BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF008K19

Length=549
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009758209.1|  PREDICTED: WD repeat-containing protein 26-l...    166   1e-44   Nicotiana sylvestris
ref|XP_009758206.1|  PREDICTED: WD repeat-containing protein 26-l...    166   1e-44   Nicotiana sylvestris
ref|XP_009608371.1|  PREDICTED: WD repeat-containing protein 26-l...    164   3e-44   Nicotiana tomentosiformis
ref|XP_009608368.1|  PREDICTED: WD repeat-containing protein 26-l...    164   3e-44   Nicotiana tomentosiformis
ref|XP_009631029.1|  PREDICTED: WD repeat-containing protein 26-l...    163   9e-44   Nicotiana tomentosiformis
ref|XP_009631025.1|  PREDICTED: WD repeat-containing protein 26-l...    163   1e-43   Nicotiana tomentosiformis
ref|XP_006354306.1|  PREDICTED: WD repeat-containing protein 26-like    163   1e-43   Solanum tuberosum [potatoes]
emb|CDP17860.1|  unnamed protein product                                159   4e-42   Coffea canephora [robusta coffee]
ref|XP_009780908.1|  PREDICTED: WD repeat-containing protein 26-like    159   4e-42   Nicotiana sylvestris
ref|XP_004252042.1|  PREDICTED: WD repeat-containing protein 26-like    151   1e-41   
ref|XP_004243618.1|  PREDICTED: WD repeat-containing protein 26         157   1e-41   Solanum lycopersicum
emb|CAN80620.1|  hypothetical protein VITISV_007853                     152   4e-41   Vitis vinifera
ref|XP_006366633.1|  PREDICTED: WD repeat-containing protein 26-like    155   5e-41   Solanum tuberosum [potatoes]
ref|XP_009618673.1|  PREDICTED: WD repeat-containing protein 26-like    155   5e-41   Nicotiana tomentosiformis
ref|XP_006351997.1|  PREDICTED: WD repeat-containing protein 26-l...    154   2e-40   Solanum tuberosum [potatoes]
ref|XP_011085429.1|  PREDICTED: WD repeat-containing protein 26-like    153   3e-40   Sesamum indicum [beniseed]
ref|XP_010657105.1|  PREDICTED: WD repeat-containing protein 26-like    152   1e-39   
ref|XP_010321118.1|  PREDICTED: WD repeat-containing protein 26 i...    151   1e-39   Solanum lycopersicum
ref|XP_004239310.1|  PREDICTED: WD repeat-containing protein 26 i...    150   2e-39   Solanum lycopersicum
ref|XP_007048928.1|  Transducin family protein / WD-40 repeat fam...    150   6e-39   Theobroma cacao [chocolate]
ref|XP_007048927.1|  Transducin family protein / WD-40 repeat fam...    149   9e-39   
gb|KJB33387.1|  hypothetical protein B456_006G008900                    148   2e-38   Gossypium raimondii
gb|KJB33386.1|  hypothetical protein B456_006G008900                    148   2e-38   Gossypium raimondii
ref|XP_009765607.1|  PREDICTED: WD repeat-containing protein 26-l...    148   3e-38   Nicotiana sylvestris
ref|XP_010256452.1|  PREDICTED: WD repeat-containing protein 26 i...    147   4e-38   Nelumbo nucifera [Indian lotus]
gb|KHG12711.1|  wdr26                                                   147   7e-38   Gossypium arboreum [tree cotton]
ref|XP_011100492.1|  PREDICTED: WD repeat-containing protein 26-l...    147   7e-38   Sesamum indicum [beniseed]
ref|XP_008811627.1|  PREDICTED: WD repeat-containing protein 26-like    143   8e-38   Phoenix dactylifera
gb|KDP29808.1|  hypothetical protein JCGZ_19323                         145   2e-37   Jatropha curcas
ref|XP_006484997.1|  PREDICTED: WD repeat-containing protein 26-l...    144   5e-37   Citrus sinensis [apfelsine]
ref|XP_006437085.1|  hypothetical protein CICLE_v10031058mg             144   5e-37   
gb|KJB48956.1|  hypothetical protein B456_008G095100                    144   9e-37   Gossypium raimondii
ref|XP_010275088.1|  PREDICTED: WD repeat-containing protein 26-like    139   2e-36   
ref|XP_004491280.1|  PREDICTED: WD repeat-containing protein 26-like    142   2e-36   Cicer arietinum [garbanzo]
ref|XP_008790475.1|  PREDICTED: WD repeat-containing protein 26-like    142   3e-36   Phoenix dactylifera
ref|XP_010906218.1|  PREDICTED: WD repeat-containing protein 26-like    142   3e-36   Elaeis guineensis
ref|XP_009377000.1|  PREDICTED: WD repeat-containing protein 26-like    141   7e-36   Pyrus x bretschneideri [bai li]
ref|XP_010103563.1|  WD repeat-containing protein 26                    142   8e-36   
gb|EPS60063.1|  hypothetical protein M569_14740                         141   8e-36   Genlisea aurea
ref|XP_010943696.1|  PREDICTED: uncharacterized WD repeat-contain...    140   9e-36   Elaeis guineensis
gb|KHG30817.1|  WD repeat-containing 26                                 140   1e-35   Gossypium arboreum [tree cotton]
ref|XP_008342331.1|  PREDICTED: WD repeat-containing protein 26-like    140   1e-35   Malus domestica [apple tree]
ref|XP_006602270.1|  PREDICTED: WD repeat-containing protein 26-l...    140   1e-35   Glycine max [soybeans]
ref|XP_006448494.1|  hypothetical protein CICLE_v10014731mg             140   1e-35   
ref|XP_006602271.1|  PREDICTED: WD repeat-containing protein 26-l...    140   1e-35   Glycine max [soybeans]
ref|XP_006448495.1|  hypothetical protein CICLE_v10014731mg             140   2e-35   Citrus clementina [clementine]
ref|XP_011032764.1|  PREDICTED: WD repeat-containing protein 26-like    140   2e-35   Populus euphratica
ref|XP_008775985.1|  PREDICTED: WD repeat-containing protein 26-like    140   2e-35   Phoenix dactylifera
ref|XP_008229590.1|  PREDICTED: WD repeat-containing protein 26-like    140   2e-35   Prunus mume [ume]
ref|XP_002513152.1|  WD-repeat protein, putative                        140   2e-35   Ricinus communis
ref|XP_006448496.1|  hypothetical protein CICLE_v10014731mg             140   2e-35   Citrus clementina [clementine]
ref|XP_009356585.1|  PREDICTED: WD repeat-containing protein 26-like    140   2e-35   Pyrus x bretschneideri [bai li]
ref|XP_002306758.1|  hypothetical protein POPTR_0005s22820g             139   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_004303899.1|  PREDICTED: WD repeat-containing protein 26         139   3e-35   Fragaria vesca subsp. vesca
gb|KDO77043.1|  hypothetical protein CISIN_1g008011mg                   139   3e-35   Citrus sinensis [apfelsine]
ref|XP_002302127.1|  hypothetical protein POPTR_0002s05670g             139   3e-35   Populus trichocarpa [western balsam poplar]
ref|XP_006468684.1|  PREDICTED: WD repeat-containing protein 26-l...    139   4e-35   Citrus sinensis [apfelsine]
ref|XP_010093188.1|  WD repeat-containing protein 26                    139   4e-35   
ref|XP_006468682.1|  PREDICTED: WD repeat-containing protein 26-l...    139   5e-35   Citrus sinensis [apfelsine]
ref|XP_007217238.1|  hypothetical protein PRUPE_ppa006325mg             137   6e-35   
ref|XP_008380168.1|  PREDICTED: WD repeat-containing protein 26-like    138   6e-35   
ref|XP_008221109.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    137   1e-34   Prunus mume [ume]
ref|XP_011026207.1|  PREDICTED: WD repeat-containing protein 26-like    137   2e-34   Populus euphratica
ref|XP_004149516.1|  PREDICTED: WD repeat-containing protein 26-like    137   2e-34   
ref|XP_004162570.1|  PREDICTED: WD repeat-containing protein 26-like    137   2e-34   
ref|XP_007146281.1|  hypothetical protein PHAVU_006G027500g             137   2e-34   Phaseolus vulgaris [French bean]
ref|XP_003617329.1|  WD-repeat protein-like protein                     135   9e-34   Medicago truncatula
ref|XP_007043170.1|  Transducin family protein / WD-40 repeat fam...    134   2e-33   
ref|XP_011000199.1|  PREDICTED: WD repeat-containing protein 26-like    134   2e-33   Populus euphratica
ref|XP_008466801.1|  PREDICTED: uncharacterized WD repeat-contain...    134   2e-33   Cucumis melo [Oriental melon]
ref|XP_007141447.1|  hypothetical protein PHAVU_008G196400g             134   3e-33   Phaseolus vulgaris [French bean]
ref|XP_010054068.1|  PREDICTED: WD repeat-containing protein 26         132   8e-33   Eucalyptus grandis [rose gum]
ref|XP_003532075.1|  PREDICTED: WD repeat-containing protein 26-like    132   1e-32   Glycine max [soybeans]
ref|XP_009405376.1|  PREDICTED: WD repeat-containing protein 26-like    131   2e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006399360.1|  hypothetical protein EUTSA_v10013060mg             129   8e-32   
ref|XP_003545311.1|  PREDICTED: WD repeat-containing protein 26-like    129   9e-32   Glycine max [soybeans]
ref|XP_010546278.1|  PREDICTED: WD repeat-containing protein 26-like    129   1e-31   Tarenaya hassleriana [spider flower]
gb|EYU42813.1|  hypothetical protein MIMGU_mgv1a003386mg                129   1e-31   Erythranthe guttata [common monkey flower]
ref|XP_006399358.1|  hypothetical protein EUTSA_v10013060mg             129   2e-31   Eutrema salsugineum [saltwater cress]
ref|XP_004171491.1|  PREDICTED: WD repeat-containing protein 26-like    129   2e-31   
ref|XP_004149517.1|  PREDICTED: WD repeat-containing protein 26-like    129   2e-31   Cucumis sativus [cucumbers]
ref|XP_007222293.1|  hypothetical protein PRUPE_ppa003324mg             129   2e-31   
ref|XP_010423053.1|  PREDICTED: WD repeat-containing protein 26-like    128   4e-31   Camelina sativa [gold-of-pleasure]
gb|KEH33653.1|  transducin/WD40 repeat protein                          128   4e-31   Medicago truncatula
gb|KJB47108.1|  hypothetical protein B456_008G011600                    127   5e-31   Gossypium raimondii
gb|KJB47107.1|  hypothetical protein B456_008G011600                    127   9e-31   Gossypium raimondii
gb|KJB47106.1|  hypothetical protein B456_008G011600                    127   1e-30   Gossypium raimondii
ref|XP_004499533.1|  PREDICTED: WD repeat-containing protein 26-l...    126   1e-30   Cicer arietinum [garbanzo]
ref|XP_004499532.1|  PREDICTED: WD repeat-containing protein 26-l...    126   1e-30   Cicer arietinum [garbanzo]
ref|XP_002873372.1|  transducin family protein                          126   1e-30   
gb|KEH33651.1|  transducin family protein/WD-40 repeat protein          124   2e-30   Medicago truncatula
ref|XP_003519528.1|  PREDICTED: WD repeat-containing protein 26-like    125   4e-30   Glycine max [soybeans]
gb|KHN38353.1|  WD repeat-containing protein 26                         125   4e-30   Glycine soja [wild soybean]
ref|XP_010491500.1|  PREDICTED: WD repeat-containing protein 26-like    125   4e-30   Camelina sativa [gold-of-pleasure]
dbj|BAD22174.1|  putative WD repeat protein                             124   4e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006647187.1|  PREDICTED: WD repeat-containing protein 26-like    125   5e-30   Oryza brachyantha
ref|XP_002270103.1|  PREDICTED: WD repeat-containing protein 26         125   5e-30   Vitis vinifera
ref|XP_009412042.1|  PREDICTED: WD repeat-containing protein 26-like    124   9e-30   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX81113.1|  BnaC03g03670D                                          124   1e-29   
ref|XP_008647998.1|  PREDICTED: uncharacterized protein LOC100304...    123   2e-29   Zea mays [maize]
ref|NP_196473.1|  WD40 domain-containing protein                        123   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010680145.1|  PREDICTED: uncharacterized WD repeat-contain...    122   3e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008647995.1|  PREDICTED: uncharacterized protein LOC100304...    122   4e-29   
ref|XP_006287344.1|  hypothetical protein CARUB_v10000543mg             122   5e-29   Capsella rubella
ref|XP_009131082.1|  PREDICTED: WD repeat-containing protein 26-like    122   6e-29   Brassica rapa
ref|XP_006845990.1|  hypothetical protein AMTR_s00155p00039520          122   7e-29   Amborella trichopoda
ref|XP_004972947.1|  PREDICTED: WD repeat-containing protein 26-like    122   9e-29   Setaria italica
ref|XP_003578602.1|  PREDICTED: WD repeat-containing protein 26         121   1e-28   Brachypodium distachyon [annual false brome]
ref|XP_010687529.1|  PREDICTED: WD repeat-containing protein 26 h...    115   2e-28   Beta vulgaris subsp. vulgaris [field beet]
gb|ABR16581.1|  unknown                                                 119   4e-28   Picea sitchensis
gb|EYU42800.1|  hypothetical protein MIMGU_mgv1a003351mg                119   9e-28   Erythranthe guttata [common monkey flower]
emb|CDX78343.1|  BnaA03g02550D                                          118   1e-27   
dbj|BAK03563.1|  predicted protein                                      118   1e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009765608.1|  PREDICTED: WD repeat-containing protein 26-l...    116   4e-27   Nicotiana sylvestris
ref|XP_008676635.1|  PREDICTED: hypothetical protein isoform X1         117   4e-27   Zea mays [maize]
gb|KDO44760.1|  hypothetical protein CISIN_1g009188mg                   116   7e-27   Citrus sinensis [apfelsine]
ref|XP_004239311.1|  PREDICTED: WD repeat-containing protein 26 i...    115   1e-26   Solanum lycopersicum
emb|CDY21550.1|  BnaC09g47420D                                          114   4e-26   Brassica napus [oilseed rape]
ref|XP_009419551.1|  PREDICTED: WD repeat-containing protein 26-like    111   3e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009122471.1|  PREDICTED: WD repeat-containing protein 26         112   3e-25   Brassica rapa
ref|XP_011100498.1|  PREDICTED: WD repeat-containing protein 26-l...    109   2e-24   Sesamum indicum [beniseed]
ref|XP_010256454.1|  PREDICTED: WD repeat-containing protein 26 i...    109   2e-24   Nelumbo nucifera [Indian lotus]
gb|KHG19792.1|  WD repeat-containing 26                                 107   1e-23   Gossypium arboreum [tree cotton]
gb|EAY85451.1|  hypothetical protein OsI_06831                          104   1e-22   Oryza sativa Indica Group [Indian rice]
gb|EAZ22671.1|  hypothetical protein OsJ_06341                          104   1e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CBI35349.3|  unnamed protein product                                103   2e-22   Vitis vinifera
gb|EMT24581.1|  hypothetical protein F775_29927                         102   8e-22   
gb|EMS67128.1|  WD repeat-containing protein 26                         102   9e-22   Triticum urartu
gb|EMT06242.1|  hypothetical protein F775_31507                         102   9e-22   
gb|EYU42859.1|  hypothetical protein MIMGU_mgv1a005363mg              87.8    8e-17   Erythranthe guttata [common monkey flower]
ref|XP_001770300.1|  predicted protein                                88.2    8e-17   
ref|XP_001771286.1|  predicted protein                                85.1    7e-16   
ref|XP_002513147.1|  hypothetical protein RCOM_1454380                79.3    7e-16   
ref|XP_006281895.1|  hypothetical protein CARUB_v10028093mg           81.3    1e-14   
gb|EYU42819.1|  hypothetical protein MIMGU_mgv1a005559mg              79.7    5e-14   Erythranthe guttata [common monkey flower]
ref|XP_002311889.2|  hypothetical protein POPTR_0008s00330g           79.7    5e-14   
ref|XP_011033097.1|  PREDICTED: WD repeat-containing protein 26-like  79.0    8e-14   Populus euphratica
ref|XP_002982745.1|  hypothetical protein SELMODRAFT_268628           78.6    2e-13   
ref|XP_002315365.1|  hypothetical protein POPTR_0010s26090g           78.2    2e-13   Populus trichocarpa [western balsam poplar]
ref|XP_002990891.1|  hypothetical protein SELMODRAFT_161256           78.2    2e-13   
ref|XP_011046605.1|  PREDICTED: WD repeat-containing protein 26       77.0    4e-13   Populus euphratica
gb|EYU42821.1|  hypothetical protein MIMGU_mgv1a022686mg              75.1    2e-12   Erythranthe guttata [common monkey flower]
ref|XP_006854396.1|  hypothetical protein AMTR_s00039p00186000        73.2    9e-12   Amborella trichopoda
ref|XP_002866568.1|  hypothetical protein ARALYDRAFT_919661           72.0    2e-11   Arabidopsis lyrata subsp. lyrata
gb|EYU42862.1|  hypothetical protein MIMGU_mgv1a021742mg              71.6    3e-11   Erythranthe guttata [common monkey flower]
ref|XP_011035628.1|  PREDICTED: WD repeat-containing protein 26 i...  70.1    9e-11   Populus euphratica
ref|XP_011035629.1|  PREDICTED: WD repeat-containing protein 26 i...  70.1    9e-11   Populus euphratica
gb|EYU42863.1|  hypothetical protein MIMGU_mgv11b015403mg             69.7    9e-11   Erythranthe guttata [common monkey flower]
ref|XP_010069704.1|  PREDICTED: WD repeat-containing protein 26-like  68.9    2e-10   Eucalyptus grandis [rose gum]
gb|EYU42861.1|  hypothetical protein MIMGU_mgv1a020302mg              68.6    2e-10   Erythranthe guttata [common monkey flower]
ref|XP_010040357.1|  PREDICTED: WD repeat-containing protein 26-like  68.6    3e-10   
emb|CDY13140.1|  BnaA09g16770D                                        68.6    4e-10   Brassica napus [oilseed rape]
emb|CDY36957.1|  BnaC09g17730D                                        68.6    4e-10   Brassica napus [oilseed rape]
ref|XP_009113968.1|  PREDICTED: WD repeat-containing protein 26       67.8    4e-10   Brassica rapa
ref|XP_004495043.1|  PREDICTED: WD repeat-containing protein 26-like  67.8    5e-10   Cicer arietinum [garbanzo]
ref|XP_010264797.1|  PREDICTED: WD repeat-containing protein 26 i...  67.4    7e-10   Nelumbo nucifera [Indian lotus]
ref|XP_010264796.1|  PREDICTED: WD repeat-containing protein 26 i...  67.4    7e-10   Nelumbo nucifera [Indian lotus]
ref|XP_003554312.1|  PREDICTED: WD repeat-containing protein 26-like  67.4    7e-10   
gb|KHN02443.1|  WD repeat-containing protein 26                       67.4    7e-10   Glycine soja [wild soybean]
ref|XP_010264795.1|  PREDICTED: WD repeat-containing protein 26 i...  67.4    7e-10   Nelumbo nucifera [Indian lotus]
ref|XP_010264794.1|  PREDICTED: WD repeat-containing protein 26 i...  67.4    8e-10   Nelumbo nucifera [Indian lotus]
gb|KHF98324.1|  WD repeat-containing 26                               66.2    1e-09   Gossypium arboreum [tree cotton]
gb|KJB26051.1|  hypothetical protein B456_004G222700                  66.2    1e-09   Gossypium raimondii
ref|XP_006403164.1|  hypothetical protein EUTSA_v10003179mg           66.2    2e-09   Eutrema salsugineum [saltwater cress]
ref|XP_002533626.1|  WD-repeat protein, putative                      65.5    2e-09   Ricinus communis
ref|XP_008775134.1|  PREDICTED: WD repeat-containing protein 26       64.7    5e-09   Phoenix dactylifera
ref|XP_003574020.1|  PREDICTED: WD repeat-containing protein 26       64.7    5e-09   Brachypodium distachyon [annual false brome]
gb|KDO60331.1|  hypothetical protein CISIN_1g042434mg                 64.7    5e-09   Citrus sinensis [apfelsine]
ref|XP_006443707.1|  hypothetical protein CICLE_v10019514mg           64.7    5e-09   Citrus clementina [clementine]
ref|XP_006443706.1|  hypothetical protein CICLE_v10019514mg           64.3    6e-09   
gb|KDD75569.1|  hypothetical protein H632_c614p2                      60.8    1e-08   Helicosporidium sp. ATCC 50920
gb|KEH42443.1|  transducin/WD40 repeat protein                        63.2    2e-08   Medicago truncatula
gb|KGN58315.1|  hypothetical protein Csa_3G611890                     61.2    2e-08   Cucumis sativus [cucumbers]
ref|XP_006280294.1|  hypothetical protein CARUB_v10026218mg           63.2    2e-08   Capsella rubella
ref|XP_010918959.1|  PREDICTED: WD repeat-containing protein 26       62.8    2e-08   Elaeis guineensis
ref|XP_010441956.1|  PREDICTED: WD repeat-containing protein 26       62.8    2e-08   
ref|XP_004152068.1|  PREDICTED: WD repeat-containing protein 26-like  61.2    4e-08   
ref|XP_008235562.1|  PREDICTED: WD repeat-containing protein 26       61.6    5e-08   Prunus mume [ume]
ref|XP_007201159.1|  hypothetical protein PRUPE_ppa004283mg           61.6    5e-08   
ref|XP_010481800.1|  PREDICTED: WD repeat-containing protein 26-l...  61.6    5e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010481799.1|  PREDICTED: WD repeat-containing protein 26-l...  61.6    6e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010494385.1|  PREDICTED: WD repeat-containing protein 26-l...  61.2    6e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010494383.1|  PREDICTED: WD repeat-containing protein 26-l...  61.2    6e-08   Camelina sativa [gold-of-pleasure]
ref|XP_008382686.1|  PREDICTED: WD repeat-containing protein 26       60.8    9e-08   
emb|CAN70491.1|  hypothetical protein VITISV_017611                   60.5    1e-07   Vitis vinifera
ref|XP_007162638.1|  hypothetical protein PHAVU_001G167600g           60.5    1e-07   Phaseolus vulgaris [French bean]
ref|XP_008447357.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...  60.1    1e-07   Cucumis melo [Oriental melon]
ref|XP_010684801.1|  PREDICTED: WD repeat-containing protein 26       60.1    1e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009629554.1|  PREDICTED: WD repeat-containing protein 26 i...  60.1    2e-07   Nicotiana tomentosiformis
ref|XP_009629555.1|  PREDICTED: WD repeat-containing protein 26 i...  60.1    2e-07   Nicotiana tomentosiformis
ref|XP_002268789.2|  PREDICTED: WD repeat-containing protein 26       59.7    2e-07   Vitis vinifera
ref|XP_009792756.1|  PREDICTED: WD repeat-containing protein 26 i...  59.3    3e-07   Nicotiana sylvestris
ref|XP_009792757.1|  PREDICTED: WD repeat-containing protein 26 i...  59.3    3e-07   Nicotiana sylvestris
gb|AAL07102.1|  putative WD-repeat protein                            58.5    3e-07   Arabidopsis thaliana [mouse-ear cress]
gb|KFK31679.1|  hypothetical protein AALP_AA6G145100                  58.9    4e-07   Arabis alpina [alpine rockcress]
ref|XP_010091833.1|  WD repeat-containing protein 26                  58.5    5e-07   Morus notabilis
ref|XP_011083080.1|  PREDICTED: WD repeat-containing protein 26       58.5    5e-07   Sesamum indicum [beniseed]
ref|NP_199205.1|  transducin/WD40 domain-containing protein           58.5    5e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009370775.1|  PREDICTED: WD repeat-containing protein 26       58.5    6e-07   Pyrus x bretschneideri [bai li]
emb|CBI37215.3|  unnamed protein product                              58.2    6e-07   Vitis vinifera
gb|EYU17955.1|  hypothetical protein MIMGU_mgv1a004677mg              58.2    6e-07   Erythranthe guttata [common monkey flower]
ref|XP_004247123.1|  PREDICTED: WD repeat-containing protein 26       58.2    7e-07   Solanum lycopersicum
ref|XP_006355901.1|  PREDICTED: WD repeat-containing protein 26-like  58.2    7e-07   Solanum tuberosum [potatoes]
gb|EYU42860.1|  hypothetical protein MIMGU_mgv1a025082mg              57.8    8e-07   Erythranthe guttata [common monkey flower]
ref|XP_002865396.1|  transducin family protein                        57.8    1e-06   
emb|CDP03813.1|  unnamed protein product                              56.6    2e-06   Coffea canephora [robusta coffee]
gb|EYU42820.1|  hypothetical protein MIMGU_mgv1a018113mg              56.2    3e-06   Erythranthe guttata [common monkey flower]
gb|EYU42822.1|  hypothetical protein MIMGU_mgv1a024382mg              55.5    5e-06   Erythranthe guttata [common monkey flower]
gb|AFK42042.1|  unknown                                               50.8    7e-06   Medicago truncatula
ref|XP_009386572.1|  PREDICTED: WD repeat-containing protein 26       55.1    8e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004982941.1|  PREDICTED: WD repeat-containing protein 26-like  54.3    1e-05   Setaria italica
gb|EMT27850.1|  hypothetical protein F775_27811                       53.9    1e-05   
ref|XP_004292253.1|  PREDICTED: WD repeat-containing protein 26       53.5    2e-05   Fragaria vesca subsp. vesca
ref|XP_005646513.1|  WD40 repeat-like protein                         53.5    3e-05   Coccomyxa subellipsoidea C-169
gb|EMS48361.1|  WD repeat-containing protein 26                       52.0    9e-05   Triticum urartu
ref|XP_002464509.1|  hypothetical protein SORBIDRAFT_01g019860        51.6    9e-05   Sorghum bicolor [broomcorn]
ref|XP_010522523.1|  PREDICTED: WD repeat-containing protein 26       51.6    9e-05   Tarenaya hassleriana [spider flower]
emb|CDX84431.1|  BnaC03g50690D                                        51.2    1e-04   
emb|CDY41528.1|  BnaA06g22810D                                        50.1    3e-04   Brassica napus [oilseed rape]
ref|XP_007395402.1|  hypothetical protein PHACADRAFT_94848            50.1    3e-04   Phanerochaete carnosa HHB-10118-sp
dbj|GAM21975.1|  hypothetical protein SAMD00019534_051500             50.1    4e-04   Acytostelium subglobosum LB1
ref|XP_011399695.1|  WD repeat-containing protein 26                  49.7    4e-04   Auxenochlorella protothecoides
gb|KDQ60900.1|  hypothetical protein JAAARDRAFT_55637                 49.3    7e-04   Jaapia argillacea MUCL 33604
ref|XP_004222828.1|  WD-repeat protein                                49.3    8e-04   Plasmodium cynomolgi strain B
ref|XP_003035313.1|  hypothetical protein SCHCODRAFT_66095            48.5    0.001   Schizophyllum commune H4-8



>ref|XP_009758209.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Nicotiana 
sylvestris]
Length=547

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 97/120 (81%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGE---LLNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGG ED EPP KRVKVSSGE   L N    RDP +CSL+D  MAR LVC+  ++VVG+KG
Sbjct  1    MGGAEDAEPPSKRVKVSSGEPGDLSNSTFPRDPASCSLNDL-MARPLVCQRDDEVVGTKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            +VKKVEFV+I+AEALYSLGY KTGA LEEESGI L S+VV LFMQQILDGKWDESV TLH
Sbjct  60   VVKKVEFVRILAEALYSLGYNKTGAHLEEESGIPLQSAVVKLFMQQILDGKWDESVATLH  119



>ref|XP_009758206.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009758207.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009758208.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
sylvestris]
Length=581

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 97/120 (81%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGE---LLNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGG ED EPP KRVKVSSGE   L N    RDP +CSL+D  MAR LVC+  ++VVG+KG
Sbjct  1    MGGAEDAEPPSKRVKVSSGEPGDLSNSTFPRDPASCSLNDL-MARPLVCQRDDEVVGTKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            +VKKVEFV+I+AEALYSLGY KTGA LEEESGI L S+VV LFMQQILDGKWDESV TLH
Sbjct  60   VVKKVEFVRILAEALYSLGYNKTGAHLEEESGIPLQSAVVKLFMQQILDGKWDESVATLH  119



>ref|XP_009608371.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Nicotiana 
tomentosiformis]
Length=545

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 101/120 (84%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKS---LRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGG +DDEPP KRVKVS GE  +R +   L+DP +CSLS+ SMAR L  +G +++VG+KG
Sbjct  1    MGGAKDDEPPSKRVKVSFGESADRSNGTFLKDPASCSLSE-SMARPLAVQGDDEIVGTKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            IVKKVEFV+IIA+ALYSLGYKKTGA LEEESGI LHSS V+LFMQ+ILDG+WDESV TLH
Sbjct  60   IVKKVEFVRIIADALYSLGYKKTGALLEEESGIPLHSSQVHLFMQKILDGRWDESVATLH  119



>ref|XP_009608368.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009608369.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
tomentosiformis]
Length=579

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 101/120 (84%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKS---LRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGG +DDEPP KRVKVS GE  +R +   L+DP +CSLS+ SMAR L  +G +++VG+KG
Sbjct  1    MGGAKDDEPPSKRVKVSFGESADRSNGTFLKDPASCSLSE-SMARPLAVQGDDEIVGTKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            IVKKVEFV+IIA+ALYSLGYKKTGA LEEESGI LHSS V+LFMQ+ILDG+WDESV TLH
Sbjct  60   IVKKVEFVRIIADALYSLGYKKTGALLEEESGIPLHSSQVHLFMQKILDGRWDESVATLH  119



>ref|XP_009631029.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Nicotiana 
tomentosiformis]
Length=547

 Score =   163 bits (412),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 97/119 (82%), Gaps = 4/119 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSG---ELLNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGG ED EPP KRVKVSSG   +L N    RDP +CSL+D  MAR LVC+G ++VVG+KG
Sbjct  1    MGGAEDAEPPSKRVKVSSGKPGDLSNSTFPRDPASCSLNDL-MARPLVCQGDDEVVGTKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            ++KKVEFV+I+AEALYSLGY KTGA LEEESGI L S+VV LFMQQ+LDGKWDESV TL
Sbjct  60   VIKKVEFVRILAEALYSLGYNKTGAHLEEESGIPLQSAVVKLFMQQVLDGKWDESVATL  118



>ref|XP_009631025.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009631026.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009631027.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009631028.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
tomentosiformis]
Length=581

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 97/119 (82%), Gaps = 4/119 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSG---ELLNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGG ED EPP KRVKVSSG   +L N    RDP +CSL+D  MAR LVC+G ++VVG+KG
Sbjct  1    MGGAEDAEPPSKRVKVSSGKPGDLSNSTFPRDPASCSLNDL-MARPLVCQGDDEVVGTKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            ++KKVEFV+I+AEALYSLGY KTGA LEEESGI L S+VV LFMQQ+LDGKWDESV TL
Sbjct  60   VIKKVEFVRILAEALYSLGYNKTGAHLEEESGIPLQSAVVKLFMQQVLDGKWDESVATL  118



>ref|XP_006354306.1| PREDICTED: WD repeat-containing protein 26-like [Solanum tuberosum]
Length=581

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 97/120 (81%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSS---GELLNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MG  EDDEPP KRVKVSS   G+L     L DP +CSL+D  MAR LVC+G ++V+G+KG
Sbjct  1    MGRAEDDEPPPKRVKVSSRKLGDLSKSTLLTDPASCSLNDL-MARPLVCQGDDEVIGAKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            +VKKVEFV+IIAEALYSLGY K GA+LEEESGI L S+VV LFMQQILDGKWDESV TLH
Sbjct  60   VVKKVEFVRIIAEALYSLGYNKAGARLEEESGIPLQSAVVKLFMQQILDGKWDESVATLH  119



>emb|CDP17860.1| unnamed protein product [Coffea canephora]
Length=588

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 97/120 (81%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGEL---LNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGVEDDEPP KRV++SS +L    N  SLR+P + +  D  MAR L  EG ++VVG KG
Sbjct  1    MGGVEDDEPPSKRVRISSCKLEGLSNGTSLREPASGASCDL-MARPLASEGDDEVVGPKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            +V+KVEFV+IIAEALYSLGYKKTGA LEEESGI LHSS VN FMQQ+L+GKWDESV+TLH
Sbjct  60   VVRKVEFVRIIAEALYSLGYKKTGAHLEEESGIPLHSSAVNSFMQQVLEGKWDESVVTLH  119



>ref|XP_009780908.1| PREDICTED: WD repeat-containing protein 26-like [Nicotiana sylvestris]
 ref|XP_009780909.1| PREDICTED: WD repeat-containing protein 26-like [Nicotiana sylvestris]
Length=579

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 99/119 (83%), Gaps = 4/119 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKS---LRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGG +DDEPP KRVKVS GE  +  +   L+DP +CSLS+ SMAR L  +G +++VG+KG
Sbjct  1    MGGAKDDEPPSKRVKVSFGESADHSNGTFLKDPASCSLSE-SMARPLAVQGDDEIVGTKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            +VKKVEFV+IIA+ALYSLGYKKTGA LEEESGI LHSS V+LFM+QILDG+WDESV TL
Sbjct  60   VVKKVEFVRIIADALYSLGYKKTGAFLEEESGIPLHSSQVHLFMEQILDGRWDESVATL  118



>ref|XP_004252042.1| PREDICTED: WD repeat-containing protein 26-like, partial [Solanum 
lycopersicum]
Length=254

 Score =   151 bits (382),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 90/120 (75%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKS---LRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGG EDDEP  KRVKVS  E  +R +   LRDP +  LSD  M   L  +G ++VVG KG
Sbjct  1    MGGAEDDEPLSKRVKVSFRESADRSNGTFLRDPVSSPLSDL-MVCPLEIQGDDEVVGRKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            +VKKVE VQII E LYSLGYKK GAQLEEESGI LH S+VNLFMQQILDGKWDES+ TLH
Sbjct  60   VVKKVELVQIITETLYSLGYKKAGAQLEEESGIPLHPSLVNLFMQQILDGKWDESIATLH  119



>ref|XP_004243618.1| PREDICTED: WD repeat-containing protein 26 [Solanum lycopersicum]
 ref|XP_010323928.1| PREDICTED: WD repeat-containing protein 26 [Solanum lycopersicum]
 ref|XP_010323929.1| PREDICTED: WD repeat-containing protein 26 [Solanum lycopersicum]
Length=580

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 97/119 (82%), Gaps = 4/119 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLN---RKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MG  +DDEPP KRVKVSS +L++   R  +RDP +CSL D SMAR L  +G ++VVG+KG
Sbjct  1    MGAEDDDEPPSKRVKVSSSQLVDISDRTFVRDPVSCSLGD-SMARPLTLQGDDEVVGTKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            +VKKVEFV+II EAL SLGYKKT A LEEESGI LH+SVVNLFMQQILDGKWDES+ TL
Sbjct  60   VVKKVEFVRIITEALDSLGYKKTRALLEEESGIPLHTSVVNLFMQQILDGKWDESLNTL  118



>emb|CAN80620.1| hypothetical protein VITISV_007853 [Vitis vinifera]
Length=310

 Score =   152 bits (383),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 95/120 (79%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGV+DDEPP KR+K+SSGEL    N  SL +P   SL D SMA SL  E   ++VGS+G
Sbjct  1    MGGVDDDEPPSKRMKLSSGELRGLSNGSSLTEPVXGSLRD-SMACSLPSEENEEMVGSRG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            I+K+VEFV+IIA+ALYSLGY K+GA LEEESGI LHSSVV+LFM QILDG WDES +TLH
Sbjct  60   IIKRVEFVRIIAKALYSLGYTKSGAHLEEESGIPLHSSVVSLFMNQILDGNWDESXLTLH  119



>ref|XP_006366633.1| PREDICTED: WD repeat-containing protein 26-like [Solanum tuberosum]
Length=580

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 97/119 (82%), Gaps = 4/119 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKS---LRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MG  +DDEPP KRVKVSSG+L++      +RDP +CSL D SMAR L  +G ++VVG+KG
Sbjct  1    MGAEDDDEPPSKRVKVSSGQLVDISDGTFVRDPASCSLGD-SMARPLTLQGDDEVVGTKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            +VKKVEFV+II EAL SLGYKKT A LEEESGI LH+SV+NLFMQQILDGKWDES+ TL
Sbjct  60   VVKKVEFVRIITEALDSLGYKKTRALLEEESGIPLHTSVINLFMQQILDGKWDESLNTL  118



>ref|XP_009618673.1| PREDICTED: WD repeat-containing protein 26-like [Nicotiana tomentosiformis]
Length=581

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 96/120 (80%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKS---LRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGG ED+EPP KRVKVSSG+L++      +RD  +CSL D SMAR L  +G ++VVG+KG
Sbjct  1    MGGAEDEEPPLKRVKVSSGQLVDISDGTFVRDRASCSLGD-SMARPLDLQGDDEVVGTKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            +VKKVEFV+II EALYSLGY K GA LEEESGI LHSS +NLFMQQI DGKWDES+ TL+
Sbjct  60   VVKKVEFVRIITEALYSLGYNKAGAHLEEESGIPLHSSGINLFMQQIRDGKWDESLTTLN  119



>ref|XP_006351997.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006351998.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Solanum 
tuberosum]
Length=584

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 93/120 (78%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKS---LRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGG EDDEP  KRVKVS GE  +  +   LRDP +  LSD  M R L  +G +++VG KG
Sbjct  1    MGGAEDDEPLSKRVKVSFGESADHSNGIFLRDPASFPLSDL-MVRPLEFQGDDEIVGRKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            +VKKVE VQIIAEALYSLGYKK GAQLEEESGI LH S+VNLFMQQILDG+WDES+ TLH
Sbjct  60   VVKKVELVQIIAEALYSLGYKKAGAQLEEESGIPLHPSLVNLFMQQILDGRWDESIATLH  119



>ref|XP_011085429.1| PREDICTED: WD repeat-containing protein 26-like [Sesamum indicum]
 ref|XP_011085430.1| PREDICTED: WD repeat-containing protein 26-like [Sesamum indicum]
Length=580

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 97/120 (81%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGE---LLNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGVEDDEPP KRVKVSSGE   L N  S+ +  +CSLSD SMAR    +  ++VVGSKG
Sbjct  1    MGGVEDDEPPSKRVKVSSGESGDLSNGLSVSEKGSCSLSD-SMARLPASQEDDEVVGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++KKVE V+IIAEALYSLGY KTGA+LEEESGI L S++++ FMQQILDGKWDESV TLH
Sbjct  60   VIKKVELVRIIAEALYSLGYSKTGARLEEESGIPLRSTLIDSFMQQILDGKWDESVATLH  119



>ref|XP_010657105.1| PREDICTED: WD repeat-containing protein 26-like [Vitis vinifera]
Length=581

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 97/120 (81%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGV+DDEPP KR+K+SSGEL    N  SL +P + SL D SMA SL  E   ++VGS+G
Sbjct  1    MGGVDDDEPPSKRMKLSSGELRGLSNGSSLTEPVDGSLRD-SMACSLPSEENEEMVGSRG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            I+K+VEFV+IIA+ALYSLGY K+GA LEEESGI LHSSVV+LFM QILDG WDES++TLH
Sbjct  60   IIKRVEFVRIIAKALYSLGYTKSGAHLEEESGIPLHSSVVSLFMNQILDGNWDESMLTLH  119



>ref|XP_010321118.1| PREDICTED: WD repeat-containing protein 26 isoform X2 [Solanum 
lycopersicum]
Length=549

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 93/119 (78%), Gaps = 3/119 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSS--GELLNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKGI  370
            MG  EDDEPP KRVKVSS  G+L     L DP +CSL+D  MA  LV +G ++VVG+KG+
Sbjct  1    MGRAEDDEPPPKRVKVSSRKGDLPKSTLLTDPASCSLNDL-MAHPLVRQGDDEVVGAKGV  59

Query  371  VKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            VKKVEFV+I+AEALYSLGY K GA+LEEESGI L S+ V L MQQILDGKWDESV TLH
Sbjct  60   VKKVEFVRIVAEALYSLGYNKAGARLEEESGIPLQSAEVKLLMQQILDGKWDESVATLH  118



>ref|XP_004239310.1| PREDICTED: WD repeat-containing protein 26 isoform X1 [Solanum 
lycopersicum]
Length=580

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 93/119 (78%), Gaps = 3/119 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSS--GELLNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKGI  370
            MG  EDDEPP KRVKVSS  G+L     L DP +CSL+D  MA  LV +G ++VVG+KG+
Sbjct  1    MGRAEDDEPPPKRVKVSSRKGDLPKSTLLTDPASCSLNDL-MAHPLVRQGDDEVVGAKGV  59

Query  371  VKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            VKKVEFV+I+AEALYSLGY K GA+LEEESGI L S+ V L MQQILDGKWDESV TLH
Sbjct  60   VKKVEFVRIVAEALYSLGYNKAGARLEEESGIPLQSAEVKLLMQQILDGKWDESVATLH  118



>ref|XP_007048928.1| Transducin family protein / WD-40 repeat family protein isoform 
2 [Theobroma cacao]
 ref|XP_007048929.1| Transducin family protein / WD-40 repeat family protein isoform 
2 [Theobroma cacao]
 gb|EOX93085.1| Transducin family protein / WD-40 repeat family protein isoform 
2 [Theobroma cacao]
 gb|EOX93086.1| Transducin family protein / WD-40 repeat family protein isoform 
2 [Theobroma cacao]
Length=580

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 95/120 (79%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGVEDDEP  KR+K+SS EL    N  ++++P   S  D  MAR L  EGG +VVGSKG
Sbjct  1    MGGVEDDEPASKRMKLSSEELRRLSNGSTIKEPVAGSSGDL-MARPLQSEGGEEVVGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++KKVEFV+II +ALYSLGY K+GA LEEESGI LHSSVVN+FM+QIL+G WDESV+TLH
Sbjct  60   VIKKVEFVRIITKALYSLGYIKSGAHLEEESGIPLHSSVVNVFMRQILEGNWDESVVTLH  119



>ref|XP_007048927.1| Transducin family protein / WD-40 repeat family protein isoform 
1 [Theobroma cacao]
 gb|EOX93084.1| Transducin family protein / WD-40 repeat family protein isoform 
1 [Theobroma cacao]
Length=619

 Score =   149 bits (377),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 95/120 (79%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGVEDDEP  KR+K+SS EL    N  ++++P   S  D  MAR L  EGG +VVGSKG
Sbjct  1    MGGVEDDEPASKRMKLSSEELRRLSNGSTIKEPVAGSSGDL-MARPLQSEGGEEVVGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++KKVEFV+II +ALYSLGY K+GA LEEESGI LHSSVVN+FM+QIL+G WDESV+TLH
Sbjct  60   VIKKVEFVRIITKALYSLGYIKSGAHLEEESGIPLHSSVVNVFMRQILEGNWDESVVTLH  119



>gb|KJB33387.1| hypothetical protein B456_006G008900 [Gossypium raimondii]
 gb|KJB33388.1| hypothetical protein B456_006G008900 [Gossypium raimondii]
Length=580

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 95/119 (80%), Gaps = 4/119 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGVEDDEP  KR+K+SS EL    N  ++++P   S  D  MAR L  EGG +VVGSKG
Sbjct  1    MGGVEDDEPASKRMKLSSEELRRLSNGSTIKEPVAGSSRDL-MARPLQSEGGEEVVGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            ++KKVEFV+IIA+ALYSLGY K+GA LEEESGI LHSSVVN+FM+QIL+G WDESV+TL
Sbjct  60   VIKKVEFVRIIAKALYSLGYIKSGAHLEEESGIPLHSSVVNVFMRQILEGNWDESVVTL  118



>gb|KJB33386.1| hypothetical protein B456_006G008900 [Gossypium raimondii]
Length=546

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 95/120 (79%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGVEDDEP  KR+K+SS EL    N  ++++P   S  D  MAR L  EGG +VVGSKG
Sbjct  1    MGGVEDDEPASKRMKLSSEELRRLSNGSTIKEPVAGSSRDL-MARPLQSEGGEEVVGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++KKVEFV+IIA+ALYSLGY K+GA LEEESGI LHSSVVN+FM+QIL+G WDESV+TL 
Sbjct  60   VIKKVEFVRIIAKALYSLGYIKSGAHLEEESGIPLHSSVVNVFMRQILEGNWDESVVTLR  119



>ref|XP_009765607.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
sylvestris]
Length=581

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 94/119 (79%), Gaps = 4/119 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKS---LRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGG ED+EPP KRVK+SSG+L++      +RD  + SL D SMAR L  +G ++VVG+KG
Sbjct  1    MGGGEDEEPPLKRVKLSSGQLVDISDGTFVRDRASRSLGD-SMARPLDLQGDDEVVGTKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            +VKKVEFV+II EALYSLGY K GA LEEESGI LHSS +NLFMQQI DGKWDES+ TL
Sbjct  60   VVKKVEFVRIITEALYSLGYNKAGAHLEEESGIPLHSSGINLFMQQIRDGKWDESLTTL  118



>ref|XP_010256452.1| PREDICTED: WD repeat-containing protein 26 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010256453.1| PREDICTED: WD repeat-containing protein 26 isoform X1 [Nelumbo 
nucifera]
Length=584

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 94/120 (78%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGEL---LNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGVEDDEPP KRVK+SSGEL   L   SL +P + S  D SMAR L  +G   +VGSKG
Sbjct  1    MGGVEDDEPPSKRVKLSSGELRSPLKESSLAEPLSGSFRD-SMARPLPSQGDEQMVGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++++ EFV+II +ALYSLGY+++GA LEEESGI LHSS+VNLF QQ+LDG WDESV TLH
Sbjct  60   LIERGEFVRIITKALYSLGYERSGALLEEESGIPLHSSMVNLFRQQLLDGSWDESVDTLH  119



>gb|KHG12711.1| wdr26 [Gossypium arboreum]
 gb|KHG12712.1| wdr26 [Gossypium arboreum]
Length=580

 Score =   147 bits (370),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 95/119 (80%), Gaps = 4/119 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGVEDDEP  KR+K+SS EL    N  ++++P   S  D  MAR L  EGG +VVGSKG
Sbjct  1    MGGVEDDEPASKRMKLSSEELRRLSNGSTIKEPVAGSSRDL-MARPLQSEGGEEVVGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            ++KKVEFV+IIA+ALYSLGY K+GA LEEESGI LHSSVVN+FM+QIL+G WD+SV+TL
Sbjct  60   VIKKVEFVRIIAKALYSLGYIKSGAHLEEESGIPLHSSVVNVFMRQILEGNWDDSVVTL  118



>ref|XP_011100492.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Sesamum 
indicum]
 ref|XP_011100493.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Sesamum 
indicum]
 ref|XP_011100494.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Sesamum 
indicum]
 ref|XP_011100495.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Sesamum 
indicum]
 ref|XP_011100497.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Sesamum 
indicum]
Length=585

 Score =   147 bits (370),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 92/120 (77%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGE---LLNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            M GVEDDEPP KRVKVSSGE   L N  S R+  +CSLS+ +MAR L  +  ++VVGS G
Sbjct  1    MEGVEDDEPPSKRVKVSSGESGGLSNGVSYREQCSCSLSE-TMARPLASQEDDEVVGSNG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            I+KKVE V+IIAEALYSLGY K GA LEEESGI LHS  V+LFM QIL+G+WDESV  LH
Sbjct  60   IIKKVELVRIIAEALYSLGYSKMGAHLEEESGILLHSPAVDLFMHQILEGQWDESVSMLH  119



>ref|XP_008811627.1| PREDICTED: WD repeat-containing protein 26-like [Phoenix dactylifera]
 ref|XP_008811628.1| PREDICTED: WD repeat-containing protein 26-like [Phoenix dactylifera]
Length=302

 Score =   143 bits (360),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 91/119 (76%), Gaps = 5/119 (4%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVS---SGELLNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGV+D+EPP KRV+V    SG LL      +P   SL    MAR L  EG  D++GSKG
Sbjct  1    MGGVDDNEPPLKRVRVPTVESGSLLKNSPFSEPV-ISLGG-PMARPLASEGKEDIIGSKG  58

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            ++KKVEFV+II +ALYSLGY+++GA LE+ESGI+LHSSVVNLF +Q+LDG WDES++TL
Sbjct  59   VIKKVEFVRIITKALYSLGYERSGAALEDESGIYLHSSVVNLFRKQVLDGYWDESLVTL  117



>gb|KDP29808.1| hypothetical protein JCGZ_19323 [Jatropha curcas]
Length=581

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 92/120 (77%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGVEDDEP  KR+K++SGEL    N  SL +    S  D  MAR L  EG  +VVGSKG
Sbjct  1    MGGVEDDEPVSKRMKLASGELTGLSNGSSLIETIVGSSRDL-MARPLQSEGDEEVVGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++K+VEFV+IIA+ALYSLGYKK+ A LEEESGI L SS VNLFMQQILDG WDESV+TLH
Sbjct  60   VIKRVEFVRIIAKALYSLGYKKSSAHLEEESGIPLQSSAVNLFMQQILDGSWDESVVTLH  119



>ref|XP_006484997.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Citrus 
sinensis]
 ref|XP_006484998.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Citrus 
sinensis]
 ref|XP_006484999.1| PREDICTED: WD repeat-containing protein 26-like isoform X3 [Citrus 
sinensis]
 ref|XP_006485000.1| PREDICTED: WD repeat-containing protein 26-like isoform X4 [Citrus 
sinensis]
Length=581

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 90/119 (76%), Gaps = 4/119 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGVEDDEP  KR+K+SS EL    N  + R+P   SL D  MAR L  EG  DV+G  G
Sbjct  1    MGGVEDDEPASKRMKLSSVELRGLSNGSAFREPVAGSLRDL-MARPLPSEGDEDVIGPAG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            ++K+VEFV+IIA+ALYSLGY K+GA LEEESGI LHSS+VNLF QQILDG WDES+ TL
Sbjct  60   VIKRVEFVRIIAKALYSLGYTKSGAHLEEESGIPLHSSMVNLFTQQILDGHWDESLATL  118



>ref|XP_006437085.1| hypothetical protein CICLE_v10031058mg [Citrus clementina]
 ref|XP_006437086.1| hypothetical protein CICLE_v10031058mg [Citrus clementina]
 ref|XP_006437087.1| hypothetical protein CICLE_v10031058mg [Citrus clementina]
 ref|XP_006437088.1| hypothetical protein CICLE_v10031058mg [Citrus clementina]
 gb|ESR50325.1| hypothetical protein CICLE_v10031058mg [Citrus clementina]
 gb|ESR50326.1| hypothetical protein CICLE_v10031058mg [Citrus clementina]
 gb|ESR50327.1| hypothetical protein CICLE_v10031058mg [Citrus clementina]
 gb|ESR50328.1| hypothetical protein CICLE_v10031058mg [Citrus clementina]
Length=581

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 90/119 (76%), Gaps = 4/119 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGVEDDEP  KR+K+SS EL    N  + R+P   SL D  MAR L  EG  DV+G  G
Sbjct  1    MGGVEDDEPASKRMKLSSVELRGLSNGSAFREPVAGSLRDL-MARPLPSEGDEDVIGPAG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            ++K+VEFV+IIA+ALYSLGY K+GA LEEESGI LHSS+VNLF QQILDG WDES+ TL
Sbjct  60   VIKRVEFVRIIAKALYSLGYTKSGAHLEEESGIPLHSSMVNLFTQQILDGHWDESLATL  118



>gb|KJB48956.1| hypothetical protein B456_008G095100 [Gossypium raimondii]
 gb|KJB48957.1| hypothetical protein B456_008G095100 [Gossypium raimondii]
 gb|KJB48958.1| hypothetical protein B456_008G095100 [Gossypium raimondii]
Length=580

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 96/120 (80%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGVEDDEP  KR+K+SS EL+   N  ++++    S  D  MAR L  +GG +VVGSKG
Sbjct  1    MGGVEDDEPASKRMKLSSEELIHLSNGSTVKESIVGSSRDL-MARPLQSDGGEEVVGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++KKVEFV+I+A+ALYSLGY+++GA LEEESGI LHSS++N+FM+Q+L+G WDESV TLH
Sbjct  60   VIKKVEFVRIMAKALYSLGYRRSGAHLEEESGIALHSSIINVFMRQVLEGDWDESVATLH  119



>ref|XP_010275088.1| PREDICTED: WD repeat-containing protein 26-like [Nelumbo nucifera]
Length=315

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 91/120 (76%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGEL---LNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGVEDDEPP KRVK+SSGEL   LN  SL +    S  D  M R L  +G   +VG++G
Sbjct  1    MGGVEDDEPPSKRVKLSSGELRSPLNNSSLAETLTGSSGDL-MPRPLPSQGDEQMVGTQG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++++VEFV+II +ALYSLGY ++GA LEEESGI LHSS+V+LF QQ++DG WDESV TLH
Sbjct  60   LIERVEFVRIITKALYSLGYDRSGALLEEESGIPLHSSMVDLFRQQLIDGNWDESVATLH  119



>ref|XP_004491280.1| PREDICTED: WD repeat-containing protein 26-like [Cicer arietinum]
Length=572

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 91/120 (76%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRK---SLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGV+D+EP  KR+KVSS  L+N     S  +P     +D SMAR L  EG   VVGSKG
Sbjct  1    MGGVDDEEPALKRMKVSSKGLVNLSNGSSSVEPVGGYFAD-SMARPLPSEGDEQVVGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++K+ EFV+IIA+ALYSLGY+K+GA+LEEESGI LHS  VNLFMQQ+LDG WDESV TLH
Sbjct  60   VIKREEFVRIIAKALYSLGYRKSGARLEEESGIPLHSPGVNLFMQQVLDGNWDESVATLH  119



>ref|XP_008790475.1| PREDICTED: WD repeat-containing protein 26-like [Phoenix dactylifera]
Length=582

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 93/124 (75%), Gaps = 13/124 (10%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKSLRDPTNCSLSDC-------SMARSLVCEGGNDVV  355
            MGGVEDDEPP KRVK S+      + LR P + S           SMAR L+ +G +D++
Sbjct  1    MGGVEDDEPPSKRVKAST------EDLRSPFDNSSRSVPISPLGGSMARPLLSQGKDDMI  54

Query  356  GSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESV  535
            GSKG++KKVEFV+II +ALYSLGY+++GA LEEESGI LHSSVVNLF +Q+LDG W+ESV
Sbjct  55   GSKGVIKKVEFVRIITKALYSLGYERSGAALEEESGICLHSSVVNLFRKQVLDGNWNESV  114

Query  536  ITLH  547
            +TLH
Sbjct  115  LTLH  118



>ref|XP_010906218.1| PREDICTED: WD repeat-containing protein 26-like [Elaeis guineensis]
 ref|XP_010906219.1| PREDICTED: WD repeat-containing protein 26-like [Elaeis guineensis]
Length=584

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 90/119 (76%), Gaps = 5/119 (4%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKV---SSGELLNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGV+D+EPP KRV+V    SG LL   S  +P    +    MAR L  EG  D++GSKG
Sbjct  1    MGGVDDNEPPLKRVRVPTVESGRLLKNSSFSEPVTSLVG--LMARPLASEGKEDIIGSKG  58

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            ++KKVEFV+II +ALYSLGY+++GA LE+ESGI+LHSS VNLF +Q+LDG WDES++TL
Sbjct  59   VIKKVEFVRIITKALYSLGYERSGAALEDESGIYLHSSAVNLFRKQVLDGYWDESLVTL  117



>ref|XP_009377000.1| PREDICTED: WD repeat-containing protein 26-like [Pyrus x bretschneideri]
 ref|XP_009377004.1| PREDICTED: WD repeat-containing protein 26-like [Pyrus x bretschneideri]
Length=578

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 90/120 (75%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGV D+EP  KR+K+S+GEL    N  S  +P   S  D  MAR L  EG   VVGSKG
Sbjct  1    MGGVGDEEPATKRMKLSAGELKGLSNGSSCAEPVAGSSRDL-MARPLPSEGDEQVVGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++K+VEFV++IA+ALYSLGYKK+GA LEEESGI LHSSVVNLFMQQILDG WD SV TL 
Sbjct  60   VIKRVEFVRLIAKALYSLGYKKSGAHLEEESGIPLHSSVVNLFMQQILDGNWDGSVDTLQ  119



>ref|XP_010103563.1| WD repeat-containing protein 26 [Morus notabilis]
 gb|EXB96340.1| WD repeat-containing protein 26 [Morus notabilis]
Length=721

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 89/119 (75%), Gaps = 4/119 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSG---ELLNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGVED EPP KRVK+  G     L   SLR+   CSL D SMARSL  +G  ++VGSKG
Sbjct  1    MGGVEDTEPPLKRVKLPLGGSKSFLEDSSLRNLVICSLGD-SMARSLPSQGDGEIVGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            ++KK EFV+II  ALYSLGY K+GA LEEESGI L SSVVN FMQQ++DGKWD+S+ TL
Sbjct  60   VIKKSEFVKIITRALYSLGYNKSGAILEEESGIPLRSSVVNEFMQQVVDGKWDDSLATL  118



>gb|EPS60063.1| hypothetical protein M569_14740 [Genlisea aurea]
Length=622

 Score =   141 bits (356),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 91/120 (76%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRK---SLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGVEDDEPP KRVKV SG+        S  D    SLSD SMAR L  +  +D+VG+KG
Sbjct  1    MGGVEDDEPPTKRVKVFSGDSRVHSCNISAIDQGGSSLSD-SMARLLTSQEDDDIVGTKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++KK E ++IIAEALYSLGY K+GA+LEEESGI LHS +V+LFM+QILDG WDES+ TLH
Sbjct  60   VIKKTELIRIIAEALYSLGYSKSGARLEEESGIPLHSGLVDLFMKQILDGHWDESLATLH  119



>ref|XP_010943696.1| PREDICTED: uncharacterized WD repeat-containing protein C343.04c-like 
[Elaeis guineensis]
 ref|XP_010943697.1| PREDICTED: uncharacterized WD repeat-containing protein C343.04c-like 
[Elaeis guineensis]
Length=582

 Score =   140 bits (354),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 90/119 (76%), Gaps = 3/119 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKSLRDPTNCSLSDC--SMARSLVCEGGNDVVGSKGI  370
            MGGVEDDEPP KRVK S+ E L R       +   S    SMAR L  +G +D++GSKG+
Sbjct  1    MGGVEDDEPPSKRVKAST-EDLGRPFDNSSRSVPFSPLGGSMARPLPSQGKDDMIGSKGV  59

Query  371  VKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            +KKVEFV+II +ALYSLGY+++GA LEEESGI LHSS VNLF +Q+LDG WDESV+TLH
Sbjct  60   IKKVEFVRIITKALYSLGYERSGAALEEESGICLHSSAVNLFRKQVLDGNWDESVLTLH  118



>gb|KHG30817.1| WD repeat-containing 26 [Gossypium arboreum]
Length=546

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 94/120 (78%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGVEDDEP  KR+K+SS  L+   N  ++++    S  D  MAR L  +GG +VVGSKG
Sbjct  1    MGGVEDDEPASKRMKLSSEALIHLSNGSTVKESIVGSSRDL-MARPLQSDGGEEVVGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++KKVEFV+IIA+ALYSLGY ++GA LEEESGI LHSS++N+FM+Q+L+G WDESV TLH
Sbjct  60   VIKKVEFVRIIAKALYSLGYIRSGAHLEEESGIALHSSIINVFMRQVLEGDWDESVATLH  119



>ref|XP_008342331.1| PREDICTED: WD repeat-containing protein 26-like [Malus domestica]
 ref|XP_008342332.1| PREDICTED: WD repeat-containing protein 26-like [Malus domestica]
Length=578

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 90/120 (75%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGV D+EP  KR+K+S+GEL    N  S  +P   S  D  MAR L  EG   VVGSKG
Sbjct  1    MGGVGDEEPATKRMKLSAGELKGLSNGSSCGEPVAGSSRDL-MARPLPSEGDEQVVGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++K+VEFV++IA+ALYSLGYKK+GA LEEESGI LHSSVVNLFMQQILDG WD SV TL 
Sbjct  60   VIKRVEFVRLIAKALYSLGYKKSGAHLEEESGIPLHSSVVNLFMQQILDGNWDGSVDTLQ  119



>ref|XP_006602270.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Glycine 
max]
Length=580

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 92/119 (77%), Gaps = 3/119 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGEL--LNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKGI  370
            MGGVED+ P  KR+K+SS  L  L+  S  +P   S SD  MAR L  EG  +V+GSKG+
Sbjct  1    MGGVEDEAPALKRMKLSSKGLVGLSNGSSGEPVGGSSSDL-MARPLSSEGDGEVIGSKGV  59

Query  371  VKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            +K+ EFV+II +ALYSLGYKK+G +LEEESGI LHSSVVNLFMQQILDG WDES++TL+
Sbjct  60   IKREEFVRIITKALYSLGYKKSGVRLEEESGIPLHSSVVNLFMQQILDGHWDESIVTLN  118



>ref|XP_006448494.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
 gb|ESR61734.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
Length=532

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 87/120 (73%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVK---VSSGELLNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGG+E+ EPP KR K     S  L    S+++ + CSL D  MAR L  +G  + +GSKG
Sbjct  1    MGGIEESEPPLKRAKGPVAESKNLAEDSSVKESSVCSLGDV-MARPLTSQGDEETIGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++KK EF++II  ALYSLGY K+GA LEEESGI +HSSVVN FMQQ++DG WDES+ITLH
Sbjct  60   VIKKSEFIKIITRALYSLGYDKSGALLEEESGIPMHSSVVNQFMQQVMDGYWDESIITLH  119



>ref|XP_006602271.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Glycine 
max]
 gb|KHN28541.1| WD repeat-containing protein 26 [Glycine soja]
Length=546

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 92/119 (77%), Gaps = 3/119 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGEL--LNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKGI  370
            MGGVED+ P  KR+K+SS  L  L+  S  +P   S SD  MAR L  EG  +V+GSKG+
Sbjct  1    MGGVEDEAPALKRMKLSSKGLVGLSNGSSGEPVGGSSSDL-MARPLSSEGDGEVIGSKGV  59

Query  371  VKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            +K+ EFV+II +ALYSLGYKK+G +LEEESGI LHSSVVNLFMQQILDG WDES++TL+
Sbjct  60   IKREEFVRIITKALYSLGYKKSGVRLEEESGIPLHSSVVNLFMQQILDGHWDESIVTLN  118



>ref|XP_006448495.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
 gb|ESR61735.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
Length=557

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 87/120 (73%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVK---VSSGELLNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGG+E+ EPP KR K     S  L    S+++ + CSL D  MAR L  +G  + +GSKG
Sbjct  1    MGGIEESEPPLKRAKGPVAESKNLAEDSSVKESSVCSLGDV-MARPLTSQGDEETIGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++KK EF++II  ALYSLGY K+GA LEEESGI +HSSVVN FMQQ++DG WDES+ITLH
Sbjct  60   VIKKSEFIKIITRALYSLGYDKSGALLEEESGIPMHSSVVNQFMQQVMDGYWDESIITLH  119



>ref|XP_011032764.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
 ref|XP_011032766.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
 ref|XP_011032767.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
 ref|XP_011032768.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
 ref|XP_011032769.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
 ref|XP_011032770.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
Length=558

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 92/120 (77%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGV+DDEP  KR+K++SG L    N  SL +P   S  D  MAR L  EG  +V+GSKG
Sbjct  1    MGGVDDDEPALKRLKLASGRLTGLSNGSSLTEPIVGSSRDL-MARPLQSEGDEEVLGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++K+VEFV+IIA+ALYSLGYKK+ A+LEEESGI L+SS V++F QQILDG WDESV TLH
Sbjct  60   VIKRVEFVRIIAKALYSLGYKKSYARLEEESGIPLYSSSVDIFTQQILDGSWDESVATLH  119



>ref|XP_008775985.1| PREDICTED: WD repeat-containing protein 26-like [Phoenix dactylifera]
Length=582

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 92/121 (76%), Gaps = 7/121 (6%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKSLRDPT----NCSLSDCSMARSLVCEGGNDVVGSK  364
            MGGVEDDEPP KR+K SS +L    SLRD +      S    SMAR L  +G + VVGSK
Sbjct  1    MGGVEDDEPPSKRMKTSSEDL---GSLRDKSFLSERISPLGGSMARPLPPQGKDYVVGSK  57

Query  365  GIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            G++K+VEFV+II +ALYSLGY+ +GA LEEESGI+LHSS VNLF +Q+LDG WDESV+TL
Sbjct  58   GLIKRVEFVRIITKALYSLGYESSGAALEEESGIYLHSSGVNLFRKQVLDGNWDESVVTL  117

Query  545  H  547
            H
Sbjct  118  H  118



>ref|XP_008229590.1| PREDICTED: WD repeat-containing protein 26-like [Prunus mume]
 ref|XP_008229591.1| PREDICTED: WD repeat-containing protein 26-like [Prunus mume]
Length=578

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 90/120 (75%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGV D+EP  KR+K+S G+L    N  S+ +P   S  D  MAR L  EG  +VVGSKG
Sbjct  1    MGGVGDEEPATKRMKLSPGQLRGLSNGSSITEPVAGSSRDL-MARPLTSEGDEEVVGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++K+VEFV++IA+ALYSLGYKK+GA LEEESGI LHSSVV LFMQQILDG WD SV TL 
Sbjct  60   VIKRVEFVRLIAKALYSLGYKKSGAHLEEESGIPLHSSVVTLFMQQILDGNWDGSVDTLQ  119



>ref|XP_002513152.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF49655.1| WD-repeat protein, putative [Ricinus communis]
Length=578

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 89/119 (75%), Gaps = 4/119 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGE---LLNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MG VED+EPP KRVK+  GE    L+  S+  P +CSL D  MAR L  +G  + VGS+G
Sbjct  1    MGVVEDNEPPLKRVKLPVGEVRTFLDHSSVTGPVSCSLGDL-MARPLNSQGDGETVGSRG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            ++K++EFV+II  ALYSLGY K+GA LEEESGI LHS VV+LFMQQ++D KWDESV TL
Sbjct  60   VIKRLEFVKIITRALYSLGYDKSGALLEEESGIPLHSPVVSLFMQQVIDEKWDESVATL  118



>ref|XP_006448496.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
 ref|XP_006448497.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
 ref|XP_006448498.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
 ref|XP_006448499.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
 gb|ESR61736.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
 gb|ESR61737.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
 gb|ESR61738.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
 gb|ESR61739.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
Length=581

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 87/120 (73%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVK---VSSGELLNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGG+E+ EPP KR K     S  L    S+++ + CSL D  MAR L  +G  + +GSKG
Sbjct  1    MGGIEESEPPLKRAKGPVAESKNLAEDSSVKESSVCSLGDV-MARPLTSQGDEETIGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++KK EF++II  ALYSLGY K+GA LEEESGI +HSSVVN FMQQ++DG WDES+ITLH
Sbjct  60   VIKKSEFIKIITRALYSLGYDKSGALLEEESGIPMHSSVVNQFMQQVMDGYWDESIITLH  119



>ref|XP_009356585.1| PREDICTED: WD repeat-containing protein 26-like [Pyrus x bretschneideri]
 ref|XP_009356586.1| PREDICTED: WD repeat-containing protein 26-like [Pyrus x bretschneideri]
 ref|XP_009356587.1| PREDICTED: WD repeat-containing protein 26-like [Pyrus x bretschneideri]
Length=579

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 89/120 (74%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGV D+EP  KR+K+S+GEL    N  S  +P   S  D  MAR L  EG   VVGSKG
Sbjct  1    MGGVGDEEPATKRMKLSAGELRGLSNGSSCAEPVAGSSRDL-MARPLPSEGDEQVVGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++K+VEFV++IA+ALYSLGYKK+GA LEEESGI LHSS VNLFMQQILDG WD SV TL 
Sbjct  60   VIKRVEFVRLIAKALYSLGYKKSGAHLEEESGIPLHSSFVNLFMQQILDGNWDGSVDTLQ  119



>ref|XP_002306758.1| hypothetical protein POPTR_0005s22820g [Populus trichocarpa]
 gb|EEE93754.1| hypothetical protein POPTR_0005s22820g [Populus trichocarpa]
Length=581

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 92/120 (77%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGV+DDEP  KR+K++SG L    N  SL +P   S  D  MAR L  EG  +V+GSKG
Sbjct  1    MGGVDDDEPALKRLKLASGRLTGLSNGSSLTEPIVGSSRDL-MARPLQSEGDEEVLGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++K+VEFV+IIA+ALYSLGYKK+ A+LEEESGI L+SS V++F QQILDG WDESV TLH
Sbjct  60   VIKRVEFVRIIAKALYSLGYKKSYARLEEESGIPLYSSSVDIFTQQILDGSWDESVATLH  119



>ref|XP_004303899.1| PREDICTED: WD repeat-containing protein 26 [Fragaria vesca subsp. 
vesca]
Length=578

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 91/120 (76%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGV D+EP  KR+KVS G+L    N  S  +P   S  D  MAR L  +G  +VVGSKG
Sbjct  1    MGGVGDEEPASKRMKVSPGDLRGLSNGSSYTEPVAGSSRDL-MARPLTSQGDEEVVGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++K+VEFV++IA+ALYSLGY K+GA+LEEESGI LHS VVNLFM+QIL+G WDESV+TL 
Sbjct  60   VIKRVEFVRLIAKALYSLGYNKSGARLEEESGIPLHSPVVNLFMEQILNGNWDESVVTLQ  119



>gb|KDO77043.1| hypothetical protein CISIN_1g008011mg [Citrus sinensis]
Length=532

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 87/120 (73%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVK---VSSGELLNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGG+E+ EPP KR K     S  L    S+++ + CSL D  MAR L  +G  + +GSKG
Sbjct  1    MGGIEESEPPLKRAKGPVAESKNLAEDSSVKESSVCSLGDV-MARPLTSQGDEEKIGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++KK EF++II  ALYSLGY K+GA LEEESGI +HSSVVN FMQQ++DG WDES+ITLH
Sbjct  60   VIKKSEFIKIITRALYSLGYDKSGALLEEESGIPMHSSVVNQFMQQVMDGYWDESIITLH  119



>ref|XP_002302127.1| hypothetical protein POPTR_0002s05670g [Populus trichocarpa]
 gb|EEE81400.1| hypothetical protein POPTR_0002s05670g [Populus trichocarpa]
Length=580

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 91/120 (76%), Gaps = 5/120 (4%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGVEDDEP  KR+K++SG L    N  SL +P   S     MAR    EG  DV+GSKG
Sbjct  1    MGGVEDDEPASKRLKLASGRLTGLSNGSSLTEPIVGSRD--LMARPPQSEGDKDVLGSKG  58

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++K+VEFV+IIA+AL+SLGYKK+ A LEEESGI LHSS V+LFMQQ+L+G WDESV+TLH
Sbjct  59   VIKRVEFVRIIAKALHSLGYKKSCAHLEEESGIPLHSSAVDLFMQQVLNGNWDESVVTLH  118



>ref|XP_006468684.1| PREDICTED: WD repeat-containing protein 26-like isoform X3 [Citrus 
sinensis]
 gb|KDO77042.1| hypothetical protein CISIN_1g008011mg [Citrus sinensis]
Length=556

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 87/120 (73%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVK---VSSGELLNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGG+E+ EPP KR K     S  L    S+++ + CSL D  MAR L  +G  + +GSKG
Sbjct  1    MGGIEESEPPLKRAKGPVAESKNLAEDSSVKESSVCSLGDV-MARPLTSQGDEEKIGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++KK EF++II  ALYSLGY K+GA LEEESGI +HSSVVN FMQQ++DG WDES+ITLH
Sbjct  60   VIKKSEFIKIITRALYSLGYDKSGALLEEESGIPMHSSVVNQFMQQVMDGYWDESIITLH  119



>ref|XP_010093188.1| WD repeat-containing protein 26 [Morus notabilis]
 gb|EXB53676.1| WD repeat-containing protein 26 [Morus notabilis]
Length=588

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 94/122 (77%), Gaps = 9/122 (7%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKSLRDPTNC--SLSDCS----MARSLVCEGGNDVVG  358
            MGGV D+EP  KR+K+SSGEL   +SL + T+    ++ CS    MAR L   G ++VVG
Sbjct  1    MGGVGDEEPATKRMKLSSGEL---RSLSNGTSSVEPVAGCSSRGLMARPLQSAGDDEVVG  57

Query  359  SKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVI  538
            SKG++K+VEFV+IIA+ALYSLGYKK+GA LEEESGI LHSS VNLFMQQ+ DG W+ESV 
Sbjct  58   SKGVIKRVEFVRIIAKALYSLGYKKSGAHLEEESGISLHSSSVNLFMQQVRDGNWNESVT  117

Query  539  TL  544
            TL
Sbjct  118  TL  119



>ref|XP_006468682.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Citrus 
sinensis]
 ref|XP_006468683.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Citrus 
sinensis]
 gb|KDO77040.1| hypothetical protein CISIN_1g008011mg [Citrus sinensis]
 gb|KDO77041.1| hypothetical protein CISIN_1g008011mg [Citrus sinensis]
Length=581

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 87/120 (73%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVK---VSSGELLNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGG+E+ EPP KR K     S  L    S+++ + CSL D  MAR L  +G  + +GSKG
Sbjct  1    MGGIEESEPPLKRAKGPVAESKNLAEDSSVKESSVCSLGDV-MARPLTSQGDEEKIGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++KK EF++II  ALYSLGY K+GA LEEESGI +HSSVVN FMQQ++DG WDES+ITLH
Sbjct  60   VIKKSEFIKIITRALYSLGYDKSGALLEEESGIPMHSSVVNQFMQQVMDGYWDESIITLH  119



>ref|XP_007217238.1| hypothetical protein PRUPE_ppa006325mg [Prunus persica]
 gb|EMJ18437.1| hypothetical protein PRUPE_ppa006325mg [Prunus persica]
Length=417

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 89/120 (74%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGV D+EP  KR+K+S G+L    N  S+ +P   S  D  MAR L  EG  +VVGSKG
Sbjct  1    MGGVGDEEPATKRMKLSPGQLRGLSNGSSITEPVAGSSRDL-MARPLTSEGDEEVVGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++K+VEFV++IA+ALYSLGYKK+ A LEEESGI LHSSVV LFMQQILDG WD SV TL 
Sbjct  60   VIKRVEFVRLIAKALYSLGYKKSSAHLEEESGIPLHSSVVTLFMQQILDGNWDGSVDTLQ  119



>ref|XP_008380168.1| PREDICTED: WD repeat-containing protein 26-like [Malus domestica]
 ref|XP_008380169.1| PREDICTED: WD repeat-containing protein 26-like [Malus domestica]
 ref|XP_008380170.1| PREDICTED: WD repeat-containing protein 26-like [Malus domestica]
 ref|XP_008380171.1| PREDICTED: WD repeat-containing protein 26-like [Malus domestica]
Length=579

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 88/120 (73%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGV D+EP  KR+K+S+GEL    N  S   P   S  D  MAR L  EG   VVGSKG
Sbjct  1    MGGVGDEEPATKRMKLSAGELRGLSNGSSCAKPVAGSSRDL-MARPLPSEGDEQVVGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++K+VEFV++IA+ALYSLGYKK+GA LEEESGI LHSS VNLFMQQILDG WD SV TL 
Sbjct  60   VIKRVEFVRLIAKALYSLGYKKSGAHLEEESGIPLHSSFVNLFMQQILDGNWDGSVDTLQ  119



>ref|XP_008221109.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized WD repeat-containing 
protein C343.04c [Prunus mume]
Length=562

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 85/119 (71%), Gaps = 4/119 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLN---RKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGG ED EPP KRVKV+  E  N     S+ DP   SL D  MAR L  +G  + +G  G
Sbjct  1    MGGREDSEPPLKRVKVTLTESKNSSDHSSITDPVASSLGD-YMARPLPSQGDEETIGKTG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            ++K+ EF+++I  ALYSLGY KTGA LEEESGI +HSSVVNLFMQQ++DGKWD+SV TL
Sbjct  60   VIKRSEFIKVITRALYSLGYDKTGAILEEESGIPMHSSVVNLFMQQVMDGKWDDSVATL  118



>ref|XP_011026207.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
Length=580

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 91/120 (76%), Gaps = 5/120 (4%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGVEDDEP  KR+K++SG L    N  SL +P   S     MAR    EG  +V+GSKG
Sbjct  1    MGGVEDDEPASKRLKLASGRLTGLSNGSSLTEPIVGSRD--LMARPPQSEGDKEVLGSKG  58

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++K+VEFV+IIA+AL+SLGYKK+ A LEEESGI LHSS V+LFMQQ+L+G WDESV+TLH
Sbjct  59   VIKRVEFVRIIAKALHSLGYKKSCAHLEEESGIPLHSSAVDLFMQQVLNGNWDESVVTLH  118



>ref|XP_004149516.1| PREDICTED: WD repeat-containing protein 26-like [Cucumis sativus]
Length=591

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 91/121 (75%), Gaps = 5/121 (4%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGN-DVVGSK  364
            MGG+ED+EP  KR+KVSS +L    N  S+ +P   S  D  MAR L  EG + DV+GSK
Sbjct  1    MGGLEDEEPASKRMKVSSEKLKGLSNGLSVVEPLGGSSRDL-MARPLQSEGDSGDVIGSK  59

Query  365  GIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            G++K+VEFV+IIA ALYSLGYKKTGA LEEESGI LHS  VN+ MQQI DGKWDESV TL
Sbjct  60   GVIKRVEFVRIIANALYSLGYKKTGAYLEEESGIPLHSPAVNVLMQQIHDGKWDESVETL  119

Query  545  H  547
            H
Sbjct  120  H  120



>ref|XP_004162570.1| PREDICTED: WD repeat-containing protein 26-like [Cucumis sativus]
 gb|KGN54948.1| hypothetical protein Csa_4G614210 [Cucumis sativus]
Length=591

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 91/121 (75%), Gaps = 5/121 (4%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGN-DVVGSK  364
            MGG+ED+EP  KR+KVSS +L    N  S+ +P   S  D  MAR L  EG + DV+GSK
Sbjct  1    MGGLEDEEPASKRMKVSSEKLKGLSNGLSVVEPLGGSSRDL-MARPLQSEGDSGDVIGSK  59

Query  365  GIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            G++K+VEFV+IIA ALYSLGYKKTGA LEEESGI LHS  VN+ MQQI DGKWDESV TL
Sbjct  60   GVIKRVEFVRIIANALYSLGYKKTGAYLEEESGIPLHSPAVNVLMQQIHDGKWDESVETL  119

Query  545  H  547
            H
Sbjct  120  H  120



>ref|XP_007146281.1| hypothetical protein PHAVU_006G027500g [Phaseolus vulgaris]
 gb|ESW18275.1| hypothetical protein PHAVU_006G027500g [Phaseolus vulgaris]
Length=586

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 90/120 (75%), Gaps = 5/120 (4%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLN----RKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSK  364
            MGGVED+EP  KR+KVSS  L+       S  +P     SD  MAR L  EG  +VVGS+
Sbjct  1    MGGVEDEEPALKRMKVSSKGLVGLSNGSSSSVEPVGGPSSDL-MARPLSSEGDGEVVGSR  59

Query  365  GIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            G++K+ EFV+II +ALYSLGYKK+GA+LEEESGI LHSS+VNL MQQILDG WDES++TL
Sbjct  60   GVIKREEFVRIITKALYSLGYKKSGARLEEESGIPLHSSIVNLCMQQILDGHWDESIVTL  119



>ref|XP_003617329.1| WD-repeat protein-like protein [Medicago truncatula]
 gb|AET00288.1| transducin/WD40 repeat protein [Medicago truncatula]
Length=572

 Score =   135 bits (340),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 91/119 (76%), Gaps = 4/119 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGV+D+EP  KR+K+S+  L+   N  S ++P     SD SMAR L  EG + VVGSKG
Sbjct  1    MGGVDDEEPALKRMKLSAKGLVGLANGSSSKEPVGGFSSD-SMARLLPSEGDDQVVGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            ++K+ EFV+IIA+ALYSLGY+K+GA+LEEESGI LHS  VNLF QQ+LDG WDESV TL
Sbjct  60   VIKRDEFVRIIAKALYSLGYRKSGARLEEESGIPLHSPGVNLFTQQVLDGNWDESVATL  118



>ref|XP_007043170.1| Transducin family protein / WD-40 repeat family protein isoform 
1 [Theobroma cacao]
 ref|XP_007043171.1| Transducin family protein / WD-40 repeat family protein isoform 
1 [Theobroma cacao]
 ref|XP_007043172.1| Transducin family protein / WD-40 repeat family protein isoform 
1 [Theobroma cacao]
 gb|EOX99001.1| Transducin family protein / WD-40 repeat family protein isoform 
1 [Theobroma cacao]
 gb|EOX99002.1| Transducin family protein / WD-40 repeat family protein isoform 
1 [Theobroma cacao]
 gb|EOX99003.1| Transducin family protein / WD-40 repeat family protein isoform 
1 [Theobroma cacao]
Length=581

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 85/123 (69%), Gaps = 10/123 (8%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKS------LRDPTNCSLSDCSMARSLVCEGGNDVVG  358
            MG +ED EPP KRVK   G L   KS        +P +CSL    MAR L  +G  + +G
Sbjct  1    MGVIEDTEPPLKRVK---GPLDESKSSPEDRLTAEPVSCSLG-AQMARPLTSQGDGETIG  56

Query  359  SKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVI  538
            SKG++KK EF+++I  ALYSLGY K+GA LEEESGI LHS VVNLFMQQ+ DGKWD+SV 
Sbjct  57   SKGVIKKAEFIKLITRALYSLGYDKSGALLEEESGIPLHSPVVNLFMQQVTDGKWDDSVA  116

Query  539  TLH  547
            TLH
Sbjct  117  TLH  119



>ref|XP_011000199.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
 ref|XP_011000201.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
Length=510

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 90/120 (75%), Gaps = 5/120 (4%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGVEDDEP  KR+K++SG L    N  SL +    S     MAR    EG  +V+GSKG
Sbjct  1    MGGVEDDEPASKRLKLASGRLTGLSNGSSLTESIVGSRD--LMARPPQSEGDKEVLGSKG  58

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++K+VEFV+IIA+AL+SLGYKK+ A LEEESGI LHSS V+LFMQQ+L+G WDESV+TLH
Sbjct  59   VIKRVEFVRIIAKALHSLGYKKSCAHLEEESGIPLHSSAVDLFMQQVLNGNWDESVVTLH  118



>ref|XP_008466801.1| PREDICTED: uncharacterized WD repeat-containing protein C343.04c-like 
[Cucumis melo]
Length=594

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 90/121 (74%), Gaps = 5/121 (4%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGN-DVVGSK  364
            MGG+ED+EP  KR+KVSS +L    N  S+ +P   S  D  MAR L  EG + DV+GSK
Sbjct  1    MGGLEDEEPASKRMKVSSEKLKGLSNGLSVVEPLGGSSRDL-MARPLQSEGDSGDVIGSK  59

Query  365  GIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            G++K+VEFV+IIA ALYSLGYKKTGA LEEESGI LHS  VN+ MQQI DGKWDESV TL
Sbjct  60   GVIKRVEFVRIIANALYSLGYKKTGAYLEEESGIPLHSPAVNVLMQQIHDGKWDESVETL  119

Query  545  H  547
             
Sbjct  120  Q  120



>ref|XP_007141447.1| hypothetical protein PHAVU_008G196400g [Phaseolus vulgaris]
 gb|ESW13441.1| hypothetical protein PHAVU_008G196400g [Phaseolus vulgaris]
Length=573

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 88/119 (74%), Gaps = 4/119 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGVED+EP  KR+K+SS  L+   N  S ++P    LS   MAR L  +G   VVGSKG
Sbjct  1    MGGVEDEEPALKRMKLSSKGLVALSNGSSSKEPVG-GLSRDFMARPLPSKGDEQVVGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            ++KK EFV+IIA+ALYSLGY K+GA LEEESGI LHS  VN+FMQQILDG WD+SV TL
Sbjct  60   VIKKEEFVRIIAKALYSLGYGKSGAHLEEESGIPLHSPGVNIFMQQILDGNWDDSVATL  118



>ref|XP_010054068.1| PREDICTED: WD repeat-containing protein 26 [Eucalyptus grandis]
 gb|KCW89786.1| hypothetical protein EUGRSUZ_A02037 [Eucalyptus grandis]
 gb|KCW89787.1| hypothetical protein EUGRSUZ_A02037 [Eucalyptus grandis]
 gb|KCW89788.1| hypothetical protein EUGRSUZ_A02037 [Eucalyptus grandis]
Length=584

 Score =   132 bits (333),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 90/120 (75%), Gaps = 3/120 (3%)
 Frame = +2

Query  197  MGGVEDD-EPPFKRVKVSSGEL--LNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGVED+ EP  KR+K+SS  L  L   S R       S   MAR L  EG  +V+GSKG
Sbjct  1    MGGVEDESEPASKRMKLSSRVLRGLANGSSRTEPAAGSSLGLMARPLPIEGDEEVIGSKG  60

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++K+VEFV++IA+ALYSLGY+K+GA+LEEESGI L SSVVNLFMQQI DG WDESV+TLH
Sbjct  61   VIKRVEFVRLIAKALYSLGYEKSGARLEEESGIPLQSSVVNLFMQQISDGLWDESVVTLH  120



>ref|XP_003532075.1| PREDICTED: WD repeat-containing protein 26-like [Glycine max]
 gb|KHM99675.1| WD repeat-containing protein 26 [Glycine soja]
Length=581

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 90/120 (75%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGGVED+EP  KR+K+SS  L+   N  S  +    S SD  MAR L  EG  +V+GSKG
Sbjct  1    MGGVEDEEPALKRMKLSSKGLVGLSNGSSSVESVGGSSSDL-MARPLSSEGDGEVIGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++K+ EFV+II +ALYSLGYKK+GA+LEEESGI LHSSVVN FMQ ILDG WDESV TL+
Sbjct  60   VIKREEFVRIITKALYSLGYKKSGARLEEESGIPLHSSVVNQFMQHILDGHWDESVATLN  119



>ref|XP_009405376.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405377.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405378.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405379.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405380.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
Length=582

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 89/122 (73%), Gaps = 11/122 (9%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKSLRDPTNCSLSDCS------MARSLVCEGGNDVVG  358
            MGGVED+EPP KRVK SS EL N  +       SLS+        MAR L  +G  D+VG
Sbjct  1    MGGVEDNEPPSKRVKTSSLELENLSN-----TSSLSEFINPLGGLMARPLPSQGREDMVG  55

Query  359  SKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVI  538
            SKG++KKVEFV+II +ALYSLGY+++GA LEEESGI LHSS V++F +Q+L+G WDESVI
Sbjct  56   SKGVIKKVEFVRIITKALYSLGYERSGAVLEEESGIPLHSSAVDIFRKQVLEGNWDESVI  115

Query  539  TL  544
             L
Sbjct  116  AL  117



>ref|XP_006399360.1| hypothetical protein EUTSA_v10013060mg [Eutrema salsugineum]
 gb|ESQ40813.1| hypothetical protein EUTSA_v10013060mg [Eutrema salsugineum]
Length=530

 Score =   129 bits (325),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 84/121 (69%), Gaps = 5/121 (4%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGE---LLNRKSLRDPT-NCSLSDCSMARSLVCEGGNDVVGSK  364
            MG VED EPP KR K  + E        S+R  T N SL D  MAR L  +G ++ +GSK
Sbjct  1    MGVVEDTEPPLKRAKRLADEPNSFSGNSSVRGSTVNNSLGDL-MARPLTSQGDDETIGSK  59

Query  365  GIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            G++KK EF++II  ALYSLGY K GA LEEESGI LH S+V +F+QQ+ DGKWDESV+TL
Sbjct  60   GVIKKTEFIRIITRALYSLGYDKAGAMLEEESGIPLHHSLVKVFLQQVKDGKWDESVVTL  119

Query  545  H  547
            H
Sbjct  120  H  120



>ref|XP_003545311.1| PREDICTED: WD repeat-containing protein 26-like [Glycine max]
 gb|KHN11996.1| WD repeat-containing protein 26 [Glycine soja]
Length=572

 Score =   129 bits (325),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 90/119 (76%), Gaps = 4/119 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGEL--LNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKGI  370
            MGGVED+EP  KR+K+SS  L  L+  S ++P    LS   MAR L  +G ++ VGSKG+
Sbjct  1    MGGVEDEEPSMKRMKLSSKGLVGLSNGSSKEPVG-GLSSDLMARPLPSKG-DEHVGSKGV  58

Query  371  VKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            +KK EFV+IIA+ALYSLGY K+GA LEEESGI LHS  VNLFMQQILDG WD+SV TL+
Sbjct  59   IKKEEFVRIIAKALYSLGYGKSGAHLEEESGIPLHSPGVNLFMQQILDGNWDDSVATLY  117



>ref|XP_010546278.1| PREDICTED: WD repeat-containing protein 26-like [Tarenaya hassleriana]
 ref|XP_010546280.1| PREDICTED: WD repeat-containing protein 26-like [Tarenaya hassleriana]
Length=578

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 82/120 (68%), Gaps = 4/120 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGE---LLNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MG VED EPP KR K    E        S+ D  N  L D  MAR L  +G  + +GSKG
Sbjct  1    MGVVEDTEPPLKRAKTLVDEPNGFSGNSSVIDSVNNYLGDL-MARPLTSQGDGETIGSKG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++KK EF++II  ALYSLGY KTGA LEEESGI +H+S+V LF+QQ++DGKWDESV TLH
Sbjct  60   VIKKSEFIRIITRALYSLGYDKTGALLEEESGIPMHASIVKLFLQQVMDGKWDESVGTLH  119



>gb|EYU42813.1| hypothetical protein MIMGU_mgv1a003386mg [Erythranthe guttata]
 gb|EYU42815.1| hypothetical protein MIMGU_mgv1a003386mg [Erythranthe guttata]
Length=588

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 91/120 (76%), Gaps = 5/120 (4%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGE---LLNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MGG+EDDEP  KRVKV SGE   L N  SL + +  SL D SMAR L  +G N+ +GSKG
Sbjct  1    MGGIEDDEPLSKRVKVLSGESVGLSNGLSLNEGS-FSLRD-SMARLLSSQGDNEAIGSKG  58

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++KKVE V+II EALYSLG  +TGA+LEEESGI LH+ VV++FM+Q L+G+WD+SV  LH
Sbjct  59   VIKKVELVRIITEALYSLGNSETGARLEEESGIPLHTPVVDMFMRQTLEGQWDKSVSMLH  118



>ref|XP_006399358.1| hypothetical protein EUTSA_v10013060mg [Eutrema salsugineum]
 ref|XP_006399359.1| hypothetical protein EUTSA_v10013060mg [Eutrema salsugineum]
 gb|ESQ40811.1| hypothetical protein EUTSA_v10013060mg [Eutrema salsugineum]
 gb|ESQ40812.1| hypothetical protein EUTSA_v10013060mg [Eutrema salsugineum]
Length=587

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 84/121 (69%), Gaps = 5/121 (4%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGE---LLNRKSLRDPT-NCSLSDCSMARSLVCEGGNDVVGSK  364
            MG VED EPP KR K  + E        S+R  T N SL D  MAR L  +G ++ +GSK
Sbjct  1    MGVVEDTEPPLKRAKRLADEPNSFSGNSSVRGSTVNNSLGDL-MARPLTSQGDDETIGSK  59

Query  365  GIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            G++KK EF++II  ALYSLGY K GA LEEESGI LH S+V +F+QQ+ DGKWDESV+TL
Sbjct  60   GVIKKTEFIRIITRALYSLGYDKAGAMLEEESGIPLHHSLVKVFLQQVKDGKWDESVVTL  119

Query  545  H  547
            H
Sbjct  120  H  120



>ref|XP_004171491.1| PREDICTED: WD repeat-containing protein 26-like, partial [Cucumis 
sativus]
Length=571

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 87/120 (73%), Gaps = 5/120 (4%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGN-DVVGSK  364
            MGGVED+EP  KR+KV+S EL    N  S+ +    S  +  MAR L  EG N  V+GS+
Sbjct  1    MGGVEDEEPALKRMKVASTELRGLSNGSSILERVGGSSREL-MARPLPSEGDNRKVIGSR  59

Query  365  GIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            G+++K EFV+IIA ALYSLGYKK+ A LEEESGI LHSS VN+FMQ ILDG WDES+ TL
Sbjct  60   GVIRKDEFVRIIANALYSLGYKKSSALLEEESGIPLHSSTVNIFMQHILDGNWDESINTL  119



>ref|XP_004149517.1| PREDICTED: WD repeat-containing protein 26-like [Cucumis sativus]
 gb|KGN54949.1| hypothetical protein Csa_4G614220 [Cucumis sativus]
Length=584

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 87/120 (73%), Gaps = 5/120 (4%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELL---NRKSLRDPTNCSLSDCSMARSLVCEGGN-DVVGSK  364
            MGGVED+EP  KR+KV+S EL    N  S+ +    S  +  MAR L  EG N  V+GS+
Sbjct  1    MGGVEDEEPALKRMKVASTELRGLSNGSSILERVGGSSREL-MARPLPSEGDNRKVIGSR  59

Query  365  GIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            G+++K EFV+IIA ALYSLGYKK+ A LEEESGI LHSS VN+FMQ ILDG WDES+ TL
Sbjct  60   GVIRKDEFVRIIANALYSLGYKKSSALLEEESGIPLHSSTVNIFMQHILDGNWDESINTL  119



>ref|XP_007222293.1| hypothetical protein PRUPE_ppa003324mg [Prunus persica]
 gb|EMJ23492.1| hypothetical protein PRUPE_ppa003324mg [Prunus persica]
Length=585

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 83/119 (70%), Gaps = 4/119 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLN---RKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            M  ++D EPP KRVKV+  +  N     S+ DP   SL D  MA  L  +G  + +G  G
Sbjct  1    MAAIKDSEPPLKRVKVTLTQSKNSSDHSSITDPVASSLGD-YMAWPLPSQGDEETIGKTG  59

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            ++K+ EF+++I  ALYSLGY KTGA LEEESGI +HSS+VNLFMQQ++DGKWD+SV TL
Sbjct  60   VIKRSEFIKVITRALYSLGYDKTGAILEEESGIPMHSSLVNLFMQQVMDGKWDDSVATL  118



>ref|XP_010423053.1| PREDICTED: WD repeat-containing protein 26-like [Camelina sativa]
Length=587

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 82/121 (68%), Gaps = 5/121 (4%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGE---LLNRKSLRD-PTNCSLSDCSMARSLVCEGGNDVVGSK  364
            MG VED EPP KR K   GE        S+R    N SL D  MAR L  +G +  +GSK
Sbjct  1    MGVVEDTEPPLKRAKRLVGEPNGFSGNSSVRPCSVNNSLGDL-MARPLTSQGDDQTIGSK  59

Query  365  GIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            G++KK EFV+II  ALYSLGY KTGA LEEESGI LH+S++  F+QQ+ DGKWDESV TL
Sbjct  60   GVIKKSEFVRIITRALYSLGYDKTGAMLEEESGISLHNSIIKAFLQQVKDGKWDESVKTL  119

Query  545  H  547
            H
Sbjct  120  H  120



>gb|KEH33653.1| transducin/WD40 repeat protein [Medicago truncatula]
Length=581

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 86/119 (72%), Gaps = 2/119 (2%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKSLRDPTNCSLSDCS--MARSLVCEGGNDVVGSKGI  370
            MGGVED+EP  KR K+ S  L +  +        +   S  MAR L  EG N+VVGSKGI
Sbjct  1    MGGVEDEEPALKRTKLLSKGLNSLSNGSSSVERVVGSSSELMARPLSSEGDNEVVGSKGI  60

Query  371  VKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            +KK EFV+II +ALYSLGYKKTG  LEEESGI L+SSVVN+FMQQ+LDG W+ESV TL+
Sbjct  61   IKKGEFVRIITKALYSLGYKKTGENLEEESGIPLNSSVVNVFMQQVLDGDWEESVSTLN  119



>gb|KJB47108.1| hypothetical protein B456_008G011600 [Gossypium raimondii]
Length=514

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 84/122 (69%), Gaps = 10/122 (8%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKSLRD------PTNCSLSDCSMARSLVCEGGNDVVG  358
            MG  ED EPP KRVK   G L   KSL +        +CSL D  MAR L  +G  + +G
Sbjct  1    MGVAEDSEPPLKRVK---GPLEESKSLPEDHSTTKSVSCSLGD-QMARPLTSQGDGETIG  56

Query  359  SKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVI  538
            S+G+++K EF++II  ALYSLGY K+GA LEEESGI LHSSVVNLFM Q+ +GKWD+SV 
Sbjct  57   SQGVIRKAEFIKIITRALYSLGYDKSGALLEEESGIPLHSSVVNLFMGQVTNGKWDDSVA  116

Query  539  TL  544
            TL
Sbjct  117  TL  118



>gb|KJB47107.1| hypothetical protein B456_008G011600 [Gossypium raimondii]
Length=574

 Score =   127 bits (318),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 84/122 (69%), Gaps = 10/122 (8%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKSLRD------PTNCSLSDCSMARSLVCEGGNDVVG  358
            MG  ED EPP KRVK   G L   KSL +        +CSL D  MAR L  +G  + +G
Sbjct  1    MGVAEDSEPPLKRVK---GPLEESKSLPEDHSTTKSVSCSLGD-QMARPLTSQGDGETIG  56

Query  359  SKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVI  538
            S+G+++K EF++II  ALYSLGY K+GA LEEESGI LHSSVVNLFM Q+ +GKWD+SV 
Sbjct  57   SQGVIRKAEFIKIITRALYSLGYDKSGALLEEESGIPLHSSVVNLFMGQVTNGKWDDSVA  116

Query  539  TL  544
            TL
Sbjct  117  TL  118



>gb|KJB47106.1| hypothetical protein B456_008G011600 [Gossypium raimondii]
 gb|KJB47109.1| hypothetical protein B456_008G011600 [Gossypium raimondii]
 gb|KJB47110.1| hypothetical protein B456_008G011600 [Gossypium raimondii]
Length=580

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 84/122 (69%), Gaps = 10/122 (8%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKSLRD------PTNCSLSDCSMARSLVCEGGNDVVG  358
            MG  ED EPP KRVK   G L   KSL +        +CSL D  MAR L  +G  + +G
Sbjct  1    MGVAEDSEPPLKRVK---GPLEESKSLPEDHSTTKSVSCSLGD-QMARPLTSQGDGETIG  56

Query  359  SKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVI  538
            S+G+++K EF++II  ALYSLGY K+GA LEEESGI LHSSVVNLFM Q+ +GKWD+SV 
Sbjct  57   SQGVIRKAEFIKIITRALYSLGYDKSGALLEEESGIPLHSSVVNLFMGQVTNGKWDDSVA  116

Query  539  TL  544
            TL
Sbjct  117  TL  118



>ref|XP_004499533.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Cicer 
arietinum]
Length=540

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 87/119 (73%), Gaps = 8/119 (7%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKSLRDPTNCSLSDCS--MARSLVCEGGNDVVGSKGI  370
            MGGVED+EP  KR+++SS    N  S      C++   S  MAR L  EG ++V+GS GI
Sbjct  1    MGGVEDEEPALKRMRLSS---YNGSS---SVECTVGSSSGLMARPLSAEGEDEVIGSTGI  54

Query  371  VKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            +K+ EFV+II +ALYSLGYKK+G  LEEESGI L SSVVN+FMQ+ILDG WDES+ TL+
Sbjct  55   IKRREFVRIITKALYSLGYKKSGEHLEEESGIPLQSSVVNVFMQKILDGDWDESLATLN  113



>ref|XP_004499532.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Cicer 
arietinum]
Length=574

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 87/119 (73%), Gaps = 8/119 (7%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKSLRDPTNCSLSDCS--MARSLVCEGGNDVVGSKGI  370
            MGGVED+EP  KR+++SS    N  S      C++   S  MAR L  EG ++V+GS GI
Sbjct  1    MGGVEDEEPALKRMRLSS---YNGSS---SVECTVGSSSGLMARPLSAEGEDEVIGSTGI  54

Query  371  VKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            +K+ EFV+II +ALYSLGYKK+G  LEEESGI L SSVVN+FMQ+ILDG WDES+ TL+
Sbjct  55   IKRREFVRIITKALYSLGYKKSGEHLEEESGIPLQSSVVNVFMQKILDGDWDESLATLN  113



>ref|XP_002873372.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49631.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=587

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 84/121 (69%), Gaps = 5/121 (4%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGE---LLNRKSLRDPT-NCSLSDCSMARSLVCEGGNDVVGSK  364
            MG VED EPP KR K  + E        SLR  + N SL D  MAR L  +G ++ +GSK
Sbjct  1    MGVVEDTEPPLKRAKRLTDEQNGFSGNSSLRGTSVNNSLGDL-MARPLTSQGDDETIGSK  59

Query  365  GIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            G++KK EF++II  ALYSLGY KTGA LEEESGI LH+S + LF+QQ+ DGKWD+SV TL
Sbjct  60   GVIKKSEFIRIITRALYSLGYDKTGAMLEEESGISLHNSTIKLFLQQVKDGKWDQSVKTL  119

Query  545  H  547
            +
Sbjct  120  Y  120



>gb|KEH33651.1| transducin family protein/WD-40 repeat protein [Medicago truncatula]
Length=311

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 83/116 (72%), Gaps = 5/116 (4%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKGIVK  376
            MGGVED+EP  KR K+S     N  S  +    S SD  MA  L  EG ++VVG+KG +K
Sbjct  1    MGGVEDEEPATKRTKLSP----NSSSSMEHVVGSTSDL-MAPPLSAEGDDEVVGTKGSLK  55

Query  377  KVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            + EFV++I +A+YSLGYKK+G  LEEESGI L+SS VNLFMQQ+LDG WDES+ TL
Sbjct  56   RREFVRMITKAMYSLGYKKSGEHLEEESGIPLNSSAVNLFMQQVLDGDWDESLATL  111



>ref|XP_003519528.1| PREDICTED: WD repeat-containing protein 26-like [Glycine max]
Length=573

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 87/119 (73%), Gaps = 3/119 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGEL--LNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKGI  370
            MGGVED+EP  KR+K+SS  L  L+  S ++P    LS   MA+ L+ +    VVGSKG+
Sbjct  1    MGGVEDEEPSMKRMKLSSKGLVGLSNGSSKEPVR-GLSSDLMAQPLLSKEDEHVVGSKGV  59

Query  371  VKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            +KK EFV+IIA+ALYSLGY K+GA LEEESGI L S  VNLF QQILDG WD+SV TL+
Sbjct  60   IKKEEFVRIIAKALYSLGYGKSGAHLEEESGIPLQSPGVNLFRQQILDGNWDDSVATLY  118



>gb|KHN38353.1| WD repeat-containing protein 26 [Glycine soja]
Length=570

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 87/119 (73%), Gaps = 3/119 (3%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGEL--LNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKGI  370
            MGGVED+EP  KR+K+SS  L  L+  S ++P    LS   MA+ L+ +    VVGSKG+
Sbjct  1    MGGVEDEEPSMKRMKLSSKGLVGLSNGSSKEPVR-GLSSDLMAQPLLSKEDEHVVGSKGV  59

Query  371  VKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            +KK EFV+IIA+ALYSLGY K+GA LEEESGI L S  VNLF QQILDG WD+SV TL+
Sbjct  60   IKKEEFVRIIAKALYSLGYGKSGAHLEEESGIPLQSPGVNLFRQQILDGNWDDSVATLY  118



>ref|XP_010491500.1| PREDICTED: WD repeat-containing protein 26-like [Camelina sativa]
Length=587

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 81/121 (67%), Gaps = 5/121 (4%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGE---LLNRKSLRD-PTNCSLSDCSMARSLVCEGGNDVVGSK  364
            MG VED EPP KR K    E        S+R    N SL D  MAR L  +G +  +GSK
Sbjct  1    MGVVEDTEPPLKRAKRLVDEPNGFSGNSSVRPCSVNNSLGDL-MARPLTSQGDDQTIGSK  59

Query  365  GIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            G++KK EFV+II  ALYSLGY KTGA LEEESGI LH+S++  F+QQ+ DGKWDESV TL
Sbjct  60   GVIKKSEFVRIITRALYSLGYDKTGAMLEEESGISLHNSIIKAFLQQVKDGKWDESVKTL  119

Query  545  H  547
            H
Sbjct  120  H  120



>dbj|BAD22174.1| putative WD repeat protein [Oryza sativa Japonica Group]
Length=510

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 84/120 (70%), Gaps = 7/120 (6%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKSLRDPTNC----SLSDCSMARSLVCEGGNDVVGSK  364
            MGG EDDEPP KR + SS E     SL D  +C    +    +MAR L  +G   +VGSK
Sbjct  1    MGGFEDDEPPSKRARASSVE---PASLLDSFSCLKPAAPLGSTMARPLPSQGKEVMVGSK  57

Query  365  GIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            G++K+ EFV+II +ALYSLGY+K+GA LEEESGI LHS  VNLF +Q+LDG WD +V+TL
Sbjct  58   GVIKRDEFVRIITKALYSLGYEKSGAVLEEESGITLHSPTVNLFRRQVLDGNWDSAVVTL  117



>ref|XP_006647187.1| PREDICTED: WD repeat-containing protein 26-like [Oryza brachyantha]
Length=592

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 85/121 (70%), Gaps = 7/121 (6%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKSLRDPTNCSLSD----CSMARSLVCEGGNDVVGSK  364
            MGG EDDEPP KR + S+ E     SL D  +C  S      +MAR L  +G   +VGSK
Sbjct  1    MGGFEDDEPPSKRARASTVE---PASLLDRFSCLKSTPPLGSTMARPLPSQGKEVMVGSK  57

Query  365  GIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            G++K+ EFV+II +ALYSLGY+K+GA LEEESGI LHS  VNLF +Q+LDG WD +V+TL
Sbjct  58   GVIKRDEFVRIITKALYSLGYEKSGAVLEEESGITLHSPTVNLFRKQVLDGNWDSAVVTL  117

Query  545  H  547
            +
Sbjct  118  N  118



>ref|XP_002270103.1| PREDICTED: WD repeat-containing protein 26 [Vitis vinifera]
 ref|XP_010655963.1| PREDICTED: WD repeat-containing protein 26 [Vitis vinifera]
 ref|XP_010655964.1| PREDICTED: WD repeat-containing protein 26 [Vitis vinifera]
 ref|XP_010655965.1| PREDICTED: WD repeat-containing protein 26 [Vitis vinifera]
 ref|XP_010655966.1| PREDICTED: WD repeat-containing protein 26 [Vitis vinifera]
Length=586

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 87/124 (70%), Gaps = 8/124 (6%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSG---ELLNRKSLRDP----TNCSLSDCSMARSLVCEGGNDVV  355
            MGG+E+ E P KRVKV SG    L    SL +P    +  SL D SMA S   +G  D +
Sbjct  1    MGGIEESERPLKRVKVPSGGSNSLSANLSLTEPREPASGFSLRD-SMAWSPSSQGDRDAI  59

Query  356  GSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESV  535
            GSKGI+K+ EF++II  ALYSLGY ++G  L++ESGI LHS+VV+LF QQ++DGKWDESV
Sbjct  60   GSKGIIKRPEFIKIITRALYSLGYSRSGDLLQKESGISLHSTVVDLFRQQVVDGKWDESV  119

Query  536  ITLH  547
             TLH
Sbjct  120  DTLH  123



>ref|XP_009412042.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
Length=586

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKSLRDPT-NCSLSDCSMARSLVCEGGNDVVGSKGIV  373
            MGG++DDEPP KRVK SS EL +  +      +       MA+ L   G  D++GSKG++
Sbjct  1    MGGLDDDEPPAKRVKASSAELRSLLNTSSSLLHIGCLGGPMAKPLPFHGEQDMIGSKGVI  60

Query  374  KKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            K+ EFV+II + LYSLGY+K+GA LEEESGI LHSSVVNLF +Q+LDG WD S+ TLH
Sbjct  61   KRAEFVRIITKTLYSLGYEKSGAILEEESGISLHSSVVNLFRKQVLDGNWDGSLETLH  118



>emb|CDX81113.1| BnaC03g03670D [Brassica napus]
Length=589

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 86/123 (70%), Gaps = 7/123 (6%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLN--RKSLRDPT--NCSLSDCSMARSLVC--EGGNDVVG  358
            MG VED EPPFKR K+   +  N    S+R  +  N SL D  MAR L    +G ++ +G
Sbjct  1    MGVVEDTEPPFKRAKLLLADEPNGNSSSIRATSSVNNSLGDL-MARPLTSSSQGDDETIG  59

Query  359  SKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVI  538
            SKG++KK EFV+II+ ALYSLGY KTGA LEEESGI +H SVV  F+QQ+ +GKWDESV 
Sbjct  60   SKGVIKKSEFVRIISRALYSLGYGKTGAMLEEESGIPMHQSVVKAFLQQVKEGKWDESVA  119

Query  539  TLH  547
            TLH
Sbjct  120  TLH  122



>ref|XP_008647998.1| PREDICTED: uncharacterized protein LOC100304385 isoform X2 [Zea 
mays]
 gb|AFW74460.1| hypothetical protein ZEAMMB73_133126 [Zea mays]
Length=510

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 85/129 (66%), Gaps = 23/129 (18%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKSLRDPTNCSLSDC------------SMARSLVCEG  340
            MGG EDDEPP KR + SS E           + SL DC            +MAR L  +G
Sbjct  1    MGGFEDDEPPSKRARASSVE-----------SASLPDCFLFSKSANPLGSTMARPLPSQG  49

Query  341  GNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGK  520
               +VGSKG++KK EFV+II++ LYSLGY+K+GA LEEESGI LH+ +VNLF +Q++DG 
Sbjct  50   KEAMVGSKGVIKKEEFVRIISKTLYSLGYEKSGAVLEEESGITLHNPMVNLFREQVIDGN  109

Query  521  WDESVITLH  547
            WD +V+TL+
Sbjct  110  WDNAVVTLN  118



>ref|NP_196473.1| WD40 domain-containing protein [Arabidopsis thaliana]
 ref|NP_001078546.1| WD40 domain-containing protein [Arabidopsis thaliana]
 dbj|BAB10005.1| WD-repeat protein-like [Arabidopsis thaliana]
 gb|AAK96726.1| WD-repeat protein-like [Arabidopsis thaliana]
 gb|AAL47352.1| WD-repeat protein-like [Arabidopsis thaliana]
 gb|AED91320.1| WD40 domain-containing protein [Arabidopsis thaliana]
 gb|AED91321.1| WD40 domain-containing protein [Arabidopsis thaliana]
Length=589

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 84/122 (69%), Gaps = 6/122 (5%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGE---LLNRKSLRDPT--NCSLSDCSMARSLVCEGGNDVVGS  361
            MG VED EPP KR K  + E        S+R  +  + SL D  MAR L  +G ++ +GS
Sbjct  1    MGVVEDTEPPLKRAKRLADEPNGFSANSSVRGSSVNSNSLGDL-MARPLPSQGDDETIGS  59

Query  362  KGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVIT  541
            KG+++K EFV+II  ALYSLGY KTGA LEEESGI LH+S + LF+QQ+ DGKWD+SV T
Sbjct  60   KGVIRKSEFVRIITRALYSLGYDKTGAMLEEESGISLHNSTIKLFLQQVKDGKWDQSVKT  119

Query  542  LH  547
            LH
Sbjct  120  LH  121



>ref|XP_010680145.1| PREDICTED: uncharacterized WD repeat-containing protein C343.04c 
[Beta vulgaris subsp. vulgaris]
Length=582

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 86/122 (70%), Gaps = 6/122 (5%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLN-----RKSLRDPTNCSLSDCSMARSLVCEGGNDVVGS  361
            MGGVED +PP+KR+++S     N     R   +     SL D  MAR + C+G  +V+GS
Sbjct  1    MGGVEDGQPPYKRLRLSCAGSSNLSSGLRAEEQPAAARSLRDL-MARPIQCQGEEEVIGS  59

Query  362  KGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVIT  541
            +G++KK+EFV++IA ALY+LGY+++GA LEEESGI L ++ VNL MQ +LDG+WDES + 
Sbjct  60   RGVIKKLEFVRLIAGALYALGYERSGACLEEESGIPLQTAAVNLLMQHVLDGRWDESALI  119

Query  542  LH  547
            L 
Sbjct  120  LQ  121



>ref|XP_008647995.1| PREDICTED: uncharacterized protein LOC100304385 isoform X1 [Zea 
mays]
 ref|XP_008647996.1| PREDICTED: uncharacterized protein LOC100304385 isoform X1 [Zea 
mays]
 ref|XP_008647997.1| PREDICTED: uncharacterized protein LOC100304385 isoform X1 [Zea 
mays]
 gb|AFW74459.1| hypothetical protein ZEAMMB73_133126 [Zea mays]
Length=599

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 85/129 (66%), Gaps = 23/129 (18%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKSLRDPTNCSLSDC------------SMARSLVCEG  340
            MGG EDDEPP KR + SS E           + SL DC            +MAR L  +G
Sbjct  1    MGGFEDDEPPSKRARASSVE-----------SASLPDCFLFSKSANPLGSTMARPLPSQG  49

Query  341  GNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGK  520
               +VGSKG++KK EFV+II++ LYSLGY+K+GA LEEESGI LH+ +VNLF +Q++DG 
Sbjct  50   KEAMVGSKGVIKKEEFVRIISKTLYSLGYEKSGAVLEEESGITLHNPMVNLFREQVIDGN  109

Query  521  WDESVITLH  547
            WD +V+TL+
Sbjct  110  WDNAVVTLN  118



>ref|XP_006287344.1| hypothetical protein CARUB_v10000543mg [Capsella rubella]
 gb|EOA20242.1| hypothetical protein CARUB_v10000543mg [Capsella rubella]
Length=587

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 81/120 (68%), Gaps = 5/120 (4%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGE---LLNRKSLRDPT-NCSLSDCSMARSLVCEGGNDVVGSK  364
            MG VED EPP KR K    E        S+R  T N SL D  MAR L  +G  + +GSK
Sbjct  1    MGVVEDTEPPLKRAKRLVDEPNGFSGNSSVRACTVNNSLGDL-MARPLTSQGDEETIGSK  59

Query  365  GIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            G++KK EFV+II  ALYSLGY KTGA LEEESGI LH++ + +F+QQ+ DGKWDESV TL
Sbjct  60   GVIKKSEFVKIITRALYSLGYDKTGAMLEEESGISLHNTTIKVFLQQVKDGKWDESVKTL  119



>ref|XP_009131082.1| PREDICTED: WD repeat-containing protein 26-like [Brassica rapa]
 ref|XP_009131084.1| PREDICTED: WD repeat-containing protein 26-like [Brassica rapa]
Length=589

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 87/126 (69%), Gaps = 13/126 (10%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKV-----SSGELLNRKSLRDPT--NCSLSDCSMARSLVC--EGGND  349
            MG VED EPP KR K+     S+G   N  S+R  +  N SL D  MAR L    +G ++
Sbjct  1    MGVVEDTEPPLKRAKLLLADESNG---NSSSIRATSSVNNSLGDL-MARPLTSSSQGDDE  56

Query  350  VVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDE  529
             +GS+G++KK EFV+II  ALYSLGY KTGA LEEESGI +H SVV +F+QQ+ +GKWDE
Sbjct  57   TIGSRGVIKKSEFVRIITRALYSLGYGKTGAMLEEESGIPMHQSVVKVFLQQVKEGKWDE  116

Query  530  SVITLH  547
            SV TLH
Sbjct  117  SVATLH  122



>ref|XP_006845990.1| hypothetical protein AMTR_s00155p00039520 [Amborella trichopoda]
 gb|ERN07665.1| hypothetical protein AMTR_s00155p00039520 [Amborella trichopoda]
Length=579

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 84/119 (71%), Gaps = 5/119 (4%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKSLRD-PTNCSLSDCS--MARSLVCEGGNDVVGSKG  367
            MGGVEDD+PP KR+K+S  ++  R   +D P    L      MA S    G  + VGSKG
Sbjct  1    MGGVEDDDPPLKRLKISPRDI--RSISKDLPLAGPLGSVGVLMASSPTVHGDEETVGSKG  58

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            ++++VE V+II +ALYSLGY+K+GA LEEESGI LHSS V LF QQ+L+GKWDESV TL
Sbjct  59   VIRRVELVRIITKALYSLGYEKSGALLEEESGIPLHSSQVKLFRQQVLEGKWDESVNTL  117



>ref|XP_004972947.1| PREDICTED: WD repeat-containing protein 26-like [Setaria italica]
Length=599

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 84/129 (65%), Gaps = 23/129 (18%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKSLRDPTNCSLSDC------------SMARSLVCEG  340
            MGG EDDEPP KR + SS E           + SL DC            +MAR L  +G
Sbjct  1    MGGFEDDEPPSKRARASSVE-----------SASLPDCFSFSKSANPLGSTMARPLPSQG  49

Query  341  GNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGK  520
               +VGSKG++KK EFV+II + LYSLGY+K+GA LEEESGI LH+ +VNLF +Q++DG 
Sbjct  50   KEVMVGSKGVIKKEEFVRIITKTLYSLGYEKSGAVLEEESGITLHNPMVNLFREQVIDGN  109

Query  521  WDESVITLH  547
            WD +V+TL+
Sbjct  110  WDNAVVTLN  118



>ref|XP_003578602.1| PREDICTED: WD repeat-containing protein 26 [Brachypodium distachyon]
Length=595

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 83/121 (69%), Gaps = 7/121 (6%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKSLRDPTNCSLSDC----SMARSLVCEGGNDVVGSK  364
            MGG EDDEPP KR K SS E  N   L D    S S      +MAR L  +G   +VGSK
Sbjct  1    MGGFEDDEPPSKRAKASSVESAN---LSDSFCYSKSTNPLGGTMARPLTSQGKEVMVGSK  57

Query  365  GIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            G++K+ EFV+II +ALY+LGY+K+GA LEEESGI LHS  VNLF +Q+LDG WD +V TL
Sbjct  58   GVIKRDEFVRIITKALYTLGYEKSGAVLEEESGITLHSPSVNLFRKQVLDGNWDNAVSTL  117

Query  545  H  547
            +
Sbjct  118  N  118



>ref|XP_010687529.1| PREDICTED: WD repeat-containing protein 26 homolog [Beta vulgaris 
subsp. vulgaris]
Length=186

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 22/130 (17%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSG-------------ELLNRKSLRDPTNCSLSDCSMARSLVCE  337
            MGGVED +PP KR+++S               +L   +SLRD          MAR    +
Sbjct  1    MGGVEDGQPPTKRLRLSCAGSNNLSSGLRAEEQLAAARSLRD---------LMARPKQYQ  51

Query  338  GGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDG  517
            G  +V+GS+G++KK+EFV++IA ALY+LGY+++GA LEEESGI L S+ VNL MQ +LDG
Sbjct  52   GEEEVIGSRGVIKKLEFVRLIAGALYALGYERSGACLEEESGIPLQSAAVNLLMQHVLDG  111

Query  518  KWDESVITLH  547
            +WDES   L 
Sbjct  112  RWDESASILQ  121



>gb|ABR16581.1| unknown [Picea sitchensis]
Length=584

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 85/120 (71%), Gaps = 5/120 (4%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKSLRDPTNC-SLSDCS--MARSLVCEGGNDVVGSKG  367
            MG +ED+EPP KR+K+SS  L  R+ L +     S+   S  MA+SL  E   + VGSKG
Sbjct  1    MGAIEDEEPPLKRLKLSSPGL--RRGLEEEAPALSVGSVSILMAKSLSLEEEGETVGSKG  58

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            ++++VEFV+II +ALYSLGY+K GA LEEESGI + S  V  F +QILDGKWDESV+TL 
Sbjct  59   LIRRVEFVRIITQALYSLGYQKAGALLEEESGILVQSPTVASFRKQILDGKWDESVVTLQ  118



>gb|EYU42800.1| hypothetical protein MIMGU_mgv1a003351mg [Erythranthe guttata]
Length=590

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 87/120 (73%), Gaps = 10/120 (8%)
 Frame = +2

Query  197  MGGVEDDEPPF-KRVKVSSGELLNRKSLRDPTNCSLSDC-SMARSLVCEGGN-DVVGSKG  367
            MGG+EDD+ P  KRVKV SGE           +  LSD  SMAR L  +G N + +GSKG
Sbjct  1    MGGLEDDDEPLSKRVKVMSGE-------SGGFSNGLSDSFSMARQLSSQGDNVEAIGSKG  53

Query  368  IVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITLH  547
            +V K E V+I+AEALYSLGY +TGA+LEEESGI LH+ VV++FM+QI++G+WD+SV  LH
Sbjct  54   VVNKTELVRILAEALYSLGYSETGARLEEESGIPLHTPVVDMFMRQIVEGQWDKSVSMLH  113



>emb|CDX78343.1| BnaA03g02550D [Brassica napus]
Length=589

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 80/123 (65%), Gaps = 7/123 (6%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLN----RKSLRDPTNCSLSDCSMARSLVC--EGGNDVVG  358
            MG VED EPP KR K+   +  N            N SL D  MAR L    +G ++ +G
Sbjct  1    MGVVEDTEPPLKRAKLLLADEPNGNSSSVRAASSVNSSLGDL-MARPLTSSSQGDDETIG  59

Query  359  SKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVI  538
            S+G++KK EFV+II  ALYSLGY KTGA LEEESGI +H SVV  F+QQ+ +GKWDESV 
Sbjct  60   SRGVIKKSEFVRIITRALYSLGYGKTGAMLEEESGIPMHQSVVKAFLQQVKEGKWDESVA  119

Query  539  TLH  547
            TLH
Sbjct  120  TLH  122



>dbj|BAK03563.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=595

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 85/121 (70%), Gaps = 7/121 (6%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKSLRD-PTNCSLSDC---SMARSLVCEGGNDVVGSK  364
            MGG EDDEPP KR + SS E     SL D P     ++    +MAR L  +G   +VGSK
Sbjct  1    MGGFEDDEPPSKRARASSVE---SASLSDIPCYSKPANPLGGTMARPLTSQGKEVMVGSK  57

Query  365  GIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            G++K+ EFV+I+ ++LY+LGY+KTGA LEEESGI LHS  VNLF +Q+LDG WD +++TL
Sbjct  58   GLIKRDEFVRILTKSLYTLGYEKTGAVLEEESGITLHSPPVNLFRKQVLDGNWDGALVTL  117

Query  545  H  547
            +
Sbjct  118  N  118



>ref|XP_009765608.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Nicotiana 
sylvestris]
Length=540

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +2

Query  314  MARSLVCEGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNL  493
            MAR L  +G ++VVG+KG+VKKVEFV+II EALYSLGY K GA LEEESGI LHSS +NL
Sbjct  1    MARPLDLQGDDEVVGTKGVVKKVEFVRIITEALYSLGYNKAGAHLEEESGIPLHSSGINL  60

Query  494  FMQQILDGKWDESVITL  544
            FMQQI DGKWDES+ TL
Sbjct  61   FMQQIRDGKWDESLTTL  77



>ref|XP_008676635.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW61288.1| hypothetical protein ZEAMMB73_320588 [Zea mays]
Length=598

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 83/129 (64%), Gaps = 23/129 (18%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKSLRDPTNCSLSDC------------SMARSLVCEG  340
            MGG EDDEPP KR + SS E           + SL DC            +MAR L  +G
Sbjct  1    MGGSEDDEPPSKRARTSSVE-----------SASLPDCFSFSKFSNPLGSTMARPLPSQG  49

Query  341  GNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGK  520
               +VGSKG++KK EFV+II + LYSLGY+K+GA LEEESGI LH+ +V LF +Q++DG 
Sbjct  50   KEVMVGSKGVIKKEEFVRIITKTLYSLGYEKSGAVLEEESGIILHNPMVKLFREQVIDGN  109

Query  521  WDESVITLH  547
            WD +V+T++
Sbjct  110  WDNAVVTMN  118



>gb|KDO44760.1| hypothetical protein CISIN_1g009188mg [Citrus sinensis]
Length=540

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +2

Query  314  MARSLVCEGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNL  493
            MAR L  EG  DV+G  G++K+VEFV+IIA+ALYSLGY K+GA LEEESGI LHSS+VNL
Sbjct  1    MARPLPSEGDEDVIGPAGVIKRVEFVRIIAKALYSLGYTKSGAHLEEESGIPLHSSMVNL  60

Query  494  FMQQILDGKWDESVITL  544
            F QQILDG WDES+ TL
Sbjct  61   FTQQILDGHWDESLATL  77



>ref|XP_004239311.1| PREDICTED: WD repeat-containing protein 26 isoform X3 [Solanum 
lycopersicum]
Length=540

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +2

Query  314  MARSLVCEGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNL  493
            MA  LV +G ++VVG+KG+VKKVEFV+I+AEALYSLGY K GA+LEEESGI L S+ V L
Sbjct  1    MAHPLVRQGDDEVVGAKGVVKKVEFVRIVAEALYSLGYNKAGARLEEESGIPLQSAEVKL  60

Query  494  FMQQILDGKWDESVITLH  547
             MQQILDGKWDESV TLH
Sbjct  61   LMQQILDGKWDESVATLH  78



>emb|CDY21550.1| BnaC09g47420D [Brassica napus]
Length=578

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 77/133 (58%), Gaps = 29/133 (22%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGELLNRKSLRDPTN---------------CSLSDCSMARSLV  331
            MG VED EPP KR K            RD TN                SL D  MAR L 
Sbjct  1    MGVVEDTEPPLKRAK------------RDETNGFSGSNSSVRVSSVTNSLGDL-MARPLT  47

Query  332  CEGGND-VVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQI  508
               G+D  +GSKG++KK EFV+II   LYSLGY K GA LEEESGI LH S V  FM+Q+
Sbjct  48   SSQGDDETIGSKGVIKKSEFVRIITRTLYSLGYGKAGAMLEEESGIPLHHSFVETFMEQV  107

Query  509  LDGKWDESVITLH  547
             DGKWDES++TLH
Sbjct  108  RDGKWDESIVTLH  120



>ref|XP_009419551.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009419552.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009419553.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009419554.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
Length=543

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +2

Query  314  MARSLVCEGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNL  493
            MAR L  +G  +++G KG++KK+EFV+ I +ALYSLGY++TGA LEEESGI L+SS+VNL
Sbjct  1    MARPLPSQGREEMIGPKGVIKKIEFVRTITKALYSLGYERTGAVLEEESGIPLYSSMVNL  60

Query  494  FMQQILDGKWDESVITLH  547
            F +QILDG WDES+ITLH
Sbjct  61   FRKQILDGNWDESLITLH  78



>ref|XP_009122471.1| PREDICTED: WD repeat-containing protein 26 [Brassica rapa]
 emb|CDX69939.1| BnaA10g22880D [Brassica napus]
Length=580

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 76/123 (62%), Gaps = 7/123 (6%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSS-----GELLNRKSLRDPTNCSLSDCSMARSLVCEGGND-VVG  358
            MG VED EPP KR K            +   +    N SL D  MAR L    G+D  +G
Sbjct  1    MGVVEDTEPPLKRAKRDEETNGFSGSNSSVRVSSSVNNSLGDL-MARPLTSSQGDDETIG  59

Query  359  SKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVI  538
            SKG++KK EFV+II   LYSLGY K GA LEEESGI LH S V  FM+Q+ DGKWDESV+
Sbjct  60   SKGVIKKSEFVRIITRTLYSLGYGKAGAMLEEESGIPLHHSFVETFMEQVRDGKWDESVV  119

Query  539  TLH  547
            TLH
Sbjct  120  TLH  122



>ref|XP_011100498.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Sesamum 
indicum]
Length=544

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  314  MARSLVCEGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNL  493
            MAR L  +  ++VVGS GI+KKVE V+IIAEALYSLGY K GA LEEESGI LHS  V+L
Sbjct  1    MARPLASQEDDEVVGSNGIIKKVELVRIIAEALYSLGYSKMGAHLEEESGILLHSPAVDL  60

Query  494  FMQQILDGKWDESVITLH  547
            FM QIL+G+WDESV  LH
Sbjct  61   FMHQILEGQWDESVSMLH  78



>ref|XP_010256454.1| PREDICTED: WD repeat-containing protein 26 isoform X2 [Nelumbo 
nucifera]
Length=543

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  314  MARSLVCEGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNL  493
            MAR L  +G   +VGSKG++++ EFV+II +ALYSLGY+++GA LEEESGI LHSS+VNL
Sbjct  1    MARPLPSQGDEQMVGSKGLIERGEFVRIITKALYSLGYERSGALLEEESGIPLHSSMVNL  60

Query  494  FMQQILDGKWDESVITLH  547
            F QQ+LDG WDESV TLH
Sbjct  61   FRQQLLDGSWDESVDTLH  78



>gb|KHG19792.1| WD repeat-containing 26 [Gossypium arboreum]
Length=539

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +2

Query  314  MARSLVCEGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNL  493
            MAR L  +G  + +GS+G+++K EF++II  ALYSLGY K+GA LEEESGI LHSSVVNL
Sbjct  1    MARPLTSQGDGETIGSQGVIRKAEFIKIITRALYSLGYDKSGALLEEESGIPLHSSVVNL  60

Query  494  FMQQILDGKWDESVITL  544
            FM Q+ +GKWD+SV TL
Sbjct  61   FMGQVTNGKWDDSVATL  77



>gb|EAY85451.1| hypothetical protein OsI_06831 [Oryza sativa Indica Group]
Length=554

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +2

Query  314  MARSLVCEGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNL  493
            MAR L  +G   +VGSKG++K+ EFV+II +ALYSLGY+K+GA LEEESGI LHS  VNL
Sbjct  1    MARPLPSQGKEVMVGSKGVIKRDEFVRIITKALYSLGYEKSGAVLEEESGITLHSPTVNL  60

Query  494  FMQQILDGKWDESVITL  544
            F +Q+LDG WD +V+TL
Sbjct  61   FRRQVLDGNWDSAVVTL  77



>gb|EAZ22671.1| hypothetical protein OsJ_06341 [Oryza sativa Japonica Group]
Length=554

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +2

Query  314  MARSLVCEGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNL  493
            MAR L  +G   +VGSKG++K+ EFV+II +ALYSLGY+K+GA LEEESGI LHS  VNL
Sbjct  1    MARPLPSQGKEVMVGSKGVIKRDEFVRIITKALYSLGYEKSGAVLEEESGITLHSPTVNL  60

Query  494  FMQQILDGKWDESVITL  544
            F +Q+LDG WD +V+TL
Sbjct  61   FRRQVLDGNWDSAVVTL  77



>emb|CBI35349.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  314  MARSLVCEGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNL  493
            MA S   +G  D +GSKGI+K+ EF++II  ALYSLGY ++G  L++ESGI LHS+VV+L
Sbjct  1    MAWSPSSQGDRDAIGSKGIIKRPEFIKIITRALYSLGYSRSGDLLQKESGISLHSTVVDL  60

Query  494  FMQQILDGKWDESVITLH  547
            F QQ++DGKWDESV TLH
Sbjct  61   FRQQVVDGKWDESVDTLH  78



>gb|EMT24581.1| hypothetical protein F775_29927 [Aegilops tauschii]
Length=557

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  314  MARSLVCEGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNL  493
            MAR L  +G   +VGSKG++K+ EFV+II ++LY+LGY+KTGA LEEESGI LHS  VN+
Sbjct  1    MARPLTSQGKEVMVGSKGLIKRDEFVRIITKSLYTLGYEKTGAVLEEESGITLHSPPVNV  60

Query  494  FMQQILDGKWDESVITLH  547
            F +Q+LDG WD +V+TL+
Sbjct  61   FRKQVLDGNWDSAVVTLN  78



>gb|EMS67128.1| WD repeat-containing protein 26 [Triticum urartu]
Length=590

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  314  MARSLVCEGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNL  493
            MAR L  +G   +VGSKG++K+ EFV+II +ALY+LGY+K+GA LEEESGI LHS  VNL
Sbjct  1    MARPLASQGKEVMVGSKGVIKRDEFVRIITKALYTLGYEKSGAVLEEESGITLHSPSVNL  60

Query  494  FMQQILDGKWDESVITLH  547
            F +Q+LDG WD +V TL+
Sbjct  61   FRKQVLDGNWDNAVATLN  78



>gb|EMT06242.1| hypothetical protein F775_31507 [Aegilops tauschii]
Length=590

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  314  MARSLVCEGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNL  493
            MAR L  +G   +VGSKG++K+ EFV+II +ALY+LGY+K+GA LEEESGI LHS  VNL
Sbjct  1    MARPLASQGKEVMVGSKGVIKRDEFVRIITKALYTLGYEKSGAVLEEESGITLHSPSVNL  60

Query  494  FMQQILDGKWDESVITLH  547
            F +Q+LDG WD +V TL+
Sbjct  61   FRKQVLDGNWDNAVATLN  78



>gb|EYU42859.1| hypothetical protein MIMGU_mgv1a005363mg [Erythranthe guttata]
Length=487

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +2

Query  335  EGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILD  514
            +GG++ VGSK ++KKVE V++I E LYSLGY   G  LE ESGIHLH+  V+L ++QI+ 
Sbjct  9    QGGDEFVGSKRVIKKVELVRVITEVLYSLGYDTVGKSLERESGIHLHAERVHLLIEQIIA  68

Query  515  GKWDESVITLH  547
            GKW+ES+ T+ 
Sbjct  69   GKWNESLATVR  79



>ref|XP_001770300.1| predicted protein [Physcomitrella patens]
 gb|EDQ64975.1| predicted protein [Physcomitrella patens]
Length=559

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 1/77 (1%)
 Frame = +2

Query  314  MARSLVCEGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNL  493
            MARS +C    + VGS G ++KVEFV+II +AL+SLGY++ GA LEEESGI L S  V  
Sbjct  1    MARS-ICSNDGETVGSHGQIRKVEFVRIIEQALFSLGYQQAGAVLEEESGIRLQSPAVQQ  59

Query  494  FMQQILDGKWDESVITL  544
            F + IL G+WDE V TL
Sbjct  60   FREDILAGRWDECVATL  76



>ref|XP_001771286.1| predicted protein [Physcomitrella patens]
 gb|EDQ63846.1| predicted protein [Physcomitrella patens]
Length=559

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 55/77 (71%), Gaps = 1/77 (1%)
 Frame = +2

Query  314  MARSLVCEGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNL  493
            MARS+    G + VGS G ++KVEFV+II +AL+SLGY++ GA LEEESGI L S  V  
Sbjct  1    MARSIPINDG-ETVGSHGQIRKVEFVRIIEQALFSLGYQQAGAALEEESGIRLQSPAVQQ  59

Query  494  FMQQILDGKWDESVITL  544
            F + IL G+W+E V TL
Sbjct  60   FREDILAGRWNECVTTL  76



>ref|XP_002513147.1| hypothetical protein RCOM_1454380 [Ricinus communis]
 gb|EEF49650.1| hypothetical protein RCOM_1454380 [Ricinus communis]
Length=81

 Score = 79.3 bits (194),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 54/80 (68%), Gaps = 4/80 (5%)
 Frame = +2

Query  197  MGGVEDDEPPFKRVKVSSGE---LLNRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKG  367
            MG VED+EPP KRVK+  GE    L+  S+  P +CSL D  MAR L  +G  + VGS+G
Sbjct  1    MGVVEDNEPPLKRVKLPVGEVRTFLDHSSVTGPVSCSLGDL-MARPLNSQGDGETVGSRG  59

Query  368  IVKKVEFVQIIAEALYSLGY  427
            ++K++EFV+II  ALY L Y
Sbjct  60   VIKRLEFVKIITRALYLLPY  79



>ref|XP_006281895.1| hypothetical protein CARUB_v10028093mg, partial [Capsella rubella]
 gb|EOA14793.1| hypothetical protein CARUB_v10028093mg, partial [Capsella rubella]
Length=531

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  359  SKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVI  538
            SKG++K+ E ++II EALYSLGY ++G +LE+ESGI LHS++V LF++Q+ +G+WD+S++
Sbjct  1    SKGLIKESEVIRIITEALYSLGYGESGIRLEKESGIPLHSTIVKLFLEQVNNGEWDKSIV  60

Query  539  TL  544
            TL
Sbjct  61   TL  62



>gb|EYU42819.1| hypothetical protein MIMGU_mgv1a005559mg [Erythranthe guttata]
Length=479

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  350  VVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDE  529
            + GS+ ++KKVE V+ + EAL SL YK+T   LE ESGIHLHS  V LFM+QI+ G+WDE
Sbjct  11   IAGSQTLIKKVELVRFMIEALNSLDYKETAMCLERESGIHLHSQRVKLFMEQIIKGEWDE  70

Query  530  SVITL  544
            S+ TL
Sbjct  71   SLSTL  75



>ref|XP_002311889.2| hypothetical protein POPTR_0008s00330g [Populus trichocarpa]
 gb|EEE89256.2| hypothetical protein POPTR_0008s00330g [Populus trichocarpa]
Length=529

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +2

Query  314  MARSLVCEGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNL  493
            MA+SL  +   + VGSKG++K+ E+V+II  ALYSL Y  T   L+EES I L SS V L
Sbjct  1    MAQSLTSQRDVETVGSKGVIKRNEYVRIITRALYSLNYNMTADLLQEESRIPLDSSEVKL  60

Query  494  FMQQILDGKWDESVITL  544
              +Q+LDG W+ESV TL
Sbjct  61   LQKQVLDGNWEESVKTL  77



>ref|XP_011033097.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
 ref|XP_011033098.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
 ref|XP_011033099.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
Length=529

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = +2

Query  314  MARSLVCEGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNL  493
            MA+ L  +   D VGSKG++K+ E+V+II  ALYSL Y  T   L+EES I L SS V L
Sbjct  1    MAQPLTSQRDVDSVGSKGVIKRNEYVRIITRALYSLNYNMTADLLQEESRIPLDSSEVKL  60

Query  494  FMQQILDGKWDESVITL  544
              +Q+LDG W+ESV TL
Sbjct  61   LKKQVLDGNWEESVKTL  77



>ref|XP_002982745.1| hypothetical protein SELMODRAFT_268628 [Selaginella moellendorffii]
 gb|EFJ15990.1| hypothetical protein SELMODRAFT_268628 [Selaginella moellendorffii]
Length=588

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +2

Query  344  NDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKW  523
            + ++GSK  +++VEFV+II +ALYSLGY +  A +EEESG+ L   VV+ F +++LDG+W
Sbjct  50   SQMMGSKKQIRRVEFVRIITQALYSLGYSRAAALVEEESGVPLQLPVVSDFRREVLDGRW  109

Query  524  DESVITL  544
            +ESV TL
Sbjct  110  EESVATL  116



>ref|XP_002315365.1| hypothetical protein POPTR_0010s26090g [Populus trichocarpa]
 gb|EEF01536.1| hypothetical protein POPTR_0010s26090g [Populus trichocarpa]
Length=505

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +2

Query  347  DVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWD  526
            + VGSKG+VK+ EFV+II  AL+SLGY++ G  LE +SGI L S  ++ F  Q+L G WD
Sbjct  6    ETVGSKGVVKRTEFVRIITRALHSLGYEEIGTLLENQSGIPLQSQEISSFKNQVLAGNWD  65

Query  527  ESVITLH  547
            +SV TLH
Sbjct  66   QSVETLH  72



>ref|XP_002990891.1| hypothetical protein SELMODRAFT_161256 [Selaginella moellendorffii]
 gb|EFJ07935.1| hypothetical protein SELMODRAFT_161256 [Selaginella moellendorffii]
Length=548

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  350  VVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDE  529
            ++GSK  +++VEFV+II +ALYSLGY +  A +EEESG+ L   VV+ F +++LDG+W+E
Sbjct  1    MMGSKKQIRRVEFVRIITQALYSLGYSRAAALVEEESGVPLQLPVVSDFRREVLDGRWEE  60

Query  530  SVITL  544
            SV TL
Sbjct  61   SVATL  65



>ref|XP_011046605.1| PREDICTED: WD repeat-containing protein 26 [Populus euphratica]
Length=520

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +2

Query  347  DVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWD  526
            + VGSKG+VK+ EFV+II  AL SLGY++ G  LE +SGI L S  ++ F  Q+L G WD
Sbjct  6    ETVGSKGVVKRTEFVRIITRALQSLGYEEIGTLLENQSGIPLQSQEISSFKNQVLAGNWD  65

Query  527  ESVITLH  547
            +SV TLH
Sbjct  66   QSVETLH  72



>gb|EYU42821.1| hypothetical protein MIMGU_mgv1a022686mg, partial [Erythranthe 
guttata]
Length=484

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +2

Query  338  GGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDG  517
            G N VV S  I+KK +FV+ I + LYSL Y + G  LE+E+GI LH   V+LF++QI+DG
Sbjct  11   GENAVVRSNTILKKSKFVRGITKVLYSLCYDREGKSLEKEAGIELHEERVDLFIEQIIDG  70

Query  518  KWDESVITLH  547
            +WDES+ TL 
Sbjct  71   QWDESLSTLR  80



>ref|XP_006854396.1| hypothetical protein AMTR_s00039p00186000 [Amborella trichopoda]
 gb|ERN15863.1| hypothetical protein AMTR_s00039p00186000 [Amborella trichopoda]
Length=541

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  350  VVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDE  529
             +GS G+++  EF++++ ++LYSLGY K  + LEEESGI LHS    LF   IL+ KW+E
Sbjct  34   TLGSTGLIRTYEFIRVLIQSLYSLGYSKAASLLEEESGIALHSPDFTLFKTLILEAKWEE  93

Query  530  SVITLH  547
            S+  LH
Sbjct  94   SIEALH  99



>ref|XP_002866568.1| hypothetical protein ARALYDRAFT_919661 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42827.1| hypothetical protein ARALYDRAFT_919661 [Arabidopsis lyrata subsp. 
lyrata]
Length=513

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  350  VVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDE  529
            ++GSKG + + EF++II + LYSLG+ + G  LE+ESGI LHS+V   F++Q+ + +WD 
Sbjct  12   MMGSKGFINESEFIRIITDTLYSLGFDQIGKLLEDESGIPLHSTVAKQFLEQVKNREWDN  71

Query  530  SVITL  544
            S+ TL
Sbjct  72   SIATL  76



>gb|EYU42862.1| hypothetical protein MIMGU_mgv1a021742mg [Erythranthe guttata]
Length=494

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +2

Query  338  GGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDG  517
            GGN+VV S  ++KK + V+ I   LYS G  + G  LE+  GI LH   V+LF++QILDG
Sbjct  11   GGNEVVHSNMVLKKNKLVRGIKRLLYSFGCDREGKSLEKGPGIELHKERVDLFIEQILDG  70

Query  518  KWDESVITLH  547
            KWDES+ TL 
Sbjct  71   KWDESLSTLR  80



>ref|XP_011035628.1| PREDICTED: WD repeat-containing protein 26 isoform X1 [Populus 
euphratica]
Length=520

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +2

Query  335  EGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILD  514
            E     +GSKG++K+ EFV++I ++LYSLGY+K+G+ LE ESG+   S  + L   QIL+
Sbjct  2    ENSPTTIGSKGLIKQHEFVRVIIQSLYSLGYRKSGSCLESESGVSYKSMNLELLESQILE  61

Query  515  GKWDESVITL  544
            G WD  + TL
Sbjct  62   GDWDGCINTL  71



>ref|XP_011035629.1| PREDICTED: WD repeat-containing protein 26 isoform X2 [Populus 
euphratica]
Length=519

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +2

Query  335  EGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILD  514
            E     +GSKG++K+ EFV++I ++LYSLGY+K+G+ LE ESG+   S  + L   QIL+
Sbjct  2    ENSPTTIGSKGLIKQHEFVRVIIQSLYSLGYRKSGSCLESESGVSYKSMNLELLESQILE  61

Query  515  GKWDESVITL  544
            G WD  + TL
Sbjct  62   GDWDGCINTL  71



>gb|EYU42863.1| hypothetical protein MIMGU_mgv11b015403mg [Erythranthe guttata]
Length=515

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  338  GGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDG  517
            GGN+VV S  ++K+ + V+ I   LYS GY + G  LE+  GI LH  +V+LF++QI+DG
Sbjct  11   GGNEVVRSNTVIKRTKLVRGIKSLLYSFGYDRKGKSLEKGPGIELHKELVDLFIEQIIDG  70

Query  518  KWDESVITL  544
            K DES  TL
Sbjct  71   KCDESQSTL  79



>ref|XP_010069704.1| PREDICTED: WD repeat-containing protein 26-like [Eucalyptus grandis]
 gb|KCW58124.1| hypothetical protein EUGRSUZ_H00847 [Eucalyptus grandis]
Length=524

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  350  VVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDE  529
            V+G++G+++K+EFV+II + LYSLGY K+   LE ESGI   S    L   QIL+G WD+
Sbjct  7    VLGAEGLIRKIEFVRIIIQCLYSLGYSKSAYCLEIESGIRCRSPEFELLESQILNGSWDD  66

Query  530  SVITLH  547
             + TL+
Sbjct  67   CISTLN  72



>gb|EYU42861.1| hypothetical protein MIMGU_mgv1a020302mg [Erythranthe guttata]
Length=503

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  338  GGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDG  517
            GGN+VV S  ++KK + VQ +   LYSLGY + G  LE+   I LH  +V+LF++QI+DG
Sbjct  11   GGNEVVRSNTVLKKTKLVQGMKSLLYSLGYDRKGKSLEKGPVIELHKELVDLFIEQIIDG  70

Query  518  KWDESVITL  544
            K DES  TL
Sbjct  71   KCDESQSTL  79



>ref|XP_010040357.1| PREDICTED: WD repeat-containing protein 26-like [Eucalyptus grandis]
 ref|XP_010040358.1| PREDICTED: WD repeat-containing protein 26-like [Eucalyptus grandis]
 ref|XP_010040359.1| PREDICTED: WD repeat-containing protein 26-like [Eucalyptus grandis]
 gb|KCW45283.1| hypothetical protein EUGRSUZ_L01054 [Eucalyptus grandis]
Length=524

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  350  VVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDE  529
            V+G++G+++K+EFV+II + LYSLGY K+   LE ESGI   S    L   Q+L+G WD+
Sbjct  7    VLGAEGLIRKIEFVRIIIQCLYSLGYSKSAYCLEIESGIRCRSPEFELLESQVLNGSWDD  66

Query  530  SVITLH  547
             + TL+
Sbjct  67   CISTLN  72



>emb|CDY13140.1| BnaA09g16770D [Brassica napus]
Length=1106

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +2

Query  344  NDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKW  523
            N+V+GSKG++KK EFV+I+ + LYSLGYK + + LE+ES I   SS      +Q+L G W
Sbjct  4    NEVLGSKGLLKKHEFVRILIQCLYSLGYKNSASCLEQESNISCKSSDFEFLEKQVLTGDW  63

Query  524  DESVITL  544
            D S+  L
Sbjct  64   DSSLAVL  70



>emb|CDY36957.1| BnaC09g17730D [Brassica napus]
Length=1092

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +2

Query  344  NDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKW  523
            N+V+GSKG++KK EFV+I+ + LYSLGYK + + LE+ES I   SS      +Q+L G W
Sbjct  4    NEVLGSKGLLKKHEFVRILIQCLYSLGYKNSASCLEQESNISCKSSDFEFLEKQVLTGDW  63

Query  524  DESVITL  544
            D S+  L
Sbjct  64   DSSLAVL  70



>ref|XP_009113968.1| PREDICTED: WD repeat-containing protein 26 [Brassica rapa]
Length=526

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +2

Query  341  GNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGK  520
             N+V+GSKG++KK EFV+I+ + LYSLGYK + + LE+ES I   SS      +Q+L G 
Sbjct  3    NNEVLGSKGLLKKHEFVRILIQCLYSLGYKNSASCLEQESNISCKSSDFEFLEKQVLTGD  62

Query  521  WDESVITL  544
            WD S+  L
Sbjct  63   WDSSLAVL  70



>ref|XP_004495043.1| PREDICTED: WD repeat-containing protein 26-like [Cicer arietinum]
Length=513

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +2

Query  335  EGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILD  514
            E  ++V+GSKG++KK EFV+II + LYSLGY K+ + LE ESG+   S    L    +L+
Sbjct  2    ENPSEVLGSKGLIKKQEFVRIILQCLYSLGYTKSASCLELESGVSFKSKEFQLLESHVLN  61

Query  515  GKWDESV  535
            G WD+ V
Sbjct  62   GNWDDCV  68



>ref|XP_010264797.1| PREDICTED: WD repeat-containing protein 26 isoform X4 [Nelumbo 
nucifera]
Length=518

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +2

Query  335  EGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILD  514
            E   +++G  G++K+ EFV++I + LYSLGYKK+ + LE ESGI   SS   L   QIL+
Sbjct  2    EKSPELLGPMGLIKRHEFVRVIVQCLYSLGYKKSASLLESESGISYKSSEFTLLESQILN  61

Query  515  GKWDESVITL  544
              WD+ + T+
Sbjct  62   ANWDDCINTI  71



>ref|XP_010264796.1| PREDICTED: WD repeat-containing protein 26 isoform X3 [Nelumbo 
nucifera]
Length=519

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +2

Query  335  EGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILD  514
            E   +++G  G++K+ EFV++I + LYSLGYKK+ + LE ESGI   SS   L   QIL+
Sbjct  2    EKSPELLGPMGLIKRHEFVRVIVQCLYSLGYKKSASLLESESGISYKSSEFTLLESQILN  61

Query  515  GKWDESVITL  544
              WD+ + T+
Sbjct  62   ANWDDCINTI  71



>ref|XP_003554312.1| PREDICTED: WD repeat-containing protein 26-like [Glycine max]
Length=523

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +2

Query  335  EGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILD  514
            E   +V+GSKG++++ EFV+II + LYSLGY  + + LE ESGI   S+ V L    IL+
Sbjct  2    ENPCEVLGSKGLIRRHEFVRIIIQCLYSLGYSSSASCLESESGISYKSNEVKLLESLILN  61

Query  515  GKWDESVITLH  547
            G WDES+  L+
Sbjct  62   GSWDESIDYLN  72



>gb|KHN02443.1| WD repeat-containing protein 26 [Glycine soja]
Length=523

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +2

Query  335  EGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILD  514
            E   +V+GSKG++++ EFV+II + LYSLGY  + + LE ESGI   S+ V L    IL+
Sbjct  2    ENPCEVLGSKGLIRRHEFVRIIIQCLYSLGYSSSASCLESESGISYKSNEVKLLESLILN  61

Query  515  GKWDESVITLH  547
            G WDES+  L+
Sbjct  62   GSWDESIDYLN  72



>ref|XP_010264795.1| PREDICTED: WD repeat-containing protein 26 isoform X2 [Nelumbo 
nucifera]
Length=527

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +2

Query  335  EGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILD  514
            E   +++G  G++K+ EFV++I + LYSLGYKK+ + LE ESGI   SS   L   QIL+
Sbjct  2    EKSPELLGPMGLIKRHEFVRVIVQCLYSLGYKKSASLLESESGISYKSSEFTLLESQILN  61

Query  515  GKWDESVITL  544
              WD+ + T+
Sbjct  62   ANWDDCINTI  71



>ref|XP_010264794.1| PREDICTED: WD repeat-containing protein 26 isoform X1 [Nelumbo 
nucifera]
Length=528

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +2

Query  335  EGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILD  514
            E   +++G  G++K+ EFV++I + LYSLGYKK+ + LE ESGI   SS   L   QIL+
Sbjct  2    EKSPELLGPMGLIKRHEFVRVIVQCLYSLGYKKSASLLESESGISYKSSEFTLLESQILN  61

Query  515  GKWDESVITL  544
              WD+ + T+
Sbjct  62   ANWDDCINTI  71



>gb|KHF98324.1| WD repeat-containing 26 [Gossypium arboreum]
Length=524

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +2

Query  335  EGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILD  514
            E     +GSKG++ K EF+++I + LYSLGYKK+ + LE ESG+   S   +L   QIL 
Sbjct  2    ENSPTTLGSKGLINKHEFLRVIIQCLYSLGYKKSASCLEIESGVRYKSIEFDLLESQILS  61

Query  515  GKWDESVITLH  547
            G WD+ + TL+
Sbjct  62   GDWDDCIDTLN  72



>gb|KJB26051.1| hypothetical protein B456_004G222700 [Gossypium raimondii]
Length=524

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +2

Query  335  EGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILD  514
            E     +GSKG++ K EF+++I + LYSLGYKK+ + LE ESG+   S   +L   QIL 
Sbjct  2    ENSPTTLGSKGLINKHEFLRVIIQCLYSLGYKKSASCLEIESGVRYKSIEFDLLESQILS  61

Query  515  GKWDESVITLH  547
            G WD+ + TL+
Sbjct  62   GDWDDCIDTLN  72



>ref|XP_006403164.1| hypothetical protein EUTSA_v10003179mg [Eutrema salsugineum]
 gb|ESQ44617.1| hypothetical protein EUTSA_v10003179mg [Eutrema salsugineum]
Length=530

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +2

Query  338  GGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDG  517
            G  +V+G+KG++KK EFV+I+ + LYSLGYKK+ + LE ES I   SS        +L G
Sbjct  4    GSYEVLGTKGLLKKHEFVRILVQCLYSLGYKKSASCLEHESSISYKSSDFEFLEMHVLSG  63

Query  518  KWDESVITL  544
             WD S+  L
Sbjct  64   NWDSSLAVL  72



>ref|XP_002533626.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF28755.1| WD-repeat protein, putative [Ricinus communis]
Length=523

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +2

Query  335  EGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILD  514
            E    V+G+KG++K+ EFV++I ++L+SLGYKK+ + LE ESGI   S    L   QIL+
Sbjct  2    ENSTVVIGTKGLIKRHEFVRVIIQSLWSLGYKKSASCLEIESGISYKSVDFELLESQILE  61

Query  515  GKWDESVITLH  547
            G W+  V TL+
Sbjct  62   GNWNGCVNTLN  72



>ref|XP_008775134.1| PREDICTED: WD repeat-containing protein 26 [Phoenix dactylifera]
Length=542

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +2

Query  350  VVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDE  529
            ++G +G++ + +FV+II +ALYSLGY+K  A LE +SG+ L S      +  I+ G+WDE
Sbjct  31   MLGREGLIDRTQFVRIIIQALYSLGYRKAAAVLELDSGVQLDSPEYTSLLFDIMAGRWDE  90

Query  530  SVITLH  547
             V T++
Sbjct  91   CVATIN  96



>ref|XP_003574020.1| PREDICTED: WD repeat-containing protein 26 [Brachypodium distachyon]
Length=533

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +2

Query  353  VGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWD  526
            +G++G+V + EFV++IA++LYSLGY+KT A LE ESG+ L+    +  +  ++ G+WD
Sbjct  22   LGARGLVDREEFVRLIAQSLYSLGYRKTAATLEAESGVPLYPPEHDRLLFDVMSGRWD  79



>gb|KDO60331.1| hypothetical protein CISIN_1g042434mg [Citrus sinensis]
Length=517

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +2

Query  335  EGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILD  514
            E  + ++G +G++KK EFV+++ + LYSLGY+K+ + LE ESG+   S        QIL+
Sbjct  2    ENSSTMIGPRGLIKKYEFVRVVVQCLYSLGYQKSASCLESESGVSYKSKGFERLEVQILN  61

Query  515  GKWDESVITL  544
            G WD  + TL
Sbjct  62   GDWDGCIDTL  71



>ref|XP_006443707.1| hypothetical protein CICLE_v10019514mg [Citrus clementina]
 ref|XP_006479415.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Citrus 
sinensis]
 gb|ESR56947.1| hypothetical protein CICLE_v10019514mg [Citrus clementina]
Length=565

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +2

Query  335  EGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILD  514
            E  + ++G +G++KK EFV+++ + LYSLGY+K+ + LE ESG+   S        QIL+
Sbjct  50   ENSSTMIGPRGLIKKYEFVRVVVQCLYSLGYQKSASCLESESGVSYKSKGFERLEVQILN  109

Query  515  GKWDESVITL  544
            G WD  + TL
Sbjct  110  GDWDGCIDTL  119



>ref|XP_006443706.1| hypothetical protein CICLE_v10019514mg [Citrus clementina]
 ref|XP_006443708.1| hypothetical protein CICLE_v10019514mg [Citrus clementina]
 gb|ESR56946.1| hypothetical protein CICLE_v10019514mg [Citrus clementina]
 gb|ESR56948.1| hypothetical protein CICLE_v10019514mg [Citrus clementina]
Length=525

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +2

Query  335  EGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILD  514
            E  + ++G +G++KK EFV+++ + LYSLGY+K+ + LE ESG+   S        QIL+
Sbjct  50   ENSSTMIGPRGLIKKYEFVRVVVQCLYSLGYQKSASCLESESGVSYKSKGFERLEVQILN  109

Query  515  GKWDESVITL  544
            G WD  + TL
Sbjct  110  GDWDGCIDTL  119



>gb|KDD75569.1| hypothetical protein H632_c614p2, partial [Helicosporidium sp. 
ATCC 50920]
Length=175

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +2

Query  347  DVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWD  526
            + VG  G++ + E+V++I +AL+ LGY     QLE+ESGI +  +V   F   +L+G+WD
Sbjct  10   EYVGDNGMILRSEYVRLIEQALHCLGYPSVAEQLEKESGIVMQPTVATEFRSAVLEGRWD  69

Query  527  ESVITL  544
            E++  L
Sbjct  70   EALSLL  75



>gb|KEH42443.1| transducin/WD40 repeat protein [Medicago truncatula]
Length=507

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +2

Query  344  NDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKW  523
            ++ +GSKG++ K EF++II ++LYSLGY KT + LE ESG+   S+   L    +L+G W
Sbjct  6    SETLGSKGLINKHEFIRIILQSLYSLGYTKTASLLESESGVSYKSNEFQLLESHVLNGNW  65

Query  524  DESVITLH  547
            +  V  L+
Sbjct  66   EACVTFLN  73



>gb|KGN58315.1| hypothetical protein Csa_3G611890 [Cucumis sativus]
Length=231

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +2

Query  335  EGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILD  514
            E  + ++GSKG+++K EFV++I + LYS GY+K+   LE ESGI   SS   L   QI  
Sbjct  2    ESSSVLLGSKGLIRKHEFVRVIIQCLYSFGYQKSALCLEAESGISYKSSDFKLLESQIFS  61

Query  515  GKW  523
            G W
Sbjct  62   GNW  64



>ref|XP_006280294.1| hypothetical protein CARUB_v10026218mg [Capsella rubella]
 gb|EOA13192.1| hypothetical protein CARUB_v10026218mg [Capsella rubella]
Length=531

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +2

Query  347  DVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWD  526
            +V+GSKG++KK EFV+I+ + LYSLG+ K+ + LE+ES I   S+   +  +Q+L G WD
Sbjct  7    EVLGSKGLLKKHEFVRILVQCLYSLGFNKSASCLEQESNISCKSADFGILEKQVLSGNWD  66

Query  527  ESVITL  544
              V  L
Sbjct  67   GCVAVL  72



>ref|XP_010918959.1| PREDICTED: WD repeat-containing protein 26 [Elaeis guineensis]
Length=542

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +2

Query  350  VVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDE  529
            V+G +G++ + +F++II +ALYSL Y+K  A LE ESG+HL S      +   + G+WDE
Sbjct  31   VLGREGLIDRTQFIRIIIQALYSLDYRKAAALLELESGVHLDSPEYTSLLFDTMAGRWDE  90

Query  530  SVITLH  547
             V  ++
Sbjct  91   CVAIIN  96



>ref|XP_010441956.1| PREDICTED: WD repeat-containing protein 26 [Camelina sativa]
Length=531

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +2

Query  347  DVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWD  526
            +++GSKG++KK EF++++ + LYSLG+KK+ + LE ES I   S+   L  +Q+L G WD
Sbjct  7    ELLGSKGLLKKHEFIRVLVQCLYSLGFKKSASCLEHESNILYKSADFGLLEKQVLSGNWD  66

Query  527  ESVITL  544
              V  L
Sbjct  67   SCVAVL  72



>ref|XP_004152068.1| PREDICTED: WD repeat-containing protein 26-like [Cucumis sativus]
 ref|XP_004171047.1| PREDICTED: WD repeat-containing protein 26-like [Cucumis sativus]
Length=298

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = +2

Query  335  EGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILD  514
            E  + ++GSKG+++K EFV++I + LYS GY+K+   LE ESGI   SS   L   QI  
Sbjct  2    ESSSVLLGSKGLIRKHEFVRVIIQCLYSFGYQKSALCLEAESGISYKSSDFKLLESQIFS  61

Query  515  GKWDESVITLH  547
            G W   + T++
Sbjct  62   GNWYGCIDTIN  72



>ref|XP_008235562.1| PREDICTED: WD repeat-containing protein 26 [Prunus mume]
Length=522

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +2

Query  341  GNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGK  520
            G+  +G KG++KK EFV+I+ + LYS+GY+K+ + LE ESGI   S    L   QI  G 
Sbjct  3    GSPRLGPKGLIKKHEFVRILIQCLYSIGYEKSASCLELESGISCKSDDFQLLESQISSGN  62

Query  521  WDESVITLH  547
            WD  V TL+
Sbjct  63   WDGCVDTLN  71



>ref|XP_007201159.1| hypothetical protein PRUPE_ppa004283mg [Prunus persica]
 gb|EMJ02358.1| hypothetical protein PRUPE_ppa004283mg [Prunus persica]
Length=518

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +2

Query  341  GNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGK  520
            G+  +G KG++KK EFV+I+ + LYS+GY+K+ + LE ESGI   S    L   QI  G 
Sbjct  3    GSPRLGPKGLIKKHEFVRILIQCLYSIGYEKSASCLELESGISCKSDDFQLLESQISSGN  62

Query  521  WDESVITLH  547
            WD  V TL+
Sbjct  63   WDGCVDTLN  71



>ref|XP_010481800.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Camelina 
sativa]
Length=511

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +2

Query  347  DVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWD  526
            +++GSKG++KK EF++++ + LYSLG+KK+ + LE ES I   S    L  +Q+L G WD
Sbjct  7    ELLGSKGLLKKHEFIRVLVQCLYSLGFKKSASCLEHESNILYKSVDFGLLEKQVLSGNWD  66

Query  527  ESVITL  544
              V  L
Sbjct  67   SCVAVL  72



>ref|XP_010481799.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Camelina 
sativa]
Length=531

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +2

Query  347  DVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWD  526
            +++GSKG++KK EF++++ + LYSLG+KK+ + LE ES I   S    L  +Q+L G WD
Sbjct  7    ELLGSKGLLKKHEFIRVLVQCLYSLGFKKSASCLEHESNILYKSVDFGLLEKQVLSGNWD  66

Query  527  ESVITL  544
              V  L
Sbjct  67   SCVAVL  72



>ref|XP_010494385.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Camelina 
sativa]
Length=531

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +2

Query  347  DVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWD  526
            +++GSKG++K+ EF++I+ + LYSLG+KK+ + LE ES I   S+   L  +Q+L G WD
Sbjct  7    ELLGSKGLLKRHEFIRILVQCLYSLGFKKSASCLEHESNILYKSADFGLLEKQVLSGNWD  66

Query  527  ESVITL  544
              +  L
Sbjct  67   SCLAVL  72



>ref|XP_010494383.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Camelina 
sativa]
Length=533

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +2

Query  347  DVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWD  526
            +++GSKG++K+ EF++I+ + LYSLG+KK+ + LE ES I   S+   L  +Q+L G WD
Sbjct  7    ELLGSKGLLKRHEFIRILVQCLYSLGFKKSASCLEHESNILYKSADFGLLEKQVLSGNWD  66

Query  527  ESVITL  544
              +  L
Sbjct  67   SCLAVL  72



>ref|XP_008382686.1| PREDICTED: WD repeat-containing protein 26 [Malus domestica]
 ref|XP_008382687.1| PREDICTED: WD repeat-containing protein 26 [Malus domestica]
 ref|XP_008382688.1| PREDICTED: WD repeat-containing protein 26 [Malus domestica]
Length=522

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +2

Query  341  GNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGK  520
            G+  +GSKG+VKK EFV+II + L S+GY+K+ + LE ESGI   S    +   QI  G 
Sbjct  3    GSPRLGSKGLVKKHEFVRIIIQCLLSIGYEKSASCLELESGISCKSDDFQMLESQISSGN  62

Query  521  WDESVITLH  547
            WD  V TL+
Sbjct  63   WDGCVDTLN  71



>emb|CAN70491.1| hypothetical protein VITISV_017611 [Vitis vinifera]
Length=381

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 50/91 (55%), Gaps = 13/91 (14%)
 Frame = +2

Query  263  NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGA  442
            + K+ RDPT+              E    ++G K ++KK EFV+II + L+SLGYK + +
Sbjct  22   HHKNQRDPTSM-------------ENATAMLGPKRLIKKHEFVRIIIQCLHSLGYKNSAS  68

Query  443  QLEEESGIHLHSSVVNLFMQQILDGKWDESV  535
             LE ESGI   S    L   Q+L+  W++S+
Sbjct  69   CLESESGISHKSPESKLLEMQVLNANWEDSI  99



>ref|XP_007162638.1| hypothetical protein PHAVU_001G167600g [Phaseolus vulgaris]
 gb|ESW34632.1| hypothetical protein PHAVU_001G167600g [Phaseolus vulgaris]
Length=528

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +2

Query  335  EGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILD  514
            E   +V+G++G++++ EFV+II + LYSLGY  + + LE ESGI   S+ + L    IL+
Sbjct  2    ENPCEVLGTEGLIRRHEFVRIIIQCLYSLGYSNSASCLELESGISYRSNELKLLESFILN  61

Query  515  GKWDESV  535
            G WD+ +
Sbjct  62   GDWDDGI  68



>ref|XP_008447357.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat-containing protein 
26 [Cucumis melo]
Length=522

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  VVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKW  523
            ++GSKG+++K EFV++I + LYS GY+K+   LE ESGI   SS   L   QI  G W
Sbjct  7    LLGSKGLIRKHEFVRVIIQCLYSFGYQKSALCLEAESGISYKSSDFKLLESQIFSGNW  64



>ref|XP_010684801.1| PREDICTED: WD repeat-containing protein 26 [Beta vulgaris subsp. 
vulgaris]
Length=549

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = +2

Query  308  CSMARSLVCEGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVV  487
            C ++ ++  +  + V+GSKG+++K EFV+II + L SLG  K+ + LE ESGI   S   
Sbjct  19   CKISMTMENDSSSTVLGSKGLIRKHEFVRIIMQCLLSLGLPKSASCLELESGISYKSKEF  78

Query  488  NLFMQQILDGKWDESV  535
                 +IL+ KWDE +
Sbjct  79   EAIESEILNAKWDECI  94



>ref|XP_009629554.1| PREDICTED: WD repeat-containing protein 26 isoform X1 [Nicotiana 
tomentosiformis]
Length=517

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  353  VGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDES  532
            +GSK ++KK EFV+II + LYSLGY+K+   LE ESGI   S  +      ILD  WD  
Sbjct  8    LGSKHLIKKHEFVRIIIQCLYSLGYRKSAVSLESESGIAYKSDELESLESHILDANWDAC  67

Query  533  VITLH  547
            +  L+
Sbjct  68   IDCLN  72



>ref|XP_009629555.1| PREDICTED: WD repeat-containing protein 26 isoform X2 [Nicotiana 
tomentosiformis]
Length=486

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +2

Query  353  VGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDES  532
            +GSK ++KK EFV+II + LYSLGY+K+   LE ESGI   S  +      ILD  WD  
Sbjct  8    LGSKHLIKKHEFVRIIIQCLYSLGYRKSAVSLESESGIAYKSDELESLESHILDANWDAC  67

Query  533  V  535
            +
Sbjct  68   I  68



>ref|XP_002268789.2| PREDICTED: WD repeat-containing protein 26 [Vitis vinifera]
Length=551

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 50/91 (55%), Gaps = 13/91 (14%)
 Frame = +2

Query  263  NRKSLRDPTNCSLSDCSMARSLVCEGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGA  442
            + K+ RDPT+              E    ++G K ++KK EFV+II + L+SLGYK + +
Sbjct  22   HHKNQRDPTSM-------------ENATAMLGPKRLIKKHEFVRIIIQCLHSLGYKNSAS  68

Query  443  QLEEESGIHLHSSVVNLFMQQILDGKWDESV  535
             LE ESGI   S    L   Q+L+  W++S+
Sbjct  69   CLESESGISHKSPESKLLEMQVLNANWEDSI  99



>ref|XP_009792756.1| PREDICTED: WD repeat-containing protein 26 isoform X1 [Nicotiana 
sylvestris]
Length=516

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  353  VGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDES  532
            +GSK ++KK EFV+II + LYSLGY+K+   LE ESGI   S  +      ILD  WD  
Sbjct  8    LGSKHLIKKHEFVRIIIQCLYSLGYRKSAVSLESESGIAYKSVELKSLESHILDANWDAC  67

Query  533  VITLH  547
            +  L+
Sbjct  68   IDRLN  72



>ref|XP_009792757.1| PREDICTED: WD repeat-containing protein 26 isoform X2 [Nicotiana 
sylvestris]
Length=485

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  353  VGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDES  532
            +GSK ++KK EFV+II + LYSLGY+K+   LE ESGI   S  +      ILD  WD  
Sbjct  8    LGSKHLIKKHEFVRIIIQCLYSLGYRKSAVSLESESGIAYKSVELKSLESHILDANWDAC  67

Query  533  VITLH  547
            +  L+
Sbjct  68   IDRLN  72



>gb|AAL07102.1| putative WD-repeat protein [Arabidopsis thaliana]
Length=308

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +2

Query  338  GGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDG  517
            G  +V+GSKG++KK EF++I+ + LYSLG+K + + LE ES I   ++      +Q+L G
Sbjct  4    GLWEVLGSKGLLKKHEFIRILVQCLYSLGFKNSASCLEFESKILYKTADSEFLEKQVLSG  63

Query  518  KWDESVITL  544
             WD  V  L
Sbjct  64   NWDSCVQVL  72



>gb|KFK31679.1| hypothetical protein AALP_AA6G145100 [Arabis alpina]
Length=529

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  347  DVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWD  526
            +V+GSKG+VKK EF++I+ + LYSLG+KK+ + LE ES +   S         +L G WD
Sbjct  8    EVLGSKGLVKKHEFIRIMVQCLYSLGFKKSASCLENESNVSCKSDDFAFLEMYVLSGDWD  67



>ref|XP_010091833.1| WD repeat-containing protein 26 [Morus notabilis]
 gb|EXB46041.1| WD repeat-containing protein 26 [Morus notabilis]
Length=533

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +2

Query  323  SLVCEGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQ  502
            S+  E    V+G+K ++KK EFV++I + LYSLG+ ++ + LE ESGI   S    L   
Sbjct  22   SMSSEASRMVLGAKRLIKKHEFVRVIIQCLYSLGFDESASCLELESGISDKSLEFELLKS  81

Query  503  QILDGKWDESVITL  544
            QIL G WD  + TL
Sbjct  82   QILAGNWDGCIHTL  95



>ref|XP_011083080.1| PREDICTED: WD repeat-containing protein 26 [Sesamum indicum]
Length=515

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +2

Query  353  VGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDES  532
            VG KG++KK E V+II + LYSLGY K+ A LE ES I   S  +     QIL   WD+ 
Sbjct  8    VGPKGLIKKHELVRIIIQCLYSLGYSKSAACLESESCITCKSPELESLESQILKANWDDC  67

Query  533  VITL  544
            + +L
Sbjct  68   IKSL  71



>ref|NP_199205.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
 dbj|BAB09052.1| WD-repeat protein-like [Arabidopsis thaliana]
 dbj|BAE99272.1| WD-repeat protein-like [Arabidopsis thaliana]
 gb|ABQ85545.1| will die slowly [Arabidopsis thaliana]
 gb|AED95028.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
Length=523

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +2

Query  347  DVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWD  526
            +V+GSKG++KK EF++I+ + LYSLG+K + + LE ES I   ++      +Q+L G WD
Sbjct  7    EVLGSKGLLKKHEFIRILVQCLYSLGFKNSASCLEFESKILYKTADSEFLEKQVLSGNWD  66

Query  527  ESVITL  544
              V  L
Sbjct  67   SCVQVL  72



>ref|XP_009370775.1| PREDICTED: WD repeat-containing protein 26 [Pyrus x bretschneideri]
 ref|XP_009370783.1| PREDICTED: WD repeat-containing protein 26 [Pyrus x bretschneideri]
 ref|XP_009370792.1| PREDICTED: WD repeat-containing protein 26 [Pyrus x bretschneideri]
 ref|XP_009370800.1| PREDICTED: WD repeat-containing protein 26 [Pyrus x bretschneideri]
Length=522

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +2

Query  341  GNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGK  520
            G+  +GSKG+++K EFV+II + L S+GY+K+ + LE ESGI   S+       QI  G 
Sbjct  3    GSPRLGSKGLIRKHEFVRIIIQCLLSIGYEKSASCLELESGISCKSNDFQTLESQISSGN  62

Query  521  WDESVITLH  547
            WD  V TL+
Sbjct  63   WDGCVDTLN  71



>emb|CBI37215.3| unnamed protein product [Vitis vinifera]
Length=460

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +2

Query  335  EGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILD  514
            E    ++G K ++KK EFV+II + L+SLGYK + + LE ESGI   S    L   Q+L+
Sbjct  2    ENATAMLGPKRLIKKHEFVRIIIQCLHSLGYKNSASCLESESGISHKSPESKLLEMQVLN  61

Query  515  GKWDESV  535
              W++S+
Sbjct  62   ANWEDSI  68



>gb|EYU17955.1| hypothetical protein MIMGU_mgv1a004677mg [Erythranthe guttata]
Length=515

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 39/67 (58%), Gaps = 0/67 (0%)
 Frame = +2

Query  335  EGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILD  514
            E     +G KG++KK E V+II + LYSLGY K+ A LE ES I   S        QIL+
Sbjct  2    ENTGTALGPKGMIKKHELVRIIVQCLYSLGYNKSAACLELESCITSKSPEFESLESQILN  61

Query  515  GKWDESV  535
             KWD+ +
Sbjct  62   AKWDDCI  68



>ref|XP_004247123.1| PREDICTED: WD repeat-containing protein 26 [Solanum lycopersicum]
Length=516

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +2

Query  353  VGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDES  532
            +GSK ++KK EFV++I + LYSLGY+K+   LE ESGI   S+        I D  WD  
Sbjct  8    LGSKKLIKKHEFVRVIIQCLYSLGYRKSAVCLESESGISYKSNEFETLESYIRDANWDAC  67

Query  533  VITLH  547
            + TL+
Sbjct  68   IETLN  72



>ref|XP_006355901.1| PREDICTED: WD repeat-containing protein 26-like [Solanum tuberosum]
Length=516

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +2

Query  353  VGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDES  532
            +GSK ++KK EFV++I + LYSLGY+K+   LE ESGI   S         I D  WD  
Sbjct  8    LGSKKLIKKHEFVRVIIQCLYSLGYRKSAVSLESESGISYKSDEFETLESCIRDANWDAC  67

Query  533  VITLH  547
            + TL+
Sbjct  68   IETLN  72



>gb|EYU42860.1| hypothetical protein MIMGU_mgv1a025082mg [Erythranthe guttata]
Length=472

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 44/72 (61%), Gaps = 11/72 (15%)
 Frame = +2

Query  335  EGGND--VVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQI  508
            EGG D  V  SK +VKK + V+ I + LYSL         ++  GI LH   V+LFM+QI
Sbjct  11   EGGGDASVFFSKRVVKKTKLVRDITKLLYSL---------DKGPGIELHKERVDLFMEQI  61

Query  509  LDGKWDESVITL  544
            +DGKWDES  TL
Sbjct  62   IDGKWDESRSTL  73



>ref|XP_002865396.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41655.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=523

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +2

Query  347  DVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWD  526
            +V+GSKG++KK EF++I+ + LYSLG+K + + LE ES I   S+      +++L G WD
Sbjct  7    EVLGSKGLLKKHEFIRILVQCLYSLGFKNSASCLEIESNISCKSADYESLEKRVLSGDWD  66

Query  527  ESVITL  544
              V  L
Sbjct  67   SCVAVL  72



>emb|CDP03813.1| unnamed protein product [Coffea canephora]
Length=511

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = +2

Query  344  NDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKW  523
            N ++G KG++KK EFV+II +++++LGY+K+   LE ESGI   S         IL+  W
Sbjct  3    NLMIGPKGLIKKQEFVRIIIQSMHALGYRKSAVCLEAESGISCKSVDFESLESHILNANW  62

Query  524  DESVITLH  547
            D+ +  L+
Sbjct  63   DDCIGALN  70



>gb|EYU42820.1| hypothetical protein MIMGU_mgv1a018113mg [Erythranthe guttata]
Length=472

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 44/69 (64%), Gaps = 7/69 (10%)
 Frame = +2

Query  338  GGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDG  517
            GGN+VV S  ++KK + V+ I   LYSL Y + G  LE+  GI       +LF++QI+DG
Sbjct  11   GGNEVVRSNTVLKKTKLVRGIKSLLYSLVYDRKGKSLEKGPGI-------DLFIEQIIDG  63

Query  518  KWDESVITL  544
            K DES+ TL
Sbjct  64   KCDESLSTL  72



>gb|EYU42822.1| hypothetical protein MIMGU_mgv1a024382mg [Erythranthe guttata]
Length=468

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 41/69 (59%), Gaps = 9/69 (13%)
 Frame = +2

Query  338  GGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDG  517
            G   V  SK ++KK + V+ I + LYSLG         +  GI LH   V+LFM+QI+DG
Sbjct  10   GDASVFFSKRVLKKTKLVRDITKLLYSLG---------KGPGIELHKERVDLFMEQIIDG  60

Query  518  KWDESVITL  544
            KWDES  TL
Sbjct  61   KWDESQSTL  69



>gb|AFK42042.1| unknown [Medicago truncatula]
Length=49

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -1

Query  543  NVITLSSHFPSRICCINKFTTEECKCIPDSSSSCAPVFL  427
            NV  LSS  PS  CCIN+FT +E K +PDSSS C+P+FL
Sbjct  11   NVARLSSQSPSSTCCINRFTADEFKGMPDSSSRCSPLFL  49



>ref|XP_009386572.1| PREDICTED: WD repeat-containing protein 26 [Musa acuminata subsp. 
malaccensis]
Length=532

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = +2

Query  374  KKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            ++ EFV+II + LYSLGY++  A LE ESG+   S         ++ G+WD+ + T+
Sbjct  28   RRTEFVRIIVQCLYSLGYRRAAATLESESGVSHDSPEYTALFLDVMAGRWDDCIATI  84



>ref|XP_004982941.1| PREDICTED: WD repeat-containing protein 26-like [Setaria italica]
Length=522

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +2

Query  365  GIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            G V + E V++I E+LYSLGY++  A+LE ESG+ L+    +  +  ++ G+WD    T+
Sbjct  13   GPVDREELVRVIEESLYSLGYRRAAAELEAESGVPLYPPEHDRLLLDVMAGRWDACAETV  72



>gb|EMT27850.1| hypothetical protein F775_27811 [Aegilops tauschii]
Length=530

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +2

Query  374  KKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            ++ E V++IA++LYSLGY+K  A LE ESG+ L+    +  +  ++ G+WD    T+
Sbjct  20   RREELVRLIAQSLYSLGYRKAAATLEAESGVPLYPPEHDRLLLDVMSGRWDACAATI  76



>ref|XP_004292253.1| PREDICTED: WD repeat-containing protein 26 [Fragaria vesca subsp. 
vesca]
Length=524

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +2

Query  341  GNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGK  520
            G+  +GSKG++KK EFV++I + LYS+G  K+ + LE ESGI   S        +IL G 
Sbjct  5    GSCRLGSKGLIKKHEFVRVIIQCLYSIGCGKSASCLELESGIACQSDYFRTLESKILSGN  64

Query  521  WD  526
            W+
Sbjct  65   WN  66



>ref|XP_005646513.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE21969.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
Length=565

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +2

Query  347  DVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWD  526
            + +GSK ++ + E+++++ ++L+ LG+     QLE +SGI +    V  F   I +G+WD
Sbjct  22   EFLGSKRMINRQEYIRLMEQSLHRLGFSAAAQQLERDSGIQMQPVTVTQFQDHIFNGRWD  81

Query  527  ESVITL  544
             ++  L
Sbjct  82   AALALL  87



>gb|EMS48361.1| WD repeat-containing protein 26 [Triticum urartu]
Length=1097

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +2

Query  383  EFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            E V++IA++LYSLGY+K  A LE ESG+ L+    +  +  ++ G+WD    T+
Sbjct  23   ELVRLIAQSLYSLGYRKAAATLEAESGVPLYPPEHDRLLLDVMSGRWDACAATI  76



>ref|XP_002464509.1| hypothetical protein SORBIDRAFT_01g019860 [Sorghum bicolor]
 gb|EER91507.1| hypothetical protein SORBIDRAFT_01g019860 [Sorghum bicolor]
Length=530

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +2

Query  323  SLVCEGGNDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQ  502
            S+ C          G V + E V+ + ++LYSLGY++  A LE ESG+ L+    +  + 
Sbjct  7    SVPCADEGPAPHRLGPVDREELVRAMTQSLYSLGYRRAAAALEVESGVPLYPPEHDRLLL  66

Query  503  QILDGKWDESVITL  544
            +++ G+WD S  T+
Sbjct  67   EVMAGRWDASAETV  80



>ref|XP_010522523.1| PREDICTED: WD repeat-containing protein 26 [Tarenaya hassleriana]
Length=524

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +2

Query  347  DVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWD  526
            +++GS G++KK EF++++ + LYS G+ K+ + LE ES +   S+       Q+L G WD
Sbjct  3    EILGSNGLLKKHEFIRVLVQCLYSSGFTKSASCLEFESCVPYKSADFESLEVQVLSGHWD  62

Query  527  ESVITL  544
              ++ L
Sbjct  63   SCIVIL  68



>emb|CDX84431.1| BnaC03g50690D [Brassica napus]
Length=504

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 37/66 (56%), Gaps = 0/66 (0%)
 Frame = +2

Query  350  VVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDE  529
             +GSKG+VKK E V+II +AL SLG+    A LE +SG++L    +  F+      +W  
Sbjct  4    TIGSKGLVKKTELVRIITDALISLGFNGIAADLENQSGVNLLDPTIKHFLDLAERKEWHN  63

Query  530  SVITLH  547
             +  L 
Sbjct  64   CITLLQ  69



>emb|CDY41528.1| BnaA06g22810D [Brassica napus]
Length=479

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = +2

Query  350  VVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDE  529
             +GSKG+VKK E V+II +AL SLG+      L+ +SG++L    +  F+ +    +W+ 
Sbjct  4    TIGSKGLVKKTELVRIITDALISLGFNGIATDLQNQSGVNLLDPTIRHFLDEAKRKEWNS  63

Query  530  SV  535
             +
Sbjct  64   CI  65



>ref|XP_007395402.1| hypothetical protein PHACADRAFT_94848 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM55055.1| hypothetical protein PHACADRAFT_94848 [Phanerochaete carnosa 
HHB-10118-sp]
Length=601

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +2

Query  371  VKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            V + EFV+++ ++L  +GY ++ A LE ESG  + +S V+ F Q IL+G WD +  TL
Sbjct  84   VDREEFVRLVIQSLRDVGYIESAATLEAESGYTMETSDVSRFRQCILEGDWDSAEDTL  141



>dbj|GAM21975.1| hypothetical protein SAMD00019534_051500, partial [Acytostelium 
subglobosum LB1]
Length=702

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +2

Query  344  NDVVGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKW  523
            +D  G    V K E ++++ ++L+ LGYKK+   LE++SG+ L S  V  F+   +DG W
Sbjct  152  SDANGESTAVNKTELIRLLIQSLHYLGYKKSAEFLEKDSGVFLQSPEVMHFINSTMDGDW  211



>ref|XP_011399695.1| WD repeat-containing protein 26 [Auxenochlorella protothecoides]
 gb|KFM26753.1| WD repeat-containing protein 26 [Auxenochlorella protothecoides]
Length=545

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 36/64 (56%), Gaps = 0/64 (0%)
 Frame = +2

Query  353  VGSKGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDES  532
            VG + ++ + E+++++ +AL  LGY    +QLE ESGI +   V   F   +L G W  +
Sbjct  13   VGGRHMILRSEYIRLLEQALAGLGYPALASQLEAESGISMQPQVATDFRDAVLGGDWSSA  72

Query  533  VITL  544
            +  L
Sbjct  73   LALL  76



>gb|KDQ60900.1| hypothetical protein JAAARDRAFT_55637 [Jaapia argillacea MUCL 
33604]
Length=682

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/58 (38%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +2

Query  371  VKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWDESVITL  544
            V + EFV+++ ++L  +GY ++ A LE ESG  + +S V+ F Q +LDG W+++   L
Sbjct  90   VDREEFVRLVIQSLRDVGYIESAATLEAESGYTMETSEVSKFRQYVLDGAWEQAETML  147



>ref|XP_004222828.1| WD-repeat protein [Plasmodium cynomolgi strain B]
 dbj|GAB66881.1| WD-repeat protein [Plasmodium cynomolgi strain B]
Length=1177

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 60/132 (45%), Gaps = 13/132 (10%)
 Frame = +2

Query  185  FIQFMGGVEDDEPPFKRVKVSSGELLNRKSLRDPTNCSLSDCSMA--------RSLVCEG  340
            F ++   +  D+    R+  SS    NR S    + CS    S A        R    EG
Sbjct  41   FAKYDEQISIDKATSNRISCSSSCCGNRSSDFSESRCSYGSSSRASNRGKNHKRRKASEG  100

Query  341  GNDVVGS----KGIVKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQI  508
             +         +G++KK + + ++ +A+ ++GYKK+   LE ESGI L   +V    + +
Sbjct  101  NHKPSSGDSIWEGLLKK-DVILLLIQAIKNMGYKKSAKHLELESGIELEQPIVKEMHKNV  159

Query  509  LDGKWDESVITL  544
            L GKW  ++  L
Sbjct  160  LSGKWKNAISNL  171



>ref|XP_003035313.1| hypothetical protein SCHCODRAFT_66095 [Schizophyllum commune 
H4-8]
 gb|EFJ00411.1| hypothetical protein SCHCODRAFT_66095 [Schizophyllum commune 
H4-8]
Length=648

 Score = 48.5 bits (114),  Expect = 0.001, Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 40/59 (68%), Gaps = 2/59 (3%)
 Frame = +2

Query  371  VKKVEFVQIIAEALYSLGYKKTGAQLEEESGIHLHSSVVNLFMQQILDGKWD--ESVIT  541
            V + EF+++I ++L  +GY+++   LE ESG  + ++ V+ F Q ++DG+W   ESV+T
Sbjct  79   VDREEFIRLIVQSLRDVGYEESATALEHESGYAMEATDVSDFRQYVMDGQWTKAESVLT  137



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720