51/54 (94%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYLQMTD YCDNNLAGRT+DFLSQVALSSLSGA+VVLKSCEELLP
Sbjct  99   NVAALRCAAEYLQMTDLYCDNNLAGRTDDFLSQVALSSLSGAIVVLKSCEELLP  152


 Score = 37.0 bits (84),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  84   AAKFCYGVNFEITVH  98



>ref|XP_009777101.1| PREDICTED: root phototropism protein 2 [Nicotiana sylvestris]
Length=574

 Score =   141 bits (355),  Expect(3) = 3e-50, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 78/87 (90%), Gaps = 1/87 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA P+K+   RLSLAMERTGQWVFSQEIPTDV+V VGEA+F+LHKFMLVAKSNYIRKLI+
Sbjct  1    MAVPIKNT-NRLSLAMERTGQWVFSQEIPTDVVVEVGEANFNLHKFMLVAKSNYIRKLIL  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +SKE ++TRINLS IPGGPE+FE+  +
Sbjct  60   ESKETEVTRINLSEIPGGPEMFEKAAK  86


 Score = 68.6 bits (166),  Expect(3) = 3e-50, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAA+YLQMTDKYCDNNLA RTEDFL+QVAL+SLSGALVVLKSCE LLP
Sbjct  99   NVAALRCAADYLQMTDKYCDNNLASRTEDFLAQVALTSLSGALVVLKSCENLLP  152


 Score = 36.6 bits (83),  Expect(3) = 3e-50, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  84   AAKFCYGVNFEITVH  98



>ref|XP_007017103.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
 gb|EOY34722.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
Length=576

 Score =   140 bits (353),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 78/87 (90%), Gaps = 1/87 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+P+ S  +R+S AMERTGQWVFSQEIPTDV+V  GEA+F+LHKFMLVAKSNYIRKLI+
Sbjct  1    MATPVMSN-SRMSSAMERTGQWVFSQEIPTDVVVEAGEANFNLHKFMLVAKSNYIRKLIL  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            ++KEADLTRINLS IPGGPEIFE+  +
Sbjct  60   ETKEADLTRINLSDIPGGPEIFEKAAK  86


 Score = 69.3 bits (168),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYLQMTD YCD+NLAGRTEDFLSQVAL SLSGA+VVLKSCE+LLP
Sbjct  99   NVAALRCAAEYLQMTDNYCDSNLAGRTEDFLSQVALHSLSGAVVVLKSCEDLLP  152


 Score = 36.6 bits (83),  Expect(3) = 4e-50, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  84   AAKFCYGVNFEITVH  98



>ref|XP_006432046.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006432048.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006464960.1| PREDICTED: root phototropism protein 2-like isoform X1 [Citrus 
sinensis]
 gb|ESR45286.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45288.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
Length=584

 Score =   137 bits (344),  Expect(3) = 3e-49, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 74/87 (85%), Gaps = 3/87 (3%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+PL     R S A ERTGQWVFSQEIPTD++V VGEA+F LHKFMLVAKSNYIRKLI+
Sbjct  1    MATPLNK---RFSSAKERTGQWVFSQEIPTDIVVAVGEANFPLHKFMLVAKSNYIRKLII  57

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +SKEADLTRINLS IPGGPE+FE+  +
Sbjct  58   ESKEADLTRINLSNIPGGPEMFEKAAK  84


 Score = 69.7 bits (169),  Expect(3) = 3e-49, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAE+LQMTDKYC+NNLAGRTEDFLSQVALSSLSGA+VVLKSCE LLP
Sbjct  97   NVAALRCAAEFLQMTDKYCENNLAGRTEDFLSQVALSSLSGAVVVLKSCEALLP  150


 Score = 36.6 bits (83),  Expect(3) = 3e-49, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  82   AAKFCYGVNFEITVH  96



>gb|KDO54917.1| hypothetical protein CISIN_1g007944mg [Citrus sinensis]
Length=584

 Score =   137 bits (344),  Expect(3) = 3e-49, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 74/87 (85%), Gaps = 3/87 (3%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+PL     R S A ERTGQWVFSQEIPTD++V VGEA+F LHKFMLVAKSNYIRKLI+
Sbjct  1    MATPLNK---RFSSAKERTGQWVFSQEIPTDIVVAVGEANFPLHKFMLVAKSNYIRKLII  57

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +SKEADLTRINLS IPGGPE+FE+  +
Sbjct  58   ESKEADLTRINLSNIPGGPEMFEKAAK  84


 Score = 69.7 bits (169),  Expect(3) = 3e-49, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAE+LQMTDKYC+NNLAGRTEDFLSQVALSSLSGA+VVLKSCE LLP
Sbjct  97   NVAALRCAAEFLQMTDKYCENNLAGRTEDFLSQVALSSLSGAVVVLKSCEALLP  150


 Score = 36.6 bits (83),  Expect(3) = 3e-49, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  82   AAKFCYGVNFEITVH  96



>ref|XP_010094443.1| Root phototropism protein 2 [Morus notabilis]
 gb|EXB56024.1| Root phototropism protein 2 [Morus notabilis]
Length=574

 Score =   140 bits (353),  Expect(3) = 3e-49, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 77/87 (89%), Gaps = 1/87 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+ +K   +RLSLAMERTGQWVFSQ+IPTDV+V VGEA+FSLHKFMLVAKSNYIRKLI+
Sbjct  1    MAASVK-GNSRLSLAMERTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIV  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +S E DLTRINLS IPGGPEIFE+  +
Sbjct  60   ESNEPDLTRINLSNIPGGPEIFEKAAK  86


 Score = 65.9 bits (159),  Expect(3) = 3e-49, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAE+LQM +KYC NNLAGRTEDFL+QVAL+SLSGA+VVLKSCE+LLP
Sbjct  99   NVAALRCAAEFLQMIEKYCPNNLAGRTEDFLTQVALTSLSGAIVVLKSCEDLLP  152


 Score = 36.6 bits (83),  Expect(3) = 3e-49, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  84   AAKFCYGVNFEITVH  98



>emb|CBI15801.3| unnamed protein product [Vitis vinifera]
Length=191

 Score =   132 bits (331),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +1

Query  190  MERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGI  369
            MERTGQWVFSQEIPTDV+V VGEA+FSLHKFMLVAKSNYIRKLIM+SKEADLT I+LS I
Sbjct  1    MERTGQWVFSQEIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKEADLTNIDLSDI  60

Query  370  PGGPEIFERGGE  405
            PGGPEIFE+  +
Sbjct  61   PGGPEIFEKAAK  72


 Score = 69.3 bits (168),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYLQMTDKYCD NL+GRTEDFL QVAL+SLSGA+VVLKSCE+LLP
Sbjct  85   NVAALRCAAEYLQMTDKYCDGNLSGRTEDFLKQVALTSLSGAVVVLKSCEDLLP  138


 Score = 36.2 bits (82),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  70   AAKFCYGVNFEITVH  84



>ref|XP_011011776.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=595

 Score =   129 bits (323),  Expect(3) = 3e-46, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 77/88 (88%), Gaps = 1/88 (1%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLI  321
            +MA+P++S  +RLSL MERT +WVFSQ+IPTDV+V V EA+FSLHKFMLVAKSNYIRKLI
Sbjct  17   DMATPVRSN-SRLSLTMERTDRWVFSQDIPTDVVVVVCEATFSLHKFMLVAKSNYIRKLI  75

Query  322  MDSKEADLTRINLSGIPGGPEIFERGGE  405
            ++SKE  LT+I+LS IPGGPEIFE+  +
Sbjct  76   LESKEPALTKIDLSEIPGGPEIFEKAAK  103


 Score = 67.8 bits (164),  Expect(3) = 3e-46, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYLQMTD YCD NLAGRTEDFL+QVALSSLSGA+VVLKSCE+LLP
Sbjct  116  NVAALRCAAEYLQMTDVYCDYNLAGRTEDFLAQVALSSLSGAIVVLKSCEDLLP  169


 Score = 37.0 bits (84),  Expect(3) = 3e-46, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  101  AAKFCYGVNFEITVH  115



>gb|EYU36889.1| hypothetical protein MIMGU_mgv1a003487mg [Erythranthe guttata]
Length=582

 Score =   141 bits (356),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +1

Query  169  ATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  348
            A R +LAMERTGQWVFSQE+PTDVIV VGEASFSLHKFMLVAKSN IRKLI+DSKEADLT
Sbjct  2    ANRHNLAMERTGQWVFSQEVPTDVIVEVGEASFSLHKFMLVAKSNLIRKLILDSKEADLT  61

Query  349  RINLSGIPGGPEIFERGGE  405
            RINLSGIPGG EIFE+  +
Sbjct  62   RINLSGIPGGAEIFEKSAK  80


 Score = 70.5 bits (171),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 51/54 (94%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYLQMTD YCDNNLAGRTEDFLSQVAL+SLSGALVVLKSCE+LLP
Sbjct  93   NVAALRCAAEYLQMTDVYCDNNLAGRTEDFLSQVALTSLSGALVVLKSCEDLLP  146



>ref|XP_002319980.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
 gb|EEE95903.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
Length=578

 Score =   127 bits (320),  Expect(3) = 7e-46, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+P++S  +RLSLAMERT QWVFSQ+IPTDV+V V EA+FSLHKFMLVAKSN IRKLI+
Sbjct  1    MATPVRSN-SRLSLAMERTDQWVFSQDIPTDVVVVVCEATFSLHKFMLVAKSNCIRKLIL  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +SKE  LT+I+LS IPGGPEIFE+  +
Sbjct  60   ESKEPALTKIDLSEIPGGPEIFEKAAK  86


 Score = 67.4 bits (163),  Expect(3) = 7e-46, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYLQMTD YCD NLAGRTEDFL+QVALSSLSGA+VVLKSCE+LLP
Sbjct  99   NVAALRCAAEYLQMTDVYCDYNLAGRTEDFLAQVALSSLSGAIVVLKSCEDLLP  152


 Score = 36.6 bits (83),  Expect(3) = 7e-46, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  84   AAKFCYGVNFEITVH  98



>ref|XP_006293884.1| hypothetical protein CARUB_v10022870mg [Capsella rubella]
 gb|EOA26782.1| hypothetical protein CARUB_v10022870mg [Capsella rubella]
Length=593

 Score =   130 bits (327),  Expect(3) = 7e-46, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S +++RTGQWVFSQ+IPTDVIV VGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVIVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  358  LSGIPGGPEIFERGGE  405
            LS IPGGPEIFE+  +
Sbjct  74   LSDIPGGPEIFEKAAK  89


 Score = 67.4 bits (163),  Expect(3) = 7e-46, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLSQVALSSLSGA+VVLKSCE LLP
Sbjct  102  NVAALHCAAEFLQMTDKYCDNNLAGRTQDFLSQVALSSLSGAIVVLKSCEILLP  155


 Score = 34.3 bits (77),  Expect(3) = 7e-46, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITV 
Sbjct  87   AAKFCYGVNFEITVQ  101



>ref|XP_006591739.1| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=516

 Score =   134 bits (337),  Expect(3) = 7e-46, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 75/91 (82%), Gaps = 3/91 (3%)
 Frame = +1

Query  142  NMASPLKSAAT---RLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIR  312
            N   P K  AT   RLSLAMERTGQWVFSQ+IPTDVIV VGE +FSLHKFMLVAKSNYIR
Sbjct  27   NQNKPHKFMATPNNRLSLAMERTGQWVFSQDIPTDVIVEVGETTFSLHKFMLVAKSNYIR  86

Query  313  KLIMDSKEADLTRINLSGIPGGPEIFERGGE  405
            KLI++S E++LTRI+LS IPGGP IFE+  +
Sbjct  87   KLILESDESELTRIDLSDIPGGPSIFEKTAK  117


 Score = 62.8 bits (151),  Expect(3) = 7e-46, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCAAE+LQMTD+YC+NNLAGRTE+FL+QVA  +L+GA+ VLKSC  LLP
Sbjct  130  NVAVLRCAAEFLQMTDQYCENNLAGRTEEFLTQVAFFTLTGAVTVLKSCRHLLP  183


 Score = 35.0 bits (79),  Expect(3) = 7e-46, Method: Compositional matrix adjust.
 Identities = 14/14 (100%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = +2

Query  401  AKFCYGVNFEITVH  442
            AKFCYGVNFEITVH
Sbjct  116  AKFCYGVNFEITVH  129



>gb|AAB63085.1| unknown protein [Arabidopsis thaliana]
Length=185

 Score =   129 bits (325),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S ++ RTGQWVFSQ+IPTDV+V VGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRIN
Sbjct  14   MSSSLARTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRIN  73

Query  358  LSGIPGGPEIFERGGE  405
            LS IPGGPEIFE+  +
Sbjct  74   LSDIPGGPEIFEKAAK  89


 Score = 68.2 bits (165),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLSQVALSSLSGA+VVLKSCE LLP
Sbjct  102  NVAALHCAAEFLQMTDKYCDNNLAGRTQDFLSQVALSSLSGAIVVLKSCEILLP  155


 Score = 33.9 bits (76),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITV 
Sbjct  87   AAKFCYGVNFEITVQ  101



>ref|NP_850147.1| Root phototropism protein 2 [Arabidopsis thaliana]
 sp|Q682S0.2|RPT2_ARATH RecName: Full=Root phototropism protein 2; AltName: Full=BTB/POZ 
domain-containing protein RPT2 [Arabidopsis thaliana]
 gb|AAK59568.1| unknown protein [Arabidopsis thaliana]
 gb|AAL07245.1| unknown protein [Arabidopsis thaliana]
 gb|AAN31821.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD94074.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD94572.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD95385.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01595.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01673.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF02233.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC08401.1| Root phototropism protein 2 [Arabidopsis thaliana]
Length=593

 Score =   129 bits (325),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S ++ RTGQWVFSQ+IPTDV+V VGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRIN
Sbjct  14   MSSSLARTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRIN  73

Query  358  LSGIPGGPEIFERGGE  405
            LS IPGGPEIFE+  +
Sbjct  74   LSDIPGGPEIFEKAAK  89


 Score = 67.4 bits (163),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLSQVALSSLSGA+VVLKSCE LLP
Sbjct  102  NVAALHCAAEFLQMTDKYCDNNLAGRTQDFLSQVALSSLSGAIVVLKSCEILLP  155


 Score = 34.3 bits (77),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITV 
Sbjct  87   AAKFCYGVNFEITVQ  101



>gb|AAF33112.1|AF181683_1 RPT2 [Arabidopsis thaliana]
Length=593

 Score =   129 bits (325),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S ++ RTGQWVFSQ+IPTDV+V VGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRIN
Sbjct  14   MSSSLARTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRIN  73

Query  358  LSGIPGGPEIFERGGE  405
            LS IPGGPEIFE+  +
Sbjct  74   LSDIPGGPEIFEKAAK  89


 Score = 67.4 bits (163),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLSQVALSSLSGA+VVLKSCE LLP
Sbjct  102  NVAALHCAAEFLQMTDKYCDNNLAGRTQDFLSQVALSSLSGAIVVLKSCEILLP  155


 Score = 34.3 bits (77),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITV 
Sbjct  87   AAKFCYGVNFEITVQ  101



>ref|XP_010414259.1| PREDICTED: root phototropism protein 2-like [Camelina sativa]
Length=595

 Score =   129 bits (325),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S +++RTGQWVFSQ+IPTDV+V VGEA+FSLHKFMLVAKSNYIRKLIM+SKE+D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKESDVTRID  73

Query  358  LSGIPGGPEIFERGGE  405
            LS +PGGPEIFE+  +
Sbjct  74   LSDMPGGPEIFEKAAK  89


 Score = 67.4 bits (163),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLSQVALSSLSGA+VVLKSCE LLP
Sbjct  102  NVAALHCAAEFLQMTDKYCDNNLAGRTQDFLSQVALSSLSGAIVVLKSCEILLP  155


 Score = 34.3 bits (77),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITV 
Sbjct  87   AAKFCYGVNFEITVQ  101



>dbj|BAF02185.1| hypothetical protein [Arabidopsis thaliana]
Length=593

 Score =   129 bits (325),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S ++ RTGQWVFSQ+IPTDV+V VGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRIN
Sbjct  14   MSSSLARTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRIN  73

Query  358  LSGIPGGPEIFERGGE  405
            LS IPGGPEIFE+  +
Sbjct  74   LSDIPGGPEIFEKAAK  89


 Score = 67.4 bits (163),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLSQVALSSLSGA+VVLKSCE LLP
Sbjct  102  NVAALHCAAEFLQMTDKYCDNNLAGRTQDFLSQVALSSLSGAIVVLKSCEILLP  155


 Score = 33.9 bits (76),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITV 
Sbjct  87   AAKFCYGVNFEITVQ  101



>ref|XP_004500391.1| PREDICTED: root phototropism protein 2-like [Cicer arietinum]
Length=569

 Score =   132 bits (331),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 73/87 (84%), Gaps = 4/87 (5%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+P      RLSLAMERTGQW+FSQEIPTDVIV VGEA FSLHKFMLVAKSNYIRKLIM
Sbjct  1    MATP----PNRLSLAMERTGQWIFSQEIPTDVIVEVGEACFSLHKFMLVAKSNYIRKLIM  56

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +++E +LTRI+LS IPGG  IFE+  +
Sbjct  57   EAEETELTRIDLSDIPGGSGIFEKAAK  83


 Score = 62.4 bits (150),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCAAE+LQMTD+YCDNNLAGRT++FLS+VA  +L+G++ VLKSC  LLP
Sbjct  96   NVAVLRCAAEFLQMTDQYCDNNLAGRTDEFLSKVAFFTLTGSVTVLKSCSYLLP  149


 Score = 36.6 bits (83),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +2

Query  392  KGAAKFCYGVNFEITVH  442
            + AAKFCYGVNFEITVH
Sbjct  79   EKAAKFCYGVNFEITVH  95



>ref|XP_002881117.1| hypothetical protein ARALYDRAFT_481966 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57376.1| hypothetical protein ARALYDRAFT_481966 [Arabidopsis lyrata subsp. 
lyrata]
Length=593

 Score =   129 bits (323),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S ++ RTGQWVFSQ+IPTDVIV VGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLARTGQWVFSQDIPTDVIVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  358  LSGIPGGPEIFERGGE  405
            LS IPGGPEIFE+  +
Sbjct  74   LSDIPGGPEIFEKAAK  89


 Score = 67.0 bits (162),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLSQVALSSLSGA+VVLKSCE LLP
Sbjct  102  NVAALHCAAEFLQMTDKYCDNNLAGRTQDFLSQVALSSLSGAIVVLKSCEILLP  155


 Score = 34.3 bits (77),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITV 
Sbjct  87   AAKFCYGVNFEITVQ  101



>dbj|BAJ33924.1| unnamed protein product [Thellungiella halophila]
Length=597

 Score =   128 bits (322),  Expect(3) = 3e-45, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S +++RTGQWVFSQ+IPTDV+V VGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  358  LSGIPGGPEIFERGGE  405
            LS IPGGPE+FE+  +
Sbjct  74   LSDIPGGPEMFEKAAK  89


 Score = 67.4 bits (163),  Expect(3) = 3e-45, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLSQVALSSLSGA+VVLKSCE LLP
Sbjct  102  NVAALHCAAEFLQMTDKYCDNNLAGRTQDFLSQVALSSLSGAIVVLKSCEILLP  155


 Score = 34.3 bits (77),  Expect(3) = 3e-45, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITV 
Sbjct  87   AAKFCYGVNFEITVQ  101



>ref|XP_009144295.1| PREDICTED: root phototropism protein 2 [Brassica rapa]
Length=591

 Score =   128 bits (321),  Expect(3) = 3e-45, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S +++RTGQWVFSQ+IPTDV+V VGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  358  LSGIPGGPEIFERGGE  405
            LS IPGGPE+FE+  +
Sbjct  74   LSDIPGGPEMFEKAAK  89


 Score = 67.4 bits (163),  Expect(3) = 3e-45, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLSQVALSSLSGA+VVLKSCE LLP
Sbjct  102  NVAALHCAAEFLQMTDKYCDNNLAGRTQDFLSQVALSSLSGAVVVLKSCEILLP  155


 Score = 34.3 bits (77),  Expect(3) = 3e-45, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITV 
Sbjct  87   AAKFCYGVNFEITVQ  101



>gb|KFK22949.1| root phototropism protein 2 [Arabis alpina]
Length=596

 Score =   128 bits (322),  Expect(3) = 3e-45, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S +++RTGQWVFSQ+IPTDV+V VGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  358  LSGIPGGPEIFERGGE  405
            LS IPGGPE+FE+  +
Sbjct  74   LSDIPGGPEMFEKAAK  89


 Score = 67.0 bits (162),  Expect(3) = 3e-45, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLSQVALSSLSGA+VVLKSCE LLP
Sbjct  102  NVAALHCAAEFLQMTDKYCDNNLAGRTQDFLSQVALSSLSGAIVVLKSCEILLP  155


 Score = 34.3 bits (77),  Expect(3) = 3e-45, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITV 
Sbjct  87   AAKFCYGVNFEITVQ  101



>emb|CDY10743.1| BnaA05g11930D [Brassica napus]
Length=581

 Score =   128 bits (321),  Expect(3) = 3e-45, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S +++RTGQWVFSQ+IPTDV+V VGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  358  LSGIPGGPEIFERGGE  405
            LS IPGGPE+FE+  +
Sbjct  74   LSDIPGGPEMFEKAAK  89


 Score = 67.0 bits (162),  Expect(3) = 3e-45, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLSQVALSSLSGA+VVLKSCE LLP
Sbjct  102  NVAALHCAAEFLQMTDKYCDNNLAGRTQDFLSQVALSSLSGAVVVLKSCEILLP  155


 Score = 34.3 bits (77),  Expect(3) = 3e-45, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITV 
Sbjct  87   AAKFCYGVNFEITVQ  101



>ref|XP_010677799.1| PREDICTED: root phototropism protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=581

 Score =   127 bits (319),  Expect(3) = 4e-45, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  187  AMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSG  366
            A+ERTGQWVFSQEIPTD+++ VGEA+FSLHKFMLVAKSNYIR+LI++SKE+DL R++L+ 
Sbjct  23   ALERTGQWVFSQEIPTDIVIQVGEAAFSLHKFMLVAKSNYIRRLILESKESDLGRLDLTD  82

Query  367  IPGGPEIFERGGE  405
            IPGGPEIFE+  +
Sbjct  83   IPGGPEIFEKAAK  95


 Score = 65.5 bits (158),  Expect(3) = 4e-45, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYLQMTDK CDNNLA RTEDFL QVAL++LSGAL+VLK+CE+LLP
Sbjct  108  NVAALRCAAEYLQMTDKSCDNNLANRTEDFLCQVALTNLSGALIVLKTCEDLLP  161


 Score = 36.6 bits (83),  Expect(3) = 4e-45, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEIT+H
Sbjct  93   AAKFCYGVNFEITIH  107



>ref|XP_010244564.1| PREDICTED: root phototropism protein 2 [Nelumbo nucifera]
Length=571

 Score =   134 bits (336),  Expect(3) = 4e-45, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 78/87 (90%), Gaps = 1/87 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+ +K++ +R+SLAMERTGQWVFSQEIP+DV++ +GEA+F+LHKFMLVAKS YIR+ IM
Sbjct  1    MATTVKNS-SRVSLAMERTGQWVFSQEIPSDVVIEIGEANFALHKFMLVAKSGYIRRKIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +SKE DLTRI+LS IPGGPEIFE+  +
Sbjct  60   ESKEPDLTRIDLSDIPGGPEIFEKAAK  86


 Score = 58.5 bits (140),  Expect(3) = 4e-45, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYL+MTDK  ++NLAGRTEDFLS VAL++L GA+VVLKSCE LLP
Sbjct  99   NVAALRCAAEYLEMTDKCSESNLAGRTEDFLSHVALTTLPGAVVVLKSCELLLP  152


 Score = 37.0 bits (84),  Expect(3) = 4e-45, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  84   AAKFCYGVNFEITVH  98



>ref|XP_003600550.1| Root phototropism protein [Medicago truncatula]
 gb|AES70801.1| root phototropism-like protein [Medicago truncatula]
Length=568

 Score =   129 bits (323),  Expect(3) = 5e-45, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +1

Query  172  TRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTR  351
             RLSLAMERTGQWVFSQE+PTDVIV VGEA F LHKFMLVAKSNYIRKLIM+S E  LTR
Sbjct  6    NRLSLAMERTGQWVFSQEVPTDVIVEVGEARFCLHKFMLVAKSNYIRKLIMESDETHLTR  65

Query  352  INLSGIPGGPEIFERGGE  405
            I+LS IPGG  IFE+  +
Sbjct  66   IDLSDIPGGSGIFEKAAK  83


 Score = 63.5 bits (153),  Expect(3) = 5e-45, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCAAE+LQMTD+YCDNNLAGRT++FLS+VA  +L+G++ VLKSC  LLP
Sbjct  96   NVAVLRCAAEFLQMTDQYCDNNLAGRTDEFLSKVAFFTLTGSVAVLKSCHHLLP  149


 Score = 36.6 bits (83),  Expect(3) = 5e-45, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  81   AAKFCYGVNFEITVH  95



>dbj|BAF01791.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01873.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01940.1| hypothetical protein [Arabidopsis thaliana]
Length=593

 Score =   127 bits (319),  Expect(3) = 7e-45, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S ++ RTGQWVFSQ+IPTDV+V VGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRIN
Sbjct  14   MSSSLARTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRIN  73

Query  358  LSGIPGGPEIFERGGE  405
            LS IPG PEIFE+  +
Sbjct  74   LSDIPGDPEIFEKAAK  89


 Score = 67.4 bits (163),  Expect(3) = 7e-45, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLSQVALSSLSGA+VVLKSCE LLP
Sbjct  102  NVAALHCAAEFLQMTDKYCDNNLAGRTQDFLSQVALSSLSGAIVVLKSCEILLP  155


 Score = 34.3 bits (77),  Expect(3) = 7e-45, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITV 
Sbjct  87   AAKFCYGVNFEITVQ  101



>ref|XP_006410156.1| hypothetical protein EUTSA_v10016728mg [Eutrema salsugineum]
 gb|ESQ51609.1| hypothetical protein EUTSA_v10016728mg [Eutrema salsugineum]
Length=412

 Score =   127 bits (319),  Expect(3) = 7e-45, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S +++RTGQWVFSQ+IPTDV+V VGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  358  LSGIPGGPEIFERGGE  405
            LS IPGGPE+FE+  +
Sbjct  74   LSDIPGGPEMFEKAAK  89


 Score = 67.4 bits (163),  Expect(3) = 7e-45, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLSQVALSSLSGA+VVLKSCE LLP
Sbjct  102  NVAALHCAAEFLQMTDKYCDNNLAGRTQDFLSQVALSSLSGAIVVLKSCEILLP  155


 Score = 33.9 bits (76),  Expect(3) = 7e-45, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITV 
Sbjct  87   AAKFCYGVNFEITVQ  101



>gb|AFK45576.1| unknown [Medicago truncatula]
Length=468

 Score =   128 bits (321),  Expect(3) = 9e-45, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +1

Query  172  TRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTR  351
             RLSLAMERTGQWVFSQE+PTDVIV VGEA F LHKFMLVAKSNYIRKLIM+S E  LTR
Sbjct  6    NRLSLAMERTGQWVFSQEVPTDVIVEVGEARFCLHKFMLVAKSNYIRKLIMESDETHLTR  65

Query  352  INLSGIPGGPEIFERGGE  405
            I+LS IPGG  IFE+  +
Sbjct  66   IDLSDIPGGSGIFEKAAK  83


 Score = 63.5 bits (153),  Expect(3) = 9e-45, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCAAE+LQMTD+YCDNNLAGRT++FLS+VA  +L+G++ VLKSC  LLP
Sbjct  96   NVAVLRCAAEFLQMTDQYCDNNLAGRTDEFLSKVAFFTLTGSVAVLKSCHHLLP  149


 Score = 36.2 bits (82),  Expect(3) = 9e-45, Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +2

Query  392  KGAAKFCYGVNFEITVH  442
            + AAKFCYGVNFEITVH
Sbjct  79   EKAAKFCYGVNFEITVH  95



>ref|XP_010469846.1| PREDICTED: root phototropism protein 2 isoform X1 [Camelina sativa]
 ref|XP_010469847.1| PREDICTED: root phototropism protein 2 isoform X2 [Camelina sativa]
Length=595

 Score =   126 bits (317),  Expect(3) = 1e-44, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S +++RTGQWVFSQ+IPTDV+V VGEA+FSLHKFMLVAKSNYIRKLI++SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIIESKDSDVTRID  73

Query  358  LSGIPGGPEIFERGGE  405
            LS +PGGPEIFE+  +
Sbjct  74   LSDMPGGPEIFEKAAK  89


 Score = 67.4 bits (163),  Expect(3) = 1e-44, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLSQVALSSLSGA+VVLKSCE LLP
Sbjct  102  NVAALHCAAEFLQMTDKYCDNNLAGRTQDFLSQVALSSLSGAIVVLKSCEILLP  155


 Score = 34.3 bits (77),  Expect(3) = 1e-44, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITV 
Sbjct  87   AAKFCYGVNFEITVQ  101



>emb|CDY02075.1| BnaC04g14260D [Brassica napus]
Length=580

 Score =   126 bits (317),  Expect(3) = 1e-44, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S +++RTGQWVFSQ+IPTDV+V VGEA+FSLHKFMLVAKSNYIRKLIM+SK+ D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDIDVTRID  73

Query  358  LSGIPGGPEIFERGGE  405
            +S IPGGPE+FE+  +
Sbjct  74   ISDIPGGPEMFEKAAK  89


 Score = 67.4 bits (163),  Expect(3) = 1e-44, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLSQVALSSLSGA+VVLKSCE LLP
Sbjct  102  NVAALHCAAEFLQMTDKYCDNNLAGRTQDFLSQVALSSLSGAVVVLKSCEILLP  155


 Score = 34.3 bits (77),  Expect(3) = 1e-44, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITV 
Sbjct  87   AAKFCYGVNFEITVQ  101



>ref|XP_008239637.1| PREDICTED: root phototropism protein 2 isoform X2 [Prunus mume]
Length=584

 Score =   134 bits (338),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MAS +K   +RLS+AMERTGQW+FSQEIP+DV+V VGEA+FSLHKFMLVAKSN+IRKL++
Sbjct  1    MASSVK-GNSRLSIAMERTGQWIFSQEIPSDVMVEVGEANFSLHKFMLVAKSNHIRKLVL  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +S E DLTRINLS IPGGPE FE+  +
Sbjct  60   ESTEPDLTRINLSDIPGGPETFEKAAK  86


 Score = 72.4 bits (176),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYL+MTDKYCDNNL GRTEDFL+QVALSSLSGA+VVLKSCEELLP
Sbjct  99   NVAALRCAAEYLEMTDKYCDNNLTGRTEDFLTQVALSSLSGAIVVLKSCEELLP  152



>ref|XP_010510344.1| PREDICTED: root phototropism protein 2-like [Camelina sativa]
Length=596

 Score =   128 bits (321),  Expect(3) = 1e-44, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S +++RTGQWVFSQ+IPTDV+V VGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  358  LSGIPGGPEIFERGGE  405
            LS +PGGPEIFE+  +
Sbjct  74   LSDMPGGPEIFEKAAK  89


 Score = 65.5 bits (158),  Expect(3) = 1e-44, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAAL CAAE+LQMTDKYC+NNLAGRT+DFLSQVALSSLSGA+VVLKSCE LLP
Sbjct  102  NVAALHCAAEFLQMTDKYCNNNLAGRTQDFLSQVALSSLSGAIVVLKSCEILLP  155


 Score = 33.9 bits (76),  Expect(3) = 1e-44, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITV 
Sbjct  87   AAKFCYGVNFEITVQ  101



>ref|XP_008239576.1| PREDICTED: root phototropism protein 2 isoform X1 [Prunus mume]
Length=584

 Score =   134 bits (337),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MAS +K   +RLS+AMERTGQW+FSQEIP+DV+V VGEA+FSLHKFMLVAKSN+IRKL++
Sbjct  1    MASSVK-GNSRLSIAMERTGQWIFSQEIPSDVMVEVGEANFSLHKFMLVAKSNHIRKLVL  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +S E DLTRINLS IPGGPE FE+  +
Sbjct  60   ESTEPDLTRINLSDIPGGPETFEKAAK  86


 Score = 72.4 bits (176),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYL+MTDKYCDNNL GRTEDFL+QVALSSLSGA+VVLKSCEELLP
Sbjct  99   NVAALRCAAEYLEMTDKYCDNNLTGRTEDFLTQVALSSLSGAIVVLKSCEELLP  152



>ref|XP_007206420.1| hypothetical protein PRUPE_ppa003347mg [Prunus persica]
 gb|EMJ07619.1| hypothetical protein PRUPE_ppa003347mg [Prunus persica]
Length=583

 Score =   134 bits (337),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MAS +K   +RLS+AMERTGQW+FSQEIP+DV+V VGEA+FSLHKFMLVAKSN+IRKL++
Sbjct  1    MASSVK-GNSRLSIAMERTGQWIFSQEIPSDVMVEVGEANFSLHKFMLVAKSNHIRKLVL  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +S E DLTRINLS IPGGPE FE+  +
Sbjct  60   ESTEPDLTRINLSDIPGGPETFEKAAK  86


 Score = 72.0 bits (175),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYL+MTDKYCDNNL GRTEDFL+QVALSSLSGA+VVLKSCEELLP
Sbjct  99   NVAALRCAAEYLEMTDKYCDNNLTGRTEDFLTQVALSSLSGAIVVLKSCEELLP  152



>ref|XP_003553189.1| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=573

 Score =   129 bits (325),  Expect(3) = 2e-44, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 71/87 (82%), Gaps = 4/87 (5%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+P      RLSLAMERTGQWVFSQ+IPTDVIV VGE  FSLHKFMLVAKSNYIRKLI+
Sbjct  1    MATP----NNRLSLAMERTGQWVFSQDIPTDVIVEVGETIFSLHKFMLVAKSNYIRKLIL  56

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +S E +LTRI LS IPGGP IFE+  +
Sbjct  57   ESNEGELTRIYLSDIPGGPSIFEKTAK  83


 Score = 62.8 bits (151),  Expect(3) = 2e-44, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCAAE+LQMTD+YC+NNLAGRTE+FL+QVA  +L+GA+ VLKSC  LLP
Sbjct  96   NVAVLRCAAEFLQMTDQYCENNLAGRTEEFLTQVAFFTLTGAVTVLKSCRHLLP  149


 Score = 34.7 bits (78),  Expect(3) = 2e-44, Method: Compositional matrix adjust.
 Identities = 14/14 (100%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = +2

Query  401  AKFCYGVNFEITVH  442
            AKFCYGVNFEITVH
Sbjct  82   AKFCYGVNFEITVH  95



>ref|XP_008349518.1| PREDICTED: LOW QUALITY PROTEIN: root phototropism protein 2-like 
[Malus domestica]
Length=577

 Score =   136 bits (343),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 77/87 (89%), Gaps = 1/87 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MASPL + + RLSLAMERTGQW+FSQ+IP+DV+V VGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASPL-NGSNRLSLAMERTGQWIFSQDIPSDVVVQVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +SK+ DLTRI+LS +PGGPE FE+  +
Sbjct  60   ESKKPDLTRIDLSDVPGGPETFEKAAK  86


 Score = 68.9 bits (167),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYL+MT+KYCDNNL GRTEDFLSQVAL SLSGA+VVLKSCE+LLP
Sbjct  99   NVAALRCAAEYLEMTEKYCDNNLTGRTEDFLSQVALMSLSGAIVVLKSCEDLLP  152



>gb|ADL36608.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   136 bits (343),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 77/87 (89%), Gaps = 1/87 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MASPL + + RLSLAMERTGQW+FSQ+IP+DV+V VGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASPL-NGSNRLSLAMERTGQWIFSQDIPSDVVVQVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +SK+ DLTRI+LS +PGGPE FE+  +
Sbjct  60   ESKKPDLTRIDLSDVPGGPETFEKAAK  86


 Score = 68.9 bits (167),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYL+MT+KYCDNNL GRTEDFLSQVAL SLSGA+VVLKSCE+LLP
Sbjct  99   NVAALRCAAEYLEMTEKYCDNNLTGRTEDFLSQVALMSLSGAIVVLKSCEDLLP  152



>ref|XP_009374407.1| PREDICTED: root phototropism protein 2-like [Pyrus x bretschneideri]
Length=577

 Score =   137 bits (344),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 77/87 (89%), Gaps = 1/87 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MASPL + + RLSLAMERTGQW+FSQ+IP+DV+V VGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASPL-NGSNRLSLAMERTGQWIFSQDIPSDVVVQVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +SK+ DLTRI+LS +PGGPE FE+  +
Sbjct  60   ESKQPDLTRIDLSDVPGGPETFEKAAK  86


 Score = 68.6 bits (166),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYL+MT+KYCDNNL GRTEDFLSQVAL SLSGA+VVLKSCE+LLP
Sbjct  99   NVAALRCAAEYLEMTNKYCDNNLIGRTEDFLSQVALMSLSGAIVVLKSCEDLLP  152



>ref|XP_008366216.1| PREDICTED: root phototropism protein 2-like [Malus domestica]
Length=577

 Score =   136 bits (342),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 77/87 (89%), Gaps = 1/87 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MASPL + + RLSLAMERTGQW+FSQ+IP+DV+V VGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASPL-NGSNRLSLAMERTGQWIFSQDIPSDVVVQVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +SK+ DLTRI+LS +PGGPE FE+  +
Sbjct  60   ESKKPDLTRIDLSDVPGGPETFEKAAK  86


 Score = 68.9 bits (167),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYL+MT+KYCDNNL GRTEDFLSQVAL SLSGA+VVLKSCE+LLP
Sbjct  99   NVAALRCAAEYLEMTEKYCDNNLTGRTEDFLSQVALMSLSGAIVVLKSCEDLLP  152



>gb|KJB26282.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=558

 Score =   115 bits (289),  Expect(3) = 4e-44, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +1

Query  211  VFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF  390
            VFSQEIPTDVIV VGEA+F+LHKFMLVAKSNYIRKLIM++ EADLTRINLS IPGGPEIF
Sbjct  6    VFSQEIPTDVIVEVGEANFNLHKFMLVAKSNYIRKLIMETNEADLTRINLSEIPGGPEIF  65

Query  391  ERGGE  405
            E+  +
Sbjct  66   EKAAK  70


 Score = 73.2 bits (178),  Expect(3) = 4e-44, Method: Compositional matrix adjust.
 Identities = 52/54 (96%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQVALSSLSGA+VVLKSCE+LLP
Sbjct  83   NVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQVALSSLSGAVVVLKSCEDLLP  136


 Score = 36.6 bits (83),  Expect(3) = 4e-44, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  68   AAKFCYGVNFEITVH  82



>ref|XP_010557176.1| PREDICTED: root phototropism protein 2 [Tarenaya hassleriana]
Length=575

 Score =   126 bits (317),  Expect(3) = 5e-44, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S AMERT QWVFSQ+IPTDV+V V EA+FSLHKFMLVAKSNYIRKLIM+SK+ DLTRI+
Sbjct  12   MSSAMERTDQWVFSQDIPTDVVVEVCEANFSLHKFMLVAKSNYIRKLIMESKDTDLTRID  71

Query  358  LSGIPGGPEIFERGGE  405
            LS IPGGPE+FE+  +
Sbjct  72   LSDIPGGPEMFEKAAK  87


 Score = 65.5 bits (158),  Expect(3) = 5e-44, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAAL CAAE+LQMTDKYCD+NLAGRT+DFLSQVALSSLSGA+VVLKSCE LLP
Sbjct  100  NVAALHCAAEFLQMTDKYCDSNLAGRTQDFLSQVALSSLSGAVVVLKSCELLLP  153


 Score = 33.9 bits (76),  Expect(3) = 5e-44, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITV 
Sbjct  85   AAKFCYGVNFEITVQ  99



>gb|KHN18647.1| Root phototropism protein 2 [Glycine soja]
Length=312

 Score =   130 bits (326),  Expect(3) = 1e-43, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 71/87 (82%), Gaps = 4/87 (5%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+P      RLSLAMERTGQWVFSQ+IPTDVIV VGE  FSLHKFMLVAKSNYIRKLI+
Sbjct  1    MATP----NNRLSLAMERTGQWVFSQDIPTDVIVEVGETIFSLHKFMLVAKSNYIRKLIL  56

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +S E +LTRI LS IPGGP IFE+  +
Sbjct  57   ESNEGELTRIYLSDIPGGPSIFEKTAK  83


 Score = 59.7 bits (143),  Expect(3) = 1e-43, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDF  533
            NVA LRCAAE+LQMTD+YC+NNLAGRTE+F
Sbjct  96   NVAVLRCAAEFLQMTDQYCENNLAGRTEEF  125


 Score = 35.0 bits (79),  Expect(3) = 1e-43, Method: Compositional matrix adjust.
 Identities = 14/14 (100%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = +2

Query  401  AKFCYGVNFEITVH  442
            AKFCYGVNFEITVH
Sbjct  82   AKFCYGVNFEITVH  95



>ref|XP_008358916.1| PREDICTED: root phototropism protein 2-like [Malus domestica]
Length=175

 Score =   135 bits (341),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 77/87 (89%), Gaps = 1/87 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MASPL + + RLSLAMERTGQW+FSQ+IP+DV+V VGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASPL-NGSNRLSLAMERTGQWIFSQDIPSDVVVQVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +SK+ DLTRI+LS +PGGPE FE+  +
Sbjct  60   ESKKPDLTRIDLSDVPGGPETFEKAAK  86


 Score = 68.2 bits (165),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYL+MT+KYCDNNL GRTEDFLSQVAL SLSGA+VVLKSCE+LLP
Sbjct  99   NVAALRCAAEYLEMTEKYCDNNLTGRTEDFLSQVALMSLSGAIVVLKSCEDLLP  152



>ref|NP_001280845.1| root phototropism protein 2-like [Malus domestica]
 gb|ADL36603.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   134 bits (338),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MAS L S   RLSLAMERTGQW+ SQ+IP+DV+V VGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASSL-SGGNRLSLAMERTGQWIISQDIPSDVVVEVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +SK+ DLTRINLS IPGGPE FE+  +
Sbjct  60   ESKQPDLTRINLSDIPGGPETFEKAAK  86


 Score = 68.9 bits (167),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYL+MTDKYC+NNL GRTEDFL+QVAL+SLSGA+VVLK+CE+LLP
Sbjct  99   NVAALRCAAEYLEMTDKYCENNLTGRTEDFLAQVALTSLSGAIVVLKTCEDLLP  152



>ref|XP_007146905.1| hypothetical protein PHAVU_006G080400g [Phaseolus vulgaris]
 gb|ESW18899.1| hypothetical protein PHAVU_006G080400g [Phaseolus vulgaris]
Length=573

 Score =   130 bits (328),  Expect(3) = 2e-43, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 73/87 (84%), Gaps = 4/87 (5%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+P      RLSLAMERTGQWVFSQ+IPTDVIV VGE SFSLHKFMLVAKSNYIRKLI+
Sbjct  1    MATP----NNRLSLAMERTGQWVFSQDIPTDVIVEVGETSFSLHKFMLVAKSNYIRKLIL  56

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            ++ E ++TRI+LS IPGGP IFE+  +
Sbjct  57   EANENEVTRIDLSDIPGGPAIFEKTAK  83


 Score = 60.8 bits (146),  Expect(3) = 2e-43, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCAAE+LQMTD+YC+NNL GRTE+FL+QVA  +L+GA+ VLKSC  LLP
Sbjct  96   NVAVLRCAAEFLQMTDQYCENNLTGRTEEFLTQVAFFTLTGAVTVLKSCRNLLP  149


 Score = 32.3 bits (72),  Expect(3) = 2e-43, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = +2

Query  401  AKFCYGVNFEITVH  442
            AKFCYGVNFEITV+
Sbjct  82   AKFCYGVNFEITVN  95



>ref|XP_004294714.1| PREDICTED: root phototropism protein 2 [Fragaria vesca subsp. 
vesca]
Length=581

 Score =   132 bits (333),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MAS  ++ + RLS+AMERTGQW+FSQ+IP DV+V VGEA+FSLHKFMLVAKSN IR+LI+
Sbjct  1    MASLAQNNSRRLSIAMERTGQWIFSQDIPADVVVEVGEANFSLHKFMLVAKSNRIRQLIL  60

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +S E DLTRINLS IPGGPE FE+  +
Sbjct  61   ESDEPDLTRINLSDIPGGPETFEKAAK  87


 Score = 69.3 bits (168),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYLQMTDKYCDNNL+GRTEDFL+QVALSSLSGA+VVLKSCE L P
Sbjct  100  NVAALRCAAEYLQMTDKYCDNNLSGRTEDFLTQVALSSLSGAIVVLKSCEGLTP  153



>ref|XP_008451887.1| PREDICTED: root phototropism protein 2 isoform X1 [Cucumis melo]
Length=666

 Score =   133 bits (335),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 75/88 (85%), Gaps = 1/88 (1%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLI  321
            +M+S +K    R+S+AMERTGQW+FSQ+IPTDV+V VGEA F LHKFMLVAKSNYIRKLI
Sbjct  84   SMSSSVK-GNNRMSIAMERTGQWIFSQDIPTDVVVAVGEAHFPLHKFMLVAKSNYIRKLI  142

Query  322  MDSKEADLTRINLSGIPGGPEIFERGGE  405
            M+S EADLTRI+L+ IPGG EIFE+  +
Sbjct  143  MESTEADLTRIDLTDIPGGAEIFEKAAK  170


 Score = 68.6 bits (166),  Expect(2) = 4e-43, Method: Composition-based stats.
 Identities = 29/30 (97%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDF  533
            NVAALRCAAEYLQMTDKYCDNNL GRTEDF
Sbjct  183  NVAALRCAAEYLQMTDKYCDNNLVGRTEDF  212



>ref|XP_008451888.1| PREDICTED: root phototropism protein 2 isoform X2 [Cucumis melo]
Length=582

 Score =   134 bits (337),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            M+S +K    R+S+AMERTGQW+FSQ+IPTDV+V VGEA F LHKFMLVAKSNYIRKLIM
Sbjct  1    MSSSVK-GNNRMSIAMERTGQWIFSQDIPTDVVVAVGEAHFPLHKFMLVAKSNYIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +S EADLTRI+L+ IPGG EIFE+  +
Sbjct  60   ESTEADLTRIDLTDIPGGAEIFEKAAK  86


 Score = 67.8 bits (164),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYLQMTDKYCDNNL GRTEDFLSQVALSSLSGA+VVLKS   LLP
Sbjct  99   NVAALRCAAEYLQMTDKYCDNNLVGRTEDFLSQVALSSLSGAIVVLKSSHHLLP  152



>ref|XP_002325631.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
 gb|EEF00013.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
Length=575

 Score =   130 bits (328),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 76/87 (87%), Gaps = 3/87 (3%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MASP++S   RLSLAMERTG+WVFS++IPTDV+V V EASFSLHKFML+AKSNYIRKLI 
Sbjct  1    MASPVRS---RLSLAMERTGKWVFSKDIPTDVVVVVCEASFSLHKFMLLAKSNYIRKLIF  57

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +SKE +L RI+LSGIPGGPEIF +  +
Sbjct  58   ESKEPELARIDLSGIPGGPEIFVKAAK  84


 Score = 70.9 bits (172),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYLQMTD YCDNNLAGRTEDF +QVALSSLSGA++VLKSCE+LLP
Sbjct  97   NVAALRCAAEYLQMTDTYCDNNLAGRTEDFFAQVALSSLSGAIIVLKSCEDLLP  150



>ref|XP_004147730.1| PREDICTED: root phototropism protein 2-like [Cucumis sativus]
 ref|XP_004164428.1| PREDICTED: root phototropism protein 2-like [Cucumis sativus]
Length=582

 Score =   134 bits (337),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            M+S +K    R+S+AMERTGQW+FSQ+IPTDV+V VGEA F LHKFMLVAKSNYIRKLIM
Sbjct  1    MSSSMK-GNNRMSIAMERTGQWIFSQDIPTDVVVAVGEAHFPLHKFMLVAKSNYIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +S EADLTRI+L+ IPGG EIFE+  +
Sbjct  60   ESTEADLTRIDLTDIPGGAEIFEKAAK  86


 Score = 65.9 bits (159),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDF  533
            NVAALRCAAEYLQMTDKYCDNNL GRTEDF
Sbjct  99   NVAALRCAAEYLQMTDKYCDNNLIGRTEDF  128



>ref|XP_011015900.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=579

 Score =   128 bits (322),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 75/87 (86%), Gaps = 3/87 (3%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MASP++S   RLSLAMERTG+WVFS++IPTDV+V V EASFSLHK ML+AKSNYIRKLI 
Sbjct  1    MASPVRS---RLSLAMERTGKWVFSKDIPTDVVVVVCEASFSLHKSMLMAKSNYIRKLIF  57

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +SKE +L RINLSGIPGGPEIF +  +
Sbjct  58   ESKEPELDRINLSGIPGGPEIFVKAAK  84


 Score = 69.7 bits (169),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYLQMTD YCDNNLAGRTEDF +QVALSSLSGA+ VLKSCE+LLP
Sbjct  97   NVAALRCAAEYLQMTDLYCDNNLAGRTEDFFAQVALSSLSGAIFVLKSCEDLLP  150



>ref|NP_001280895.1| root phototropism protein 2-like [Malus domestica]
 gb|ADL36607.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   133 bits (334),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MAS L S   RLSLAMERTGQW+ SQ+IP+DV+V VGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASSL-SGGNRLSLAMERTGQWIISQDIPSDVVVEVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +SK+ DLTRI+LS IPGGPE FE+  +
Sbjct  60   ESKQPDLTRIDLSDIPGGPETFEKAAK  86


 Score = 65.1 bits (157),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYL+MTDKY +NNL GRTEDFL+QVAL+SLSGA+VVLK+CE+LLP
Sbjct  99   NVAALRCAAEYLEMTDKYYENNLTGRTEDFLAQVALTSLSGAIVVLKTCEDLLP  152



>ref|XP_009355145.1| PREDICTED: root phototropism protein 2-like [Pyrus x bretschneideri]
Length=577

 Score =   133 bits (334),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MASPL S   RLSLAMERTGQW+ SQ+IP+DV+V VGEA+F LHKFMLVAKSN IRKLIM
Sbjct  1    MASPL-SGGNRLSLAMERTGQWIISQDIPSDVVVEVGEANFPLHKFMLVAKSNRIRKLIM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +SK+ DLTRI+LS IPGGPE FE+  +
Sbjct  60   ESKQPDLTRIDLSDIPGGPETFEKAAK  86


 Score = 64.7 bits (156),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCA EYL+MTDKYC+NNL  RTEDFL+QVAL+SLSGA+VVLK+CE+LLP
Sbjct  99   NVAALRCATEYLEMTDKYCNNNLTSRTEDFLTQVALTSLSGAIVVLKTCEDLLP  152



>gb|KGN53487.1| hypothetical protein Csa_4G056750 [Cucumis sativus]
Length=572

 Score =   130 bits (328),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S+AMERTGQW+FSQ+IPTDV+V VGEA F LHKFMLVAKSNYIRKLIM+S EADLTRI+
Sbjct  1    MSIAMERTGQWIFSQDIPTDVVVAVGEAHFPLHKFMLVAKSNYIRKLIMESTEADLTRID  60

Query  358  LSGIPGGPEIFERGGE  405
            L+ IPGG EIFE+  +
Sbjct  61   LTDIPGGAEIFEKAAK  76


 Score = 65.9 bits (159),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDF  533
            NVAALRCAAEYLQMTDKYCDNNL GRTEDF
Sbjct  89   NVAALRCAAEYLQMTDKYCDNNLIGRTEDF  118



>ref|XP_011041764.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=574

 Score =   128 bits (322),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 75/87 (86%), Gaps = 3/87 (3%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MASP++S   RLSLAMERTG+WVFS++IPTDV+V V EASFSLHK ML+AKSNYIRKLI 
Sbjct  1    MASPVRS---RLSLAMERTGKWVFSKDIPTDVVVVVCEASFSLHKSMLMAKSNYIRKLIF  57

Query  325  DSKEADLTRINLSGIPGGPEIFERGGE  405
            +SKE +L RINLSGIPGGPEIF +  +
Sbjct  58   ESKEPELDRINLSGIPGGPEIFVKAAK  84


 Score = 67.0 bits (162),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYLQMTD YCD NLAGRTEDFL+QVALSSLSGA+ VLKSCE+LLP
Sbjct  97   NVAALRCAAEYLQMTDVYCDYNLAGRTEDFLAQVALSSLSGAIFVLKSCEDLLP  150



>emb|CDY23992.1| BnaC03g16990D [Brassica napus]
Length=565

 Score =   125 bits (314),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S  ++RTGQWVFSQ+IPTDV+V VGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSTLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  358  LSGIPGGPEIFERGGE  405
            LS IPGG E+FE+  +
Sbjct  74   LSDIPGGAEMFEKAAK  89


 Score = 67.8 bits (164),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAAL+CAAE+LQMTDKYCDNNLAGRT+DFLSQVALSSLSGA+VVLKSCE LLP
Sbjct  102  NVAALQCAAEFLQMTDKYCDNNLAGRTQDFLSQVALSSLSGAIVVLKSCEILLP  155



>ref|XP_003544940.2| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=579

 Score =   127 bits (318),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +1

Query  172  TRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTR  351
            TR SLAMERTGQWVFS EIPTDVIV VGE++FSLHKF+L AKSNYIRK+IM+S+E+DLTR
Sbjct  7    TRFSLAMERTGQWVFSPEIPTDVIVAVGESTFSLHKFILAAKSNYIRKVIMESEESDLTR  66

Query  352  INLSGIPGGPEIFERGGE  405
            I +S IPGG E FE+  +
Sbjct  67   IEISNIPGGQEAFEKAAK  84


 Score = 62.0 bits (149),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAAL CAA +LQMTD+YCD NLAGRTEDFLSQV LS+L  A+ VLKSC++LLP
Sbjct  97   NVAALHCAAVFLQMTDEYCDGNLAGRTEDFLSQVGLSTLHSAVAVLKSCQKLLP  150



>ref|XP_010044625.1| PREDICTED: root phototropism protein 2-like [Eucalyptus grandis]
 gb|KCW86717.1| hypothetical protein EUGRSUZ_B03325 [Eucalyptus grandis]
Length=570

 Score =   119 bits (297),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MAS +KS     S+AMERT QW+ S++ PTDV V V +A+FSLHKFMLVAKSNY+RK++M
Sbjct  1    MASHVKSNGGN-SIAMERTSQWLLSKKFPTDVDVIVSKANFSLHKFMLVAKSNYMRKMVM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGG  402
            +SKEADLTRI+LS  PGGPEIFE+  
Sbjct  60   ESKEADLTRIDLSDFPGGPEIFEKAA  85


 Score = 70.5 bits (171),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYL+MTD+YCDNNLAGRTEDFL QVA SSLSG ++VLKSCE+LLP
Sbjct  99   NVAALRCAAEYLEMTDQYCDNNLAGRTEDFLVQVAFSSLSGTILVLKSCEDLLP  152



>gb|KCW86718.1| hypothetical protein EUGRSUZ_B03325 [Eucalyptus grandis]
Length=577

 Score =   118 bits (296),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MAS +KS     S+AMERT QW+ S++ PTDV V V +A+FSLHKFMLVAKSNY+RK++M
Sbjct  1    MASHVKSNGGN-SIAMERTSQWLLSKKFPTDVDVIVSKANFSLHKFMLVAKSNYMRKMVM  59

Query  325  DSKEADLTRINLSGIPGGPEIFERGG  402
            +SKEADLTRI+LS  PGGPEIFE+  
Sbjct  60   ESKEADLTRIDLSDFPGGPEIFEKAA  85


 Score = 70.5 bits (171),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYL+MTD+YCDNNLAGRTEDFL QVA SSLSG ++VLKSCE+LLP
Sbjct  99   NVAALRCAAEYLEMTDQYCDNNLAGRTEDFLVQVAFSSLSGTILVLKSCEDLLP  152



>ref|XP_003616056.1| Root phototropism protein [Medicago truncatula]
 gb|AES99014.1| root phototropism-like protein [Medicago truncatula]
Length=579

 Score =   131 bits (329),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +1

Query  172  TRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTR  351
            +RLSLAMERTGQW+FSQEIP+DVIV +GEA++SLHKFMLVAKSNYIRKLIM+S E++LTR
Sbjct  7    SRLSLAMERTGQWIFSQEIPSDVIVTIGEATYSLHKFMLVAKSNYIRKLIMESNESELTR  66

Query  352  INLSGIPGGPEIFERGGE  405
            ++LS IPGG E FE+  +
Sbjct  67   LDLSDIPGGQEAFEKAAK  84


 Score = 57.4 bits (137),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA+L CAA +LQMTD+YCD NLAGRTE FLSQVAL++LSGA VVLKSC +L+P
Sbjct  97   NVASLHCAAMFLQMTDEYCDGNLAGRTEGFLSQVALTTLSGAAVVLKSCRQLIP  150



>ref|XP_011080638.1| PREDICTED: root phototropism protein 2 [Sesamum indicum]
Length=570

 Score =   120 bits (302),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 69/83 (83%), Gaps = 1/83 (1%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            M +P+K  +  +SLAMER GQWVFSQE+PTDV+V VGE SFSLHKFMLV KSN+IR+LI+
Sbjct  1    MPNPIKHNSN-ISLAMERAGQWVFSQELPTDVVVEVGEMSFSLHKFMLVGKSNHIRELIL  59

Query  325  DSKEADLTRINLSGIPGGPEIFE  393
            +SK+ D  RI+LSG+PGG E FE
Sbjct  60   ESKDVDCARIDLSGVPGGAETFE  82


 Score = 67.4 bits (163),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYLQMTD YC N+ AGRTEDFLSQVAL+S+SGAL VLKSCEELLP
Sbjct  99   NVAALRCAAEYLQMTDSYCKNSFAGRTEDFLSQVALTSMSGALAVLKSCEELLP  152



>ref|XP_007142019.1| hypothetical protein PHAVU_008G245700g [Phaseolus vulgaris]
 gb|ESW14013.1| hypothetical protein PHAVU_008G245700g [Phaseolus vulgaris]
Length=580

 Score =   126 bits (316),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 73/84 (87%), Gaps = 3/84 (4%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            MA+P   + TRLSLAMERTGQW+FS EIPTDVIV VGEA+FSLHKF+L AKSN IRK+IM
Sbjct  1    MATP---SPTRLSLAMERTGQWIFSPEIPTDVIVAVGEANFSLHKFILAAKSNSIRKVIM  57

Query  325  DSKEADLTRINLSGIPGGPEIFER  396
            +S+E+DLTRI+L+ IPGG E FE+
Sbjct  58   ESEESDLTRIDLTNIPGGQEAFEK  81


 Score = 60.1 bits (144),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA L CAA +LQMTD+YCD NLAGRTEDFLSQV +S+L  A+ VLKSC +LLP
Sbjct  97   NVAPLHCAAVFLQMTDEYCDGNLAGRTEDFLSQVGVSTLHSAIAVLKSCRQLLP  150



>ref|XP_003519296.1| PREDICTED: root phototropism protein 2 [Glycine max]
Length=580

 Score =   124 bits (312),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +1

Query  172  TRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTR  351
            TR SLAMERTGQWVFS EIPTDVIV VG+ +FSLHKF+L AKSNY+RK+IM+S+E+DLTR
Sbjct  7    TRFSLAMERTGQWVFSPEIPTDVIVAVGQTNFSLHKFILAAKSNYVRKVIMESEESDLTR  66

Query  352  INLSGIPGGPEIFERGGE  405
            I +S IPGG E FE+  +
Sbjct  67   IEISDIPGGSEAFEKAAK  84


 Score = 61.2 bits (147),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAAL CAA +LQMTD+YCD NLAGRTEDFLSQV LS+L  A+ VLKSC+++LP
Sbjct  97   NVAALHCAAVFLQMTDEYCDGNLAGRTEDFLSQVGLSTLHSAVAVLKSCQKILP  150



>ref|XP_006842585.1| hypothetical protein AMTR_s00077p00161250 [Amborella trichopoda]
 gb|ERN04260.1| hypothetical protein AMTR_s00077p00161250 [Amborella trichopoda]
Length=564

 Score =   134 bits (338),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +1

Query  163  SAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEAD  342
            S   RLSLAMERTG+WVFSQEIPTDV+V VGEA+FSLHKFMLVAKS YIRKLIM+SKEAD
Sbjct  4    STKNRLSLAMERTGKWVFSQEIPTDVVVEVGEANFSLHKFMLVAKSGYIRKLIMESKEAD  63

Query  343  LTRINLSGIPGGPEIFERGGE  405
            L+RI L  IPGGPE FE+  +
Sbjct  64   LSRIELPDIPGGPETFEKAAK  84


 Score = 51.6 bits (122),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEEL  599
            NVAAL CAAEYL+M++KYC+ NL  R EDFL  VAL+SLSGA+ VLKSCEEL
Sbjct  97   NVAALLCAAEYLEMSEKYCEGNLISRAEDFLVGVALTSLSGAVAVLKSCEEL  148



>ref|XP_010522018.1| PREDICTED: root phototropism protein 2-like [Tarenaya hassleriana]
Length=572

 Score =   115 bits (287),  Expect(3) = 3e-38, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            + +AMERT QWV SQ+ P DV+V V EASFSLHKF+LV KSNYIRKLIM+SK+ DLT I+
Sbjct  10   MDMAMERTDQWVSSQDTPADVVVDVCEASFSLHKFLLVGKSNYIRKLIMESKDTDLTIID  69

Query  358  LSGIPGGPEIFERGGE  405
            LS IPGGPE+FE+  +
Sbjct  70   LSDIPGGPEMFEKAAK  85


 Score = 57.0 bits (136),  Expect(3) = 3e-38, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAAL CAAE+LQMTD+YC++NLA RT DFLSQVALSSLSGA+VVLKSCE LLP
Sbjct  98   NVAALHCAAEFLQMTDEYCESNLASRTLDFLSQVALSSLSGAIVVLKSCELLLP  151


 Score = 34.3 bits (77),  Expect(3) = 3e-38, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITV 
Sbjct  83   AAKFCYGVNFEITVQ  97



>emb|CDX84827.1| BnaA03g14030D [Brassica napus]
Length=565

 Score =   119 bits (297),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S +++RTGQ  FSQ+IPTDV+V VGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQLGFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  358  LSGIPGGPEIFERGGE  405
            LS IPGG E+FE+  +
Sbjct  74   LSDIPGGAEMFEKAAK  89


 Score = 65.5 bits (158),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAAL+CAAE+LQMTDKYCDNNLAGR +DFLSQVALSSLSGA+VVLKSCE LLP
Sbjct  102  NVAALQCAAEFLQMTDKYCDNNLAGRIQDFLSQVALSSLSGAIVVLKSCEILLP  155



>ref|XP_009132742.1| PREDICTED: root phototropism protein 2-like [Brassica rapa]
Length=575

 Score =   118 bits (296),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            +S +++RTGQ  FSQ+IPTDV+V VGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQLGFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  358  LSGIPGGPEIFERGGE  405
            LS IPGG E+FE+  +
Sbjct  74   LSDIPGGAEMFEKAAK  89


 Score = 65.9 bits (159),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAAL+CAAE+LQMTDKYCDNNLAGR +DFLSQVALSSLSGA+VVLKSCE LLP
Sbjct  102  NVAALQCAAEFLQMTDKYCDNNLAGRIQDFLSQVALSSLSGAIVVLKSCEILLP  155



>ref|XP_004490729.1| PREDICTED: root phototropism protein 2-like [Cicer arietinum]
Length=573

 Score =   126 bits (317),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +1

Query  169  ATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  348
            ++RLSLAMERTGQW+ SQE+P+DVIV VGEAS+SLHKFMLVAKSNYIRKLI++S +++LT
Sbjct  6    SSRLSLAMERTGQWISSQELPSDVIVTVGEASYSLHKFMLVAKSNYIRKLIIESNDSELT  65

Query  349  RINLSGIPGGPEIFERGGE  405
            RI+LS IPGG E FE+  +
Sbjct  66   RIDLSDIPGGKEAFEKAAK  84


 Score = 55.8 bits (133),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA+L CAA +LQMT++YCD NLAGRTE FLSQVAL++LS A+VVLKSC +LLP
Sbjct  97   NVASLHCAALFLQMTEEYCDGNLAGRTEGFLSQVALTNLSSAVVVLKSCSQLLP  150



>gb|EPS73802.1| hypothetical protein M569_00954 [Genlisea aurea]
Length=566

 Score =   110 bits (274),  Expect(3) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 64/81 (79%), Gaps = 1/81 (1%)
 Frame = +1

Query  166  AATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKE-AD  342
            A  RLS AMERTGQWV SQ+IPTDV+V VG A FSLHKF L+AKSN +R LI++S+E +D
Sbjct  2    ADDRLSHAMERTGQWVLSQQIPTDVVVAVGTARFSLHKFTLIAKSNLLRTLILESEELSD  61

Query  343  LTRINLSGIPGGPEIFERGGE  405
             T I+LS IPGG EIFER  +
Sbjct  62   PTTIDLSEIPGGSEIFERAAK  82


 Score = 52.8 bits (125),  Expect(3) = 1e-35, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 4/54 (7%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYLQMT    D  L GRTEDFLS+VAL+SLS A+ VLK+CE+LLP
Sbjct  95   NVAALRCAAEYLQMT----DGTLGGRTEDFLSKVALTSLSAAVTVLKTCEDLLP  144


 Score = 34.3 bits (77),  Expect(3) = 1e-35, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITV+
Sbjct  80   AAKFCYGVNFEITVN  94



>gb|ABI34691.1| bZIP transcription factor bZIP84 [Glycine max]
Length=183

 Score =   110 bits (275),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +1

Query  196  RTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPG  375
            RTGQWVFS EIPTDVIV VG+ +FSLHKF+L AKSNY+RK+IM+S+E+DLTRI +S IPG
Sbjct  1    RTGQWVFSPEIPTDVIVAVGQTNFSLHKFILAAKSNYVRKVIMESEESDLTRIEISDIPG  60

Query  376  GPEIFERGGE  405
            G E FE+  +
Sbjct  61   GSEAFEKAAK  70


 Score = 61.2 bits (147),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAAL CAA +LQMTD+YCD NLAGRTEDFLSQV LS+L  A+ VLKSC+++LP
Sbjct  83   NVAALHCAAVFLQMTDEYCDGNLAGRTEDFLSQVGLSTLHSAVAVLKSCQKILP  136



>gb|KJB26283.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=532

 Score = 75.9 bits (185),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +1

Query  277  KFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERGGE  405
            +FMLVAKSNYIRKLIM++ EADLTRINLS IPGGPEIFE+  +
Sbjct  2    QFMLVAKSNYIRKLIMETNEADLTRINLSEIPGGPEIFEKAAK  44


 Score = 73.6 bits (179),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 52/54 (96%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQVALSSLSGA+VVLKSCE+LLP
Sbjct  57   NVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQVALSSLSGAVVVLKSCEDLLP  110


 Score = 36.6 bits (83),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  42   AAKFCYGVNFEITVH  56



>ref|XP_009384759.1| PREDICTED: root phototropism protein 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=582

 Score = 94.4 bits (233),  Expect(3) = 3e-31, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +1

Query  169  ATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  348
            ++RLS AME T  W FSQ+IP+D++V +G+A+F LHKF+L AKS YIR+ +M+S+ A+L+
Sbjct  10   SSRLSAAMETTSHWDFSQDIPSDIVVQIGDATFQLHKFVLAAKSGYIRRKVMESESANLS  69

Query  349  RINLSGIPGGPEIFER  396
             I+LS +  G E+FER
Sbjct  70   CIDLSDLSIGAEVFER  85


 Score = 54.7 bits (130),  Expect(3) = 3e-31, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDF  533
            NVAALRCAAEYLQMT++YC  NLA RTE+F
Sbjct  101  NVAALRCAAEYLQMTEEYCRGNLAARTEEF  130


 Score = 33.5 bits (75),  Expect(3) = 3e-31, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 18/22 (82%), Gaps = 2/22 (9%)
 Frame = +2

Query  401  AKFCYGVNFEITVH*RGGSALR  466
            AKFCYGVNFEI+V  R  +ALR
Sbjct  87   AKFCYGVNFEISV--RNVAALR  106



>ref|XP_006432045.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006432047.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45285.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45287.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
Length=541

 Score = 73.9 bits (180),  Expect(3) = 1e-30, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  283  MLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERGGE  405
            MLVAKSNYIRKLI++SKEADLTRINLS IPGGPE+FE+  +
Sbjct  1    MLVAKSNYIRKLIIESKEADLTRINLSNIPGGPEMFEKAAK  41


 Score = 69.7 bits (169),  Expect(3) = 1e-30, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAE+LQMTDKYC+NNLAGRTEDFLSQVALSSLSGA+VVLKSCE LLP
Sbjct  54   NVAALRCAAEFLQMTDKYCENNLAGRTEDFLSQVALSSLSGAVVVLKSCEALLP  107


 Score = 36.6 bits (83),  Expect(3) = 1e-30, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  39   AAKFCYGVNFEITVH  53



>gb|KDO54918.1| hypothetical protein CISIN_1g007944mg [Citrus sinensis]
Length=541

 Score = 73.9 bits (180),  Expect(3) = 2e-30, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  283  MLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERGGE  405
            MLVAKSNYIRKLI++SKEADLTRINLS IPGGPE+FE+  +
Sbjct  1    MLVAKSNYIRKLIIESKEADLTRINLSNIPGGPEMFEKAAK  41


 Score = 69.7 bits (169),  Expect(3) = 2e-30, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAE+LQMTDKYC+NNLAGRTEDFLSQVALSSLSGA+VVLKSCE LLP
Sbjct  54   NVAALRCAAEFLQMTDKYCENNLAGRTEDFLSQVALSSLSGAVVVLKSCEALLP  107


 Score = 36.6 bits (83),  Expect(3) = 2e-30, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  39   AAKFCYGVNFEITVH  53



>ref|XP_010650806.1| PREDICTED: root phototropism protein 2 isoform X2 [Vitis vinifera]
Length=527

 Score = 72.8 bits (177),  Expect(3) = 3e-30, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  283  MLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERGGE  405
            MLVAKSNYIRKLIM+SKEADLT I+LS IPGGPEIFE+  +
Sbjct  1    MLVAKSNYIRKLIMESKEADLTNIDLSDIPGGPEIFEKAAK  41


 Score = 70.1 bits (170),  Expect(3) = 3e-30, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYLQMTDKYCD NL+GRTEDFL QVAL+SLSGA+VVLKSCE+LLP
Sbjct  54   NVAALRCAAEYLQMTDKYCDGNLSGRTEDFLKQVALTSLSGAVVVLKSCEDLLP  107


 Score = 36.6 bits (83),  Expect(3) = 3e-30, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  39   AAKFCYGVNFEITVH  53



>ref|XP_008803009.1| PREDICTED: root phototropism protein 2 [Phoenix dactylifera]
Length=583

 Score = 97.4 bits (241),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +1

Query  187  AMERTGQWVFS-QEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLS  363
            A ERTGQWV S Q+IPTD+I+ VG+ SF LHKFMLVAKS YIR+ IMDS   ++ RI+LS
Sbjct  13   ATERTGQWVPSDQDIPTDIIIHVGDVSFPLHKFMLVAKSGYIRRKIMDSDRTNVARIDLS  72

Query  364  GIPGGPEIFERGGE  405
             +PGG E FE+  +
Sbjct  73   EVPGGVEAFEKAAK  86


 Score = 61.6 bits (148),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 51/58 (88%), Gaps = 1/58 (2%)
 Frame = +3

Query  432  SLYINVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            S+Y NV ALRCAAEYL+MT+KYC+ NL GRTE+FL+Q AL +L GA++VL+SCEELLP
Sbjct  96   SVY-NVVALRCAAEYLEMTEKYCEGNLEGRTEEFLAQAALKTLPGAVIVLRSCEELLP  152



>ref|XP_007156731.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 ref|XP_007156732.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 gb|ESW28725.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 gb|ESW28726.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
Length=617

 Score = 98.6 bits (244),  Expect(3) = 7e-29, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+DV V VGE SFSLHKF LV+K  YIRKL+ +S +AD++ I 
Sbjct  23   LSSAMKRTSEWIFSQEIPSDVNVQVGEDSFSLHKFPLVSKCGYIRKLVSESNDADVSSIE  82

Query  358  LSGIPGGPEIFE  393
            LS +PGG E FE
Sbjct  83   LSDVPGGAEAFE  94


 Score = 42.7 bits (99),  Expect(3) = 7e-29, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT+ Y   NL GRT+ +L++VAL +++GA+ VL   E LLP
Sbjct  111  NIATLRCVAEYLEMTEDYSVGNLVGRTDAYLNEVALKTIAGAVSVLHMSETLLP  164


 Score = 33.1 bits (74),  Expect(3) = 7e-29, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITV  439
            P    + + AAKFCYG+NFEI V
Sbjct  87   PGGAEAFELAAKFCYGINFEINV  109



>ref|NP_001031446.1| Root phototropism protein 2 [Arabidopsis thaliana]
 ref|NP_001077982.1| Root phototropism protein 2 [Arabidopsis thaliana]
 dbj|BAD43060.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08402.1| Root phototropism protein 2 [Arabidopsis thaliana]
 gb|AEC08403.1| Root phototropism protein 2 [Arabidopsis thaliana]
Length=545

 Score = 72.4 bits (176),  Expect(3) = 1e-28, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  283  MLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERGGE  405
            MLVAKSNYIRKLIM+SK++D+TRINLS IPGGPEIFE+  +
Sbjct  1    MLVAKSNYIRKLIMESKDSDVTRINLSDIPGGPEIFEKAAK  41


 Score = 67.0 bits (162),  Expect(3) = 1e-28, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLSQVALSSLSGA+VVLKSCE LLP
Sbjct  54   NVAALHCAAEFLQMTDKYCDNNLAGRTQDFLSQVALSSLSGAIVVLKSCEILLP  107


 Score = 33.9 bits (76),  Expect(3) = 1e-28, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITV 
Sbjct  39   AAKFCYGVNFEITVQ  53



>gb|EYU44474.1| hypothetical protein MIMGU_mgv1a027075mg [Erythranthe guttata]
Length=577

 Score = 92.4 bits (228),  Expect(3) = 5e-28, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+DV V  G  SFSLHKF LV+K  YIRKL+ +S +ADL  + 
Sbjct  9    LSTAMKRTSEWIFSQEIPSDVTVNAGGTSFSLHKFPLVSKCGYIRKLVTESTDADLAVVE  68

Query  358  LSGIPGGPEIFE  393
            +   PGGPE FE
Sbjct  69   IPDFPGGPEGFE  80


 Score = 48.5 bits (114),  Expect(3) = 5e-28, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAEYL+MT++Y   NL GRTE ++++VAL SL+GA+ +L S E LLP
Sbjct  97   NIATLRCAAEYLEMTEEYSVGNLVGRTESYVNEVALKSLAGAVSILHSAENLLP  150


 Score = 30.8 bits (68),  Expect(3) = 5e-28, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 0/25 (0%)
 Frame = +2

Query  368  FPAALRSSKGAAKFCYGVNFEITVH  442
            FP      + AA FCYG+NFEIT  
Sbjct  72   FPGGPEGFELAANFCYGINFEITTE  96



>ref|XP_004166154.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Cucumis 
sativus]
Length=802

 Score = 95.9 bits (237),  Expect(3) = 6e-28, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 62/86 (72%), Gaps = 2/86 (2%)
 Frame = +1

Query  142  NMASPLKSAATR--LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRK  315
             ++S L  +A +  LS AM+RT +W+FSQEIP+DV V VGEASFSLHKF LV+K  +IRK
Sbjct  10   QLSSSLNMSAKKELLSTAMKRTSEWIFSQEIPSDVTVHVGEASFSLHKFPLVSKCGHIRK  69

Query  316  LIMDSKEADLTRINLSGIPGGPEIFE  393
            L+ +S +ADL  + L   PGG E FE
Sbjct  70   LVSESTDADLATVELPNCPGGAEAFE  95


 Score = 46.2 bits (108),  Expect(3) = 6e-28, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDF  533
            N+A LRCAAEYL+MT++Y   NL GRTE +
Sbjct  112  NIAMLRCAAEYLEMTEEYAVGNLVGRTEAY  141


 Score = 29.3 bits (64),  Expect(3) = 6e-28, Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 14/21 (67%), Gaps = 0/21 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEI  433
            P    + + AA FCYG+NFEI
Sbjct  88   PGGAEAFELAAMFCYGINFEI  108



>ref|XP_004149698.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Cucumis 
sativus]
Length=621

 Score = 96.3 bits (238),  Expect(3) = 6e-28, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 62/86 (72%), Gaps = 2/86 (2%)
 Frame = +1

Query  142  NMASPLKSAATR--LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRK  315
             ++S L  +A +  LS AM+RT +W+FSQEIP+DV V VGEASFSLHKF LV+K  +IRK
Sbjct  10   QLSSSLNMSAKKELLSTAMKRTSEWIFSQEIPSDVTVHVGEASFSLHKFPLVSKCGHIRK  69

Query  316  LIMDSKEADLTRINLSGIPGGPEIFE  393
            L+ +S +ADL  + L   PGG E FE
Sbjct  70   LVSESTDADLATVELPNCPGGAEAFE  95


 Score = 45.8 bits (107),  Expect(3) = 6e-28, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDF  533
            N+A LRCAAEYL+MT++Y   NL GRTE +
Sbjct  112  NIAMLRCAAEYLEMTEEYAVGNLVGRTEAY  141


 Score = 29.3 bits (64),  Expect(3) = 6e-28, Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 14/21 (67%), Gaps = 0/21 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEI  433
            P    + + AA FCYG+NFEI
Sbjct  88   PGGAEAFELAAMFCYGINFEI  108



>ref|XP_003538794.2| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Glycine max]
Length=618

 Score = 96.7 bits (239),  Expect(3) = 7e-28, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+DV V VGEASFSLHKF LV+K  YIRKL+ +S +AD++ I 
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVNVQVGEASFSLHKFPLVSKCGYIRKLVSESNDADVSFIE  83

Query  358  LSGIPGGPEIFE  393
            L  +PGG E FE
Sbjct  84   LPEVPGGAEAFE  95


 Score = 42.7 bits (99),  Expect(3) = 7e-28, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT+ Y   NL GRT+ +L++VAL +++GA+ +L   E LLP
Sbjct  112  NIATLRCVAEYLEMTEDYSVGNLVGRTDAYLNEVALKTIAGAVSILHMSENLLP  165


 Score = 31.6 bits (70),  Expect(3) = 7e-28, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITV  439
            P    + + AAKFCYG+NF+I V
Sbjct  88   PGGAEAFELAAKFCYGINFDINV  110



>ref|XP_002284242.2| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Vitis 
vinifera]
Length=636

 Score = 96.7 bits (239),  Expect(3) = 7e-28, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 60/84 (71%), Gaps = 3/84 (4%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLI  321
            NM+S  K     LS AM+RT +W+FSQEIP+DV V  GE SFSLHKF LV+K  YIRKL+
Sbjct  15   NMSSKKKEL---LSTAMKRTSEWIFSQEIPSDVTVHAGEVSFSLHKFPLVSKCGYIRKLV  71

Query  322  MDSKEADLTRINLSGIPGGPEIFE  393
             +S +ADL+ I +  +PGG E FE
Sbjct  72   SESSDADLSVIEVHDVPGGAEAFE  95


 Score = 42.4 bits (98),  Expect(3) = 7e-28, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT+ Y   NL GR E +L++VAL SL+GA+ +L   E LLP
Sbjct  112  NIAMLRCVAEYLEMTEDYSVGNLVGRAEAYLNEVALKSLAGAVTILHLSEALLP  165


 Score = 32.3 bits (72),  Expect(3) = 7e-28, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCYG+NFEI+
Sbjct  88   PGGAEAFELAAKFCYGINFEIS  109



>ref|XP_010277089.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010277090.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Nelumbo nucifera]
Length=605

 Score = 91.3 bits (225),  Expect(3) = 8e-28, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +1

Query  181  SLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINL  360
            S AMERT +W+FSQEIP+D+ V  G ASFSLHKF LV+K  YIRKL+ +  +AD++ + L
Sbjct  10   STAMERTSEWIFSQEIPSDITVHAGGASFSLHKFPLVSKCGYIRKLVSEDSDADVSVVEL  69

Query  361  SGIPGGPEIFE  393
              +PGG E FE
Sbjct  70   PDVPGGEEAFE  80


 Score = 48.1 bits (113),  Expect(3) = 8e-28, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT+ Y   NL GRTED+L++VAL SL+GA+ VL + E LLP
Sbjct  97   NIATLRCVAEYLEMTEDYAVGNLVGRTEDYLNEVALKSLAGAISVLHTSENLLP  150


 Score = 31.6 bits (70),  Expect(3) = 8e-28, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCYG+NFEI+
Sbjct  73   PGGEEAFELAAKFCYGINFEIS  94



>ref|XP_008457766.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Cucumis melo]
Length=621

 Score = 95.9 bits (237),  Expect(3) = 8e-28, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +1

Query  157  LKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKE  336
            + S    LS AM+RT +W+FSQEIP+DV V VGEASFSLHKF LV+K  +IRKL+ +S +
Sbjct  14   MSSKKELLSTAMKRTSEWIFSQEIPSDVTVHVGEASFSLHKFPLVSKCGHIRKLVSESTD  73

Query  337  ADLTRINLSGIPGGPEIFE  393
            ADL  + L   PGG E FE
Sbjct  74   ADLATVELPNCPGGAEAFE  92


 Score = 45.8 bits (107),  Expect(3) = 8e-28, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDF  533
            N+A LRCAAEYL+MT++Y   NL GRTE +
Sbjct  109  NIAMLRCAAEYLEMTEEYAVGNLVGRTEAY  138


 Score = 29.3 bits (64),  Expect(3) = 8e-28, Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 14/21 (67%), Gaps = 0/21 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEI  433
            P    + + AA FCYG+NFEI
Sbjct  85   PGGAEAFELAAMFCYGINFEI  105



>ref|XP_008457767.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Cucumis melo]
Length=620

 Score = 95.9 bits (237),  Expect(3) = 8e-28, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +1

Query  157  LKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKE  336
            + S    LS AM+RT +W+FSQEIP+DV V VGEASFSLHKF LV+K  +IRKL+ +S +
Sbjct  14   MSSKKELLSTAMKRTSEWIFSQEIPSDVTVHVGEASFSLHKFPLVSKCGHIRKLVSESTD  73

Query  337  ADLTRINLSGIPGGPEIFE  393
            ADL  + L   PGG E FE
Sbjct  74   ADLATVELPNCPGGAEAFE  92


 Score = 45.8 bits (107),  Expect(3) = 8e-28, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDF  533
            N+A LRCAAEYL+MT++Y   NL GRTE +
Sbjct  109  NIAMLRCAAEYLEMTEEYAVGNLVGRTEAY  138


 Score = 29.3 bits (64),  Expect(3) = 8e-28, Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 14/21 (67%), Gaps = 0/21 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEI  433
            P    + + AA FCYG+NFEI
Sbjct  85   PGGAEAFELAAMFCYGINFEI  105



>ref|XP_002978505.1| hypothetical protein SELMODRAFT_443843 [Selaginella moellendorffii]
 gb|EFJ20491.1| hypothetical protein SELMODRAFT_443843 [Selaginella moellendorffii]
Length=615

 Score = 85.1 bits (209),  Expect(3) = 8e-28, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +1

Query  172  TRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLT  348
            + +S A +RT +WV S ++PTDV+V  G  SF+LHKF LV++S  IRKL+  DS+E D++
Sbjct  16   STVSSAAKRTAEWVMSTDVPTDVLVEAGGVSFALHKFPLVSRSGKIRKLVAGDSRELDVS  75

Query  349  RINLSGIPGGPEIFE  393
             I LS +PGGPE FE
Sbjct  76   FIKLSDLPGGPEAFE  90


 Score = 52.4 bits (124),  Expect(3) = 8e-28, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCAAEYL MT+ Y D NL  RTE F+ ++A  +LS A+ VL SCE LLP
Sbjct  107  NVATLRCAAEYLDMTEDYGDGNLVARTEAFIDEIATQNLSNAVAVLHSCESLLP  160


 Score = 33.5 bits (75),  Expect(3) = 8e-28, Method: Composition-based stats.
 Identities = 13/24 (54%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +2

Query  368  FPAALRSSKGAAKFCYGVNFEITV  439
             P    + + AAKFCYG+NFEI+V
Sbjct  82   LPGGPEAFELAAKFCYGINFEISV  105



>ref|XP_010086959.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB25095.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=624

 Score = 94.0 bits (232),  Expect(3) = 1e-27, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS A++RT +W+FSQEIP+DV + VG  SFSLHKF LV+K  YIRKL+ +S ++DL+ I 
Sbjct  24   LSTALKRTSEWIFSQEIPSDVTIDVGGVSFSLHKFPLVSKCGYIRKLVSESNDSDLSIIE  83

Query  358  LSGIPGGPEIFE  393
            L+ IPGG E FE
Sbjct  84   LADIPGGAEAFE  95


 Score = 44.3 bits (103),  Expect(3) = 1e-27, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAEYL+MT+ Y   NL GRT+ +L++VAL SL+ A  +L   E  LP
Sbjct  112  NIAMLRCAAEYLEMTEDYAVGNLVGRTDAYLNEVALKSLASAASILHISENFLP  165


 Score = 32.3 bits (72),  Expect(3) = 1e-27, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCYG+NFEI+
Sbjct  88   PGGAEAFELAAKFCYGINFEIS  109



>ref|XP_007047478.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
 gb|EOX91635.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
Length=623

 Score = 91.3 bits (225),  Expect(3) = 1e-27, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 61/84 (73%), Gaps = 3/84 (4%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLI  321
            NM+S  K     LS AM+RT +W+FSQEIP+DV V VG ASFSLHKF LV+K  +IRK++
Sbjct  15   NMSSKKKEL---LSTAMKRTSEWIFSQEIPSDVTVQVGGASFSLHKFPLVSKCGFIRKVV  71

Query  322  MDSKEADLTRINLSGIPGGPEIFE  393
             +S +AD++ I +  +PGG + FE
Sbjct  72   SESNDADVSVIEIPDVPGGADSFE  95


 Score = 46.6 bits (109),  Expect(3) = 1e-27, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAEYL+MT+ Y   NL GRTE +L++VAL SL+GA+ VL + E LLP
Sbjct  112  NIAMLRCAAEYLEMTEDYAVGNLVGRTEAYLNEVALKSLAGAVSVLHTSENLLP  165


 Score = 32.7 bits (73),  Expect(3) = 1e-27, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    S + AAKFCYG+NFEI+
Sbjct  88   PGGADSFELAAKFCYGINFEIS  109



>emb|CAN71562.1| hypothetical protein VITISV_007563 [Vitis vinifera]
Length=621

 Score = 95.9 bits (237),  Expect(3) = 1e-27, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+DV V  GE SFSLHKF LV+K  YIRKL+ +S +ADL+ I 
Sbjct  9    LSTAMKRTSEWIFSQEIPSDVTVHAGEVSFSLHKFPLVSKCGYIRKLVSESSDADLSVIE  68

Query  358  LSGIPGGPEIFE  393
            +  +PGG E FE
Sbjct  69   VHDVPGGAEAFE  80


 Score = 42.4 bits (98),  Expect(3) = 1e-27, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT+ Y   NL GR E +L++VAL SL+GA+ +L   E LLP
Sbjct  97   NIAMLRCVAEYLEMTEDYSVGNLVGRAEAYLNEVALKSLAGAVTILHLSEALLP  150


 Score = 32.3 bits (72),  Expect(3) = 1e-27, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCYG+NFEI+
Sbjct  73   PGGAEAFELAAKFCYGINFEIS  94



>gb|KGN61975.1| hypothetical protein Csa_2G277660 [Cucumis sativus]
Length=299

 Score = 95.9 bits (237),  Expect(3) = 1e-27, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 62/86 (72%), Gaps = 2/86 (2%)
 Frame = +1

Query  142  NMASPLKSAATR--LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRK  315
             ++S L  +A +  LS AM+RT +W+FSQEIP+DV V VGEASFSLHKF LV+K  +IRK
Sbjct  10   QLSSSLNMSAKKELLSTAMKRTSEWIFSQEIPSDVTVHVGEASFSLHKFPLVSKCGHIRK  69

Query  316  LIMDSKEADLTRINLSGIPGGPEIFE  393
            L+ +S +ADL  + L   PGG E FE
Sbjct  70   LVSESTDADLATVELPNCPGGAEAFE  95


 Score = 46.6 bits (109),  Expect(3) = 1e-27, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAEYL+MT++Y   NL GRTE ++++VAL SL+GA+ VL   + LLP
Sbjct  112  NIAMLRCAAEYLEMTEEYAVGNLVGRTEAYINEVALKSLAGAVSVLHMSQSLLP  165


 Score = 27.7 bits (60),  Expect(3) = 1e-27, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEI  433
            AA FCYG+NFEI
Sbjct  97   AAMFCYGINFEI  108



>ref|XP_002963864.1| hypothetical protein SELMODRAFT_141980 [Selaginella moellendorffii]
 gb|EFJ35735.1| hypothetical protein SELMODRAFT_141980 [Selaginella moellendorffii]
Length=631

 Score = 82.0 bits (201),  Expect(3) = 2e-27, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = +1

Query  160  KSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEA  339
            K   +R S   +RTGQW+ S ++PTDV+V     SFSLHKF LVA+   IR+ + +++E 
Sbjct  11   KRLVSRTSYNKKRTGQWIMSADVPTDVVVEAAGTSFSLHKFPLVARCGRIRRAVAEAREM  70

Query  340  DLTRINLSGIPGGPEIFE  393
            DL+RI    +PGG E FE
Sbjct  71   DLSRIEFPDVPGGAETFE  88


 Score = 54.7 bits (130),  Expect(3) = 2e-27, Method: Composition-based stats.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYL+M D+Y   NL GRTE F+++V L S + +L VL SCEELLP
Sbjct  105  NVAALRCAAEYLEMKDEYGQGNLLGRTEAFVNEVVLPSFANSLCVLHSCEELLP  158


 Score = 33.1 bits (74),  Expect(3) = 2e-27, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCYG+NFEIT
Sbjct  81   PGGAETFELAAKFCYGINFEIT  102



>ref|XP_002988267.1| hypothetical protein SELMODRAFT_447227 [Selaginella moellendorffii]
 gb|EFJ10686.1| hypothetical protein SELMODRAFT_447227 [Selaginella moellendorffii]
Length=631

 Score = 82.0 bits (201),  Expect(3) = 2e-27, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = +1

Query  160  KSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEA  339
            K   +R S   +RTGQW+ S ++PTDV+V     SFSLHKF LVA+   IR+ + +++E 
Sbjct  11   KRLVSRTSYNKKRTGQWIMSADVPTDVVVEAAGTSFSLHKFPLVARCGRIRRAVAEAREM  70

Query  340  DLTRINLSGIPGGPEIFE  393
            DL+RI    +PGG E FE
Sbjct  71   DLSRIEFPDVPGGAETFE  88


 Score = 54.3 bits (129),  Expect(3) = 2e-27, Method: Composition-based stats.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVAALRCAAEYL+M D+Y   NL GRTE F+++V L S + +L VL SCEELLP
Sbjct  105  NVAALRCAAEYLEMKDEYGQGNLLGRTEAFVNEVVLPSFANSLCVLHSCEELLP  158


 Score = 33.1 bits (74),  Expect(3) = 2e-27, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCYG+NFEIT
Sbjct  81   PGGAETFELAAKFCYGINFEIT  102



>ref|XP_006466487.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Citrus 
sinensis]
Length=623

 Score = 95.1 bits (235),  Expect(3) = 2e-27, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+DV V VG  SFSLHKF LV+K  YIRKL+ +S EADL+ I 
Sbjct  24   LSTAMKRTSEWIFSQEIPSDVTVHVGGTSFSLHKFPLVSKCGYIRKLVSESSEADLSVIE  83

Query  358  LSGIPGGPEIFE  393
            +  +PGG E FE
Sbjct  84   IPDVPGGAEAFE  95


 Score = 42.7 bits (99),  Expect(3) = 2e-27, Method: Composition-based stats.
 Identities = 18/30 (60%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDF  533
            NVA LRC AEYL+MT+ Y   NL GR E +
Sbjct  112  NVAGLRCVAEYLEMTEDYAVGNLVGRAEAY  141


 Score = 31.6 bits (70),  Expect(3) = 2e-27, Method: Composition-based stats.
 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEI  433
            P    + + AAKFCYG+NFEI
Sbjct  88   PGGAEAFELAAKFCYGINFEI  108



>ref|XP_006841959.1| hypothetical protein AMTR_s00144p00020600 [Amborella trichopoda]
 gb|ERN03634.1| hypothetical protein AMTR_s00144p00020600 [Amborella trichopoda]
Length=609

 Score = 94.4 bits (233),  Expect(3) = 3e-27, Method: Composition-based stats.
 Identities = 45/84 (54%), Positives = 60/84 (71%), Gaps = 3/84 (4%)
 Frame = +1

Query  151  SPLKSAATR---LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLI  321
            SPL  +  +   LS AM+RT +W+FSQEIP+DV V  G A+FSLHKF LV+K  Y+RKL+
Sbjct  8    SPLIMSTKKKQLLSSAMKRTSEWIFSQEIPSDVTVQAGGATFSLHKFPLVSKCGYMRKLV  67

Query  322  MDSKEADLTRINLSGIPGGPEIFE  393
             ++ +ADL+ I +  IPGG E FE
Sbjct  68   SEANDADLSMIEIPDIPGGAEAFE  91


 Score = 42.7 bits (99),  Expect(3) = 3e-27, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRC AEYL+MT+ Y   NL  RTE ++++VAL SLSGA+ VL   E LLP
Sbjct  108  NVAMLRCVAEYLEMTEDYTTGNLVNRTEAYVTEVALKSLSGAITVLHRSESLLP  161


 Score = 32.3 bits (72),  Expect(3) = 3e-27, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCYG+NFEI+
Sbjct  84   PGGAEAFELAAKFCYGINFEIS  105



>ref|XP_011099322.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Sesamum 
indicum]
Length=616

 Score = 93.2 bits (230),  Expect(3) = 4e-27, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+D+ V  G  SFSLHKF LV+K  YIRKL+ +S +ADL+ I 
Sbjct  24   LSTAMKRTSEWIFSQEIPSDITVNAGGTSFSLHKFPLVSKCGYIRKLVSESSDADLSAIE  83

Query  358  LSGIPGGPEIFE  393
            +  +PGG E FE
Sbjct  84   IPDVPGGAEAFE  95


 Score = 43.5 bits (101),  Expect(3) = 4e-27, Method: Composition-based stats.
 Identities = 18/30 (60%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDF  533
            N+A LRC AEYL+MT+ Y   NL GRTE +
Sbjct  112  NIARLRCVAEYLEMTEDYAVGNLVGRTEAY  141


 Score = 32.0 bits (71),  Expect(3) = 4e-27, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCYG+NFEI+
Sbjct  88   PGGAEAFELAAKFCYGINFEIS  109



>emb|CBI33715.3| unnamed protein product [Vitis vinifera]
Length=529

 Score = 95.5 bits (236),  Expect(3) = 4e-27, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+DV V  GE SFSLHKF LV+K  YIRKL+ +S +ADL+ I 
Sbjct  9    LSTAMKRTSEWIFSQEIPSDVTVHAGEVSFSLHKFPLVSKCGYIRKLVSESSDADLSVIE  68

Query  358  LSGIPGGPEIFE  393
            +  +PGG E FE
Sbjct  69   VHDVPGGAEAFE  80


 Score = 42.4 bits (98),  Expect(3) = 4e-27, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT+ Y   NL GR E +L++VAL SL+GA+ +L   E LLP
Sbjct  97   NIAMLRCVAEYLEMTEDYSVGNLVGRAEAYLNEVALKSLAGAVTILHLSEALLP  150


 Score = 30.8 bits (68),  Expect(3) = 4e-27, Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYG+NFEI+  
Sbjct  82   AAKFCYGINFEISTE  96



>ref|XP_009402205.1| PREDICTED: root phototropism protein 2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=581

 Score =   102 bits (253),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +1

Query  169  ATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  348
            ++RL  AME+T QWV SQ+IP+D+IV VG+ +F LHKFMLVA S YIR+ +M+S+ A+L 
Sbjct  7    SSRLCAAMEKTSQWVLSQDIPSDIIVQVGDDTFRLHKFMLVANSGYIRRKVMESERANLG  66

Query  349  RINLSGIPGGPEIFERGGE  405
             I+LS +PGG E+FE+  +
Sbjct  67   CIDLSDVPGGAEVFEKAAK  85


 Score = 46.6 bits (109),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCE-ELLP  605
            NV ALRCAAEYLQMT+ Y   NLA R E+F++Q A+ +L GA+ +L+SCE  LLP
Sbjct  98   NVTALRCAAEYLQMTEDYSRGNLAERAEEFINQAAVKTLPGAVALLRSCEGSLLP  152



>ref|XP_003517336.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
Length=618

 Score = 97.4 bits (241),  Expect(3) = 4e-27, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+DV V VGEASFSLHKF LV+K  YIRKL+ +S +AD++ I 
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVNVQVGEASFSLHKFPLVSKCGYIRKLVSESNDADVSFIE  83

Query  358  LSGIPGGPEIFE  393
            L  +PGG E FE
Sbjct  84   LPDVPGGAEAFE  95


 Score = 38.1 bits (87),  Expect(3) = 4e-27, Method: Composition-based stats.
 Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDF  533
            N+A L C AEYL+MT+ Y   NL GRT+ +
Sbjct  112  NIATLCCVAEYLEMTEDYSVGNLMGRTDAY  141


 Score = 33.1 bits (74),  Expect(3) = 4e-27, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITV  439
            P    + + AAKFCYG+NFEI V
Sbjct  88   PGGAEAFELAAKFCYGINFEINV  110



>gb|KHN36285.1| BTB/POZ domain-containing protein [Glycine soja]
Length=618

 Score = 97.1 bits (240),  Expect(3) = 5e-27, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+DV V VGEASFSLHKF LV+K  YIRKL+ +S +AD++ I 
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVNVQVGEASFSLHKFPLVSKCGYIRKLVSESNDADVSFIE  83

Query  358  LSGIPGGPEIFE  393
            L  +PGG E FE
Sbjct  84   LPDVPGGAEAFE  95


 Score = 38.1 bits (87),  Expect(3) = 5e-27, Method: Composition-based stats.
 Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDF  533
            N+A L C AEYL+MT+ Y   NL GRT+ +
Sbjct  112  NIATLCCVAEYLEMTEDYSVGNLMGRTDAY  141


 Score = 33.1 bits (74),  Expect(3) = 5e-27, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITV  439
            P    + + AAKFCYG+NFEI V
Sbjct  88   PGGAEAFELAAKFCYGINFEINV  110



>ref|XP_003597110.1| Root phototropism protein [Medicago truncatula]
 ref|XP_003611625.1| Root phototropism protein [Medicago truncatula]
 gb|AES94583.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=630

 Score = 94.7 bits (234),  Expect(3) = 5e-27, Method: Composition-based stats.
 Identities = 41/72 (57%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT  W+FSQEIP+DV V +GE+SF+LHK+ LV+K  YIRKL+ +S ++D++ + 
Sbjct  24   LSSAMKRTSDWIFSQEIPSDVNVQIGESSFTLHKYPLVSKCGYIRKLVSESNDSDVSFVE  83

Query  358  LSGIPGGPEIFE  393
            LS +PGG E FE
Sbjct  84   LSDVPGGAEAFE  95


 Score = 40.4 bits (93),  Expect(3) = 5e-27, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT+ Y   NL  RT+ +L+ VAL +++G++ +L   E LLP
Sbjct  112  NIAMLRCVAEYLEMTEDYSVGNLVARTDAYLNDVALKTIAGSVSILHISESLLP  165


 Score = 33.1 bits (74),  Expect(3) = 5e-27, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITV  439
            P    + + AAKFCYG+NFEI V
Sbjct  88   PGGAEAFELAAKFCYGINFEINV  110



>gb|KJB48677.1| hypothetical protein B456_008G080700 [Gossypium raimondii]
Length=614

 Score = 87.8 bits (216),  Expect(3) = 7e-27, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +1

Query  157  LKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKE  336
            + S    LS AM+RT +W+FSQEIP+DV V VG  SFSLHKF L++KS ++RK++ +S +
Sbjct  16   MSSKKELLSSAMKRTSEWIFSQEIPSDVTVQVGGVSFSLHKFPLISKSGFVRKVVSESND  75

Query  337  ADLTRINLSGIPGGPEIFE  393
            AD + I +  +PGG + FE
Sbjct  76   ADHSIIEIPNVPGGADSFE  94


 Score = 47.0 bits (110),  Expect(3) = 7e-27, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAEYL+MT+ Y   NL GRTE +L++VAL SL+GA+ VL   E LLP
Sbjct  111  NIAMLRCAAEYLEMTEDYAVGNLVGRTEAYLNEVALKSLAGAVSVLHMSESLLP  164


 Score = 32.7 bits (73),  Expect(3) = 7e-27, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    S + AAKFCYG+NFEI+
Sbjct  87   PGGADSFELAAKFCYGINFEIS  108



>ref|XP_009628088.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Nicotiana 
tomentosiformis]
Length=620

 Score = 91.3 bits (225),  Expect(3) = 7e-27, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT  W+FSQEIP+DV V  G ++FSLHKF LV+KS YIRK+I +S +AD++ + 
Sbjct  26   LSTAMKRTSDWIFSQEIPSDVTVNAGGSAFSLHKFPLVSKSGYIRKIISESNDADVSTVE  85

Query  358  LSGIPGGPEIFE  393
            +  IPGG + FE
Sbjct  86   IPDIPGGSDAFE  97


 Score = 45.1 bits (105),  Expect(3) = 7e-27, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT+ Y   NL GRTE +L++VAL SL+GA+ +L S E LLP
Sbjct  114  NIALLRCTAEYLEMTEDYAVGNLVGRTEAYLNEVALKSLAGAVSILHSSESLLP  167


 Score = 31.2 bits (69),  Expect(3) = 7e-27, Method: Composition-based stats.
 Identities = 11/13 (85%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEIT  436
            AAKFCYG+NFEI+
Sbjct  99   AAKFCYGINFEIS  111



>gb|KDO78972.1| hypothetical protein CISIN_1g006971mg [Citrus sinensis]
Length=623

 Score = 93.2 bits (230),  Expect(3) = 8e-27, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+DV V VG  SFSLHKF LV+K  YIRKL+  S EADL+ I 
Sbjct  24   LSTAMKRTSEWIFSQEIPSDVTVHVGGTSFSLHKFPLVSKCGYIRKLVSVSSEADLSVIE  83

Query  358  LSGIPGGPEIFE  393
            +  +PGG E FE
Sbjct  84   IPDVPGGAEAFE  95


 Score = 42.7 bits (99),  Expect(3) = 8e-27, Method: Composition-based stats.
 Identities = 18/30 (60%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDF  533
            NVA LRC AEYL+MT+ Y   NL GR E +
Sbjct  112  NVAGLRCVAEYLEMTEDYAVGNLVGRAEAY  141


 Score = 31.6 bits (70),  Expect(3) = 8e-27, Method: Composition-based stats.
 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEI  433
            P    + + AAKFCYG+NFEI
Sbjct  88   PGGAEAFELAAKFCYGINFEI  108



>ref|XP_006426057.1| hypothetical protein CICLE_v10025164mg [Citrus clementina]
 gb|ESR39297.1| hypothetical protein CICLE_v10025164mg [Citrus clementina]
Length=623

 Score = 93.2 bits (230),  Expect(3) = 8e-27, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+DV V VG  SFSLHKF LV+K  YIRKL+  S EADL+ I 
Sbjct  24   LSTAMKRTSEWIFSQEIPSDVTVHVGGTSFSLHKFPLVSKCGYIRKLVSVSSEADLSVIE  83

Query  358  LSGIPGGPEIFE  393
            +  +PGG E FE
Sbjct  84   IPDVPGGAEAFE  95


 Score = 42.7 bits (99),  Expect(3) = 8e-27, Method: Composition-based stats.
 Identities = 18/30 (60%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDF  533
            NVA LRC AEYL+MT+ Y   NL GR E +
Sbjct  112  NVAGLRCVAEYLEMTEDYAVGNLVGRAEAY  141


 Score = 31.6 bits (70),  Expect(3) = 8e-27, Method: Composition-based stats.
 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEI  433
            P    + + AAKFCYG+NFEI
Sbjct  88   PGGAEAFELAAKFCYGINFEI  108



>ref|XP_009782405.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Nicotiana 
sylvestris]
Length=620

 Score = 90.9 bits (224),  Expect(3) = 1e-26, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 60/84 (71%), Gaps = 3/84 (4%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLI  321
            NM++  K     LS AM+RT  W+FSQEIP+DV V  G ++FSLHKF LV+KS YIRK+I
Sbjct  17   NMSTKKKEL---LSTAMKRTSDWIFSQEIPSDVTVNAGGSAFSLHKFPLVSKSGYIRKII  73

Query  322  MDSKEADLTRINLSGIPGGPEIFE  393
             +S +AD++ + +  IPGG + FE
Sbjct  74   SESNDADVSIVEIPDIPGGSDAFE  97


 Score = 44.7 bits (104),  Expect(3) = 1e-26, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT+ Y   NL GRTE +L++VAL SL+GA+ +L S E LLP
Sbjct  114  NIALLRCTAEYLEMTEDYAVGNLVGRTEAYLNEVALKSLAGAVSILHSSESLLP  167


 Score = 31.2 bits (69),  Expect(3) = 1e-26, Method: Composition-based stats.
 Identities = 11/13 (85%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEIT  436
            AAKFCYG+NFEI+
Sbjct  99   AAKFCYGINFEIS  111



>ref|XP_006380639.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
 gb|ERP58436.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
Length=601

 Score = 95.1 bits (235),  Expect(3) = 1e-26, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  181  SLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINL  360
            S AM+RT +W+FSQEIP+DV V  G ASFSLHKF LV+KS YIRK++ +S +ADL+ I +
Sbjct  10   STAMKRTSEWIFSQEIPSDVTVHAGGASFSLHKFPLVSKSGYIRKMVSESSDADLSEIKI  69

Query  361  SGIPGGPEIFE  393
              +PGG E FE
Sbjct  70   PNVPGGAEAFE  80


 Score = 40.4 bits (93),  Expect(3) = 1e-26, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT+ Y   NL  RT+ +L++VAL SL+GA+ VL   E LLP
Sbjct  97   NIAMLRCVAEYLEMTEDYAVGNLVSRTDAYLNEVALKSLAGAVSVLHLSENLLP  150


 Score = 31.2 bits (69),  Expect(3) = 1e-26, Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYG+NFEI+  
Sbjct  82   AAKFCYGINFEISTE  96



>ref|XP_006339816.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
tuberosum]
Length=596

 Score = 94.7 bits (234),  Expect(3) = 1e-26, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT  W+FSQEIP+DV V  G  SF+LHKF LV+KS YIRKL+ +S +AD++ IN
Sbjct  9    LSSAMKRTSDWIFSQEIPSDVTVNAGGTSFALHKFPLVSKSGYIRKLVSESNDADVSTIN  68

Query  358  LSGIPGGPEIFE  393
            +  IPGG E FE
Sbjct  69   IPDIPGGGEAFE  80


 Score = 41.6 bits (96),  Expect(3) = 1e-26, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAEYL+MT+ Y   NL  RTE + ++VA+ SL+GA+ +L+S E LLP
Sbjct  97   NIALLRCAAEYLEMTEDYAVANLVERTEAYFNEVAIKSLAGAVTILRSSENLLP  150


 Score = 30.4 bits (67),  Expect(3) = 1e-26, Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYG+NFEI+  
Sbjct  82   AAKFCYGINFEISTE  96



>ref|XP_011006799.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Populus euphratica]
Length=599

 Score = 94.7 bits (234),  Expect(3) = 2e-26, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +1

Query  157  LKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKE  336
            + S    LS AM+RT +W+FSQEIP+DV V  G ASFSLHKF LV+K  YIRK++ +S +
Sbjct  1    MSSKKELLSTAMKRTSEWIFSQEIPSDVTVHAGGASFSLHKFPLVSKCGYIRKMVSESSD  60

Query  337  ADLTRINLSGIPGGPEIFE  393
            ADL+ I +  +PGG E FE
Sbjct  61   ADLSEIKIPNVPGGAEAFE  79


 Score = 40.8 bits (94),  Expect(3) = 2e-26, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT+ Y   NL  RT+ +L++VAL SL+GA+ VL   E LLP
Sbjct  96   NIAMLRCVAEYLEMTEDYAAGNLVSRTDAYLNEVALKSLAGAVSVLHLSENLLP  149


 Score = 31.2 bits (69),  Expect(3) = 2e-26, Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYG+NFEI+  
Sbjct  81   AAKFCYGINFEISTE  95



>ref|XP_002970426.1| hypothetical protein SELMODRAFT_231529 [Selaginella moellendorffii]
 gb|EFJ28556.1| hypothetical protein SELMODRAFT_231529 [Selaginella moellendorffii]
Length=603

 Score = 83.2 bits (204),  Expect(3) = 2e-26, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRI  354
            +S A +RT +WV S ++PTDV+V  G  SF+LHKF LV++S  IRKL+  DS+E D++ I
Sbjct  6    VSSAAKRTAEWVMSTDVPTDVLVEAGGVSFALHKFPLVSRSGKIRKLVAGDSRELDVSFI  65

Query  355  NLSGIPGGPEIFE  393
             LS +PGGPE FE
Sbjct  66   KLSDLPGGPEAFE  78


 Score = 50.8 bits (120),  Expect(3) = 2e-26, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCAAEYL MT+ Y D NL  RTE F+ ++A  +LS A+ VL SCE LLP
Sbjct  95   NVATLRCAAEYLDMTEDYGDGNLVARTEAFIDEIATQNLSNAVAVLHSCESLLP  148


 Score = 32.3 bits (72),  Expect(3) = 2e-26, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITV  439
            AAKFCYG+NFEI+V
Sbjct  80   AAKFCYGINFEISV  93



>ref|XP_011012051.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Populus euphratica]
Length=599

 Score = 94.7 bits (234),  Expect(3) = 2e-26, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +1

Query  157  LKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKE  336
            + S    LS AM+RT +W+FSQEIP+DV V  G ASFSLHKF LV+K  YIRK++ +S +
Sbjct  1    MSSKKELLSTAMKRTSEWIFSQEIPSDVTVHAGGASFSLHKFPLVSKCGYIRKMVSESSD  60

Query  337  ADLTRINLSGIPGGPEIFE  393
            ADL+ I +  +PGG E FE
Sbjct  61   ADLSEIKIPNVPGGAEAFE  79


 Score = 40.4 bits (93),  Expect(3) = 2e-26, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT+ Y   NL  RT+ +L++VAL SL+GA+ VL   E LLP
Sbjct  96   NIAMLRCVAEYLEMTEDYAVGNLVSRTDAYLNEVALKSLAGAVSVLHLSENLLP  149


 Score = 31.2 bits (69),  Expect(3) = 2e-26, Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYG+NFEI+  
Sbjct  81   AAKFCYGINFEISTE  95



>emb|CDP02580.1| unnamed protein product [Coffea canephora]
Length=620

 Score = 94.7 bits (234),  Expect(3) = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 59/84 (70%), Gaps = 3/84 (4%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLI  321
            NM+S  K     LS AM+RT +W+FSQEIP+DVIV  G   FSLHKF LV+K  YIRKL+
Sbjct  16   NMSSKKKEL---LSTAMKRTSEWIFSQEIPSDVIVHAGGTPFSLHKFPLVSKCGYIRKLV  72

Query  322  MDSKEADLTRINLSGIPGGPEIFE  393
             +S +ADL+ I +  IPGG E FE
Sbjct  73   SESNDADLSEIEVPDIPGGAEAFE  96


 Score = 39.3 bits (90),  Expect(3) = 2e-26, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL MT++    NL GRTE +L++VAL SL+ A+ +L S E  LP
Sbjct  113  NIAMLRCGAEYLGMTEECAIGNLVGRTEAYLNEVALKSLASAVSILHSTESFLP  166


 Score = 32.3 bits (72),  Expect(3) = 2e-26, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCYG+NFEI+
Sbjct  89   PGGAEAFELAAKFCYGINFEIS  110



>gb|KDO78973.1| hypothetical protein CISIN_1g006971mg [Citrus sinensis]
Length=457

 Score = 92.8 bits (229),  Expect(3) = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 59/84 (70%), Gaps = 3/84 (4%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLI  321
            NM++  K     LS AM+RT +W+FSQEIP+DV V VG  SFSLHKF LV+K  YIRKL+
Sbjct  15   NMSNKKKEL---LSTAMKRTSEWIFSQEIPSDVTVHVGGTSFSLHKFPLVSKCGYIRKLV  71

Query  322  MDSKEADLTRINLSGIPGGPEIFE  393
              S EADL+ I +  +PGG E FE
Sbjct  72   SVSSEADLSVIEIPDVPGGAEAFE  95


 Score = 42.7 bits (99),  Expect(3) = 3e-26, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRC AEYL+MT+ Y   NL GR E +L++VAL+SL+GA+ VL   + LLP
Sbjct  112  NVAGLRCVAEYLEMTEDYAVGNLVGRAEAYLNEVALTSLTGAVTVLHKSQGLLP  165


 Score = 30.0 bits (66),  Expect(3) = 3e-26, Method: Compositional matrix adjust.
 Identities = 11/12 (92%), Positives = 12/12 (100%), Gaps = 0/12 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEI  433
            AAKFCYG+NFEI
Sbjct  97   AAKFCYGINFEI  108



>gb|KJB48680.1| hypothetical protein B456_008G080700 [Gossypium raimondii]
Length=447

 Score = 87.4 bits (215),  Expect(3) = 3e-26, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +1

Query  157  LKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKE  336
            + S    LS AM+RT +W+FSQEIP+DV V VG  SFSLHKF L++KS ++RK++ +S +
Sbjct  16   MSSKKELLSSAMKRTSEWIFSQEIPSDVTVQVGGVSFSLHKFPLISKSGFVRKVVSESND  75

Query  337  ADLTRINLSGIPGGPEIFE  393
            AD + I +  +PGG + FE
Sbjct  76   ADHSIIEIPNVPGGADSFE  94


 Score = 47.0 bits (110),  Expect(3) = 3e-26, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAEYL+MT+ Y   NL GRTE +L++VAL SL+GA+ VL   E LLP
Sbjct  111  NIAMLRCAAEYLEMTEDYAVGNLVGRTEAYLNEVALKSLAGAVSVLHMSESLLP  164


 Score = 31.6 bits (70),  Expect(3) = 3e-26, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 16/24 (67%), Gaps = 0/24 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITVH  442
            P    S + AAKFCYG+NFEI+  
Sbjct  87   PGGADSFELAAKFCYGINFEISTE  110



>ref|XP_002533158.1| Root phototropism protein, putative [Ricinus communis]
 gb|EEF29217.1| Root phototropism protein, putative [Ricinus communis]
Length=621

 Score = 92.8 bits (229),  Expect(3) = 4e-26, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 58/84 (69%), Gaps = 3/84 (4%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLI  321
            NM+S  K     L+ AM+RT +W+FSQEIP+DV V  G  SFSLHKF LV+K  YIRKL+
Sbjct  20   NMSSKKKEL---LTTAMKRTSEWIFSQEIPSDVTVHAGGVSFSLHKFPLVSKCGYIRKLV  76

Query  322  MDSKEADLTRINLSGIPGGPEIFE  393
             +S +ADL  I +  IPGG E FE
Sbjct  77   SESSDADLGEIEIPDIPGGAEAFE  100


 Score = 40.4 bits (93),  Expect(3) = 4e-26, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC A+YL+MT+ Y   NL  R+E +L++VAL SL+GA+ +L   E LLP
Sbjct  117  NIALLRCGADYLEMTEDYAVGNLVARSESYLNEVALKSLAGAVTILHLAENLLP  170


 Score = 32.3 bits (72),  Expect(3) = 4e-26, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCYG+NFEI+
Sbjct  93   PGGAEAFELAAKFCYGINFEIS  114



>ref|XP_010559030.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Tarenaya hassleriana]
Length=588

 Score = 88.6 bits (218),  Expect(3) = 5e-26, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  354
            +S AM+RT +W+ SQEIP+DV   VGEASFSLHKF LV+KS +IRKL+ +S  E+D++ I
Sbjct  9    MSSAMKRTSEWISSQEIPSDVTAHVGEASFSLHKFPLVSKSGFIRKLVSESNNESDISVI  68

Query  355  NLSGIPGGPEIFE  393
             +  IPGG E FE
Sbjct  69   GIHEIPGGAEAFE  81


 Score = 43.9 bits (102),  Expect(3) = 5e-26, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAEYL+MT+++   NL GR E +L++VAL SLS ++ VL   E+LLP
Sbjct  98   NIAMLRCAAEYLEMTEEHSVGNLLGRAEAYLNEVALKSLSSSITVLHKAEDLLP  151


 Score = 32.7 bits (73),  Expect(3) = 5e-26, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = +2

Query  368  FPAALRSSKGAAKFCYGVNFEITVH  442
             P    + + AAKFCYG+NFEIT  
Sbjct  73   IPGGAEAFEMAAKFCYGINFEITTE  97



>ref|XP_010272171.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Nelumbo 
nucifera]
Length=620

 Score = 85.9 bits (211),  Expect(3) = 6e-26, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 59/84 (70%), Gaps = 4/84 (5%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLI  321
            NM+S  K     LS AM+RT +W+FSQEIP+DV V  G ASFSLHKF LV+K  YIRKL+
Sbjct  15   NMSSKKKQL---LSTAMKRTSEWIFSQEIPSDVTVHAGGASFSLHKFPLVSKCGYIRKLV  71

Query  322  MDSKEADLTRINLSGIPGGPEIFE  393
             ++ +A ++ I L  +PGG E FE
Sbjct  72   SEASDAAVSVIELPDVPGG-EAFE  94


 Score = 47.4 bits (111),  Expect(3) = 6e-26, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT+ Y   NL GRTED+L++VAL SLSGA+ VL + E LLP
Sbjct  111  NIAMLRCMAEYLEMTEDYAVGNLVGRTEDYLNEVALKSLSGAISVLHASENLLP  164


 Score = 31.2 bits (69),  Expect(3) = 6e-26, Method: Composition-based stats.
 Identities = 11/13 (85%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEIT  436
            AAKFCYG+NFEI+
Sbjct  96   AAKFCYGINFEIS  108



>gb|KDP32052.1| hypothetical protein JCGZ_12513 [Jatropha curcas]
Length=622

 Score = 92.0 bits (227),  Expect(3) = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 59/84 (70%), Gaps = 3/84 (4%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLI  321
            NM++  K     LS  M+RT +W+FSQEIP+DV V  G ASFSLHKF LV+K  YIRKL+
Sbjct  16   NMSAKKKEL---LSTVMKRTSEWIFSQEIPSDVTVLAGGASFSLHKFPLVSKCGYIRKLV  72

Query  322  MDSKEADLTRINLSGIPGGPEIFE  393
             +  +ADLT I++  IPGG E FE
Sbjct  73   SECNDADLTEIHIPDIPGGGEAFE  96


 Score = 40.8 bits (94),  Expect(3) = 1e-25, Method: Composition-based stats.
 Identities = 17/30 (57%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDF  533
            N+A LRC AEYL+MT+ Y   NL  RTE +
Sbjct  113  NIAMLRCVAEYLEMTEDYAVGNLVARTEAY  142


 Score = 30.8 bits (68),  Expect(3) = 1e-25, Method: Composition-based stats.
 Identities = 11/12 (92%), Positives = 12/12 (100%), Gaps = 0/12 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEI  433
            AAKFCYG+NFEI
Sbjct  98   AAKFCYGINFEI  109



>ref|XP_010679598.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679599.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679600.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679601.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679602.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679603.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679604.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=624

 Score = 87.0 bits (214),  Expect(3) = 1e-25, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            L+ AM+RT +W+ SQEIP+DV + + +ASFSLHKF LV+KS YI+KL+ +S ++++  + 
Sbjct  14   LTSAMKRTSEWIISQEIPSDVTINIDDASFSLHKFPLVSKSGYIKKLLSESNDSEICNLE  73

Query  358  LSGIPGGPEIFE  393
            +  IPGG E FE
Sbjct  74   IHDIPGGAEAFE  85


 Score = 45.4 bits (106),  Expect(3) = 1e-25, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT+ Y   NL GRTE +L++VA+ SLS    +L + E LLP
Sbjct  102  NIAMLRCVAEYLEMTEDYAVGNLVGRTETYLNEVAVKSLSSCASILLTSENLLP  155


 Score = 31.6 bits (70),  Expect(3) = 1e-25, Method: Composition-based stats.
 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEI  433
            P    + + AAKFCYG+NFEI
Sbjct  78   PGGAEAFELAAKFCYGINFEI  98



>ref|XP_004231910.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
lycopersicum]
Length=596

 Score = 93.2 bits (230),  Expect(3) = 1e-25, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +1

Query  187  AMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSG  366
            AM+RT  W+FSQEIP+DV V  G  SF+LHKF LV+KS YIRKLI +S EAD++ I++  
Sbjct  12   AMKRTSDWIFSQEIPSDVTVNAGGTSFTLHKFPLVSKSGYIRKLISESNEADVSTIDIPD  71

Query  367  IPGGPEIFE  393
            IPGG E FE
Sbjct  72   IPGGGEAFE  80


 Score = 40.0 bits (92),  Expect(3) = 1e-25, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT+ Y   NL  RTE + ++VA++SL+GA+ +L+S E LLP
Sbjct  97   NIALLRCVAEYLEMTEDYAVANLVERTEAYFNEVAITSLAGAVTILRSSENLLP  150


 Score = 30.4 bits (67),  Expect(3) = 1e-25, Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYG+NFEI+  
Sbjct  82   AAKFCYGINFEISTE  96



>ref|XP_010679597.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=634

 Score = 86.7 bits (213),  Expect(3) = 1e-25, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            L+ AM+RT +W+ SQEIP+DV + + +ASFSLHKF LV+KS YI+KL+ +S ++++  + 
Sbjct  24   LTSAMKRTSEWIISQEIPSDVTINIDDASFSLHKFPLVSKSGYIKKLLSESNDSEICNLE  83

Query  358  LSGIPGGPEIFE  393
            +  IPGG E FE
Sbjct  84   IHDIPGGAEAFE  95


 Score = 45.1 bits (105),  Expect(3) = 1e-25, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT+ Y   NL GRTE +L++VA+ SLS    +L + E LLP
Sbjct  112  NIAMLRCVAEYLEMTEDYAVGNLVGRTETYLNEVAVKSLSSCASILLTSENLLP  165


 Score = 31.6 bits (70),  Expect(3) = 1e-25, Method: Composition-based stats.
 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEI  433
            P    + + AAKFCYG+NFEI
Sbjct  88   PGGAEAFELAAKFCYGINFEI  108



>ref|XP_008238282.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Prunus 
mume]
 ref|XP_008238290.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Prunus 
mume]
Length=624

 Score = 92.4 bits (228),  Expect(3) = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 59/84 (70%), Gaps = 3/84 (4%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLI  321
            NM S  K     LS A++RT +W+FSQEIP+DV + VG  SFSLHKF L++K  YIRKLI
Sbjct  17   NMTSKKKEL---LSSALKRTSEWIFSQEIPSDVNIHVGGVSFSLHKFPLISKCGYIRKLI  73

Query  322  MDSKEADLTRINLSGIPGGPEIFE  393
             +S +ADL+ I L  +PGG E FE
Sbjct  74   SESSDADLSVIELPDVPGGAEAFE  97


 Score = 38.5 bits (88),  Expect(3) = 2e-25, Method: Composition-based stats.
 Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDF  533
            N+A LRC AEYL MT+ +   NL GRT+ +
Sbjct  114  NIAMLRCVAEYLVMTEDHAVGNLVGRTDAY  143


 Score = 32.3 bits (72),  Expect(3) = 2e-25, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCYG+NFEI+
Sbjct  90   PGGAEAFELAAKFCYGINFEIS  111



>ref|XP_006590635.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Glycine max]
Length=628

 Score = 88.6 bits (218),  Expect(3) = 2e-25, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 57/82 (70%), Gaps = 10/82 (12%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHK----------FMLVAKSNYIRKLIMD  327
            LS AM+RT +W+FSQEIP+DV V VGEASFSLHK          F LV+K  YIRKL+ +
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVNVQVGEASFSLHKVANQFKYDSLFPLVSKCGYIRKLVSE  83

Query  328  SKEADLTRINLSGIPGGPEIFE  393
            S +AD++ I L  +PGG E FE
Sbjct  84   SNDADVSFIELPEVPGGAEAFE  105


 Score = 42.7 bits (99),  Expect(3) = 2e-25, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT+ Y   NL GRT+ +L++VAL +++GA+ +L   E LLP
Sbjct  122  NIATLRCVAEYLEMTEDYSVGNLVGRTDAYLNEVALKTIAGAVSILHMSENLLP  175


 Score = 31.6 bits (70),  Expect(3) = 2e-25, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITV  439
            P    + + AAKFCYG+NF+I V
Sbjct  98   PGGAEAFELAAKFCYGINFDINV  120



>gb|KJB43880.1| hypothetical protein B456_007G221600 [Gossypium raimondii]
Length=611

 Score = 87.0 bits (214),  Expect(3) = 2e-25, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 59/84 (70%), Gaps = 3/84 (4%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLI  321
            NM++  K     +S AM+RT +W+FSQEIP+DV V V   SFSLHKF LV+K  YIRK++
Sbjct  15   NMSAKKKEL---MSTAMKRTSEWIFSQEIPSDVTVQVAGVSFSLHKFPLVSKCGYIRKVV  71

Query  322  MDSKEADLTRINLSGIPGGPEIFE  393
             +S +AD++ I +  +PGG E FE
Sbjct  72   SESNDADVSVIVIPDVPGGAESFE  95


 Score = 42.7 bits (99),  Expect(3) = 2e-25, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+AALRC AEYL+MT+ Y   +L  RTE FL++VAL SL+GA+ VL + E LLP
Sbjct  112  NIAALRCVAEYLEMTEDYAVGSLVERTEAFLNEVALQSLAGAISVLHASENLLP  165


 Score = 32.7 bits (73),  Expect(3) = 2e-25, Method: Composition-based stats.
 Identities = 13/21 (62%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEI  433
            P    S + AAKFCYG+NFEI
Sbjct  88   PGGAESFELAAKFCYGINFEI  108



>gb|AES70802.2| root phototropism-like protein [Medicago truncatula]
Length=526

 Score = 63.5 bits (153),  Expect(3) = 2e-25, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCAAE+LQMTD+YCDNNLAGRT++FLS+VA  +L+G++ VLKSC  LLP
Sbjct  54   NVAVLRCAAEFLQMTDQYCDNNLAGRTDEFLSKVAFFTLTGSVAVLKSCHHLLP  107


 Score = 62.4 bits (150),  Expect(3) = 2e-25, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  283  MLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERGGE  405
            MLVAKSNYIRKLIM+S E  LTRI+LS IPGG  IFE+  +
Sbjct  1    MLVAKSNYIRKLIMESDETHLTRIDLSDIPGGSGIFEKAAK  41


 Score = 36.6 bits (83),  Expect(3) = 2e-25, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  39   AAKFCYGVNFEITVH  53



>ref|XP_004288469.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=623

 Score = 90.5 bits (223),  Expect(3) = 2e-25, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 60/84 (71%), Gaps = 3/84 (4%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLI  321
            NM+S  K     L+ A++RT +W+FSQEIP+DV V VGE SFSLHKF LV+K  YIRKL+
Sbjct  18   NMSSKKKEL---LTSALKRTSEWIFSQEIPSDVSVRVGEVSFSLHKFPLVSKCGYIRKLV  74

Query  322  MDSKEADLTRINLSGIPGGPEIFE  393
             +S + +++ I L  +PGG E FE
Sbjct  75   SESTDDEISVIELPDVPGGAEAFE  98


 Score = 40.0 bits (92),  Expect(3) = 2e-25, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC +EYL MT++Y   NL GRT+ +L++VAL SL+GA+ VL + E  LP
Sbjct  115  NIAMLRCVSEYLLMTEEYAIGNLVGRTDAYLNEVALKSLAGAVSVLHTAESFLP  168


 Score = 32.3 bits (72),  Expect(3) = 2e-25, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCYG+NFEI+
Sbjct  91   PGGAEAFELAAKFCYGINFEIS  112



>ref|XP_007208165.1| hypothetical protein PRUPE_ppa002888mg [Prunus persica]
 gb|EMJ09364.1| hypothetical protein PRUPE_ppa002888mg [Prunus persica]
Length=624

 Score = 92.4 bits (228),  Expect(3) = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 59/84 (70%), Gaps = 3/84 (4%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLI  321
            NM S  K     LS A++RT +W+FSQEIP+DV + VG  SFSLHKF L++K  YIRKLI
Sbjct  17   NMTSKKKEL---LSSALKRTSEWIFSQEIPSDVNIHVGGVSFSLHKFPLISKCGYIRKLI  73

Query  322  MDSKEADLTRINLSGIPGGPEIFE  393
             +S +ADL+ I L  +PGG E FE
Sbjct  74   SESSDADLSVIELPDVPGGAEAFE  97


 Score = 37.0 bits (84),  Expect(3) = 5e-25, Method: Composition-based stats.
 Identities = 16/30 (53%), Positives = 20/30 (67%), Gaps = 0/30 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDF  533
            N+A LRC AEYL MT+     NL GRT+ +
Sbjct  114  NIAMLRCVAEYLVMTEDNAVGNLVGRTDAY  143


 Score = 32.3 bits (72),  Expect(3) = 5e-25, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCYG+NFEI+
Sbjct  90   PGGAEAFELAAKFCYGINFEIS  111



>gb|AES90666.2| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=595

 Score = 84.3 bits (207),  Expect(3) = 5e-25, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = +1

Query  190  MERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEA--DLTRINLS  363
            M+RT +W +SQEIP+DV + +GEAS+SLHKF L++KS YIRKLI +S +A  D+  I L 
Sbjct  1    MKRTSEWNYSQEIPSDVAIQIGEASYSLHKFPLISKSGYIRKLISESSDAVDDVPLIELI  60

Query  364  GIPGGPEIFE  393
             +PGG E FE
Sbjct  61   DVPGGSEAFE  70


 Score = 44.3 bits (103),  Expect(3) = 5e-25, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT+ Y   NL GRT+ +L++VAL S+SGA+ +L + E LLP
Sbjct  87   NIAMLRCVAEYLEMTEDYSVGNLVGRTDSYLNEVALKSMSGAISILHTSETLLP  140


 Score = 32.7 bits (73),  Expect(3) = 5e-25, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYG+NFEI+V 
Sbjct  72   AAKFCYGINFEISVE  86



>ref|XP_010905282.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Elaeis guineensis]
Length=609

 Score = 80.9 bits (198),  Expect(3) = 7e-25, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+ SQEIP+D+ +  G ++F+LHKF LV+K  YIR+L+ ++ +++++ I 
Sbjct  22   LSTAMKRTSEWILSQEIPSDITIHAGGSTFALHKFPLVSKCGYIRRLVSEANDSNMSVIE  81

Query  358  LSGIPGGPEIFE  393
            +  +PGG E FE
Sbjct  82   IPDVPGGSEAFE  93


 Score = 46.6 bits (109),  Expect(3) = 7e-25, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAE+L+MT+ Y   NL  RTED+L +VAL SLSGA+ +L+  E+LLP
Sbjct  110  NIAMLRCAAEHLEMTEDYAAGNLVNRTEDYLEEVALLSLSGAVTLLQKSEDLLP  163


 Score = 33.5 bits (75),  Expect(3) = 7e-25, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITV  439
            P    + + AAKFCYG+NFEIT+
Sbjct  86   PGGSEAFELAAKFCYGINFEITM  108



>gb|KJB43881.1| hypothetical protein B456_007G221600 [Gossypium raimondii]
Length=437

 Score = 86.7 bits (213),  Expect(3) = 7e-25, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 59/84 (70%), Gaps = 3/84 (4%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLI  321
            NM++  K     +S AM+RT +W+FSQEIP+DV V V   SFSLHKF LV+K  YIRK++
Sbjct  15   NMSAKKKEL---MSTAMKRTSEWIFSQEIPSDVTVQVAGVSFSLHKFPLVSKCGYIRKVV  71

Query  322  MDSKEADLTRINLSGIPGGPEIFE  393
             +S +AD++ I +  +PGG E FE
Sbjct  72   SESNDADVSVIVIPDVPGGAESFE  95


 Score = 43.1 bits (100),  Expect(3) = 7e-25, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+AALRC AEYL+MT+ Y   +L  RTE FL++VAL SL+GA+ VL + E LLP
Sbjct  112  NIAALRCVAEYLEMTEDYAVGSLVERTEAFLNEVALQSLAGAISVLHASENLLP  165


 Score = 31.2 bits (69),  Expect(3) = 7e-25, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITVH  442
            P    S + AAKFCYG+NFEI   
Sbjct  88   PGGAESFELAAKFCYGINFEINTE  111



>ref|XP_004511862.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X6 [Cicer arietinum]
Length=627

 Score = 96.7 bits (239),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+DV V VGEASFS+HKF LV+K  YIRKL+ +S +AD+  I 
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVKVRVGEASFSIHKFPLVSKCGYIRKLVSESGDADVPLIE  83

Query  358  LSGIPGGPEIFE  393
            LS +PGG E FE
Sbjct  84   LSDVPGGAEAFE  95


 Score = 43.9 bits (102),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT++Y   NL GRT+ +L+ VAL +++GA+ +L   E LLP
Sbjct  112  NIATLRCVAEYLEMTEEYAVGNLVGRTDAYLNDVALKTIAGAVSILHMSESLLP  165



>ref|XP_004511860.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X4 [Cicer arietinum]
 ref|XP_004511861.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X5 [Cicer arietinum]
Length=628

 Score = 96.7 bits (239),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS AM+RT +W+FSQEIP+DV V VGEASFS+HKF LV+K  YIRKL+ +S +AD+  I 
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVKVRVGEASFSIHKFPLVSKCGYIRKLVSESGDADVPLIE  83

Query  358  LSGIPGGPEIFE  393
            LS +PGG E FE
Sbjct  84   LSDVPGGAEAFE  95


 Score = 43.9 bits (102),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT++Y   NL GRT+ +L+ VAL +++GA+ +L   E LLP
Sbjct  112  NIATLRCVAEYLEMTEEYAVGNLVGRTDAYLNDVALKTIAGAVSILHMSESLLP  165



>ref|XP_010559028.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Tarenaya hassleriana]
Length=589

 Score = 83.6 bits (205),  Expect(3) = 1e-24, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 2/74 (3%)
 Frame = +1

Query  178  LSLAMERTGQW-VFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTR  351
            +S AM+RT +W + SQEIP+DV   VGEASFSLHKF LV+KS +IRKL+ +S  E+D++ 
Sbjct  9    MSSAMKRTSEWWISSQEIPSDVTAHVGEASFSLHKFPLVSKSGFIRKLVSESNNESDISV  68

Query  352  INLSGIPGGPEIFE  393
            I +  IPGG E FE
Sbjct  69   IGIHEIPGGAEAFE  82


 Score = 43.9 bits (102),  Expect(3) = 1e-24, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAEYL+MT+++   NL GR E +L++VAL SLS ++ VL   E+LLP
Sbjct  99   NIAMLRCAAEYLEMTEEHSVGNLLGRAEAYLNEVALKSLSSSITVLHKAEDLLP  152


 Score = 32.7 bits (73),  Expect(3) = 1e-24, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = +2

Query  368  FPAALRSSKGAAKFCYGVNFEITVH  442
             P    + + AAKFCYG+NFEIT  
Sbjct  74   IPGGAEAFEMAAKFCYGINFEITTE  98



>ref|XP_002866705.1| signal transducer [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42964.1| signal transducer [Arabidopsis lyrata subsp. lyrata]
Length=604

 Score = 88.2 bits (217),  Expect(3) = 2e-24, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  354
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+ +S K++D T I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGFIKKLVSESNKDSDSTVI  68

Query  355  NLSGIPGGPEIFE  393
            N++ IPGG E FE
Sbjct  69   NITDIPGGSEAFE  81


 Score = 42.4 bits (98),  Expect(3) = 2e-24, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAEYL+MT+++   NL  R E +L +VAL SLS ++ VL   EELLP
Sbjct  98   NIAMLRCAAEYLEMTEEHSVENLVVRAESYLDEVALKSLSSSITVLHKSEELLP  151


 Score = 29.3 bits (64),  Expect(3) = 2e-24, Method: Composition-based stats.
 Identities = 10/22 (45%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCYG+NF+++
Sbjct  74   PGGSEAFELAAKFCYGINFDMS  95



>ref|XP_009342777.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Pyrus 
x bretschneideri]
Length=629

 Score = 88.6 bits (218),  Expect(3) = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 61/85 (72%), Gaps = 4/85 (5%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLI  321
            NM+S  K     LS A++RT +W+FSQEIP+D+ + VG  SFSLHKF L++K  +IRKLI
Sbjct  21   NMSSKKKEL---LSSALKRTSEWIFSQEIPSDISINVGGVSFSLHKFPLISKCGHIRKLI  77

Query  322  MDSKE-ADLTRINLSGIPGGPEIFE  393
             +S + ADL+ I LS +PGG E FE
Sbjct  78   SESSDAADLSIIELSDVPGGSEAFE  102


 Score = 38.9 bits (89),  Expect(3) = 2e-24, Method: Composition-based stats.
 Identities = 16/30 (53%), Positives = 20/30 (67%), Gaps = 0/30 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDF  533
            N+A LRC AEYL MT+ Y   NL GR + +
Sbjct  119  NIAMLRCVAEYLLMTEDYAVGNLVGRADAY  148


 Score = 32.0 bits (71),  Expect(3) = 2e-24, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCYG+NFEI+
Sbjct  95   PGGSEAFELAAKFCYGINFEIS  116



>gb|KHN12984.1| BTB/POZ domain-containing protein [Glycine soja]
Length=640

 Score = 84.0 bits (206),  Expect(3) = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 57/94 (61%), Gaps = 22/94 (23%)
 Frame = +1

Query  178  LSLAMERTGQW----------------------VFSQEIPTDVIVGVGEASFSLHKFMLV  291
            LS AM+RT +W                      +FSQEIP+DV V VGEASFSLHKF LV
Sbjct  24   LSSAMKRTSEWYASCPLNETNTLVAFMSNVHNLIFSQEIPSDVNVQVGEASFSLHKFPLV  83

Query  292  AKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFE  393
            +K  YIRKL+ +S +AD++ I L  +PGG E FE
Sbjct  84   SKCGYIRKLVSESNDADVSFIELPEVPGGAEAFE  117


 Score = 42.7 bits (99),  Expect(3) = 4e-24, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT+ Y   NL GRT+ +L++VAL +++GA+ +L   E LLP
Sbjct  134  NIATLRCVAEYLEMTEDYSVGNLVGRTDAYLNEVALKTIAGAVSILHMSENLLP  187


 Score = 31.6 bits (70),  Expect(3) = 4e-24, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITV  439
            P    + + AAKFCYG+NF+I V
Sbjct  110  PGGAEAFELAAKFCYGINFDINV  132



>ref|XP_004233453.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Solanum lycopersicum]
Length=605

 Score = 86.7 bits (213),  Expect(3) = 5e-24, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS  M+RT +W+ SQ+IP+D+ + VG  SF+LHKF LV+K  YIRKL+  S +A L+ I 
Sbjct  22   LSNVMKRTSEWILSQDIPSDITIHVGRTSFALHKFPLVSKCGYIRKLVSKSNDAKLSTIE  81

Query  358  LSGIPGGPEIFE  393
            +  IPGGPE FE
Sbjct  82   IPDIPGGPEAFE  93


 Score = 43.1 bits (100),  Expect(3) = 5e-24, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A +RC AEYL+MTD Y   NL G TE +L++V L S++ ++ +L S E+LLP
Sbjct  110  NIALIRCVAEYLEMTDDYAVGNLVGLTETYLTEVGLKSIASSVSILHSSEKLLP  163


 Score = 28.5 bits (62),  Expect(3) = 5e-24, Method: Composition-based stats.
 Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCY +NFEI+
Sbjct  86   PGGPEAFELAAKFCYEINFEIS  107



>ref|XP_004509079.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Cicer arietinum]
 ref|XP_004509080.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Cicer arietinum]
Length=598

 Score = 80.9 bits (198),  Expect(3) = 7e-24, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = +1

Query  190  MERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMD-SKEADLTRINLSG  366
            M+RT +W +SQEIP+DV + +GEAS+SLHKF L++KS YIRK I + S  A++  I L  
Sbjct  1    MKRTSEWNYSQEIPSDVTIQIGEASYSLHKFPLISKSGYIRKFISEYSDAAEVPTIELFD  60

Query  367  IPGGPEIFE  393
            +PGG E FE
Sbjct  61   VPGGSEAFE  69


 Score = 43.5 bits (101),  Expect(3) = 7e-24, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT+ Y   NL GRT+ +L++VAL S SGA+ +L   E LLP
Sbjct  86   NIAMLRCVAEYLEMTEDYSVGNLVGRTDSYLNEVALKSFSGAISILHISETLLP  139


 Score = 32.7 bits (73),  Expect(3) = 7e-24, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYG+NFEI+V 
Sbjct  71   AAKFCYGINFEISVE  85



>gb|KHG27515.1| hypothetical protein F383_13864 [Gossypium arboreum]
Length=471

 Score = 90.5 bits (223),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +1

Query  157  LKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKE  336
            + S    LS AM+RT +W+FSQEIP+DV V VG  SFSLHKF L++KS Y+RK++ +S +
Sbjct  16   MSSKKELLSTAMKRTSEWIFSQEIPSDVTVQVGGVSFSLHKFPLISKSGYVRKVVTESND  75

Query  337  ADLTRINLSGIPGGPEIFE  393
            AD + I +  +PGG + FE
Sbjct  76   ADHSIIEIPNVPGGADSFE  94


 Score = 47.0 bits (110),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAEYL+MT+ Y   NL GRTE +L++VAL SL+GA+ VL   E LLP
Sbjct  111  NIAMLRCAAEYLEMTEDYAVGNLVGRTEAYLNEVALKSLAGAVSVLHMSESLLP  164



>ref|XP_008354715.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Malus 
domestica]
Length=626

 Score = 87.8 bits (216),  Expect(3) = 7e-24, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKE-ADLTRI  354
            LS A++RT +W+FSQEIP+D+ + VG  SFSLHKF L++K  +IRKLI +S + ADL+ I
Sbjct  27   LSSALKRTSEWIFSQEIPSDISINVGGVSFSLHKFPLISKCGHIRKLISESSDAADLSVI  86

Query  355  NLSGIPGGPEIFE  393
             LS +PGG E FE
Sbjct  87   ELSDVPGGSEAFE  99


 Score = 38.1 bits (87),  Expect(3) = 7e-24, Method: Composition-based stats.
 Identities = 16/30 (53%), Positives = 20/30 (67%), Gaps = 0/30 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDF  533
            N+A LRC AEYL MT+ Y   NL GR + +
Sbjct  116  NIAMLRCVAEYLLMTEDYGVGNLVGRADAY  145


 Score = 32.0 bits (71),  Expect(3) = 7e-24, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCYG+NFEI+
Sbjct  92   PGGSEAFELAAKFCYGINFEIS  113



>ref|XP_010922790.1| PREDICTED: root phototropism protein 2 [Elaeis guineensis]
Length=577

 Score = 77.4 bits (189),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 63/83 (76%), Gaps = 3/83 (4%)
 Frame = +1

Query  157  LKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKE  336
            L S+++RL  AMERTGQW+ SQ+I TD+I+ +G+ SF LHKF+LVAKS YIR+ IMDS  
Sbjct  3    LSSSSSRLPSAMERTGQWILSQDIQTDIIIDIGDVSFPLHKFILVAKSGYIRRKIMDS--  60

Query  337  ADLTRINLSGIPGGPEIFERGGE  405
             D  RINLS +PGG E FE+  +
Sbjct  61   -DDGRINLSEVPGGVEAFEKAAK  82


 Score = 59.7 bits (143),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NV  LRCAAEYL+MT++YC+ NLAGRTE+FL+Q AL +L GA+++L+SCE+LLP
Sbjct  95   NVVVLRCAAEYLEMTERYCEGNLAGRTEEFLAQAALKTLPGAVILLQSCEDLLP  148



>ref|XP_006364419.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
tuberosum]
Length=602

 Score = 84.7 bits (208),  Expect(3) = 1e-23, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS  M+RT +W+ SQ+IP+D+ + VG  SFSLHKF LV+K  YIRKL+  S +A L+ I 
Sbjct  22   LSNVMKRTSEWILSQDIPSDITIHVGRTSFSLHKFPLVSKCGYIRKLVSKSSDAKLSAIE  81

Query  358  LSGIPGGPEIFE  393
            +  IPGG E FE
Sbjct  82   IPDIPGGAEAFE  93


 Score = 44.3 bits (103),  Expect(3) = 1e-23, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A +RC AEYL+MTD+Y   NL G TE +L++V L S++ ++ +L S E+LLP
Sbjct  110  NIALIRCVAEYLEMTDEYAVGNLVGLTEAYLNEVGLKSIASSVSILHSSEKLLP  163


 Score = 27.7 bits (60),  Expect(3) = 1e-23, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEI  433
            AAKFCY +NFEI
Sbjct  95   AAKFCYDINFEI  106



>ref|XP_010939121.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Elaeis 
guineensis]
Length=606

 Score = 77.8 bits (190),  Expect(3) = 2e-23, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS  M+RT +W+ SQE+P+D+ V  G A+F+LHKF L++K  YIR+L+ ++ +++++ I 
Sbjct  20   LSTTMKRTSEWILSQEVPSDITVHAGGATFALHKFPLISKCGYIRRLVSEANDSNISLIE  79

Query  358  LSGIPGGPEIF  390
            +  +PGG E F
Sbjct  80   IPDVPGGAEAF  90


 Score = 45.4 bits (106),  Expect(3) = 2e-23, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT+ Y   NL  RTE FL +VAL SL  A+ VL   EELLP
Sbjct  108  NIAMLRCVAEYLEMTEDYVVGNLVSRTEIFLEEVALMSLPDAVTVLHKSEELLP  161


 Score = 32.7 bits (73),  Expect(3) = 2e-23, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    +   AAKFCYG+NFEIT
Sbjct  84   PGGAEAFGFAAKFCYGINFEIT  105



>ref|XP_010028106.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Eucalyptus grandis]
Length=615

 Score = 89.0 bits (219),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS  MERT  W+FSQEIP+DV V     SF+LHKF LV++   IRKL+ +S EADL+ I 
Sbjct  21   LSTVMERTSAWIFSQEIPSDVTVHAAGTSFALHKFPLVSRCGCIRKLVSESSEADLSNIE  80

Query  358  LSGIPGGPEIFE  393
            L GIPGG E FE
Sbjct  81   LVGIPGGAEAFE  92


 Score = 45.8 bits (107),  Expect(2) = 4e-23, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAEYL+MT+ Y   NL GRTE +L +VAL S++GA+ VL   E LLP
Sbjct  109  NIAMLRCAAEYLEMTEDYAVGNLVGRTEAYLKEVALKSIAGAITVLHMTESLLP  162



>ref|XP_010028107.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Eucalyptus grandis]
 gb|KCW54768.1| hypothetical protein EUGRSUZ_I00715 [Eucalyptus grandis]
Length=614

 Score = 89.0 bits (219),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS  MERT  W+FSQEIP+DV V     SF+LHKF LV++   IRKL+ +S EADL+ I 
Sbjct  21   LSTVMERTSAWIFSQEIPSDVTVHAAGTSFALHKFPLVSRCGCIRKLVSESSEADLSNIE  80

Query  358  LSGIPGGPEIFE  393
            L GIPGG E FE
Sbjct  81   LVGIPGGAEAFE  92


 Score = 45.8 bits (107),  Expect(2) = 4e-23, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAEYL+MT+ Y   NL GRTE +L +VAL S++GA+ VL   E LLP
Sbjct  109  NIAMLRCAAEYLEMTEDYAVGNLVGRTEAYLKEVALKSIAGAITVLHMTESLLP  162



>gb|KFK28391.1| hypothetical protein AALP_AA8G509000 [Arabis alpina]
Length=604

 Score = 82.4 bits (202),  Expect(3) = 5e-23, Method: Composition-based stats.
 Identities = 39/73 (53%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  354
             S AM+RT +W+ SQE+ +DV V +GEASFSLHKF L++K  +I+KL+ +SK +AD T +
Sbjct  9    FSSAMKRTSEWISSQEVSSDVTVHIGEASFSLHKFPLLSKCGFIKKLVSESKTDADSTIV  68

Query  355  NLSGIPGGPEIFE  393
             +  IPGG E FE
Sbjct  69   KIPDIPGGSEAFE  81


 Score = 43.9 bits (102),  Expect(3) = 5e-23, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAEYL+MT+++   NL  RTE +L++VAL SLS ++ VL   EELLP
Sbjct  98   NIAMLRCAAEYLEMTEEHSVENLVVRTEAYLNEVALKSLSSSITVLHKSEELLP  151


 Score = 28.5 bits (62),  Expect(3) = 5e-23, Method: Composition-based stats.
 Identities = 10/21 (48%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEI  433
            P    + + AAKFCYG+NF++
Sbjct  74   PGGSEAFELAAKFCYGINFDM  94



>ref|NP_680473.2| phototropic-responsive NPH3-like protein [Arabidopsis thaliana]
 sp|Q66GP0.2|Y5738_ARATH RecName: Full=BTB/POZ domain-containing protein At5g67385 [Arabidopsis 
thaliana]
 gb|AED98336.1| phototropic-responsive NPH3-like protein [Arabidopsis thaliana]
Length=604

 Score = 84.7 bits (208),  Expect(3) = 7e-23, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMD-SKEADLTRI  354
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+ + SK++D T I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLMSKCGFIKKLVSESSKDSDSTVI  68

Query  355  NLSGIPGGPEIFE  393
             +  IPGG E FE
Sbjct  69   KIPDIPGGSEAFE  81


 Score = 40.0 bits (92),  Expect(3) = 7e-23, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAEYL+MT+++   NL  R E +L++VAL SLS ++ VL   E+LLP
Sbjct  98   NIAMLRCAAEYLEMTEEHSVENLVVRAEAYLNEVALKSLSSSITVLHKSEKLLP  151


 Score = 29.3 bits (64),  Expect(3) = 7e-23, Method: Composition-based stats.
 Identities = 10/22 (45%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCYG+NF+++
Sbjct  74   PGGSEAFELAAKFCYGINFDMS  95



>gb|AAU05485.1| At5g67385 [Arabidopsis thaliana]
 gb|AAU95431.1| At5g67385 [Arabidopsis thaliana]
Length=604

 Score = 84.7 bits (208),  Expect(3) = 7e-23, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMD-SKEADLTRI  354
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+ + SK++D T I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLMSKCGFIKKLVSESSKDSDSTVI  68

Query  355  NLSGIPGGPEIFE  393
             +  IPGG E FE
Sbjct  69   KIPDIPGGSEAFE  81


 Score = 40.0 bits (92),  Expect(3) = 7e-23, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAEYL+MT+++   NL  R E +L++VAL SLS ++ VL   E+LLP
Sbjct  98   NIAMLRCAAEYLEMTEEHSVENLVVRAEAYLNEVALKSLSSSITVLHKSEKLLP  151


 Score = 29.3 bits (64),  Expect(3) = 7e-23, Method: Composition-based stats.
 Identities = 10/22 (45%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCYG+NF+++
Sbjct  74   PGGSEAFELAAKFCYGINFDMS  95



>ref|XP_010277091.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Nelumbo nucifera]
Length=594

 Score = 75.5 bits (184),  Expect(3) = 7e-23, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  211  VFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF  390
            +FSQEIP+D+ V  G ASFSLHKF LV+K  YIRKL+ +  +AD++ + L  +PGG E F
Sbjct  9    IFSQEIPSDITVHAGGASFSLHKFPLVSKCGYIRKLVSEDSDADVSVVELPDVPGGEEAF  68

Query  391  E  393
            E
Sbjct  69   E  69


 Score = 48.1 bits (113),  Expect(3) = 7e-23, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT+ Y   NL GRTED+L++VAL SL+GA+ VL + E LLP
Sbjct  86   NIATLRCVAEYLEMTEDYAVGNLVGRTEDYLNEVALKSLAGAISVLHTSENLLP  139


 Score = 30.4 bits (67),  Expect(3) = 7e-23, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEIT  436
            AAKFCYG+NFEI+
Sbjct  71   AAKFCYGINFEIS  83



>ref|XP_007155848.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 ref|XP_007155849.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 gb|ESW27842.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 gb|ESW27843.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
Length=591

 Score = 81.6 bits (200),  Expect(3) = 9e-23, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +1

Query  190  MERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGI  369
            M+RT  W FS EIP+DV V VGE SFSLHKF LV+K  YI KL+ +S   D++ I L  +
Sbjct  1    MKRTSGWAFSHEIPSDVTVQVGEVSFSLHKFPLVSKCGYIEKLVSESSGEDVSFIELYDV  60

Query  370  PGGPEIFE  393
            PGG E FE
Sbjct  61   PGGAEAFE  68


 Score = 40.4 bits (93),  Expect(3) = 9e-23, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDF  533
            N+A LRC AEYL+MT+ Y   NL GR + +
Sbjct  85   NIAMLRCVAEYLEMTEDYSVGNLVGRADSY  114


 Score = 31.6 bits (70),  Expect(3) = 9e-23, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            A KFCYGVNFEI+V 
Sbjct  70   ATKFCYGVNFEISVE  84



>ref|XP_006380638.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
 gb|ERP58435.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
Length=643

 Score = 80.9 bits (198),  Expect(3) = 9e-23, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  211  VFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF  390
            +FSQEIP+DV V  G ASFSLHKF LV+KS YIRK++ +S +ADL+ I +  +PGG E F
Sbjct  62   IFSQEIPSDVTVHAGGASFSLHKFPLVSKSGYIRKMVSESSDADLSEIKIPNVPGGAEAF  121

Query  391  E  393
            E
Sbjct  122  E  122


 Score = 40.4 bits (93),  Expect(3) = 9e-23, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT+ Y   NL  RT+ +L++VAL SL+GA+ VL   E LLP
Sbjct  139  NIAMLRCVAEYLEMTEDYAVGNLVSRTDAYLNEVALKSLAGAVSVLHLSENLLP  192


 Score = 32.3 bits (72),  Expect(3) = 9e-23, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCYG+NFEI+
Sbjct  115  PGGAEAFELAAKFCYGINFEIS  136



>ref|XP_006280202.1| hypothetical protein CARUB_v10026107mg [Capsella rubella]
 gb|EOA13100.1| hypothetical protein CARUB_v10026107mg [Capsella rubella]
Length=605

 Score = 82.4 bits (202),  Expect(3) = 1e-22, Method: Composition-based stats.
 Identities = 39/73 (53%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  354
            L+ AM+RT +W+ SQE+ +D+ V VGEASFSLHKF L++K  +I+KL+ +S K++D T I
Sbjct  9    LTSAMKRTSEWISSQEVSSDITVHVGEASFSLHKFPLLSKCGFIKKLMSESTKDSDSTVI  68

Query  355  NLSGIPGGPEIFE  393
             +  IPGG E FE
Sbjct  69   KIPDIPGGSEAFE  81


 Score = 41.6 bits (96),  Expect(3) = 1e-22, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAEYL+MT+++   NL  R E ++++VAL SLS ++ VL   EELLP
Sbjct  98   NIAMLRCAAEYLEMTEEHSVENLVVRAEAYVNEVALKSLSSSITVLHKSEELLP  151


 Score = 29.3 bits (64),  Expect(3) = 1e-22, Method: Composition-based stats.
 Identities = 10/22 (45%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCYG+NF+++
Sbjct  74   PGGSEAFELAAKFCYGINFDMS  95



>ref|XP_002983725.1| hypothetical protein SELMODRAFT_228979 [Selaginella moellendorffii]
 gb|EFJ15221.1| hypothetical protein SELMODRAFT_228979 [Selaginella moellendorffii]
Length=604

 Score = 82.4 bits (202),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +1

Query  175  RLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  354
            R S +M RT  WV S ++PTD+ V +   SF+LHKF LV++S  +RKL+ +++++DL+R+
Sbjct  11   RNSFSMRRTNDWVMSTDVPTDITVDICGTSFALHKFPLVSRSGRLRKLVAEARDSDLSRV  70

Query  355  NLSGIPGGPEIFERGGE  405
              + IPGGPE FE   +
Sbjct  71   EFNDIPGGPEGFEMAAK  87


 Score = 48.1 bits (113),  Expect(2) = 8e-22, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRC AEYL+MTD +   NLA R+E F+  V   S   ++ VL SCE+LLP
Sbjct  100  NVAILRCVAEYLEMTDDFGQANLASRSEAFIEDVVTHSFGSSITVLHSCEKLLP  153



>ref|XP_002989054.1| hypothetical protein SELMODRAFT_272040 [Selaginella moellendorffii]
 gb|EFJ09848.1| hypothetical protein SELMODRAFT_272040 [Selaginella moellendorffii]
Length=607

 Score = 82.4 bits (202),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +1

Query  175  RLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  354
            R S +M RT  WV S ++PTD+ V +   SF+LHKF LV++S  +RKL+ +++++DL+R+
Sbjct  11   RNSFSMRRTNDWVMSTDVPTDITVDICGTSFALHKFPLVSRSGRLRKLVAEARDSDLSRV  70

Query  355  NLSGIPGGPEIFERGGE  405
              + IPGGPE FE   +
Sbjct  71   EFNDIPGGPEGFEMAAK  87


 Score = 47.8 bits (112),  Expect(2) = 9e-22, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRC AEYL+MTD +   NLA R+E F+  V + S   ++ VL SCE+LLP
Sbjct  100  NVAILRCVAEYLEMTDDFGQANLASRSEAFIEDVVMHSFGSSITVLHSCEKLLP  153



>ref|XP_008787157.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Phoenix 
dactylifera]
Length=610

 Score = 73.6 bits (179),  Expect(3) = 1e-21, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +1

Query  181  SLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINL  360
            S AM+RT +W+ SQEIP+D+ +  G ++F+LHK  LV+K  YIR+L+ ++  ++++ I +
Sbjct  23   STAMKRTSEWILSQEIPSDITIHAGGSAFALHKLPLVSKCGYIRRLVSEANGSNISVIEI  82

Query  361  SGIPGGPEIFE  393
              +PGG E F+
Sbjct  83   PDVPGGAEAFK  93


 Score = 40.8 bits (94),  Expect(3) = 1e-21, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC A YL+MT+ Y   NL  RTE +L +VAL SLSGA+ VL   E+LLP
Sbjct  110  NIAMLRCVAGYLEMTEDYAAGNLVNRTEGYLEEVALMSLSGAVTVLHKSEDLLP  163


 Score = 35.4 bits (80),  Expect(3) = 1e-21, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + K AAKFCYG+NFEIT
Sbjct  86   PGGAEAFKFAAKFCYGINFEIT  107



>ref|XP_007050812.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX94969.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
Length=631

 Score = 73.6 bits (179),  Expect(3) = 3e-21, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +1

Query  175  RLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  354
            R S ++    +W  S ++ +D+ + VG +SF+LHKF LV++S  IRKL++D+K+A ++R+
Sbjct  20   RPSSSIRHATEWPIS-DVSSDLTIEVGASSFALHKFPLVSRSGRIRKLLIDAKDAKISRV  78

Query  355  NLSGIPGGPEIFE  393
            N+S +PGGPE FE
Sbjct  79   NISSVPGGPEAFE  91


 Score = 44.7 bits (104),  Expect(3) = 3e-21, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCA+ +L+MT+++ + NL  RTE +L  + L ++S ++ VL  CE LLP
Sbjct  108  NVAMLRCASHFLEMTEEFAEKNLEARTEAYLKDMVLPNISSSISVLHRCESLLP  161


 Score = 30.4 bits (67),  Expect(3) = 3e-21, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITV  439
            P    + + AAKFCYG+N EIT+
Sbjct  84   PGGPEAFELAAKFCYGINVEITL  106



>ref|XP_006600924.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
 gb|KHN28330.1| BTB/POZ domain-containing protein [Glycine soja]
Length=583

 Score = 76.3 bits (186),  Expect(3) = 3e-21, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = +1

Query  190  MERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGI  369
            M+R  +W +S EIP+DV + VGE SFSLHKF LV+KS YI KL+ +S +A    I L  +
Sbjct  1    MKRASEWAYSHEIPSDVTIQVGEVSFSLHKFPLVSKSGYIGKLVSESSDA---FIELYDV  57

Query  370  PGGPEIFE  393
            PGG E FE
Sbjct  58   PGGAEAFE  65


 Score = 41.6 bits (96),  Expect(3) = 3e-21, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL MT+ Y   NL GR + +L++VAL ++SGA  +L   E LLP
Sbjct  82   NIAMLRCVAEYLDMTEDYSVGNLVGRADSYLNEVALKTISGAASILHVSERLLP  135


 Score = 30.8 bits (68),  Expect(3) = 3e-21, Method: Compositional matrix adjust.
 Identities = 10/15 (67%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            A KFCYG+NFEI++ 
Sbjct  67   ATKFCYGINFEISIE  81



>ref|XP_003608469.1| BTB/POZ domain-containing protein [Medicago truncatula]
Length=424

 Score = 84.0 bits (206),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = +1

Query  190  MERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEA--DLTRINLS  363
            M+RT +W +SQEIP+DV + +GEAS+SLHKF L++KS YIRKLI +S +A  D+  I L 
Sbjct  1    MKRTSEWNYSQEIPSDVAIQIGEASYSLHKFPLISKSGYIRKLISESSDAVDDVPLIELI  60

Query  364  GIPGGPEIFE  393
             +PGG E FE
Sbjct  61   DVPGGSEAFE  70


 Score = 44.7 bits (104),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT+ Y   NL GRT+ +L++VAL S+SGA+ +L + E LLP
Sbjct  87   NIAMLRCVAEYLEMTEDYSVGNLVGRTDSYLNEVALKSMSGAISILHTSETLLP  140



>ref|XP_007050813.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
 gb|EOX94970.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
Length=626

 Score = 72.8 bits (177),  Expect(3) = 6e-21, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  223  EIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFE  393
            ++ +D+ + VG +SF+LHKF LV++S  IRKL++D+K+A ++R+N+S +PGGPE FE
Sbjct  30   DVSSDLTIEVGASSFALHKFPLVSRSGRIRKLLIDAKDAKISRVNISSVPGGPEAFE  86


 Score = 44.7 bits (104),  Expect(3) = 6e-21, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCA+ +L+MT+++ + NL  RTE +L  + L ++S ++ VL  CE LLP
Sbjct  103  NVAMLRCASHFLEMTEEFAEKNLEARTEAYLKDMVLPNISSSISVLHRCESLLP  156


 Score = 30.4 bits (67),  Expect(3) = 6e-21, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITV  439
            P    + + AAKFCYG+N EIT+
Sbjct  79   PGGPEAFELAAKFCYGINVEITL  101



>ref|XP_004247086.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Solanum 
lycopersicum]
Length=607

 Score = 68.2 bits (165),  Expect(3) = 7e-21, Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +1

Query  193  ERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  372
            +R  +WVF +++P+D+++ V   +FSLHKF LV++S  IRKL+   +++D++ I L  +P
Sbjct  17   QRYNEWVF-RDVPSDIMIVVDGGTFSLHKFPLVSRSGRIRKLVAGHRDSDISMIELHSLP  75

Query  373  GGPEIFE  393
            GG E FE
Sbjct  76   GGAESFE  82


 Score = 43.5 bits (101),  Expect(3) = 7e-21, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA L C ++YL+MT++Y  NNL  R E++L  V   +L   + VLK CE LLP
Sbjct  99   NVAQLYCVSDYLEMTEEYSKNNLGSRAEEYLEVVVSKNLEMCVEVLKQCENLLP  152


 Score = 35.4 bits (80),  Expect(3) = 7e-21, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  368  FPAALRSSKGAAKFCYGVNFEIT  436
             P    S + AAKFCYGVNFEIT
Sbjct  74   LPGGAESFELAAKFCYGVNFEIT  96



>ref|XP_006579934.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
 gb|KHN06007.1| BTB/POZ domain-containing protein [Glycine soja]
Length=590

 Score = 75.5 bits (184),  Expect(3) = 8e-21, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 48/68 (71%), Gaps = 1/68 (1%)
 Frame = +1

Query  190  MERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGI  369
            M+R  +W +S EI +DV V VGE SFSLHKF LV+KS YI KL+ +S + D++ I L  +
Sbjct  1    MKRASEWAYSHEILSDVTVQVGEVSFSLHKFPLVSKSGYIGKLVSESSD-DVSFIELYDV  59

Query  370  PGGPEIFE  393
            PGG E FE
Sbjct  60   PGGAEAFE  67


 Score = 40.4 bits (93),  Expect(3) = 8e-21, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL MT+ Y   NL GR + +L++VAL ++SGA+ +L   E  LP
Sbjct  84   NIATLRCVAEYLDMTEDYSVGNLVGRADSYLNEVALKTISGAVSILHMSERFLP  137


 Score = 31.2 bits (69),  Expect(3) = 8e-21, Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            A KFCYG+NFEI+V 
Sbjct  69   ATKFCYGINFEISVE  83



>ref|XP_009630229.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Nicotiana tomentosiformis]
Length=618

 Score = 87.0 bits (214),  Expect(2) = 8e-21, Method: Composition-based stats.
 Identities = 39/72 (54%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS  M+RT +W+ SQEIP+D+ V V   SF+LHKF LV+K  YIRKL+  S +A+L+ I 
Sbjct  26   LSNVMKRTSEWILSQEIPSDITVHVAGTSFALHKFPLVSKCGYIRKLVAKSNDANLSEIE  85

Query  358  LSGIPGGPEIFE  393
            +  IPGG E FE
Sbjct  86   IPDIPGGAEAFE  97


 Score = 40.0 bits (92),  Expect(2) = 8e-21, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL MTD Y   NL G +E +L++VAL S++GA+ VL S E+LLP
Sbjct  114  NIALLRCVAEYLDMTDYYAVGNLVGLSEAYLNEVALKSIAGAVSVLHSSEKLLP  167



>gb|KHG21965.1| hypothetical protein F383_08186 [Gossypium arboreum]
Length=632

 Score = 71.2 bits (173),  Expect(3) = 2e-20, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = +1

Query  175  RLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  354
            R S ++    +W  S ++ +D+ + VG +SF+LHKF LV++S  IRKL++D+K+  ++RI
Sbjct  20   RPSSSIRHATEWPIS-DVSSDLKIEVGTSSFALHKFPLVSRSGRIRKLLIDTKDTKISRI  78

Query  355  NLSGIPGGPEIFE  393
            NLS  PGGPE FE
Sbjct  79   NLSSAPGGPEAFE  91


 Score = 44.7 bits (104),  Expect(3) = 2e-20, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRC + YL+M +++ +NNL  RTE +L  + L ++S  + VL  CE LLP
Sbjct  108  NVAMLRCISHYLEMAEEFAENNLEARTEAYLKDMVLPNISSTIAVLHRCESLLP  161


 Score = 30.4 bits (67),  Expect(3) = 2e-20, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITV  439
            P    + + AAKFCYG+N EIT+
Sbjct  84   PGGPEAFELAAKFCYGINVEITL  106



>ref|XP_009630230.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Nicotiana tomentosiformis]
Length=446

 Score = 84.3 bits (207),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS  M+RT +W+ SQEIP+D+ V V   SF+LHKF LV+K  YIRKL+  S +A+L+ I 
Sbjct  26   LSNVMKRTSEWILSQEIPSDITVHVAGTSFALHKFPLVSKCGYIRKLVAKSNDANLSEIE  85

Query  358  LSGIPGGPEIFE  393
            +  IPGG E FE
Sbjct  86   IPDIPGGAEAFE  97


 Score = 42.0 bits (97),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL MTD Y   NL G +E +L++VAL S++GA+ VL S E+LLP
Sbjct  114  NIALLRCVAEYLDMTDYYAVGNLVGLSEAYLNEVALKSIAGAVSVLHSSEKLLP  167



>gb|EPS72379.1| hypothetical protein M569_02379, partial [Genlisea aurea]
Length=583

 Score = 84.7 bits (208),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = +1

Query  181  SLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL-TRIN  357
            S AM+RT +W+FSQEIP+D+ + VG+ SFSLHKF LV+K  YIR+ + +S EAD  T + 
Sbjct  14   STAMKRTSEWIFSQEIPSDITIKVGDNSFSLHKFPLVSKCGYIRRFVSESDEADDPTTLE  73

Query  358  LSGIPGGPEIFE  393
            +  IPGG E F+
Sbjct  74   IDDIPGGAESFD  85


 Score = 40.8 bits (94),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 2/56 (4%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCE--ELLP  605
            N+AA+RCAAE+L+MT+ Y   NL  R E ++S+VAL+SLS A+ VL +CE   LLP
Sbjct  102  NIAAIRCAAEFLEMTEDYAVGNLVSRAESYISEVALTSLSVAVSVLHTCENNNLLP  157



>ref|XP_004511857.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Cicer arietinum]
 ref|XP_004511858.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Cicer arietinum]
Length=679

 Score = 81.3 bits (199),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  211  VFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF  390
            +FSQEIP+DV V VGEASFS+HKF LV+K  YIRKL+ +S +AD+  I LS +PGG E F
Sbjct  86   IFSQEIPSDVKVRVGEASFSIHKFPLVSKCGYIRKLVSESGDADVPLIELSDVPGGAEAF  145

Query  391  E  393
            E
Sbjct  146  E  146


 Score = 43.5 bits (101),  Expect(2) = 3e-20, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT++Y   NL GRT+ +L+ VAL +++GA+ +L   E LLP
Sbjct  163  NIATLRCVAEYLEMTEEYAVGNLVGRTDAYLNDVALKTIAGAVSILHMSESLLP  216



>ref|XP_004511859.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X3 [Cicer arietinum]
Length=678

 Score = 81.3 bits (199),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  211  VFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF  390
            +FSQEIP+DV V VGEASFS+HKF LV+K  YIRKL+ +S +AD+  I LS +PGG E F
Sbjct  86   IFSQEIPSDVKVRVGEASFSIHKFPLVSKCGYIRKLVSESGDADVPLIELSDVPGGAEAF  145

Query  391  E  393
            E
Sbjct  146  E  146


 Score = 43.5 bits (101),  Expect(2) = 3e-20, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT++Y   NL GRT+ +L+ VAL +++GA+ +L   E LLP
Sbjct  163  NIATLRCVAEYLEMTEEYAVGNLVGRTDAYLNDVALKTIAGAVSILHMSESLLP  216



>gb|KHG21966.1| hypothetical protein F383_08186 [Gossypium arboreum]
Length=627

 Score = 70.1 bits (170),  Expect(3) = 4e-20, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  223  EIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFE  393
            ++ +D+ + VG +SF+LHKF LV++S  IRKL++D+K+  ++RINLS  PGGPE FE
Sbjct  30   DVSSDLKIEVGTSSFALHKFPLVSRSGRIRKLLIDTKDTKISRINLSSAPGGPEAFE  86


 Score = 44.3 bits (103),  Expect(3) = 4e-20, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRC + YL+M +++ +NNL  RTE +L  + L ++S  + VL  CE LLP
Sbjct  103  NVAMLRCISHYLEMAEEFAENNLEARTEAYLKDMVLPNISSTIAVLHRCESLLP  156


 Score = 30.4 bits (67),  Expect(3) = 4e-20, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITV  439
            P    + + AAKFCYG+N EIT+
Sbjct  79   PGGPEAFELAAKFCYGINVEITL  101



>gb|KJB23203.1| hypothetical protein B456_004G086600 [Gossypium raimondii]
Length=630

 Score = 70.1 bits (170),  Expect(3) = 4e-20, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  223  EIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFE  393
            ++ +D+ + VG +SF+LHKF LV++S  IRKL++D+K+  ++RINLS  PGGPE FE
Sbjct  30   DVSSDLKIEVGTSSFALHKFPLVSRSGRIRKLLIDAKDTKISRINLSSAPGGPEAFE  86


 Score = 44.3 bits (103),  Expect(3) = 4e-20, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRC + YL+M +++ +NNL  RTE +L  + + ++S  + VL  CE LLP
Sbjct  103  NVAMLRCISHYLEMAEEFAENNLEARTEAYLKDMVVPNISSTIAVLHRCESLLP  156


 Score = 30.4 bits (67),  Expect(3) = 4e-20, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITV  439
            P    + + AAKFCYG+N EIT+
Sbjct  79   PGGPEAFELAAKFCYGINVEITL  101



>ref|XP_009411062.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Musa 
acuminata subsp. malaccensis]
Length=583

 Score = 73.9 bits (180),  Expect(3) = 4e-20, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +1

Query  190  MERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGI  369
            M+RTG+W++S E+P+D+ V VG + F LHK++LV+K  YIRKL  ++ + + + I +  +
Sbjct  1    MKRTGEWIYSPEVPSDIDVKVGGSIFPLHKYLLVSKCGYIRKLASEANQPNTSAIEIPDV  60

Query  370  PGGPEIFE  393
            PGG E FE
Sbjct  61   PGGAEAFE  68


 Score = 42.0 bits (97),  Expect(3) = 4e-20, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL+MT+ Y   NL  R E +L +VAL SLS A+ VL   EELLP
Sbjct  85   NIAMLRCVAEYLEMTEDYTVGNLVSRAEAYLEEVALLSLSAAVTVLHKSEELLP  138


 Score = 28.5 bits (62),  Expect(3) = 4e-20, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEIT  436
              K+CYGVNFEIT
Sbjct  70   VTKYCYGVNFEIT  82



>gb|KJB41979.1| hypothetical protein B456_007G130600 [Gossypium raimondii]
Length=633

 Score = 69.7 bits (169),  Expect(3) = 5e-20, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = +1

Query  175  RLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  354
            R S ++    +W  S ++ +D+ + VG +SF+LHKF LV++S  I+KL++D+K++ ++ I
Sbjct  20   RQSSSIRHATEWPIS-DVSSDLTIEVGASSFALHKFPLVSRSGRIKKLLVDTKDSKISHI  78

Query  355  NLSGIPGGPEIFE  393
            NLS IPGG E FE
Sbjct  79   NLSSIPGGSEAFE  91


 Score = 46.6 bits (109),  Expect(3) = 5e-20, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCA+ +L+MT+++ D NL  RTE ++  + L ++S ++ VL  CE LLP
Sbjct  108  NVAMLRCASNFLEMTEEFADKNLEARTEAYMKDMVLPNISSSISVLHHCESLLP  161


 Score = 28.5 bits (62),  Expect(3) = 5e-20, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITV  439
            P    + + AAKFCYG+N EI +
Sbjct  84   PGGSEAFELAAKFCYGINVEIML  106



>ref|XP_006393938.1| hypothetical protein EUTSA_v10003858mg [Eutrema salsugineum]
 gb|ESQ31224.1| hypothetical protein EUTSA_v10003858mg [Eutrema salsugineum]
Length=603

 Score = 82.8 bits (203),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +1

Query  181  SLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRIN  357
            S AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+ +SK ++D T I 
Sbjct  10   SSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGFIKKLVSESKSDSDATVIK  69

Query  358  LSGIPGGPEIFE  393
            L  IPGG E FE
Sbjct  70   LPDIPGGSEAFE  81


 Score = 42.0 bits (97),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAEYL+MT+++   NL  R E +L++VAL SLS ++ VL   EELLP
Sbjct  98   NIAMLRCAAEYLEMTEEHSVENLVVRAEAYLNEVALKSLSSSITVLHKSEELLP  151



>dbj|BAJ34215.1| unnamed protein product [Thellungiella halophila]
Length=603

 Score = 82.4 bits (202),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +1

Query  181  SLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRIN  357
            S AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+ +SK ++D T I 
Sbjct  10   SSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGFIKKLVSESKSDSDATVIK  69

Query  358  LSGIPGGPEIFE  393
            L  IPGG E FE
Sbjct  70   LPDIPGGSEAFE  81


 Score = 42.0 bits (97),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAEYL+MT+++   NL  R E +L++VAL SLS ++ VL   EELLP
Sbjct  98   NIAMLRCAAEYLEMTEEHSVENLVVRAEAYLNEVALKSLSSSITVLHKSEELLP  151



>gb|KJB26098.1| hypothetical protein B456_004G225600 [Gossypium raimondii]
Length=612

 Score = 67.4 bits (163),  Expect(3) = 8e-20, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +1

Query  193  ERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  372
            +R  +W+F +++P+D+ + V   SF+LHKF LV++S  I+KL+ + +++D+ R+ L  +P
Sbjct  16   QRCNEWIF-RDVPSDITIEVNGVSFALHKFPLVSRSGRIQKLVAEHRDSDMLRVELVNVP  74

Query  373  GGPEIFE  393
            GG E FE
Sbjct  75   GGAESFE  81


 Score = 41.6 bits (96),  Expect(3) = 8e-20, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA L C ++YL+MT+++  +NL  RTE++L  V   +L   + VL+ CE LLP
Sbjct  98   NVAQLYCVSDYLEMTEEFSKDNLGSRTEEYLEIVVCKNLEMCVEVLQQCESLLP  151


 Score = 34.7 bits (78),  Expect(3) = 8e-20, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    S + AAKFCYG+NFEIT
Sbjct  74   PGGAESFELAAKFCYGINFEIT  95



>ref|XP_008352542.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Malus 
domestica]
Length=448

 Score = 84.7 bits (208),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  354
            LS A++RT +W+FSQEIP+D+ + VG  SFSLHKF L++K  +I+KLI +S   ADL+ I
Sbjct  9    LSSALKRTSEWIFSQEIPSDISINVGGVSFSLHKFPLISKCGHIKKLISESSYAADLSVI  68

Query  355  NLSGIPGGPEIFE  393
             LS +PGG E FE
Sbjct  69   ELSDVPGGSEAFE  81


 Score = 38.9 bits (89),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL MT+ Y   NL GR + +L++VAL SL+GA+ VL   E  LP
Sbjct  98   NIAMLRCVAEYLLMTEDYAVGNLVGRADAYLNEVALKSLAGAVTVLHMSENFLP  151



>ref|XP_010112756.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXC34714.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=631

 Score = 73.2 bits (178),  Expect(3) = 1e-19, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +1

Query  175  RLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  354
            R S ++    +W  S ++ +D+ V VG +SFSLHKF LV++S  IRKL++++K+  +TRI
Sbjct  20   RPSSSIRHATEWPIS-DVSSDLTVEVGTSSFSLHKFPLVSRSGRIRKLLLEAKDTKITRI  78

Query  355  NLSGIPGGPEIFE  393
            NL+ +PGGPE FE
Sbjct  79   NLATVPGGPEAFE  91


 Score = 39.3 bits (90),  Expect(3) = 1e-19, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA L CAA +L+MT+ + + NL  R E +L ++ L +++ ++ VL  CE LLP
Sbjct  108  NVAMLCCAAHFLEMTEDFAEKNLEARVEAYLKEMVLPNIANSISVLHRCETLLP  161


 Score = 30.4 bits (67),  Expect(3) = 1e-19, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCYGVN EIT
Sbjct  84   PGGPEAFELAAKFCYGVNVEIT  105



>ref|XP_008372448.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Malus 
domestica]
Length=448

 Score = 84.0 bits (206),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  354
            LS A++RT +W+FSQEIP+D+ + VG  SFSLHKF L+ K  +I+KLI +S   ADL+ I
Sbjct  9    LSSALKRTSEWIFSQEIPSDISINVGGVSFSLHKFPLIXKCGHIKKLISESSYAADLSVI  68

Query  355  NLSGIPGGPEIFE  393
             LS +PGG E FE
Sbjct  69   ELSDVPGGSEAFE  81


 Score = 38.9 bits (89),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC AEYL MT+ Y   NL GR + +L++VAL SL+GA+ VL   E  LP
Sbjct  98   NIAMLRCVAEYLLMTEDYAVGNLVGRADAYLNEVALKSLAGAVTVLHMSENFLP  151



>ref|XP_009780159.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Nicotiana 
sylvestris]
Length=621

 Score = 81.3 bits (199),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  357
            LS  M+RT +W+ SQEIP+D+ V V   SF+LHKF LV+K  YIRKL+  S +A+L+   
Sbjct  26   LSNVMKRTSEWILSQEIPSDITVHVAGTSFALHKFPLVSKCGYIRKLVAKSNDANLSVFE  85

Query  358  LSGIPGGPEIFE  393
            +  IPGG E FE
Sbjct  86   IPDIPGGAEAFE  97


 Score = 41.6 bits (96),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRC AEYL MTD Y   NL G +E +L+++AL S++GA+ VL S E+LLP
Sbjct  114  NVALLRCVAEYLDMTDDYAVGNLVGLSEAYLNELALKSIAGAVSVLHSSEKLLP  167



>ref|XP_010484507.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Camelina sativa]
 ref|XP_010484508.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Camelina sativa]
Length=603

 Score = 79.0 bits (193),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  354
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+  S K++D + I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGFIKKLMSGSNKDSDSSVI  68

Query  355  NLSGIPGGPEIFE  393
             +  IPGG E FE
Sbjct  69   KILDIPGGSEAFE  81


 Score = 43.9 bits (102),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAEYL+MTD++   NL  R E +L++VAL SLS ++ VL   EELLP
Sbjct  98   NIAMLRCAAEYLEMTDEHSVENLVVRAEAYLNEVALKSLSSSITVLHKSEELLP  151



>ref|XP_010241864.1| PREDICTED: BTB/POZ domain-containing protein At1g03010-like isoform 
X1 [Nelumbo nucifera]
Length=630

 Score = 66.2 bits (160),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +1

Query  199  TGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGG  378
            T +W  S ++ +D+IV VG  +F +HKF LV++S  IRKL++++K++ ++RINL  +PGG
Sbjct  28   TTEWPIS-DVSSDLIVEVGAVTFPIHKFPLVSRSGKIRKLLLEAKDSKVSRINLPSVPGG  86

Query  379  PEIFE  393
             E FE
Sbjct  87   SEAFE  91


 Score = 45.1 bits (105),  Expect(3) = 2e-19, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCAA YL+MT+++ + NL  RTE ++ ++ +S++S ++ VL  CE LLP
Sbjct  108  NVAMLRCAAHYLEMTEEFSEKNLEYRTEIYIKEMVISNISNSISVLHHCETLLP  161


 Score = 31.2 bits (69),  Expect(3) = 2e-19, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITV  439
            P    + + AAKFCYGVN EIT+
Sbjct  84   PGGSEAFELAAKFCYGVNIEITL  106



>gb|KHG21232.1| hypothetical protein F383_08117 [Gossypium arboreum]
 gb|KHG21831.1| hypothetical protein F383_08674 [Gossypium arboreum]
Length=616

 Score = 66.2 bits (160),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +1

Query  193  ERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  372
            +R  +W+F +++P+D+ + V   +F+LHKF LV++S  I+KL+ + +++D+ R+ L  +P
Sbjct  20   QRCNEWIF-RDVPSDITIEVNGVAFALHKFPLVSRSGRIQKLVAEHRDSDMLRVELVNVP  78

Query  373  GGPEIFE  393
            GG E FE
Sbjct  79   GGAESFE  85


 Score = 41.6 bits (96),  Expect(3) = 2e-19, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA L C ++YL+MT+++  +NL  RTE++L  V   +L   + VL+ CE LLP
Sbjct  102  NVAQLYCVSDYLEMTEEFSKDNLGSRTEEYLEIVVCKNLEMCVEVLQQCESLLP  155


 Score = 34.7 bits (78),  Expect(3) = 2e-19, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    S + AAKFCYG+NFEIT
Sbjct  78   PGGAESFELAAKFCYGINFEIT  99



>ref|XP_010464139.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Camelina 
sativa]
Length=603

 Score = 80.5 bits (197),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  354
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+ +S K++D + I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGFIKKLMSESNKDSDSSVI  68

Query  355  NLSGIPGGPEIFE  393
             +  IPGG E FE
Sbjct  69   KILDIPGGSEAFE  81


 Score = 42.0 bits (97),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAEYL+MT+++   NL  R E +L++VAL SLS ++ VL   EELLP
Sbjct  98   NIAMLRCAAEYLEMTEEHSVENLVVRAEAYLNEVALKSLSSSITVLHKSEELLP  151



>gb|KJB41980.1| hypothetical protein B456_007G130600 [Gossypium raimondii]
Length=628

 Score = 67.4 bits (163),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  223  EIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFE  393
            ++ +D+ + VG +SF+LHKF LV++S  I+KL++D+K++ ++ INLS IPGG E FE
Sbjct  30   DVSSDLTIEVGASSFALHKFPLVSRSGRIKKLLVDTKDSKISHINLSSIPGGSEAFE  86


 Score = 46.2 bits (108),  Expect(3) = 2e-19, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCA+ +L+MT+++ D NL  RTE ++  + L ++S ++ VL  CE LLP
Sbjct  103  NVAMLRCASNFLEMTEEFADKNLEARTEAYMKDMVLPNISSSISVLHHCESLLP  156


 Score = 28.5 bits (62),  Expect(3) = 2e-19, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITV  439
            P    + + AAKFCYG+N EI +
Sbjct  79   PGGSEAFELAAKFCYGINVEIML  101



>ref|XP_010028108.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X3 [Eucalyptus grandis]
Length=597

 Score = 74.7 bits (182),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  211  VFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF  390
            +FSQEIP+DV V     SF+LHKF LV++   IRKL+ +S EADL+ I L GIPGG E F
Sbjct  14   IFSQEIPSDVTVHAAGTSFALHKFPLVSRCGCIRKLVSESSEADLSNIELVGIPGGAEAF  73

Query  391  E  393
            E
Sbjct  74   E  74


 Score = 47.0 bits (110),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAEYL+MT+ Y   NL GRTE +L +VAL S++GA+ VL   E LLP
Sbjct  91   NIAMLRCAAEYLEMTEDYAVGNLVGRTEAYLKEVALKSIAGAITVLHMTESLLP  144



>gb|KHG27924.1| hypothetical protein F383_10949 [Gossypium arboreum]
Length=633

 Score = 69.7 bits (169),  Expect(3) = 4e-19, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +1

Query  205  QWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPE  384
            +W  S ++ +DV + +G +SF+LHKF LV++S  IR+L+++ K+A ++R+NLS IPGGPE
Sbjct  31   EWPIS-DVSSDVTIEIGASSFALHKFPLVSRSGRIRRLLIEEKDATISRMNLSLIPGGPE  89

Query  385  IFE  393
             FE
Sbjct  90   AFE  92


 Score = 40.8 bits (94),  Expect(3) = 4e-19, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCAA +L+MT+++   NL  RTE +L    L ++S ++ VL  CE L P
Sbjct  109  NVAMLRCAAHFLEMTEEFVQKNLEARTEAYLKDTVLPNISNSISVLHRCECLSP  162


 Score = 30.8 bits (68),  Expect(3) = 4e-19, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITV  439
            P    + + AAKFCYG+N EIT+
Sbjct  85   PGGPEAFELAAKFCYGINIEITL  107



>gb|KEH28209.1| root phototropism-like protein [Medicago truncatula]
Length=536

 Score = 63.9 bits (154),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  283  MLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERGGE  405
            MLVAKSNYIRKLIM+S E++LTR++LS IPGG E FE+  +
Sbjct  1    MLVAKSNYIRKLIMESNESELTRLDLSDIPGGQEAFEKAAK  41


 Score = 57.4 bits (137),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA+L CAA +LQMTD+YCD NLAGRTE FLSQVAL++LSGA VVLKSC +L+P
Sbjct  54   NVASLHCAAMFLQMTDEYCDGNLAGRTEGFLSQVALTTLSGAAVVLKSCRQLIP  107



>ref|XP_001770455.1| predicted protein [Physcomitrella patens]
 gb|EDQ64792.1| predicted protein [Physcomitrella patens]
Length=622

 Score = 55.8 bits (133),  Expect(3) = 6e-19, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 43/64 (67%), Gaps = 5/64 (8%)
 Frame = +1

Query  211  VFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLI---MDSKEADLTRINLSGIPGGP  381
            V + ++P+D++V  G  +FSLHKF LVA+S  IRKL+    DS+  +L  + L+ +PGG 
Sbjct  27   VLTTDVPSDIVVEAGGMNFSLHKFPLVARSGRIRKLVANLADSENPNL--LQLTDVPGGA  84

Query  382  EIFE  393
            E F+
Sbjct  85   EAFD  88


 Score = 52.0 bits (123),  Expect(3) = 6e-19, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCAAEYL MT+ Y +NNL  RTE FLS+V L SL+ ++ VL +CE LLP
Sbjct  105  NVAVLRCAAEYLDMTESYGENNLVARTEAFLSEVVLQSLADSIAVLHNCENLLP  158


 Score = 32.7 bits (73),  Expect(3) = 6e-19, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    +   AAKFCYG+NFEIT
Sbjct  81   PGGAEAFDLAAKFCYGINFEIT  102



>ref|XP_009757790.1| PREDICTED: BTB/POZ domain-containing protein At1g03010-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009757791.1| PREDICTED: BTB/POZ domain-containing protein At1g03010-like isoform 
X1 [Nicotiana sylvestris]
Length=625

 Score = 65.5 bits (158),  Expect(3) = 6e-19, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 48/63 (76%), Gaps = 1/63 (2%)
 Frame = +1

Query  205  QWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPE  384
            +W  S ++ +D+ + VG ASF+LHKF LV++S  IRKL++++K++ ++R+NL  +PGG E
Sbjct  24   EWPIS-DVSSDLTIKVGAASFALHKFPLVSRSGRIRKLLLEAKDSKMSRLNLPDLPGGSE  82

Query  385  IFE  393
             FE
Sbjct  83   AFE  85


 Score = 43.1 bits (100),  Expect(3) = 6e-19, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCA+ +L+MT+   D NL  RTE FL      ++S ++ VL SCE+LLP
Sbjct  102  NVAMLRCASSFLEMTEYISDKNLEIRTEVFLKDTVFPNISNSVSVLHSCEKLLP  155


 Score = 32.0 bits (71),  Expect(3) = 6e-19, Method: Composition-based stats.
 Identities = 13/24 (54%), Positives = 16/24 (67%), Gaps = 0/24 (0%)
 Frame = +2

Query  368  FPAALRSSKGAAKFCYGVNFEITV  439
             P    + + AAKFCYGVN EIT+
Sbjct  77   LPGGSEAFELAAKFCYGVNVEITI  100



>ref|XP_010241873.1| PREDICTED: BTB/POZ domain-containing protein At1g03010-like isoform 
X2 [Nelumbo nucifera]
Length=600

 Score = 64.3 bits (155),  Expect(3) = 7e-19, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  223  EIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFE  393
            ++ +D+IV VG  +F +HKF LV++S  IRKL++++K++ ++RINL  +PGG E FE
Sbjct  5    DVSSDLIVEVGAVTFPIHKFPLVSRSGKIRKLLLEAKDSKVSRINLPSVPGGSEAFE  61


 Score = 45.1 bits (105),  Expect(3) = 7e-19, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCAA YL+MT+++ + NL  RTE ++ ++ +S++S ++ VL  CE LLP
Sbjct  78   NVAMLRCAAHYLEMTEEFSEKNLEYRTEIYIKEMVISNISNSISVLHHCETLLP  131


 Score = 31.2 bits (69),  Expect(3) = 7e-19, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITV  439
            AAKFCYGVN EIT+
Sbjct  63   AAKFCYGVNIEITL  76



>ref|XP_011468065.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X3 [Fragaria vesca subsp. vesca]
Length=583

 Score = 68.9 bits (167),  Expect(3) = 7e-19, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  223  EIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFE  393
            EIP+DV V VGE SFSLHKF LV+K  YIRKL+ +S + +++ I L  +PGG E FE
Sbjct  2    EIPSDVSVRVGEVSFSLHKFPLVSKCGYIRKLVSESTDDEISVIELPDVPGGAEAFE  58


 Score = 40.4 bits (93),  Expect(3) = 7e-19, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC +EYL MT++Y   NL GRT+ +L++VAL SL+GA+ VL + E  LP
Sbjct  75   NIAMLRCVSEYLLMTEEYAIGNLVGRTDAYLNEVALKSLAGAVSVLHTAESFLP  128


 Score = 30.8 bits (68),  Expect(3) = 7e-19, Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYG+NFEI+  
Sbjct  60   AAKFCYGINFEISTE  74



>ref|XP_007133999.1| hypothetical protein PHAVU_010G010500g [Phaseolus vulgaris]
 gb|ESW05993.1| hypothetical protein PHAVU_010G010500g [Phaseolus vulgaris]
Length=610

 Score = 68.6 bits (166),  Expect(3) = 9e-19, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +1

Query  193  ERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  372
            +R  +W+F +++P+D+ + V   +FSLHKF LV++S  IR+++ ++++ D++R+ L+ +P
Sbjct  17   QRYNEWIF-RDVPSDITIEVNGGAFSLHKFPLVSRSGRIRRIVAENRDDDISRVVLNNLP  75

Query  373  GGPEIFE  393
            GG E FE
Sbjct  76   GGAECFE  82


 Score = 38.9 bits (89),  Expect(3) = 9e-19, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA L C ++YL+MT+ +  +NL  R E++L  V   +L   + VL+ CE LLP
Sbjct  99   NVAQLCCVSDYLEMTEDFSKDNLGSRAEEYLESVVCKNLEMCVEVLQQCESLLP  152


 Score = 32.7 bits (73),  Expect(3) = 9e-19, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = +2

Query  368  FPAALRSSKGAAKFCYGVNFEIT  436
             P      + AAKFCYG+NFEIT
Sbjct  74   LPGGAECFELAAKFCYGINFEIT  96



>ref|XP_006479889.1| PREDICTED: BTB/POZ domain-containing protein At1g03010-like isoform 
X1 [Citrus sinensis]
Length=631

 Score = 68.9 bits (167),  Expect(3) = 9e-19, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +1

Query  175  RLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  354
            R S ++    +W  S ++ +D+ + VG +SF+LHKF LV++S  IRKL++++K++ ++R+
Sbjct  20   RPSSSIRHATEWPIS-DVSSDLTIEVGASSFALHKFPLVSRSGRIRKLLLEAKDSKVSRV  78

Query  355  NLSGIPGGPEIFE  393
            NLS +PGG E FE
Sbjct  79   NLSAVPGGAEAFE  91


 Score = 41.2 bits (95),  Expect(3) = 9e-19, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA +RC A +L+MT+ + + NL  R E +L ++   + S ++ VLK CE LLP
Sbjct  108  NVATIRCVAHFLEMTEDFAEKNLEARAEAYLKEMVFPNTSNSISVLKCCESLLP  161


 Score = 29.6 bits (65),  Expect(3) = 9e-19, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITV  439
            P    + + AAKFCYG+N E+T+
Sbjct  84   PGGAEAFELAAKFCYGINVELTL  106



>ref|XP_002320358.1| hypothetical protein POPTR_0014s12800g [Populus trichocarpa]
 gb|EEE98673.1| hypothetical protein POPTR_0014s12800g [Populus trichocarpa]
Length=632

 Score = 70.1 bits (170),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  169  ATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  348
            A R S ++    +W  S ++ +D+ V VG A+F+LHKF LV++S  IRKL++++K++ ++
Sbjct  18   AFRPSSSIRHATEWPIS-DVSSDLTVEVGAANFALHKFPLVSRSGRIRKLLLEAKDSKIS  76

Query  349  RINLSGIPGGPEIFE  393
            RIN+  +PGGPE FE
Sbjct  77   RINIPAVPGGPEAFE  91


 Score = 39.3 bits (90),  Expect(3) = 1e-18, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA L CAA +L+MT+ + + NL  R E +L ++ L ++S ++ V+  CE LLP
Sbjct  108  NVAMLCCAAHFLEMTEDFAEKNLEARAEAYLKEMVLPNISSSISVIHRCETLLP  161


 Score = 30.4 bits (67),  Expect(3) = 1e-18, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCYGVN EIT
Sbjct  84   PGGPEAFELAAKFCYGVNVEIT  105



>gb|KJB47066.1| hypothetical protein B456_008G009400 [Gossypium raimondii]
Length=462

 Score = 69.7 bits (169),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +1

Query  205  QWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPE  384
            +W  S ++ +DV + +G +SF+LHKF LV++S  IR+L++++K+A ++R+NLS IPGGPE
Sbjct  31   EWPIS-DVSSDVTIEIGASSFALHKFPLVSRSGRIRRLLIEAKDATISRMNLSLIPGGPE  89

Query  385  IFERGGE  405
             FE   +
Sbjct  90   AFELAAK  96


 Score = 40.0 bits (92),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDF  533
            NVA LRCAA +L+MT+++   NL  RTE +
Sbjct  109  NVAMLRCAAHFLEMTEEFVQKNLEARTEAY  138


 Score = 30.4 bits (67),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITV  439
            AAKFCYG+N EIT+
Sbjct  94   AAKFCYGINIEITL  107



>ref|XP_002267241.2| PREDICTED: BTB/POZ domain-containing protein At1g03010 isoform 
X1 [Vitis vinifera]
 ref|XP_010652065.1| PREDICTED: BTB/POZ domain-containing protein At1g03010 isoform 
X1 [Vitis vinifera]
 emb|CBI32255.3| unnamed protein product [Vitis vinifera]
Length=631

 Score = 65.1 bits (157),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +1

Query  175  RLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  354
            R S +     +W  S ++ +D+ + VG +SF+LHKF LV++S  IRKL++++K++ ++RI
Sbjct  20   RPSSSTRHATEWPIS-DVSSDLTIEVGASSFALHKFPLVSRSGRIRKLLLEAKDSKVSRI  78

Query  355  NLSGIPGGPEIFE  393
             +  +PGGPE FE
Sbjct  79   AIPSVPGGPEAFE  91


 Score = 43.5 bits (101),  Expect(3) = 1e-18, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRC A +L+MT+++ + NL  RTE +L +    ++S ++ VL  CE LLP
Sbjct  108  NVAMLRCVAHFLEMTEEFAEKNLETRTEGYLKETVFPNISSSISVLHQCETLLP  161


 Score = 31.2 bits (69),  Expect(3) = 1e-18, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITV  439
            P    + + AAKFCYGVN EIT+
Sbjct  84   PGGPEAFELAAKFCYGVNIEITL  106



>ref|XP_010317168.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Solanum lycopersicum]
Length=570

 Score = 68.2 bits (165),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  223  EIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFE  393
            +IP+D+ + VG  SF+LHKF LV+K  YIRKL+  S +A L+ I +  IPGGPE FE
Sbjct  2    DIPSDITIHVGRTSFALHKFPLVSKCGYIRKLVSKSNDAKLSTIEIPDIPGGPEAFE  58


 Score = 44.3 bits (103),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A +RC AEYL+MTD Y   NL G TE +L++V L S++ ++ +L S E+LLP
Sbjct  75   NIALIRCVAEYLEMTDDYAVGNLVGLTETYLTEVGLKSIASSVSILHSSEKLLP  128


 Score = 27.3 bits (59),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEIT  436
            AAKFCY +NFEI+
Sbjct  60   AAKFCYEINFEIS  72



>gb|KJB47067.1| hypothetical protein B456_008G009400 [Gossypium raimondii]
Length=581

 Score = 70.1 bits (170),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 50/63 (79%), Gaps = 1/63 (2%)
 Frame = +1

Query  205  QWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPE  384
            +W  S ++ +DV + +G +SF+LHKF LV++S  IR+L++++K+A ++R+NLS IPGGPE
Sbjct  31   EWPIS-DVSSDVTIEIGASSFALHKFPLVSRSGRIRRLLIEAKDATISRMNLSLIPGGPE  89

Query  385  IFE  393
             FE
Sbjct  90   AFE  92


 Score = 39.7 bits (91),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDF  533
            NVA LRCAA +L+MT+++   NL  RTE +
Sbjct  109  NVAMLRCAAHFLEMTEEFVQKNLEARTEAY  138


 Score = 30.0 bits (66),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITV  439
            AAKFCYG+N EIT+
Sbjct  94   AAKFCYGINIEITL  107



>emb|CAN74119.1| hypothetical protein VITISV_002050 [Vitis vinifera]
Length=1388

 Score = 64.7 bits (156),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  223  EIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFE  393
            ++ +D+ + VG +SF+LHKF LV++S  IRKL++++K++ ++RI +  +PGGPE FE
Sbjct  709  DVSSDLTIEVGASSFALHKFPLVSRSGRIRKLLLEAKDSKVSRIAIPSVPGGPEAFE  765


 Score = 43.5 bits (101),  Expect(3) = 1e-18, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRC A +L+MT+++ + NL  RTE +L +    ++S ++ VL  CE LLP
Sbjct  782  NVAMLRCVAHFLEMTEEFAEKNLETRTEGYLKETVFPNISSSISVLHQCETLLP  835


 Score = 31.2 bits (69),  Expect(3) = 1e-18, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITV  439
            P    + + AAKFCYGVN EIT+
Sbjct  758  PGGPEAFELAAKFCYGVNIEITL  780



>ref|XP_001763717.1| predicted protein [Physcomitrella patens]
 gb|EDQ71359.1| predicted protein [Physcomitrella patens]
Length=599

 Score = 55.5 bits (132),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 44/64 (69%), Gaps = 5/64 (8%)
 Frame = +1

Query  211  VFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLI---MDSKEADLTRINLSGIPGGP  381
            V + ++P+D++V  G  +FSLHKF LVA+S  IRKL+   +D++  +L R  L+ +PGG 
Sbjct  22   VLTTDVPSDLVVEAGGMNFSLHKFPLVARSGRIRKLVPNLVDNENPNLLR--LTDVPGGA  79

Query  382  EIFE  393
            E F+
Sbjct  80   EAFD  83


 Score = 52.4 bits (124),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCAAEYL+MT+ Y +NNL  RTE FLS+V L SL+ ++ VL +CE LLP
Sbjct  100  NVAVLRCAAEYLEMTEPYGENNLVARTETFLSEVVLQSLADSIAVLHNCENLLP  153


 Score = 31.6 bits (70),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITV  439
            AAKFCYG+NFEIT 
Sbjct  85   AAKFCYGINFEITT  98



>ref|XP_011033592.1| PREDICTED: BTB/POZ domain-containing protein At1g03010 isoform 
X3 [Populus euphratica]
Length=632

 Score = 70.5 bits (171),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  169  ATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  348
            A R S ++    +W  S ++ +D+ V VG A+F+LHKF LV++S  IRKL++++KE  ++
Sbjct  18   AFRPSSSIRHATEWPIS-DVSSDLTVEVGAANFALHKFPLVSRSGRIRKLLLEAKELKIS  76

Query  349  RINLSGIPGGPEIFE  393
            RIN+  +PGGPE FE
Sbjct  77   RINIPAVPGGPEAFE  91


 Score = 38.5 bits (88),  Expect(3) = 1e-18, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA L CAA +L+MT+ + + NL  R E +L ++ L ++S ++ V+  CE LLP
Sbjct  108  NVAMLCCAAHFLEMTEDFGEKNLEARAEAYLKEMVLPNISSSISVIHRCETLLP  161


 Score = 30.4 bits (67),  Expect(3) = 1e-18, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCYGVN EIT
Sbjct  84   PGGPEAFELAAKFCYGVNVEIT  105



>ref|XP_006855474.1| hypothetical protein AMTR_s00057p00189750 [Amborella trichopoda]
 gb|ERN16941.1| hypothetical protein AMTR_s00057p00189750 [Amborella trichopoda]
Length=611

 Score = 63.9 bits (154),  Expect(3) = 2e-18, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = +1

Query  205  QWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPE  384
            QW  S ++ +D+ V +G A+FSLHKF LV++S  IRK++ ++K++  + I L   PGGPE
Sbjct  10   QWPLS-DVSSDLTVNIGAANFSLHKFPLVSRSGKIRKILTEAKDSKASNITLHSFPGGPE  68

Query  385  IFE  393
             FE
Sbjct  69   AFE  71


 Score = 43.1 bits (100),  Expect(3) = 2e-18, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCA+++L+MT+ + + NL  RTE +L +  + ++S ++  L +CE LLP
Sbjct  88   NVAMLRCASQFLEMTEDFTERNLIYRTESYLKETVIPNISNSIAALHNCEGLLP  141


 Score = 32.3 bits (72),  Expect(3) = 2e-18, Method: Composition-based stats.
 Identities = 13/24 (54%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +2

Query  368  FPAALRSSKGAAKFCYGVNFEITV  439
            FP    + + AAKFCYG+N EIT+
Sbjct  63   FPGGPEAFELAAKFCYGLNIEITL  86



>ref|XP_010652066.1| PREDICTED: BTB/POZ domain-containing protein At1g03010 isoform 
X2 [Vitis vinifera]
Length=616

 Score = 64.7 bits (156),  Expect(3) = 2e-18, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  223  EIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFE  393
            ++ +D+ + VG +SF+LHKF LV++S  IRKL++++K++ ++RI +  +PGGPE FE
Sbjct  20   DVSSDLTIEVGASSFALHKFPLVSRSGRIRKLLLEAKDSKVSRIAIPSVPGGPEAFE  76


 Score = 43.5 bits (101),  Expect(3) = 2e-18, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRC A +L+MT+++ + NL  RTE +L +    ++S ++ VL  CE LLP
Sbjct  93   NVAMLRCVAHFLEMTEEFAEKNLETRTEGYLKETVFPNISSSISVLHQCETLLP  146


 Score = 31.2 bits (69),  Expect(3) = 2e-18, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITV  439
            P    + + AAKFCYGVN EIT+
Sbjct  69   PGGPEAFELAAKFCYGVNIEITL  91



>ref|XP_006479890.1| PREDICTED: BTB/POZ domain-containing protein At1g03010-like isoform 
X2 [Citrus sinensis]
Length=626

 Score = 68.2 bits (165),  Expect(3) = 2e-18, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  223  EIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFE  393
            ++ +D+ + VG +SF+LHKF LV++S  IRKL++++K++ ++R+NLS +PGG E FE
Sbjct  30   DVSSDLTIEVGASSFALHKFPLVSRSGRIRKLLLEAKDSKVSRVNLSAVPGGAEAFE  86


 Score = 41.2 bits (95),  Expect(3) = 2e-18, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA +RC A +L+MT+ + + NL  R E +L ++   + S ++ VLK CE LLP
Sbjct  103  NVATIRCVAHFLEMTEDFAEKNLEARAEAYLKEMVFPNTSNSISVLKCCESLLP  156


 Score = 29.6 bits (65),  Expect(3) = 2e-18, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITV  439
            P    + + AAKFCYG+N E+T+
Sbjct  79   PGGAEAFELAAKFCYGINVELTL  101



>ref|XP_009379310.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Pyrus x bretschneideri]
Length=625

 Score = 83.2 bits (204),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  354
            LS A++RT +W+FSQEIP+D+ + VG  SFSLHKF L++K  +IRKLI +S   ADL+ I
Sbjct  29   LSSALKRTSEWIFSQEIPSDISINVGGVSFSLHKFPLISKCGHIRKLISESSYAADLSVI  88

Query  355  NLSGIPGGPEIFE  393
             L  +PGG E FE
Sbjct  89   ELFDVPGGSEAFE  101


 Score = 35.8 bits (81),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 0/30 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDF  533
            N+A LRC AEYL MT+ Y   NL  R + +
Sbjct  118  NIAMLRCVAEYLLMTEDYAVGNLVERADAY  147



>ref|XP_008389180.1| PREDICTED: BTB/POZ domain-containing protein At1g03010-like [Malus 
domestica]
 ref|XP_008366991.1| PREDICTED: BTB/POZ domain-containing protein At1g03010-like [Malus 
domestica]
Length=633

 Score = 68.9 bits (167),  Expect(3) = 2e-18, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +1

Query  175  RLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  354
            R S ++    +W  S ++ +D+ V +G +SF+LHKF LV+KS  IR+L++++K+A ++RI
Sbjct  20   RPSSSIRHATEWPIS-DVSSDLTVEIGASSFALHKFPLVSKSGRIRRLLLEAKDAKVSRI  78

Query  355  NLSGIPGGPEIFE  393
             LS +PGGPE FE
Sbjct  79   ILSAVPGGPEGFE  91


 Score = 42.0 bits (97),  Expect(3) = 2e-18, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRC A +L+MT++Y + N+  R E +L +  L ++S ++ VL  CE LLP
Sbjct  108  NVAMLRCVAHFLEMTEEYAEKNMETRAEAYLKETVLPNISKSISVLHRCETLLP  161


 Score = 28.1 bits (61),  Expect(3) = 2e-18, Method: Composition-based stats.
 Identities = 11/13 (85%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEIT  436
            AAKFCYGV+ EIT
Sbjct  93   AAKFCYGVHVEIT  105



>ref|XP_009130549.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At5g67385-like [Brassica rapa]
Length=600

 Score = 77.8 bits (190),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  354
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K    +KL+ +S  ++D T I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGLFKKLVSESTNDSDATVI  68

Query  355  NLSGIPGGPEIFE  393
             +  IPGG E FE
Sbjct  69   KIPDIPGGSEAFE  81


 Score = 41.6 bits (96),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCA+EYL+MT+++   NL  R+E +L++VAL SLS A+ VL   EELLP
Sbjct  98   NIAMLRCASEYLEMTEEHSVENLISRSEAYLNEVALKSLSSAITVLHKSEELLP  151



>emb|CDY37857.1| BnaAnng05180D [Brassica napus]
Length=600

 Score = 77.8 bits (190),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  354
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K    +KL+ +S  ++D T I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGLFKKLVSESTNDSDATVI  68

Query  355  NLSGIPGGPEIFE  393
             +  IPGG E FE
Sbjct  69   KIPDIPGGSEAFE  81


 Score = 41.6 bits (96),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCA+EYL+MT+++   NL  R+E +L++VAL SLS A+ VL   EELLP
Sbjct  98   NIAMLRCASEYLEMTEEHSVENLISRSEAYLNEVALKSLSSAITVLHKSEELLP  151



>dbj|BAJ96209.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=662

 Score = 59.7 bits (143),  Expect(3) = 2e-18, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  223  EIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFE  393
            ++ +D+ V VG +SF+LHKF LV++S  IR+L+ ++K+A L R+ L   PGG   FE
Sbjct  37   DVSSDLTVEVGTSSFALHKFPLVSRSGKIRRLVAEAKDAKLARLTLHATPGGAPAFE  93


 Score = 50.8 bits (120),  Expect(3) = 2e-18, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCAA YLQMTD + D NL  RTE FL    L S++ ++ VL++CE LLP
Sbjct  110  NVAMLRCAARYLQMTDDFSDKNLELRTEAFLRDAVLPSIASSVAVLRTCEALLP  163


 Score = 28.5 bits (62),  Expect(3) = 2e-18, Method: Composition-based stats.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITV  439
            AAKFCYGV+ +ITV
Sbjct  95   AAKFCYGVHVDITV  108



>emb|CDY57436.1| BnaAnng14510D [Brassica napus]
Length=603

 Score = 79.3 bits (194),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  354
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K   I+KL+ +SK ++D + I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGLIKKLMSESKNDSDASVI  68

Query  355  NLSGIPGGPEIFE  393
             +  IPGG E FE
Sbjct  69   KIPDIPGGSEAFE  81


 Score = 39.3 bits (90),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAEYL MT+++   NL  R E +L++VAL SLS A+ VL   E+LLP
Sbjct  98   NIAMLRCAAEYLDMTEEHSVENLVVRAEAYLNEVALKSLSSAITVLHKSEDLLP  151



>ref|XP_009414870.1| PREDICTED: BTB/POZ domain-containing protein At1g03010-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=634

 Score = 74.3 bits (181),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +1

Query  175  RLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  354
            R SL+  +  +W  S ++ +D+ V VG +SF+LHKF LV++S  IRKLI D+K + +TRI
Sbjct  22   RSSLSTRQATEWPLS-DVSSDLTVEVGTSSFALHKFPLVSRSGRIRKLISDAKNSKVTRI  80

Query  355  NLSGIPGGPEIFE  393
            NL G PGG E FE
Sbjct  81   NLHGTPGGAEAFE  93


 Score = 44.3 bits (103),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCAA YL+MT+++ + NL  RTE +L +  + ++  ++ VL  CE LLP
Sbjct  110  NVAMLRCAAHYLEMTEEFAEKNLELRTEIYLKEAVIPNIVNSITVLHHCESLLP  163



>ref|XP_009378916.1| PREDICTED: BTB/POZ domain-containing protein At1g03010 [Pyrus 
x bretschneideri]
Length=633

 Score = 68.6 bits (166),  Expect(3) = 3e-18, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +1

Query  175  RLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  354
            R S ++    +W  S ++ +D+ V +G +SF+LHKF LV+KS  IRKL++++K+A ++RI
Sbjct  20   RPSSSIRHATEWPIS-DVSSDLTVEIGASSFALHKFPLVSKSGRIRKLLLEAKDAKVSRI  78

Query  355  NLSGIPGGPEIFE  393
             L+ +PGGPE FE
Sbjct  79   ILNSVPGGPEGFE  91


 Score = 42.0 bits (97),  Expect(3) = 3e-18, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRC A +L+MT++Y + N+  RTE  L +  L ++S ++ VL  CE LLP
Sbjct  108  NVAMLRCVAHFLEMTEEYAEKNMETRTEACLKETVLPNISKSISVLHRCETLLP  161


 Score = 28.1 bits (61),  Expect(3) = 3e-18, Method: Composition-based stats.
 Identities = 11/13 (85%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEIT  436
            AAKFCYGV+ EIT
Sbjct  93   AAKFCYGVHVEIT  105



>emb|CDY43566.1| BnaC02g16630D [Brassica napus]
Length=295

 Score = 75.5 bits (184),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  354
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K    +KL+ +S  ++D T I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGLFKKLVSESTNDSDATVI  68

Query  355  NLSGIPGGPEIFE  393
             +  IPG  E FE
Sbjct  69   KIPDIPGSSEAFE  81


 Score = 42.4 bits (98),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCA+EYL+MT+++   NL  R+E +L++VAL SLS A+ VL   EELLP
Sbjct  98   NIAMLRCASEYLEMTEEHSVENLVSRSEAYLNEVALKSLSSAITVLHKSEELLP  151



>gb|KDP28100.1| hypothetical protein JCGZ_13871 [Jatropha curcas]
Length=545

 Score = 66.2 bits (160),  Expect(3) = 4e-18, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  223  EIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERGG  402
            ++ +D+ V +G +SF+LHKF LV++S  IRKL++++K++ ++RIN++ +PGG E FE   
Sbjct  30   DVSSDLTVEIGASSFALHKFPLVSRSGRIRKLLLEAKDSKVSRINIAAVPGGAEAFELAA  89

Query  403  E  405
            +
Sbjct  90   K  90


 Score = 39.7 bits (91),  Expect(3) = 4e-18, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA L CAA +L+MT+ + + NL  R E +L ++ L ++S ++ VL  CE LLP
Sbjct  103  NVAMLLCAAHFLEMTEDFAEKNLEARAESYLKEMVLPNISSSISVLHRCEALLP  156


 Score = 32.0 bits (71),  Expect(3) = 4e-18, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITV  439
            AAKFCYGVN EITV
Sbjct  88   AAKFCYGVNVEITV  101



>emb|CDY68489.1| BnaCnng59210D [Brassica napus]
Length=449

 Score = 75.9 bits (185),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  354
            LS AM+RT  W+ SQE+ +DV V VGEASFSLHKF L++K    +KL+ +S  ++D T I
Sbjct  9    LSSAMKRTSVWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGLFKKLVSESTNDSDATVI  68

Query  355  NLSGIPGGPEIFE  393
             +  IPGG E FE
Sbjct  69   KIPDIPGGSEAFE  81


 Score = 42.0 bits (97),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCA+EYL+MT+++   NL  R+E +L++VAL SLS A+ VL   EELLP
Sbjct  98   NIAMLRCASEYLEMTEEHSVENLVSRSEAYLNEVALKSLSSAITVLHKSEELLP  151



>ref|XP_011033590.1| PREDICTED: BTB/POZ domain-containing protein At1g03010 isoform 
X2 [Populus euphratica]
Length=642

 Score = 68.9 bits (167),  Expect(3) = 5e-18, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  223  EIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFE  393
            ++ +D+ V VG A+F+LHKF LV++S  IRKL++++KE  ++RIN+  +PGGPE FE
Sbjct  45   DVSSDLTVEVGAANFALHKFPLVSRSGRIRKLLLEAKELKISRINIPAVPGGPEAFE  101


 Score = 38.1 bits (87),  Expect(3) = 5e-18, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA L CAA +L+MT+ + + NL  R E +L ++ L ++S ++ V+  CE LLP
Sbjct  118  NVAMLCCAAHFLEMTEDFGEKNLEARAEAYLKEMVLPNISSSISVIHRCETLLP  171


 Score = 30.4 bits (67),  Expect(3) = 5e-18, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCYGVN EIT
Sbjct  94   PGGPEAFELAAKFCYGVNVEIT  115



>ref|XP_009103425.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Brassica 
rapa]
Length=601

 Score = 78.6 bits (192),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  354
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K   I+KL+ +SK ++D + I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGLIKKLMSESKNDSDASVI  68

Query  355  NLSGIPGGPEIFE  393
             +  IPGG E FE
Sbjct  69   KIPDIPGGFEAFE  81


 Score = 39.3 bits (90),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAEYL MT+++   NL  R E +L++VAL SLS A+ VL   E+LLP
Sbjct  98   NIAMLRCAAEYLDMTEEHSVENLVVRAEAYLNEVALKSLSSAITVLHKSEDLLP  151



>ref|XP_003600551.1| Root phototropism protein [Medicago truncatula]
Length=513

 Score = 63.5 bits (153),  Expect(3) = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCAAE+LQMTD+YCDNNLAGRT++FLS+VA  +L+G++ VLKSC  LLP
Sbjct  41   NVAVLRCAAEFLQMTDQYCDNNLAGRTDEFLSKVAFFTLTGSVAVLKSCHHLLP  94


 Score = 37.7 bits (86),  Expect(3) = 5e-18, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  322  MDSKEADLTRINLSGIPGGPEIFERGGE  405
            M+S E  LTRI+LS IPGG  IFE+  +
Sbjct  1    MESDETHLTRIDLSDIPGGSGIFEKAAK  28


 Score = 36.6 bits (83),  Expect(3) = 5e-18, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITVH  442
            AAKFCYGVNFEITVH
Sbjct  26   AAKFCYGVNFEITVH  40



>ref|XP_010685004.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Beta 
vulgaris subsp. vulgaris]
Length=610

 Score = 66.6 bits (161),  Expect(3) = 5e-18, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +1

Query  193  ERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  372
            +R+ +W+F +++P+D+ + V   +F+LHKF LV++S  +RKL+ D +++D+++I L  +P
Sbjct  17   QRSNEWIF-RDVPSDITLEVPGGTFALHKFPLVSRSGRLRKLVADYRDSDISKIELPNLP  75

Query  373  GGPEIFE  393
            GG E FE
Sbjct  76   GGAESFE  82


 Score = 38.1 bits (87),  Expect(3) = 5e-18, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA L C ++YL+MT+ Y  ++L  R E++L  V   +L   + VLK CE LLP
Sbjct  99   NVAQLCCVSDYLEMTENYSKDSLGSRAEEYLDSVVCKNLEMCVEVLKQCENLLP  152


 Score = 32.7 bits (73),  Expect(3) = 5e-18, Method: Composition-based stats.
 Identities = 14/23 (61%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = +2

Query  368  FPAALRSSKGAAKFCYGVNFEIT  436
             P    S + AAKFCYG NFEIT
Sbjct  74   LPGGAESFELAAKFCYGNNFEIT  96



>ref|XP_006844655.1| hypothetical protein AMTR_s00016p00237490 [Amborella trichopoda]
 gb|ERN06330.1| hypothetical protein AMTR_s00016p00237490 [Amborella trichopoda]
Length=616

 Score = 76.3 bits (186),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +1

Query  190  MERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGI  369
            M++T  W+ + ++P+D+ V VG  +FSLHKF L ++S  IRKL+   K+  +T+INLS I
Sbjct  26   MQKTSDWLLT-DVPSDLTVEVGSKNFSLHKFPLASQSGRIRKLLAQPKDVKITKINLSDI  84

Query  370  PGGPEIFERGGE  405
            PGGPE FE   +
Sbjct  85   PGGPEAFEHAAK  96


 Score = 41.6 bits (96),  Expect(2) = 5e-18, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCAA+YL+MT++Y   +L  RTE  L+++ + S+  ++ VL  CE L+P
Sbjct  109  NVAMLRCAADYLEMTEEYGQGSLESRTERHLNEIVIPSIPLSVTVLHRCETLIP  162



>ref|XP_008386633.1| PREDICTED: BTB/POZ domain-containing protein At1g03010-like isoform 
X1 [Malus domestica]
Length=634

 Score = 63.9 bits (154),  Expect(3) = 5e-18, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  169  ATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  348
            + R S ++    +W  S ++ +D+ V +G +S +LHKF LV++S  IRKL++++K++ ++
Sbjct  19   SIRPSSSIRHATEWPIS-DVSSDLTVEIGASSLALHKFPLVSRSGRIRKLLLEAKDSKVS  77

Query  349  RINLSGIPGGPEIFE  393
            RI L+ +PGGPE FE
Sbjct  78   RIILASVPGGPEGFE  92


 Score = 43.1 bits (100),  Expect(3) = 5e-18, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRC A +L+MT++Y + N+  RTE +L +    +++ ++ VL  CE LLP
Sbjct  109  NVATLRCVAHFLEMTEEYAEKNMETRTEAYLKETVFPNIAKSISVLHRCEILLP  162


 Score = 30.4 bits (67),  Expect(3) = 5e-18, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEIT  436
            AAKFCYGVN EIT
Sbjct  94   AAKFCYGVNVEIT  106



>gb|EYU46717.1| hypothetical protein MIMGU_mgv1a003257mg [Erythranthe guttata]
Length=596

 Score = 75.9 bits (185),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  223  EIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERGG  402
            ++ +D+ + VG ASF+LHKF LV++S  IRKL+M+SK++ ++R+NLSG+PGGP  FE+  
Sbjct  7    DVSSDLTIEVGSASFALHKFPLVSRSGRIRKLLMESKDSKISRLNLSGVPGGPHTFEQAA  66

Query  403  E  405
            +
Sbjct  67   K  67


 Score = 41.2 bits (95),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAA +L+M ++Y + NL  RTE +L    L S+  ++ VL  C+ L+P
Sbjct  80   NIATLRCAAHFLEMNEEYSEKNLESRTEAYLKDTILPSIPNSITVLHHCQNLIP  133



>ref|XP_006444252.1| hypothetical protein CICLE_v10019309mg [Citrus clementina]
 gb|ESR57492.1| hypothetical protein CICLE_v10019309mg [Citrus clementina]
Length=626

 Score = 68.2 bits (165),  Expect(3) = 7e-18, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  223  EIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFE  393
            ++ +D+ + VG +SF+LHKF LV++S  IRKL++++K++ ++R+NLS +PGG E FE
Sbjct  30   DVSSDLTIEVGASSFALHKFPLVSRSGRIRKLLLEAKDSKVSRVNLSAVPGGAEAFE  86


 Score = 39.3 bits (90),  Expect(3) = 7e-18, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA +RC A +L+MT+ + + N+  R E +L ++   + S ++ VLK CE LLP
Sbjct  103  NVATIRCVAHFLEMTEDFAEKNVEARAEAYLKEMVFPNTSNSISVLKCCEGLLP  156


 Score = 29.6 bits (65),  Expect(3) = 7e-18, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITV  439
            P    + + AAKFCYG+N E+T+
Sbjct  79   PGGAEAFELAAKFCYGINVELTL  101



>gb|EYU39234.1| hypothetical protein MIMGU_mgv1a003527mg [Erythranthe guttata]
Length=580

 Score = 66.2 bits (160),  Expect(3) = 8e-18, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +1

Query  193  ERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  372
            +R  +WVF +++P+D+ + V   +F LHKF LV++S  IRKL+ D +++D++RI L  + 
Sbjct  8    QRCSEWVF-RDVPSDITIEVDGTTFLLHKFPLVSRSGRIRKLVADHRDSDISRIELVSLQ  66

Query  373  GGPEIFERGGE  405
            GG + FE   +
Sbjct  67   GGADSFELAAQ  77


 Score = 40.0 bits (92),  Expect(3) = 8e-18, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA L C ++YL+MT+ Y  NNL  R E++L  +   SL   + VL+ CE+LLP
Sbjct  90   NVAHLYCISDYLEMTEDYSKNNLFTRAEEYLEIIVSKSLEMCVKVLQQCEKLLP  143


 Score = 30.8 bits (68),  Expect(3) = 8e-18, Method: Compositional matrix adjust.
 Identities = 12/13 (92%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEIT  436
            AA+FCYGVNFEIT
Sbjct  75   AAQFCYGVNFEIT  87



>dbj|BAK07863.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=613

 Score = 73.2 bits (178),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +1

Query  181  SLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINL  360
            S AM+RT  W+ SQE P+D+ + VGE+SF+LHK  L +K  YIRKL+  +  + +T + +
Sbjct  9    SAAMKRTSDWIRSQEFPSDITIQVGESSFNLHKLPLASKCGYIRKLVSGANGSRVTHLEI  68

Query  361  SGIPGGPEIFE  393
            +G+PG  + F+
Sbjct  69   TGMPGDAKAFD  79


 Score = 43.9 bits (102),  Expect(2) = 8e-18, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCAAE+L+MT++    NL GRTE +L +VAL+SL GA+  L+  EELLP
Sbjct  96   NVAMLRCAAEHLEMTEECKPGNLVGRTEAYLEEVALASLEGAVAALRRAEELLP  149



>emb|CDY12841.1| BnaC07g15920D [Brassica napus]
Length=603

 Score = 74.7 bits (182),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  354
            LS AM+RT +W+ SQE+ +DV V VGEASF LHKF L++K   I+KL+ ++K ++D + I
Sbjct  9    LSSAMKRTSEWISSQEVCSDVTVHVGEASFLLHKFPLLSKCGLIKKLVSETKNDSDASLI  68

Query  355  NLSGIPGGPEIFE  393
             +  IPGG E FE
Sbjct  69   KIPYIPGGSEAFE  81


 Score = 42.0 bits (97),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAEYL+MT+++   NL  R E +L++VAL SLS A+ VL   EELLP
Sbjct  98   NIAMLRCAAEYLEMTEEHSVENLVVRAEAYLNEVALKSLSSAITVLHKSEELLP  151



>ref|XP_006429637.1| hypothetical protein CICLE_v10011315mg [Citrus clementina]
 ref|XP_006481238.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform 
X1 [Citrus sinensis]
 gb|ESR42877.1| hypothetical protein CICLE_v10011315mg [Citrus clementina]
Length=611

 Score = 57.8 bits (138),  Expect(3) = 1e-17, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +1

Query  211  VFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF  390
            +FS ++  D+ + V   SF LHKF LV++S  IRK++ D+K+++ +++ L  IPGGP+ F
Sbjct  32   IFS-DVAGDITIVVDGESFLLHKFPLVSRSGKIRKMVADAKDSNSSKLELHNIPGGPQTF  90

Query  391  E  393
            E
Sbjct  91   E  91


 Score = 47.4 bits (111),  Expect(3) = 1e-17, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA+LRCAAEYL+MT+ Y D NL  RTE +L++V + SL  ++ VL  CE L P
Sbjct  108  NVASLRCAAEYLEMTEDYRDENLVARTEVYLNEVVVQSLEKSVEVLSICEMLPP  161


 Score = 31.2 bits (69),  Expect(3) = 1e-17, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P   ++ + A KFCYG+NFEIT
Sbjct  84   PGGPQTFELAVKFCYGMNFEIT  105



>ref|XP_010069979.1| PREDICTED: BTB/POZ domain-containing protein At1g03010-like [Eucalyptus 
grandis]
 gb|KCW58528.1| hypothetical protein EUGRSUZ_H01197 [Eucalyptus grandis]
Length=658

 Score = 63.5 bits (153),  Expect(3) = 1e-17, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 50/73 (68%), Gaps = 1/73 (1%)
 Frame = +1

Query  175  RLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  354
            R S ++  T +W  S ++ +D+ + VG  +F+ HKF LV++S  I KL++D+KE+  +RI
Sbjct  22   RPSSSVRHTVEWPIS-DVSSDLTIEVGATTFAFHKFPLVSRSGRILKLLVDTKESKASRI  80

Query  355  NLSGIPGGPEIFE  393
            +L  +PGGP+ FE
Sbjct  81   SLRDVPGGPQAFE  93


 Score = 44.3 bits (103),  Expect(3) = 1e-17, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRC A YL+MT++  + NLA RTE ++  + L ++S ++ VL+ C++LLP
Sbjct  110  NVATLRCVAHYLEMTEELAEKNLAYRTEAYIKDMVLPNISSSITVLQQCQKLLP  163


 Score = 28.5 bits (62),  Expect(3) = 1e-17, Method: Composition-based stats.
 Identities = 10/23 (43%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITV  439
            P   ++ + AAKFCYG+N +I++
Sbjct  86   PGGPQAFEIAAKFCYGINIDISL  108



>ref|XP_009783326.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like [Nicotiana 
sylvestris]
 ref|XP_009783328.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like [Nicotiana 
sylvestris]
Length=592

 Score = 58.2 bits (139),  Expect(3) = 1e-17, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 47/83 (57%), Gaps = 11/83 (13%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            M SP  S  TR           +FS E+  D+ +     SF LHKF LV+ S  IRK++ 
Sbjct  1    MVSPYNSFTTR----------TIFS-EVAGDITIAANGESFLLHKFPLVSLSGKIRKMVA  49

Query  325  DSKEADLTRINLSGIPGGPEIFE  393
            D+ + +L+ ++L+ +PGGPE FE
Sbjct  50   DANDPNLSELDLNHVPGGPETFE  72


 Score = 47.0 bits (110),  Expect(3) = 1e-17, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRC AEYL+MT+ Y + NL  RTE FL +V   SL  ++ VL SCE LLP
Sbjct  89   NVARLRCVAEYLEMTEDYREENLIARTETFLDEVVSPSLEKSVQVLSSCEALLP  142


 Score = 30.8 bits (68),  Expect(3) = 1e-17, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEITV  439
            AAKFCYG+NFEIT 
Sbjct  74   AAKFCYGMNFEITT  87



>ref|XP_009605134.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform 
X1 [Nicotiana tomentosiformis]
Length=624

 Score = 55.1 bits (131),  Expect(3) = 1e-17, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 46/83 (55%), Gaps = 11/83 (13%)
 Frame = +1

Query  145  MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIM  324
            M SP  S  TR           +FS E+  D+ +     SF LHKF LV+ S  I+K++ 
Sbjct  33   MVSPYNSFTTR----------TIFS-EVAGDITIAANGESFLLHKFPLVSLSGKIQKMVA  81

Query  325  DSKEADLTRINLSGIPGGPEIFE  393
            D+ + +L  ++L+ +PGGPE FE
Sbjct  82   DANDPNLPELDLTHVPGGPETFE  104


 Score = 48.5 bits (114),  Expect(3) = 1e-17, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRC AEYL+MT+ Y + NL  RTE FL +V   SL  ++ VL SCE LLP
Sbjct  121  NVARLRCVAEYLEMTEDYREENLIARTETFLDEVVSPSLEKSVQVLSSCEALLP  174


 Score = 32.3 bits (72),  Expect(3) = 1e-17, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCYG+NFEIT
Sbjct  97   PGGPETFELAAKFCYGMNFEIT  118



>ref|XP_003558544.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Brachypodium 
distachyon]
Length=625

 Score = 74.3 bits (181),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 31/71 (44%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +1

Query  181  SLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINL  360
            S AM+RT  W+ SQE P+D+ + VG+ +F+LHK  L +K  YIRKL+  +  + +T + +
Sbjct  9    SAAMKRTSDWIRSQEFPSDITIQVGDGTFNLHKLPLASKCGYIRKLVSGANGSRVTHLEI  68

Query  361  SGIPGGPEIFE  393
             G+PGG + FE
Sbjct  69   PGLPGGAKAFE  79


 Score = 41.6 bits (96),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCAAE+L+MT++    NL GR E +L +VAL+SL+G++  L++ EELLP
Sbjct  96   NVAMLRCAAEHLEMTEECKPGNLIGRAEAYLEEVALASLAGSVAALRASEELLP  149



>ref|XP_002877714.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53973.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=551

 Score = 79.7 bits (195),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = +1

Query  178  LSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLI-MDSKEADLTRI  354
            LS AMERT +W+ SQ+IP+DV V VGE SFSLHKF LV+K  +I+KL    S ++++T I
Sbjct  8    LSSAMERTSEWISSQKIPSDVTVHVGETSFSLHKFPLVSKCGFIKKLASKSSNDSNITVI  67

Query  355  NLSGIPGGPEIFE  393
             L   PGG E FE
Sbjct  68   KLPDFPGGAEAFE  80


 Score = 36.6 bits (83),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRCAAEYL+MT+++   NL    E +L++V L SLS ++ VL+  ++LLP
Sbjct  97   NIAMLRCAAEYLEMTEEHSVENLVETIEVYLNEVVLKSLSKSVKVLRKSQDLLP  150



>ref|XP_008386634.1| PREDICTED: BTB/POZ domain-containing protein At1g03010-like isoform 
X2 [Malus domestica]
Length=621

 Score = 63.2 bits (152),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  223  EIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFE  393
            ++ +D+ V +G +S +LHKF LV++S  IRKL++++K++ ++RI L+ +PGGPE FE
Sbjct  23   DVSSDLTVEIGASSLALHKFPLVSRSGRIRKLLLEAKDSKVSRIILASVPGGPEGFE  79


 Score = 42.7 bits (99),  Expect(3) = 2e-17, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRC A +L+MT++Y + N+  RTE +L +    +++ ++ VL  CE LLP
Sbjct  96   NVATLRCVAHFLEMTEEYAEKNMETRTEAYLKETVFPNIAKSISVLHRCEILLP  149


 Score = 30.4 bits (67),  Expect(3) = 2e-17, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEIT  436
            AAKFCYGVN EIT
Sbjct  81   AAKFCYGVNVEIT  93



>ref|XP_011468062.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=615

 Score = 63.9 bits (154),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 11/84 (13%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLI  321
            NM+S  K     L+ A++RT +         DV V VGE SFSLHKF LV+K  YIRKL+
Sbjct  18   NMSSKKKEL---LTSALKRTSEC--------DVSVRVGEVSFSLHKFPLVSKCGYIRKLV  66

Query  322  MDSKEADLTRINLSGIPGGPEIFE  393
             +S + +++ I L  +PGG E FE
Sbjct  67   SESTDDEISVIELPDVPGGAEAFE  90


 Score = 39.7 bits (91),  Expect(3) = 2e-17, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+A LRC +EYL MT++Y   NL GRT+ +L++VAL SL+GA+ VL + E  LP
Sbjct  107  NIAMLRCVSEYLLMTEEYAIGNLVGRTDAYLNEVALKSLAGAVSVLHTAESFLP  160


 Score = 32.3 bits (72),  Expect(3) = 2e-17, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEIT  436
            P    + + AAKFCYG+NFEI+
Sbjct  83   PGGAEAFELAAKFCYGINFEIS  104



>ref|XP_006389692.1| hypothetical protein POPTR_0020s00510g [Populus trichocarpa]
 gb|ERP48606.1| hypothetical protein POPTR_0020s00510g [Populus trichocarpa]
Length=631

 Score = 67.4 bits (163),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +1

Query  169  ATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  348
            A R S ++    +W  S ++ +D+ + VG ++F+LHKF LV++S  IRKL++++K++ ++
Sbjct  18   AFRPSSSIRHATEWPIS-DVSSDLTIEVGASNFALHKFPLVSRSGRIRKLLLEAKDSKIS  76

Query  349  RINLSGIPGGPEIFE  393
            RIN+  +PGGPE FE
Sbjct  77   RINIPAVPGGPEGFE  91


 Score = 35.0 bits (79),  Expect(3) = 2e-17, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA L C A +L+MT+   + NL  R E +L ++ L ++S ++ VL  CE LLP
Sbjct  108  NVAMLCCTARFLEMTEDLAEKNLEARAEAYLKEMVLPNISISISVLHRCETLLP  161


 Score = 33.1 bits (74),  Expect(3) = 2e-17, Method: Composition-based stats.
 Identities = 13/13 (100%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEIT  436
            AAKFCYGVNFEIT
Sbjct  93   AAKFCYGVNFEIT  105



>ref|XP_002465671.1| hypothetical protein SORBIDRAFT_01g043470 [Sorghum bicolor]
 gb|EER92669.1| hypothetical protein SORBIDRAFT_01g043470 [Sorghum bicolor]
Length=598

 Score = 72.8 bits (177),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  187  AMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSG  366
            AM R   W+ SQE P+D+ + VGEA+F+LHK  L ++ +YIRK +     + +T I+L+G
Sbjct  10   AMRRISDWIMSQEFPSDITIQVGEATFNLHKLPLASRCDYIRKQVSGINGSRVTHIDLTG  69

Query  367  IPGGPEIFE  393
            +PGG   FE
Sbjct  70   MPGGAAAFE  78


 Score = 43.5 bits (101),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCAAE+L+MTD     NLA RTE +L  VAL+SL+GA+ VL+  E+LLP
Sbjct  95   NVAMLRCAAEHLEMTDDSMGGNLAARTEAYLEAVALTSLAGAVTVLRRSEDLLP  148



>ref|XP_010684491.1| PREDICTED: BTB/POZ domain-containing protein At1g03010 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=636

 Score = 60.1 bits (144),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 53/77 (69%), Gaps = 6/77 (8%)
 Frame = +1

Query  163  SAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEAD  342
            S++TR     +   +W  S ++ +D+ + +G +SF+LHKF LV++S  IRKL++++K++ 
Sbjct  22   SSSTR-----QHATEWPIS-DVTSDLTIEMGGSSFALHKFPLVSRSGRIRKLLLEAKDSK  75

Query  343  LTRINLSGIPGGPEIFE  393
             +RI+L  +PGG E FE
Sbjct  76   SSRISLPTVPGGSEAFE  92


 Score = 45.1 bits (105),  Expect(3) = 2e-17, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA LRCAA +L+MTD Y + +L  RTE +L    L+++S +++VL  CE LLP
Sbjct  109  NVAMLRCAAHFLEMTDDYAEKSLETRTEVYLKDTVLTNISNSILVLHRCETLLP  162


 Score = 30.4 bits (67),  Expect(3) = 2e-17, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITV  439
            P    + + AAKFCYG+N EIT+
Sbjct  85   PGGSEAFELAAKFCYGINVEITL  107



>ref|XP_011015142.1| PREDICTED: BTB/POZ domain-containing protein At1g03010-like isoform 
X1 [Populus euphratica]
Length=631

 Score = 67.0 bits (162),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  169  ATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  348
            A R S ++    +W  S ++ +D+ + VG ++F+LHKF LV++S  IRKL++++K+  ++
Sbjct  18   AFRPSSSIRHATEWPIS-DVSSDLTIEVGASNFALHKFPLVSRSGRIRKLLLEAKDTKIS  76

Query  349  RINLSGIPGGPEIFE  393
            RIN+  +PGGPE FE
Sbjct  77   RINIPAVPGGPEGFE  91


 Score = 35.4 bits (80),  Expect(3) = 2e-17, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            NVA L C A +L+MT+   + NL  R E +L ++ L ++S ++ VL  CE LLP
Sbjct  108  NVAMLCCTARFLEMTEDVVEKNLEARAEAYLKEMVLPNISISISVLHRCETLLP  161


 Score = 33.1 bits (74),  Expect(3) = 2e-17, Method: Composition-based stats.
 Identities = 13/13 (100%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +2

Query  398  AAKFCYGVNFEIT  436
            AAKFCYGVNFEIT
Sbjct  93   AAKFCYGVNFEIT  105



>ref|XP_003528390.2| PREDICTED: root phototropism protein 3-like isoform X1 [Glycine 
max]
Length=747

 Score = 71.2 bits (173),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +1

Query  190  MERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGI  369
             +R   W  S +IP+D++V +G+A+F LHK+ L+++S  + ++I DS++ DL++I +  +
Sbjct  104  QQRGNSWYVSADIPSDLLVQIGDANFHLHKYPLLSRSGKLNRIIYDSRDPDLSKIVMDDL  163

Query  370  PGGPEIFE  393
            PGGPE FE
Sbjct  164  PGGPEAFE  171


 Score = 40.4 bits (93),  Expect(3) = 2e-17, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N++ LRCAAEYL+MT+   + NL  +TE FLS V LSS   ++VVLKSCE+L P
Sbjct  188  NISGLRCAAEYLEMTEDLEEGNLIFKTEAFLSYVVLSSWRDSIVVLKSCEKLSP  241


 Score = 23.9 bits (50),  Expect(3) = 2e-17, Method: Composition-based stats.
 Identities = 8/23 (35%), Positives = 14/23 (61%), Gaps = 0/23 (0%)
 Frame = +2

Query  368  FPAALRSSKGAAKFCYGVNFEIT  436
             P    + + A+KFCYG+  ++T
Sbjct  163  LPGGPEAFELASKFCYGIAIDLT  185



>gb|KDO87367.1| hypothetical protein CISIN_1g038941mg [Citrus sinensis]
Length=615

 Score = 68.9 bits (167),  Expect(3) = 2e-17, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +1

Query  175  RLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  354
            R S ++    +W  S ++ +D+ + VG +SF+LHKF LV++S  IRKL++++K++ ++R+
Sbjct  20   RPSSSIRHATEWPIS-DVSSDLTIEVGASSFALHKFPLVSRSGRIRKLLLEAKDSKVSRV  78

Query  355  NLSGIPGGPEIFE  393
            NLS +PGG E FE
Sbjct  79   NLSAVPGGAEAFE  91


 Score = 36.6 bits (83),  Expect(3) = 2e-17, Method: Composition-based stats.
 Identities = 13/30 (43%), Positives = 20/30 (67%), Gaps = 0/30 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDF  533
            NVA +RC A +L+MT+ + + NL  R E +
Sbjct  108  NVATIRCVAHFLEMTEDFAEKNLEARAEAY  137


 Score = 30.0 bits (66),  Expect(3) = 2e-17, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFEITV  439
            P    + + AAKFCYG+N E+T+
Sbjct  84   PGGAEAFELAAKFCYGINVELTL  106



>ref|NP_182307.1| phototropic-responsive NPH3 family protein SETH6 [Arabidopsis 
thaliana]
 sp|O82253.1|SETH6_ARATH RecName: Full=BTB/POZ domain-containing protein SETH6 [Arabidopsis 
thaliana]
 gb|AAC63640.1| unknown protein [Arabidopsis thaliana]
 gb|AAM15126.1| unknown protein [Arabidopsis thaliana]
 gb|AEC10900.1| phototropic-responsive NPH3 family protein SETH6 [Arabidopsis 
thaliana]
Length=635

 Score = 66.6 bits (161),  Expect(3) = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 4/84 (5%)
 Frame = +1

Query  142  NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVGVGEASFSLHKFMLVAKSNYIRKLI  321
            N  S     A R S ++  T QW  S ++ +D+ + VG A+FSLHKF LV++S  IRKL+
Sbjct  10   NKQSVAAKRAFRPSSSIRHTPQWPVS-DVTSDLTIEVGSATFSLHKFPLVSRSGRIRKLV  68

Query  322  MDSKEADLTRINLSGIPGGPEIFE  393
            ++SK+   T +NL+ +PGG E FE
Sbjct  69   LESKD---TNLNLAAVPGGSESFE  89


 Score = 44.7 bits (104),  Expect(3) = 3e-17, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  NVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLP  605
            N+AALRC A YL+MT+   + NL  RTE +L     + +S ++ VL SCE LLP
Sbjct  106  NIAALRCVAHYLEMTEDLSEKNLEARTEAYLKDSIFNDISNSITVLHSCERLLP  159


 Score = 24.3 bits (51),  Expect(3) = 3e-17, Method: Composition-based stats.
 Identities = 10/20 (50%), Positives = 12/20 (60%), Gaps = 0/20 (0%)
 Frame = +2

Query  371  PAALRSSKGAAKFCYGVNFE  430
            P    S + AAKFCYGV  +
Sbjct  82   PGGSESFELAAKFCYGVGVQ  101



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370