BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF008I17

Length=373
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009624871.1|  PREDICTED: putative glycosyltransferase 7        49.7    2e-04   Nicotiana tomentosiformis
ref|XP_009761597.1|  PREDICTED: putative glycosyltransferase 7        48.1    5e-04   Nicotiana sylvestris
ref|XP_009777953.1|  PREDICTED: putative glycosyltransferase 7 is...  47.4    9e-04   Nicotiana sylvestris



>ref|XP_009624871.1| PREDICTED: putative glycosyltransferase 7 [Nicotiana tomentosiformis]
Length=456

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/64 (31%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +2

Query  170  IMYSELGRTQMASSMSKSRGKTAVFSDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGGFP  349
            ++ ++   + MA   +     T++FSD FLC GG++VA ++VW  W+F++ +P+ +  F 
Sbjct  6    LVQTQTSYSSMAPKQNCKSKVTSLFSDGFLCAGGSIVALLVVWAFWSFMSTSPNTDPSFF  65

Query  350  SLAG  361
            S + 
Sbjct  66   STSA  69



>ref|XP_009761597.1| PREDICTED: putative glycosyltransferase 7 [Nicotiana sylvestris]
Length=456

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 22/69 (32%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +2

Query  170  IMYSELGRTQMASSMSKSRGKTAVFSDAFLCTGGTLVAFVLVWGVWAFVAPNPSFNGG-F  346
            ++ ++   + MA   +     +++FSD FLC GG++VA ++VW  W+F++ +P+ +   F
Sbjct  6    LVQTQASYSSMAPKQNCKSKVSSLFSDGFLCAGGSIVALLVVWAFWSFMSTSPNTDPSFF  65

Query  347  PSLAGKISG  373
             S  GK S 
Sbjct  66   TSSVGKKSA  74



>ref|XP_009777953.1| PREDICTED: putative glycosyltransferase 7 isoform X1 [Nicotiana 
sylvestris]
Length=431

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 3/45 (7%)
 Frame = +2

Query  212  MSKSRGKTAV---FSDAFLCTGGTLVAFVLVWGVWAFVAPNPSFN  337
            M+K   +T V   FSD F+  GGTLVA ++   +W+F++PNPSF+
Sbjct  1    MTKQDYRTKVASFFSDGFVFVGGTLVAVLVFLAIWSFISPNPSFS  45



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555214126005