BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF008H18

Length=592
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009609674.1|  PREDICTED: dicarboxylate transporter 1, chlo...    160   2e-42   Nicotiana tomentosiformis
ref|XP_007015047.1|  Dicarboxylate transporter 1 isoform 3              156   4e-42   
ref|XP_004250945.1|  PREDICTED: dicarboxylate transporter 1, chlo...    159   5e-42   Solanum lycopersicum
ref|XP_006361749.1|  PREDICTED: dicarboxylate transporter 1, chlo...    159   5e-42   Solanum tuberosum [potatoes]
ref|XP_010102341.1|  2-oxoglutarate/malate translocator                 159   6e-42   Morus notabilis
ref|XP_011080429.1|  PREDICTED: dicarboxylate transporter 1, chlo...    157   9e-42   Sesamum indicum [beniseed]
ref|XP_009777235.1|  PREDICTED: dicarboxylate transporter 1, chlo...    157   2e-41   Nicotiana sylvestris
gb|EYU31365.1|  hypothetical protein MIMGU_mgv1a003738mg                157   3e-41   Erythranthe guttata [common monkey flower]
ref|XP_002313335.2|  hypothetical protein POPTR_0009s05850g             152   3e-41   
gb|EYU46260.1|  hypothetical protein MIMGU_mgv1a003794mg                156   3e-41   Erythranthe guttata [common monkey flower]
ref|XP_002282809.1|  PREDICTED: dicarboxylate transporter 1, chlo...    156   4e-41   Vitis vinifera
gb|EPS73843.1|  hypothetical protein M569_00906                         154   6e-41   Genlisea aurea
ref|XP_004162089.1|  PREDICTED: dicarboxylate transporter 1, chlo...    156   6e-41   
ref|NP_001119216.1|  dicarboxylate transporter 1                        155   6e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004142115.1|  PREDICTED: dicarboxylate transporter 1, chlo...    156   7e-41   Cucumis sativus [cucumbers]
ref|XP_007015045.1|  Dicarboxylate transporter 1 isoform 1              155   7e-41   
ref|NP_568283.2|  dicarboxylate transporter 1                           155   7e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007211882.1|  hypothetical protein PRUPE_ppa003549mg             155   9e-41   Prunus persica
ref|XP_008227299.1|  PREDICTED: dicarboxylate transporter 1, chlo...    155   9e-41   Prunus mume [ume]
ref|XP_010031793.1|  PREDICTED: dicarboxylate transporter 1, chlo...    155   9e-41   
ref|XP_008449718.1|  PREDICTED: dicarboxylate transporter 1, chlo...    155   1e-40   Cucumis melo [Oriental melon]
ref|XP_009375074.1|  PREDICTED: dicarboxylate transporter 1, chlo...    155   1e-40   
gb|KHG21220.1|  2-oxoglutarate/malate translocator, chloroplastic       155   1e-40   Gossypium arboreum [tree cotton]
ref|XP_010536081.1|  PREDICTED: dicarboxylate transporter 1, chlo...    155   1e-40   
ref|XP_010257247.1|  PREDICTED: dicarboxylate transporter 1, chlo...    155   1e-40   Nelumbo nucifera [Indian lotus]
gb|KJB35803.1|  hypothetical protein B456_006G129000                    154   2e-40   Gossypium raimondii
ref|XP_006399771.1|  hypothetical protein EUTSA_v10013154mg             154   2e-40   Eutrema salsugineum [saltwater cress]
ref|XP_004291789.1|  PREDICTED: dicarboxylate transporter 1, chlo...    154   2e-40   Fragaria vesca subsp. vesca
ref|XP_008363620.1|  PREDICTED: dicarboxylate transporter 1, chlo...    154   3e-40   
ref|XP_009343722.1|  PREDICTED: dicarboxylate transporter 1, chlo...    154   4e-40   Pyrus x bretschneideri [bai li]
gb|KDP22090.1|  hypothetical protein JCGZ_25921                         154   4e-40   Jatropha curcas
sp|Q41364.1|DIT1_SPIOL  RecName: Full=Dicarboxylate transporter 1...    153   4e-40   Spinacia oleracea
ref|XP_009411283.1|  PREDICTED: dicarboxylate transporter 1, chlo...    153   5e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK25523.1|  hypothetical protein AALP_AA8G126300                    153   5e-40   Arabis alpina [alpine rockcress]
ref|XP_010419844.1|  PREDICTED: dicarboxylate transporter 1, chlo...    152   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010453335.1|  PREDICTED: dicarboxylate transporter 1, chlo...    152   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_006287403.1|  hypothetical protein CARUB_v10000609mg             152   1e-39   Capsella rubella
ref|XP_010453336.1|  PREDICTED: dicarboxylate transporter 1, chlo...    152   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_002873582.1|  hypothetical protein ARALYDRAFT_909232             152   1e-39   Arabidopsis lyrata subsp. lyrata
ref|XP_010492022.1|  PREDICTED: dicarboxylate transporter 1, chlo...    152   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_009394734.1|  PREDICTED: dicarboxylate transporter 1, chlo...    152   1e-39   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK00367.1|  predicted protein                                      152   1e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008344435.1|  PREDICTED: LOW QUALITY PROTEIN: dicarboxylat...    151   1e-39   
emb|CDY53969.1|  BnaA10g30010D                                          152   1e-39   Brassica napus [oilseed rape]
ref|XP_009348953.1|  PREDICTED: dicarboxylate transporter 1, chlo...    152   2e-39   Pyrus x bretschneideri [bai li]
ref|XP_009121830.1|  PREDICTED: dicarboxylate transporter 1, chlo...    152   2e-39   Brassica rapa
ref|XP_009366121.1|  PREDICTED: dicarboxylate transporter 1, chlo...    152   2e-39   
emb|CDX97208.1|  BnaC09g44170D                                          152   2e-39   
ref|XP_011025529.1|  PREDICTED: dicarboxylate transporter 1, chlo...    152   2e-39   Populus euphratica
ref|XP_008801951.1|  PREDICTED: dicarboxylate transporter 1, chlo...    152   2e-39   Phoenix dactylifera
ref|XP_002513507.1|  2-oxoglutarate/malate translocator, chloropl...    151   3e-39   Ricinus communis
emb|CDP12268.1|  unnamed protein product                                151   4e-39   Coffea canephora [robusta coffee]
ref|XP_007015046.1|  Dicarboxylate transporter 1 isoform 2              150   5e-39   
ref|XP_006446115.1|  hypothetical protein CICLE_v10014769mg             150   6e-39   Citrus clementina [clementine]
ref|XP_011045437.1|  PREDICTED: dicarboxylate transporter 1, chlo...    149   1e-38   Populus euphratica
ref|XP_002442229.1|  hypothetical protein SORBIDRAFT_08g016630          149   3e-38   Sorghum bicolor [broomcorn]
ref|NP_001066885.1|  Os12g0515400                                       148   3e-38   
gb|ABK24751.1|  unknown                                                 147   6e-38   Picea sitchensis
ref|XP_002299910.2|  hypothetical protein POPTR_0001s26580g             147   9e-38   Populus trichocarpa [western balsam poplar]
ref|XP_011006198.1|  PREDICTED: dicarboxylate transporter 1, chlo...    147   1e-37   Populus euphratica
ref|NP_001105570.1|  LOC542560                                          147   1e-37   Zea mays [maize]
ref|XP_007132020.1|  hypothetical protein PHAVU_011G059900g             147   1e-37   Phaseolus vulgaris [French bean]
ref|XP_003575954.1|  PREDICTED: LOW QUALITY PROTEIN: dicarboxylat...    146   1e-37   
ref|XP_010931014.1|  PREDICTED: LOW QUALITY PROTEIN: dicarboxylat...    146   2e-37   
ref|XP_004507091.1|  PREDICTED: dicarboxylate transporter 1, chlo...    145   4e-37   Cicer arietinum [garbanzo]
ref|XP_003537966.1|  PREDICTED: dicarboxylate transporter 1, chlo...    145   4e-37   Glycine max [soybeans]
ref|XP_003539493.1|  PREDICTED: dicarboxylate transporter 1, chlo...    145   5e-37   Glycine max [soybeans]
emb|CAX65044.1|  plastidic 2-oxoglutarate/malate translocator           142   2e-36   Pisum sativum [garden pea]
ref|XP_010673637.1|  PREDICTED: dicarboxylate transporter 1, chlo...    143   2e-36   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH30210.1|  2-oxoglutarate/malate translocator                      142   3e-36   Medicago truncatula
ref|XP_004964101.1|  PREDICTED: dicarboxylate transporter 1, chlo...    135   2e-33   
emb|CAN74406.1|  hypothetical protein VITISV_043636                     122   7e-30   Vitis vinifera
ref|XP_001700410.1|  oxoglutarate:malate antiporter                     105   7e-23   Chlamydomonas reinhardtii
ref|XP_001700411.1|  chloroplast oxoglutarate-malate translocator       105   8e-23   Chlamydomonas reinhardtii
ref|XP_002955862.1|  hypothetical protein VOLCADRAFT_106989             105   9e-23   Volvox carteri f. nagariensis
ref|XP_005843613.1|  hypothetical protein CHLNCDRAFT_140201             102   8e-22   Chlorella variabilis
ref|XP_005650106.1|  oxoglutarate:malate antiporter                   94.0    5e-19   Coccomyxa subellipsoidea C-169
gb|EYU18451.1|  hypothetical protein MIMGU_mgv1a003725mg              94.4    7e-19   Erythranthe guttata [common monkey flower]
ref|WP_038563803.1|  2-oxoglutarate translocator                      93.6    8e-19   Terribacillus goriensis
gb|AFK44505.1|  unknown                                               91.3    1e-18   Medicago truncatula
ref|XP_009624586.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  92.8    3e-18   Nicotiana tomentosiformis
ref|XP_011397588.1|  Dicarboxylate transporter 1, chloroplastic       92.0    3e-18   Auxenochlorella protothecoides
ref|XP_009774993.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  92.8    3e-18   Nicotiana sylvestris
ref|XP_011087921.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  92.4    4e-18   Sesamum indicum [beniseed]
gb|ABO87605.1|  chloroplast glutamate/malate translocator             92.0    4e-18   Pisum sativum [garden pea]
ref|NP_201234.1|  dicarboxylate transport 2.1                         91.7    5e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010315125.1|  PREDICTED: LOW QUALITY PROTEIN: dicarboxylat...  91.7    6e-18   Solanum lycopersicum
ref|XP_006351757.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  91.7    6e-18   Solanum tuberosum [potatoes]
ref|XP_002866607.1|  DCT/DIT2.1                                       91.7    6e-18   Arabidopsis lyrata subsp. lyrata
emb|CDY18717.1|  BnaA09g06780D                                        91.3    9e-18   Brassica napus [oilseed rape]
ref|XP_007148387.1|  hypothetical protein PHAVU_006G204300g           91.3    9e-18   Phaseolus vulgaris [French bean]
ref|XP_009112126.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  90.9    1e-17   Brassica rapa
ref|XP_010520862.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  90.9    1e-17   Tarenaya hassleriana [spider flower]
ref|WP_032858509.1|  2-oxoglutarate translocator                      90.1    1e-17   Bacillus
ref|XP_010546344.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  90.5    1e-17   Tarenaya hassleriana [spider flower]
ref|WP_013351349.1|  MULTISPECIES: 2-oxoglutarate translocator        90.1    1e-17   Bacillus subtilis group
ref|WP_003155645.1|  MULTISPECIES: 2-oxoglutarate translocator        90.1    1e-17   Bacillus
ref|WP_038829541.1|  2-oxoglutarate translocator                      89.7    1e-17   Bacillus subtilis
ref|WP_007408966.1|  MULTISPECIES: 2-oxoglutarate translocator        90.1    2e-17   Bacillus
ref|WP_015417012.1|  MULTISPECIES: 2-oxoglutarate/malate transporter  90.1    2e-17   Bacillales
ref|WP_042744509.1|  2-oxoglutarate translocator                      86.3    2e-17   
dbj|BAD91178.1|  putative plastidic 2-oxoglutarate/malate translo...  89.4    2e-17   Mesembryanthemum crystallinum
ref|WP_042634956.1|  2-oxoglutarate translocator                      89.7    2e-17   Bacillus amyloliquefaciens
gb|EPS71302.1|  glutamate/malate translocator                         90.1    2e-17   Genlisea aurea
ref|XP_003593234.1|  2-oxoglutarate/malate translocator               90.1    2e-17   Medicago truncatula
ref|XP_004485598.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  90.1    2e-17   Cicer arietinum [garbanzo]
gb|KGH77071.1|  2-oxoglutarate translocator                           86.3    2e-17   Oenococcus oeni IOEB_9304
gb|KFK28120.1|  hypothetical protein AALP_AA8G475200                  90.1    2e-17   Arabis alpina [alpine rockcress]
gb|KIN32538.1|  hypothetical protein B4069_0846                       89.7    2e-17   Bacillus subtilis
gb|EYU39124.1|  hypothetical protein MIMGU_mgv1a003844mg              90.1    2e-17   Erythranthe guttata [common monkey flower]
ref|WP_041057032.1|  2-oxoglutarate translocator                      89.4    2e-17   Bacillus subtilis
ref|WP_024572847.1|  2-oxoglutarate translocator                      89.4    2e-17   Bacillus
ref|WP_015383080.1|  MULTISPECIES: 2-oxoglutarate/malate transporter  89.4    2e-17   Bacillus
ref|WP_044163592.1|  2-oxoglutarate translocator                      89.4    3e-17   Bacillus halotolerans
ref|WP_003233725.1|  2-oxoglutarate translocator                      89.4    3e-17   Bacillales
ref|WP_024120552.1|  2-oxoglutarate translocator                      89.4    3e-17   Bacillus
ref|WP_040083848.1|  2-oxoglutarate translocator                      89.4    3e-17   Bacillus
ref|WP_010330322.1|  2-oxoglutarate translocator                      89.4    3e-17   Bacillus vallismortis
ref|WP_003239908.1|  hypothetical protein                             89.4    3e-17   Bacillus subtilis
ref|WP_014113016.1|  2-oxoglutarate translocator                      89.4    3e-17   Bacillus
ref|WP_019257759.1|  2-oxoglutarate translocator                      89.4    3e-17   Bacillus
ref|WP_010333359.1|  2-oxoglutarate translocator                      89.4    3e-17   Bacillus mojavensis
ref|WP_039076181.1|  2-oxoglutarate translocator                      89.4    3e-17   Bacillus
ref|WP_041906771.1|  MULTISPECIES: 2-oxoglutarate translocator        89.4    3e-17   Bacillus subtilis
ref|WP_010787924.1|  2-oxoglutarate/malate translocator               89.4    3e-17   Bacillus atrophaeus
ref|WP_019713597.1|  2-oxoglutarate translocator                      89.0    3e-17   Bacillus subtilis
ref|WP_024715768.1|  2-oxoglutarate translocator                      89.0    3e-17   Bacillus tequilensis
ref|WP_013390434.1|  MULTISPECIES: 2-oxoglutarate translocator        89.0    3e-17   Bacillus subtilis group
ref|XP_010484204.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  89.4    3e-17   Camelina sativa [gold-of-pleasure]
ref|WP_003328331.1|  2-oxoglutarate translocator                      89.0    4e-17   Bacillus atrophaeus
ref|XP_010461628.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  89.4    4e-17   Camelina sativa [gold-of-pleasure]
gb|KFM93392.1|  transporter, divalent anion:Na+ symporter family ...  86.7    5e-17   Bacillus paralicheniformis
ref|XP_009381488.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  88.6    5e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009381487.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  89.0    5e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009381486.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  89.0    6e-17   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY43805.1|  BnaA06g23410D                                        88.6    6e-17   Brassica napus [oilseed rape]
ref|WP_025752426.1|  2-oxoglutarate translocator                      88.2    6e-17   Bacillus
ref|XP_002507903.1|  divalent Anion:Na+ symporter family              88.6    6e-17   Micromonas commoda
ref|XP_002323748.1|  putative oxoglutarate-malate-translocase fam...  88.6    6e-17   Populus trichocarpa [western balsam poplar]
ref|XP_010108404.1|  2-oxoglutarate/malate translocator               88.6    7e-17   Morus notabilis
ref|XP_010266911.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  88.6    7e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010444361.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  88.6    7e-17   Camelina sativa [gold-of-pleasure]
ref|XP_003547089.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  88.2    8e-17   Glycine max [soybeans]
ref|XP_006280257.1|  hypothetical protein CARUB_v10026173mg           88.2    1e-16   Capsella rubella
emb|CDX81219.1|  BnaC09g06300D                                        88.2    1e-16   
ref|XP_008346519.1|  PREDICTED: dicarboxylate transporter 2, chlo...  85.5    1e-16   
ref|XP_010272978.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  88.2    1e-16   Nelumbo nucifera [Indian lotus]
ref|XP_006394170.1|  hypothetical protein EUTSA_v10003922mg           87.8    1e-16   Eutrema salsugineum [saltwater cress]
ref|XP_009150500.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  87.8    1e-16   Brassica rapa
ref|WP_014663179.1|  2-oxoglutarate translocator                      86.7    2e-16   Bacillus sp. JS
ref|WP_043977584.1|  2-oxoglutarate translocator                      86.7    2e-16   Bacillus megaterium
ref|WP_028409745.1|  2-oxoglutarate translocator                      86.7    2e-16   Bacillus
ref|WP_034648188.1|  2-oxoglutarate translocator                      86.7    2e-16   Bacillus megaterium
ref|WP_013085539.1|  2-oxoglutarate translocator                      86.7    2e-16   Bacillus megaterium
ref|WP_016765975.1|  2-oxoglutarate translocator                      86.7    2e-16   Bacillus megaterium
gb|KIY93848.1|  hypothetical protein MNEG_14114                       80.9    2e-16   Monoraphidium neglectum
gb|EMT05118.1|  2-oxoglutarate/malate translocator, chloroplastic     84.7    2e-16   
ref|WP_028402895.1|  2-oxoglutarate translocator                      86.7    3e-16   Bacillus panaciterrae
dbj|BAD19756.1|  putative plastidic general dicarboxylate transpo...  86.7    3e-16   Oryza sativa Japonica Group [Japonica rice]
ref|WP_020450525.1|  MULTISPECIES: 2-oxoglutarate/malate transpor...  86.3    3e-16   Bacillus subtilis group
ref|XP_006827969.1|  hypothetical protein AMTR_s00008p00213760        86.7    3e-16   Amborella trichopoda
gb|EAZ09443.1|  hypothetical protein OsI_31717                        86.7    3e-16   Oryza sativa Indica Group [Indian rice]
ref|WP_018664356.1|  hypothetical protein                             82.8    3e-16   
emb|CDP01518.1|  unnamed protein product                              86.3    3e-16   Coffea canephora [robusta coffee]
ref|WP_019392157.1|  MULTISPECIES: 2-oxoglutarate translocator        86.3    3e-16   Bacillus
ref|WP_039073282.1|  MULTISPECIES: 2-oxoglutarate translocator        86.3    3e-16   Bacillales
ref|WP_014457694.1|  2-oxoglutarate translocator                      86.3    4e-16   Bacillus megaterium
ref|WP_043925701.1|  2-oxoglutarate translocator                      85.9    4e-16   Bacillus haynesii
ref|WP_029319476.1|  2-oxoglutarate translocator                      85.9    4e-16   Bacillus
ref|WP_013059892.1|  2-oxoglutarate translocator                      85.9    4e-16   Bacillus
ref|WP_028411930.1|  MULTISPECIES: 2-oxoglutarate translocator        85.9    4e-16   Bacillus
emb|CDX84512.1|  BnaC03g49880D                                        86.3    4e-16   
ref|XP_010942614.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  86.3    5e-16   Elaeis guineensis
ref|WP_003179716.1|  MULTISPECIES: 2-oxoglutarate translocator        85.5    5e-16   Bacillus
ref|WP_011197641.1|  2-oxoglutarate translocator                      85.5    5e-16   Bacillus
emb|CDO97413.1|  unnamed protein product                              85.9    6e-16   Coffea canephora [robusta coffee]
ref|XP_011043103.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  85.9    6e-16   Populus euphratica
ref|WP_036200998.1|  2-oxoglutarate translocator                      85.1    7e-16   
ref|WP_026578902.1|  2-oxoglutarate translocator                      85.1    7e-16   Bacillus sp. SB47
ref|WP_003223030.1|  2-oxoglutarate translocator                      85.1    7e-16   Bacillus subtilis
ref|XP_009401226.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  85.5    8e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007512423.1|  2-oxoglutarate/malate translocator               85.5    8e-16   Bathycoccus prasinos
gb|EEE53308.1|  hypothetical protein OsJ_36283                        85.1    8e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009366350.1|  PREDICTED: dicarboxylate transporter 2, chlo...  85.5    8e-16   Pyrus x bretschneideri [bai li]
ref|WP_000493040.1|  2-oxoglutarate translocator                      84.7    1e-15   Vibrio cholerae
ref|WP_000493041.1|  2-oxoglutarate translocator                      84.7    1e-15   Vibrio cholerae
ref|XP_002445989.1|  hypothetical protein SORBIDRAFT_07g029165        84.7    1e-15   
ref|XP_003574657.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  85.1    1e-15   
ref|WP_000493042.1|  2-oxoglutarate translocator                      84.7    1e-15   Vibrio cholerae
gb|KJB32094.1|  hypothetical protein B456_005G223500                  85.1    1e-15   Gossypium raimondii
ref|XP_008805911.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  85.1    1e-15   
ref|WP_026589611.1|  2-oxoglutarate translocator                      84.3    1e-15   Bacillus
ref|WP_025553155.1|  hypothetical protein                             81.6    1e-15   
gb|AGK55800.1|  divalent anion:Na+ symporter (DASS) family transp...  84.3    1e-15   Bacillus sp. 1NLA3E
gb|ACL52604.1|  unknown                                               84.7    1e-15   Zea mays [maize]
ref|WP_041581256.1|  2-oxoglutarate translocator                      84.3    2e-15   
ref|XP_002445990.1|  hypothetical protein SORBIDRAFT_07g029170        84.7    2e-15   Sorghum bicolor [broomcorn]
gb|KDP40929.1|  hypothetical protein JCGZ_24928                       84.7    2e-15   Jatropha curcas
ref|WP_000493039.1|  2-oxoglutarate translocator                      84.0    2e-15   Vibrio cholerae
ref|XP_004973727.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  84.3    2e-15   Setaria italica
gb|ACN34632.1|  unknown                                               84.3    2e-15   Zea mays [maize]
ref|NP_001104868.1|  plastidic general dicarboxylate transporter      84.3    2e-15   
ref|WP_033930314.1|  2-oxoglutarate translocator                      84.0    2e-15   Vibrio cholerae
ref|WP_018712252.1|  hypothetical protein                             84.0    2e-15   Campylobacter ureolyticus
ref|WP_006555548.1|  divalent anion:Na+ symporter (DASS) family t...  84.0    2e-15   Veillonella seminalis
ref|XP_002460379.1|  hypothetical protein SORBIDRAFT_02g027290        84.3    2e-15   Sorghum bicolor [broomcorn]
ref|XP_003078785.1|  2-oxoglutarate/malate translocator (ISS)         84.3    2e-15   Ostreococcus tauri
ref|XP_006423815.1|  hypothetical protein CICLE_v10028114mg           84.3    2e-15   Citrus clementina [clementine]
ref|XP_004290424.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  84.0    2e-15   Fragaria vesca subsp. vesca
ref|WP_042479679.1|  2-oxoglutarate translocator                      83.6    2e-15   Vibrio diazotrophicus
ref|XP_006492620.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  84.0    2e-15   Citrus sinensis [apfelsine]
ref|WP_041017059.1|  2-oxoglutarate translocator                      83.6    3e-15   Criblamydia sequanensis
dbj|BAD09285.1|  putative glutamate/malate translocator               84.0    3e-15   Oryza sativa Japonica Group [Japonica rice]
emb|CAN78375.1|  hypothetical protein VITISV_000698                   84.0    3e-15   Vitis vinifera
ref|XP_004957073.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  83.6    3e-15   Setaria italica
ref|WP_006637412.1|  sodium/sulfate symporter YflS                    83.2    3e-15   Bacillus sonorensis
ref|XP_010648147.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  83.6    3e-15   Vitis vinifera
ref|WP_029859134.1|  hypothetical protein                             80.1    3e-15   
ref|XP_010520600.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  83.2    4e-15   Tarenaya hassleriana [spider flower]
ref|WP_036800605.1|  2-oxoglutarate translocator                      83.2    4e-15   
dbj|BAJ99052.1|  predicted protein                                    83.2    4e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|WP_042357669.1|  2-oxoglutarate translocator                      83.2    4e-15   Bacillus rubiinfantis
dbj|BAK03702.1|  predicted protein                                    83.2    4e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001773473.1|  predicted protein                                82.8    5e-15   
ref|WP_016645858.1|  divalent anion:Na+ symporter (DASS) family t...  82.8    5e-15   Campylobacter ureolyticus
ref|XP_007199747.1|  hypothetical protein PRUPE_ppa003588mg           83.2    5e-15   Prunus persica
tpg|DAA47747.1|  TPA: hypothetical protein ZEAMMB73_941040            82.8    6e-15   
ref|XP_007042895.1|  Dicarboxylate transport 2.1                      82.8    6e-15   
ref|XP_006660729.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  82.8    7e-15   Oryza brachyantha
dbj|BAJ86680.1|  predicted protein                                    82.8    7e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007511000.1|  2-oxoglutarate/malate translocator               82.8    7e-15   Bathycoccus prasinos
emb|CDY31328.1|  BnaA02g34130D                                        82.8    7e-15   Brassica napus [oilseed rape]
ref|WP_031828591.1|  2-oxoglutarate translocator                      79.3    7e-15   
ref|NP_001104869.1|  plastidic general dicarboxylate transporter      82.4    8e-15   Zea mays [maize]
dbj|BAD06222.1|  plastidic general dicarboxylate transporter          82.4    8e-15   Zea mays [maize]
ref|XP_008237290.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  82.4    8e-15   Prunus mume [ume]
ref|WP_025518842.1|  hypothetical protein                             79.3    9e-15   
ref|XP_002866606.1|  DIT2.2                                           82.4    9e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_010461605.1|  PREDICTED: dicarboxylate transporter 2.2, ch...  82.4    9e-15   Camelina sativa [gold-of-pleasure]
sp|Q8L7Z9.1|DIT2_SPIOL  RecName: Full=Dicarboxylate transporter 2...  82.4    1e-14   Spinacia oleracea
ref|XP_005850013.1|  hypothetical protein CHLNCDRAFT_20518            82.0    1e-14   Chlorella variabilis
ref|XP_003531538.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  82.0    1e-14   Glycine max [soybeans]
gb|KFK28119.1|  hypothetical protein AALP_AA8G475100                  82.0    1e-14   Arabis alpina [alpine rockcress]
dbj|BAK44253.1|  dicarboxylate transporter                            82.0    1e-14   Eggerthella sp. YY7918
ref|NP_201233.1|  dicarboxylate transporter 2.2                       82.0    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|WP_029862441.1|  2-oxoglutarate translocator                      79.0    1e-14   
ref|WP_029810646.1|  2-oxoglutarate translocator                      79.0    1e-14   
ref|WP_041690951.1|  2-oxoglutarate translocator                      81.6    1e-14   
ref|XP_010690536.1|  PREDICTED: dicarboxylate transporter 2, chlo...  81.6    1e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|WP_000493055.1|  2-oxoglutarate translocator                      81.3    1e-14   Vibrio mimicus
ref|XP_003578268.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  81.6    2e-14   Brachypodium distachyon [annual false brome]
ref|XP_009130447.1|  PREDICTED: dicarboxylate transporter 2.2, ch...  81.6    2e-14   Brassica rapa
ref|XP_010484203.1|  PREDICTED: dicarboxylate transporter 2.2, ch...  81.6    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_006394171.1|  hypothetical protein EUTSA_v10003941mg           81.6    2e-14   Eutrema salsugineum [saltwater cress]
ref|XP_008382044.1|  PREDICTED: dicarboxylate transporter 2, chlo...  81.6    2e-14   
ref|WP_036154823.1|  2-oxoglutarate translocator                      80.9    2e-14   Lysinibacillus odysseyi
ref|WP_000493056.1|  MULTISPECIES: 2-oxoglutarate translocator        80.9    2e-14   Vibrio mimicus
ref|WP_010619226.1|  2-oxoglutarate translocator                      80.9    2e-14   Lactobacillus malefermentans
ref|WP_000493054.1|  2-oxoglutarate translocator                      80.9    2e-14   Vibrio mimicus
ref|XP_009380879.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  81.3    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|WP_033543815.1|  2-oxoglutarate translocator                      80.9    2e-14   Planococcus sp. CAU13
ref|WP_025533190.1|  2-oxoglutarate translocator                      80.1    2e-14   Vibrio parahaemolyticus
ref|WP_025543159.1|  2-oxoglutarate translocator                      79.7    3e-14   Vibrio parahaemolyticus
ref|WP_000458310.1|  2-oxoglutarate translocator                      80.5    3e-14   Vibrio metoecus
gb|KDO14330.1|  2-oxoglutarate translocator                           80.5    3e-14   Vibrio metoecus
ref|XP_001422207.1|  DASS family transporter: 2-oxoglutarate/malate   80.9    3e-14   Ostreococcus lucimarinus CCE9901
ref|XP_003064395.1|  divalent Anion:Na+ symporter family              80.9    3e-14   Micromonas pusilla CCMP1545
ref|WP_036802812.1|  2-oxoglutarate translocator                      80.5    3e-14   
ref|WP_029845759.1|  2-oxoglutarate translocator                      79.7    3e-14   Vibrio parahaemolyticus
ref|WP_029863307.1|  2-oxoglutarate translocator                      79.7    3e-14   Vibrio parahaemolyticus
ref|WP_029841903.1|  2-oxoglutarate translocator                      79.3    3e-14   
ref|WP_025519096.1|  2-oxoglutarate translocator                      79.3    4e-14   Vibrio parahaemolyticus
gb|ETP70180.1|  2-oxoglutarate translocator                           80.1    4e-14   Planomicrobium glaciei CHR43
ref|WP_010299206.1|  2-oxoglutarate translocator                      80.1    4e-14   Candidatus Odyssella thessalonicensis
ref|WP_029800088.1|  2-oxoglutarate translocator                      79.3    4e-14   Vibrio parahaemolyticus
ref|XP_003057697.1|  divalent Anion:Na+ symporter family              80.1    4e-14   Micromonas pusilla CCMP1545
ref|XP_005652072.1|  Sodium/sulfate symporter                         80.5    4e-14   Coccomyxa subellipsoidea C-169
ref|WP_014097116.1|  2-oxoglutarate translocator                      79.7    5e-14   Bacillus coagulans
ref|XP_005848004.1|  hypothetical protein CHLNCDRAFT_56149            79.7    5e-14   Chlorella variabilis
ref|WP_031780455.1|  2-oxoglutarate translocator                      79.7    5e-14   
ref|WP_025535261.1|  2-oxoglutarate translocator                      79.7    5e-14   
gb|EMD78885.1|  putative 2-oxoglutarate/malate translocator           79.7    5e-14   
ref|XP_003084104.1|  glutamate/malate translocator (ISS)              80.1    6e-14   
ref|XP_002500710.1|  divalent Anion:Na+ symporter family              79.3    6e-14   
ref|WP_029815021.1|  2-oxoglutarate translocator                      79.3    6e-14   
ref|WP_000493045.1|  2-oxoglutarate translocator                      79.3    7e-14   
ref|WP_020835222.1|  2-oxoglutarate translocator                      79.3    7e-14   
ref|WP_025547571.1|  2-oxoglutarate translocator                      79.3    7e-14   
ref|XP_006280266.1|  hypothetical protein CARUB_v10026187mg           79.7    7e-14   
ref|WP_043037281.1|  2-oxoglutarate translocator                      79.3    7e-14   
ref|WP_002471714.1|  2-oxoglutarate translocator                      79.3    7e-14   
ref|WP_042740292.1|  2-oxoglutarate translocator                      79.3    7e-14   
ref|WP_025630129.1|  2-oxoglutarate translocator                      79.3    7e-14   
emb|CEG00699.1|  Sodium/sulphate symporter                            79.7    7e-14   
ref|XP_002988946.1|  hypothetical protein SELMODRAFT_129026           79.7    8e-14   
ref|WP_010372129.1|  2-oxoglutarate translocator                      79.3    8e-14   
ref|XP_010520855.1|  PREDICTED: dicarboxylate transporter 2.2, ch...  79.7    8e-14   
ref|WP_031413129.1|  2-oxoglutarate translocator                      79.3    8e-14   
ref|WP_025636275.1|  2-oxoglutarate translocator                      79.3    8e-14   
ref|XP_002994720.1|  hypothetical protein SELMODRAFT_237013           79.3    8e-14   
ref|WP_042771187.1|  2-oxoglutarate translocator                      79.3    8e-14   
ref|WP_031381798.1|  2-oxoglutarate translocator                      79.3    8e-14   
ref|WP_037441920.1|  2-oxoglutarate translocator                      79.0    8e-14   
ref|WP_025604554.1|  2-oxoglutarate translocator                      79.0    8e-14   
ref|XP_002974927.1|  hypothetical protein SELMODRAFT_267817           79.3    8e-14   
ref|WP_029805577.1|  2-oxoglutarate translocator                      79.0    8e-14   
emb|CDY46791.1|  BnaC02g42990D                                        79.7    9e-14   
ref|WP_005498683.1|  2-oxoglutarate translocator                      79.0    9e-14   
gb|KHF07152.1|  2-oxoglutarate translocator                           79.0    9e-14   
ref|WP_025795900.1|  2-oxoglutarate translocator                      79.0    9e-14   
ref|WP_025787668.1|  2-oxoglutarate translocator                      79.0    9e-14   
ref|WP_025504977.1|  2-oxoglutarate translocator                      79.0    9e-14   
ref|WP_031778702.1|  2-oxoglutarate translocator                      79.0    9e-14   
ref|WP_017447632.1|  2-oxoglutarate translocator                      79.0    9e-14   
ref|WP_024701309.1|  2-oxoglutarate translocator                      79.0    9e-14   
ref|WP_031846587.1|  2-oxoglutarate translocator                      79.0    9e-14   
gb|KIY93412.1|  2-oxoglutarate/malate translocator Flags: Precursor   76.6    9e-14   
ref|WP_025611302.1|  2-oxoglutarate translocator                      79.0    9e-14   
ref|WP_025626170.1|  2-oxoglutarate translocator                      79.0    9e-14   
ref|WP_039069533.1|  2-oxoglutarate translocator                      79.0    1e-13   
ref|XP_011401658.1|  Dicarboxylate transporter 1, chloroplastic       79.0    1e-13   
ref|WP_021797818.1|  transporter, DASS family                         79.0    1e-13   
ref|WP_043151211.1|  permease                                         78.6    1e-13   
ref|WP_029804741.1|  2-oxoglutarate translocator                      78.6    1e-13   
ref|WP_025576307.1|  2-oxoglutarate translocator                      78.6    1e-13   
ref|WP_029825684.1|  2-oxoglutarate translocator                      78.6    1e-13   
ref|WP_005454276.1|  2-oxoglutarate translocator                      78.6    1e-13   
gb|AGB12076.1|  putative translocator                                 78.6    1e-13   
ref|WP_008510084.1|  2-oxoglutarate translocator                      78.6    1e-13   
gb|EFO36829.1|  2-oxoglutarate/malate translocator                    78.6    1e-13   
ref|WP_025554538.1|  2-oxoglutarate translocator                      78.6    1e-13   
ref|WP_025624265.1|  2-oxoglutarate translocator                      78.6    1e-13   
ref|WP_033908116.1|  2-oxoglutarate translocator                      78.6    1e-13   
ref|WP_021448447.1|  na+ symporter family protein                     78.6    1e-13   
gb|ETJ00105.1|  hypothetical protein Q611_LSC00146G0002               74.7    2e-13   
ref|WP_026684112.1|  2-oxoglutarate translocator                      78.6    2e-13   
ref|WP_023385002.1|  divalent anion:Na+ symporter (DASS) family p...  78.2    2e-13   
ref|WP_031841362.1|  2-oxoglutarate translocator                      78.2    2e-13   
ref|WP_025601890.1|  hypothetical protein                             73.2    2e-13   
ref|WP_031812541.1|  2-oxoglutarate translocator                      78.2    2e-13   
gb|EPS58215.1|  hypothetical protein M569_16600                       75.1    2e-13   
ref|WP_038205893.1|  2-oxoglutarate translocator                      77.8    2e-13   
ref|WP_029285914.1|  2-oxoglutarate translocator                      77.8    2e-13   
ref|WP_014234103.1|  2-oxoglutarate translocator                      77.8    3e-13   
ref|WP_020334774.1|  2-oxoglutarate translocator                      77.8    3e-13   
gb|KJB79625.1|  hypothetical protein B456_013G059600                  77.0    3e-13   
ref|WP_004096030.1|  2-oxoglutarate translocator                      77.4    3e-13   
ref|WP_029861249.1|  2-oxoglutarate translocator                      77.4    3e-13   
ref|WP_043498342.1|  2-oxoglutarate translocator                      77.4    3e-13   
gb|KED43475.1|  2-oxoglutarate translocator                           77.4    3e-13   
ref|WP_032822294.1|  2-oxoglutarate translocator                      77.4    3e-13   
ref|WP_025626594.1|  2-oxoglutarate translocator                      77.0    4e-13   
ref|WP_027275760.1|  2-oxoglutarate translocator                      77.0    4e-13   
ref|XP_008462877.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  77.4    5e-13   
ref|WP_025589928.1|  2-oxoglutarate translocator                      76.6    5e-13   
ref|XP_004154735.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  76.6    6e-13   
ref|WP_008918345.1|  2-oxoglutarate translocator                      76.6    6e-13   
ref|XP_004137158.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  77.0    6e-13   
ref|WP_043042510.1|  2-oxoglutarate translocator                      76.6    6e-13   
gb|KJB79626.1|  hypothetical protein B456_013G059600                  76.6    6e-13   
ref|WP_029378255.1|  2-oxoglutarate translocator                      76.6    7e-13   
gb|KHG19166.1|  2-oxoglutarate/malate translocator, chloroplastic     76.6    7e-13   
gb|EHY93411.1|  putative di- and tricarboxylate transporter           76.3    7e-13   
ref|XP_001696590.1|  2-oxoglutarate/malate translocator               76.6    7e-13   
ref|WP_025527212.1|  2-oxoglutarate translocator                      76.3    7e-13   
ref|WP_017867632.1|  2-oxoglutarate translocator                      76.3    7e-13   
ref|WP_038174908.1|  2-oxoglutarate translocator                      76.3    7e-13   
gb|KJB79624.1|  hypothetical protein B456_013G059600                  76.6    8e-13   
ref|WP_039471791.1|  2-oxoglutarate translocator                      76.3    8e-13   
ref|WP_027378953.1|  2-oxoglutarate translocator                      76.3    8e-13   
ref|WP_029095534.1|  2-oxoglutarate translocator                      76.3    8e-13   
ref|WP_042238686.1|  2-oxoglutarate translocator                      76.3    9e-13   
ref|WP_034989265.1|  2-oxoglutarate translocator                      75.9    1e-12   
dbj|GAJ26897.1|  2-oxoglutarate/malate translocator                   75.9    1e-12   
ref|WP_026073362.1|  2-oxoglutarate translocator                      75.9    1e-12   
ref|WP_039476182.1|  2-oxoglutarate translocator                      75.9    1e-12   
ref|WP_034875512.1|  2-oxoglutarate translocator                      75.9    1e-12   
dbj|BAK95706.1|  putative citrate transporter                         74.7    1e-12   
ref|WP_019072567.1|  hypothetical protein                             75.9    1e-12   
gb|AII14882.1|  DASS family sodium/dicarboxylate symporter            75.5    1e-12   
ref|WP_038455621.1|  2-oxoglutarate translocator                      75.5    1e-12   
ref|WP_043886829.1|  2-oxoglutarate translocator                      75.5    1e-12   
ref|WP_038139950.1|  2-oxoglutarate translocator                      75.5    1e-12   
ref|WP_038189804.1|  MULTISPECIES: 2-oxoglutarate translocator        75.5    1e-12   
gb|EQC65418.1|  2-oxoglutarate/malate translocator                    73.2    1e-12   
ref|WP_028982962.1|  2-oxoglutarate translocator                      75.5    1e-12   
ref|WP_034988937.1|  2-oxoglutarate translocator                      75.5    2e-12   
ref|WP_028977160.1|  2-oxoglutarate translocator                      75.5    2e-12   
ref|WP_010026829.1|  2-oxoglutarate translocator                      75.5    2e-12   
ref|WP_024104070.1|  MULTISPECIES: 2-oxoglutarate translocator        75.5    2e-12   
ref|WP_013957038.1|  2-oxoglutarate translocator                      75.5    2e-12   
ref|WP_039367064.1|  2-oxoglutarate translocator                      75.5    2e-12   
ref|WP_011462350.1|  2-oxoglutarate translocator                      75.1    2e-12   
ref|WP_042858137.1|  2-oxoglutarate translocator                      75.1    2e-12   
ref|WP_035825773.1|  2-oxoglutarate translocator                      75.1    2e-12   
ref|WP_005203922.1|  2-oxoglutarate translocator                      75.5    2e-12   
ref|WP_022635390.1|  2-oxoglutarate/malate transporter                75.1    2e-12   
ref|WP_011672928.1|  2-oxoglutarate translocator                      75.1    2e-12   
ref|WP_035879535.1|  2-oxoglutarate translocator                      75.1    2e-12   
ref|WP_034674881.1|  2-oxoglutarate translocator                      75.1    2e-12   
ref|WP_017531615.1|  MULTISPECIES: 2-oxoglutarate translocator        75.1    2e-12   
ref|WP_018424839.1|  2-oxoglutarate translocator                      75.1    2e-12   
ref|WP_040543388.1|  2-oxoglutarate translocator                      75.1    2e-12   
ref|WP_018137065.1|  hypothetical protein                             74.7    2e-12   
ref|WP_038917403.1|  2-oxoglutarate translocator                      74.7    2e-12   
ref|WP_033111496.1|  2-oxoglutarate translocator                      74.7    2e-12   
ref|WP_038921269.1|  2-oxoglutarate translocator                      74.7    2e-12   
gb|EIW19355.1|  anion transporter                                     74.7    2e-12   
gb|KIC74057.1|  putative malate transporter YflS                      74.7    2e-12   
ref|WP_039384971.1|  2-oxoglutarate translocator                      74.7    2e-12   
gb|ADM96308.1|  2-oxoglutarate/malate translocator                    74.7    3e-12   
gb|EIW32183.1|  anion transporter                                     74.7    3e-12   
ref|WP_034618246.1|  2-oxoglutarate translocator                      74.7    3e-12   
ref|WP_032092298.1|  2-oxoglutarate translocator                      74.7    3e-12   
ref|WP_029292431.1|  2-oxoglutarate translocator                      74.7    3e-12   
ref|WP_031502137.1|  2-oxoglutarate translocator                      74.7    3e-12   
ref|WP_022538560.1|  2-oxoglutarate translocator                      74.7    3e-12   
gb|EEY72062.1|  putative 2-oxoglutarate/malate translocator           74.3    3e-12   
ref|WP_018433575.1|  2-oxoglutarate translocator                      74.7    3e-12   
ref|WP_040528959.1|  2-oxoglutarate translocator                      74.3    3e-12   
ref|WP_037741046.1|  2-oxoglutarate translocator                      74.3    3e-12   
ref|WP_004902093.1|  2-oxoglutarate translocator                      74.3    3e-12   
ref|WP_012305442.1|  2-oxoglutarate translocator                      74.3    3e-12   
ref|WP_036486051.1|  2-oxoglutarate translocator                      74.3    3e-12   
ref|XP_004984114.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  74.7    3e-12   
ref|WP_033934696.1|  2-oxoglutarate translocator                      74.3    3e-12   
ref|WP_006500685.1|  2-oxoglutarate translocator                      74.3    3e-12   
ref|XP_001781877.1|  predicted protein                                74.3    4e-12   
ref|WP_036376936.1|  2-oxoglutarate translocator                      74.3    4e-12   
dbj|GAL52200.1|  putative transporter                                 73.2    4e-12   
ref|WP_029047214.1|  2-oxoglutarate translocator                      74.3    4e-12   
ref|WP_013091337.1|  2-oxoglutarate translocator                      74.3    4e-12   
gb|EED27286.1|  di- and tricarboxylate transporter                    73.9    4e-12   
ref|WP_017723110.1|  2-oxoglutarate translocator                      73.9    4e-12   
ref|WP_021772120.1|  putative 2-oxoglutarate/malate translocator      73.9    4e-12   
gb|AHJ13832.1|  2-oxoglutarate/malate antiporter                      73.9    5e-12   
gb|KEP87143.1|  CitT protein                                          73.9    5e-12   
ref|WP_014425790.1|  2-oxoglutarate translocator                      73.9    5e-12   
ref|WP_010495522.1|  2-oxoglutarate translocator                      73.6    6e-12   
ref|WP_025345674.1|  2-oxoglutarate translocator                      73.6    6e-12   
ref|WP_005386905.1|  2-oxoglutarate translocator                      73.6    6e-12   
ref|WP_003691116.1|  2-oxoglutarate translocator                      71.6    6e-12   
ref|WP_038664307.1|  MULTISPECIES: 2-oxoglutarate translocator        73.6    6e-12   
ref|WP_026743658.1|  2-oxoglutarate translocator                      73.6    6e-12   
emb|CEG93672.1|  Anion transporter                                    73.6    6e-12   
ref|WP_028790814.1|  2-oxoglutarate translocator                      73.6    6e-12   
ref|WP_010078392.1|  cation transport protein                         71.6    6e-12   
dbj|BAP32937.1|  DASS family divalent anion:sodium (Na+) symporter    73.6    6e-12   
ref|WP_038464208.1|  2-oxoglutarate translocator                      73.6    7e-12   
dbj|GAF36487.1|  2-oxoglutarate/malate translocator                   71.2    7e-12   
ref|WP_016475465.1|  divalent anion:Na+ symporter (DASS) family t...  73.6    7e-12   
ref|WP_026707155.1|  2-oxoglutarate translocator                      73.6    7e-12   
gb|KFF75424.1|  2-oxoglutarate translocator                           73.6    7e-12   
ref|WP_009660890.1|  2-oxoglutarate translocator                      73.6    7e-12   
ref|WP_011960208.1|  C4-dicarboxylate ABC transporter                 73.6    8e-12   
ref|WP_019878601.1|  hypothetical protein                             73.2    8e-12   
gb|EME76704.1|  anion transporter                                     73.6    8e-12   
ref|WP_034699340.1|  2-oxoglutarate translocator                      73.2    8e-12   
gb|AAM89395.1|  glutamate/malate translocator                         73.6    8e-12   
ref|WP_015004188.1|  2-oxoglutarate translocator                      73.2    8e-12   
ref|XP_001753146.1|  predicted protein                                73.2    8e-12   
ref|WP_002977415.1|  2-oxoglutarate translocator                      73.2    8e-12   
ref|WP_038602287.1|  2-oxoglutarate translocator                      73.2    9e-12   
ref|WP_037537679.1|  2-oxoglutarate translocator                      73.2    9e-12   
ref|WP_011302369.1|  2-oxoglutarate translocator                      73.2    9e-12   
ref|WP_009372098.1|  2-oxoglutarate translocator                      73.2    9e-12   
ref|WP_041079305.1|  2-oxoglutarate translocator                      73.2    9e-12   
gb|EAX47424.1|  anion transporter                                     72.8    1e-11   
ref|WP_040347794.1|  2-oxoglutarate translocator                      72.8    1e-11   
ref|WP_034326331.1|  2-oxoglutarate translocator                      72.8    1e-11   
dbj|BAL54892.1|  divalent anion:Na+ symporter, DASS family            72.8    1e-11   
ref|WP_037354028.1|  2-oxoglutarate translocator                      72.8    1e-11   
ref|WP_001195209.1|  hypothetical protein                             72.8    1e-11   
ref|WP_026759724.1|  2-oxoglutarate translocator                      72.8    1e-11   
ref|WP_025238229.1|  2-oxoglutarate translocator                      72.8    1e-11   
ref|WP_004692973.1|  2-oxoglutarate translocator                      72.8    1e-11   
ref|WP_040683231.1|  2-oxoglutarate translocator                      72.8    1e-11   
ref|WP_004697146.1|  2-oxoglutarate translocator                      72.8    1e-11   
gb|EMS48908.1|  2-oxoglutarate/malate translocator, chloroplastic     70.5    1e-11   
ref|WP_042722362.1|  2-oxoglutarate translocator                      72.8    1e-11   
ref|WP_012864229.1|  2-oxoglutarate translocator                      72.8    1e-11   
ref|WP_008600725.1|  MULTISPECIES: 2-oxoglutarate translocator        72.8    1e-11   
ref|WP_033568945.1|  2-oxoglutarate translocator                      72.4    1e-11   
gb|AEC01024.1|  anion transporter                                     72.8    1e-11   
ref|WP_038114652.1|  2-oxoglutarate translocator                      72.4    1e-11   
ref|WP_034833506.1|  2-oxoglutarate translocator                      72.4    1e-11   
gb|EEX76061.1|  transporter, DASS family                              72.8    1e-11   
gb|EEX68501.1|  transporter, DASS family                              72.4    1e-11   
gb|KEQ19593.1|  2-oxoglutarate translocator                           72.4    1e-11   
ref|WP_007236687.1|  2-oxoglutarate translocator                      72.4    2e-11   
ref|WP_014125753.1|  2-oxoglutarate translocator                      72.4    2e-11   
ref|WP_005842520.1|  2-oxoglutarate translocator                      72.4    2e-11   
ref|WP_031265609.1|  hypothetical protein                             68.6    2e-11   
ref|WP_040636008.1|  2-oxoglutarate translocator                      72.4    2e-11   
ref|WP_026258083.1|  2-oxoglutarate translocator                      72.4    2e-11   
ref|WP_022746998.1|  putative malate transporter YflS                 72.4    2e-11   
ref|WP_026766662.1|  2-oxoglutarate translocator                      72.4    2e-11   
ref|WP_028129304.1|  2-oxoglutarate translocator                      72.0    2e-11   
ref|WP_027374530.1|  MULTISPECIES: 2-oxoglutarate translocator        72.0    2e-11   
ref|WP_035166249.1|  2-oxoglutarate translocator                      72.0    2e-11   



>ref|XP_009609674.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Nicotiana 
tomentosiformis]
Length=561

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASIATG+ILWF+P P GV++NAWQLL+IFLATIVGIITQPLPLGAVALMGLGACV
Sbjct  96   IKPLIASIATGIILWFIPAPAGVTKNAWQLLAIFLATIVGIITQPLPLGAVALMGLGACV  155

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  156  LTKTLTFAAAFSAFGDPIPWLIALAF  181



>ref|XP_007015047.1| Dicarboxylate transporter 1 isoform 3 [Theobroma cacao]
 gb|EOY32666.1| Dicarboxylate transporter 1 isoform 3 [Theobroma cacao]
Length=377

 Score =   156 bits (395),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGVILWFVP P GVSRNAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  94   LKPLMASIATGVILWFVPVPSGVSRNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  153

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTF+AAFSAFGDPIPWLIALAF
Sbjct  154  LTKTLTFSAAFSAFGDPIPWLIALAF  179



>ref|XP_004250945.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Solanum 
lycopersicum]
Length=555

 Score =   159 bits (401),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGVILWF+P P GV++NAWQLL+IFLATIVGIITQPLPLGAVALMGLGACV
Sbjct  90   MKPLIASIATGVILWFIPAPAGVTKNAWQLLAIFLATIVGIITQPLPLGAVALMGLGACV  149

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  150  LTKTLTFAAAFSAFGDPIPWLIALAF  175



>ref|XP_006361749.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Solanum 
tuberosum]
Length=554

 Score =   159 bits (401),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGVILWF+P P GV++NAWQLL+IFLATIVGIITQPLPLGAVALMGLGACV
Sbjct  89   MKPLIASIATGVILWFIPAPAGVTKNAWQLLAIFLATIVGIITQPLPLGAVALMGLGACV  148

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  149  LTKTLTFAAAFSAFGDPIPWLIALAF  174



>ref|XP_010102341.1| 2-oxoglutarate/malate translocator [Morus notabilis]
 gb|EXB93302.1| 2-oxoglutarate/malate translocator [Morus notabilis]
Length=565

 Score =   159 bits (401),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASIATG+ILWFVP P GVSRNAWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  100  IKPLLASIATGIILWFVPMPSGVSRNAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  159

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTF+AAFSAFGDPIPWLIALAF
Sbjct  160  LTKTLTFSAAFSAFGDPIPWLIALAF  185



>ref|XP_011080429.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Sesamum 
indicum]
Length=482

 Score =   157 bits (397),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPLLASIATGVI+WF+P P GVSR AWQLLSIFLATIVGIITQPLPLGAVALMGLGACV
Sbjct  17   MKPLLASIATGVIIWFLPAPDGVSRIAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  76

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  77   LTKTLTFAAAFSAFGDPIPWLIALAF  102



>ref|XP_009777235.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Nicotiana 
sylvestris]
Length=561

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASIATG+ILW +P P GV++NAWQLL+IFLATIVGIITQPLPLGAVALMGLGACV
Sbjct  96   IKPLIASIATGIILWLIPAPAGVTKNAWQLLAIFLATIVGIITQPLPLGAVALMGLGACV  155

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  156  LTKTLTFAAAFSAFGDPIPWLIALAF  181



>gb|EYU31365.1| hypothetical protein MIMGU_mgv1a003738mg [Erythranthe guttata]
Length=567

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASIA GVILWF+P P GVSR AWQLLSIFLATIVGIITQPLPLGAVALMGLGACV
Sbjct  102  IKPLVASIAVGVILWFIPAPNGVSRIAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  161

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  162  LTKTLTFAAAFSAFGDPIPWLIALAF  187



>ref|XP_002313335.2| hypothetical protein POPTR_0009s05850g, partial [Populus trichocarpa]
 gb|EEE87290.2| hypothetical protein POPTR_0009s05850g, partial [Populus trichocarpa]
Length=300

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPLLASIATGVILWFVP P GV++ AWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  28   MKPLLASIATGVILWFVPVPAGVTKPAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  87

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTF+AAFSAFGDPIPWLIALAF
Sbjct  88   LTKTLTFSAAFSAFGDPIPWLIALAF  113



>gb|EYU46260.1| hypothetical protein MIMGU_mgv1a003794mg [Erythranthe guttata]
Length=564

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGVILWF+P P GVSR AWQLLSIFLATIVGIITQPLPLGAVALMGLGACV
Sbjct  99   MKPLIASIATGVILWFLPAPEGVSRVAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  158

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  159  LTKTLTFAAAFSAFGDPIPWLIALAF  184



>ref|XP_002282809.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Vitis 
vinifera]
Length=559

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL A+IATGVILWFVPQP GVSRNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  94   LKPLAAAIATGVILWFVPQPAGVSRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  153

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  154  LTKTLTFAAAFSAFGDPIPWLIALAF  179



>gb|EPS73843.1| hypothetical protein M569_00906, partial [Genlisea aurea]
Length=448

 Score =   154 bits (390),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASIATGVI+WF+P P GVSRNAWQLLSIFLATIVGII+QPLPLGAVAL+GLGA V
Sbjct  7    IKPLIASIATGVIIWFIPAPQGVSRNAWQLLSIFLATIVGIISQPLPLGAVALLGLGASV  66

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTF+AAFSAFGDPIPWLIALAF
Sbjct  67   LTKTLTFSAAFSAFGDPIPWLIALAF  92



>ref|XP_004162089.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Cucumis 
sativus]
Length=572

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASIATG+ILWFVP P GVSRNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  107  IKPLIASIATGIILWFVPVPSGVSRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  166

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTF+AAFSAFGDPIPWLIALAF
Sbjct  167  LTKTLTFSAAFSAFGDPIPWLIALAF  192



>ref|NP_001119216.1| dicarboxylate transporter 1 [Arabidopsis thaliana]
 gb|AED91823.1| dicarboxylate transporter 1 [Arabidopsis thaliana]
Length=556

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASIATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  92   IKPLLASIATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  151

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  152  LTKTLTFAAAFSAFGDPIPWLIALAF  177



>ref|XP_004142115.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Cucumis 
sativus]
 gb|KGN54177.1| 2-oxoglutarate/malate translocator [Cucumis sativus]
Length=572

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASIATG+ILWFVP P GVSRNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  107  IKPLIASIATGIILWFVPVPSGVSRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  166

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTF+AAFSAFGDPIPWLIALAF
Sbjct  167  LTKTLTFSAAFSAFGDPIPWLIALAF  192



>ref|XP_007015045.1| Dicarboxylate transporter 1 isoform 1 [Theobroma cacao]
 gb|EOY32664.1| Dicarboxylate transporter 1 isoform 1 [Theobroma cacao]
Length=559

 Score =   155 bits (393),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGVILWFVP P GVSRNAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  94   LKPLMASIATGVILWFVPVPSGVSRNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  153

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTF+AAFSAFGDPIPWLIALAF
Sbjct  154  LTKTLTFSAAFSAFGDPIPWLIALAF  179



>ref|NP_568283.2| dicarboxylate transporter 1 [Arabidopsis thaliana]
 sp|Q9LXV3.1|DIT1_ARATH RecName: Full=Dicarboxylate transporter 1, chloroplastic; AltName: 
Full=2-oxoglutarate/malate translocator 1; Short=AtpOMT1; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB88250.1| 2-oxoglutarate/malate translocator precursor-like protein [Arabidopsis 
thaliana]
 gb|AED91822.1| dicarboxylate transporter 1 [Arabidopsis thaliana]
Length=557

 Score =   155 bits (393),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASIATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  92   IKPLLASIATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  151

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  152  LTKTLTFAAAFSAFGDPIPWLIALAF  177



>ref|XP_007211882.1| hypothetical protein PRUPE_ppa003549mg [Prunus persica]
 gb|EMJ13081.1| hypothetical protein PRUPE_ppa003549mg [Prunus persica]
Length=566

 Score =   155 bits (393),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPLLASIATGVILWFVP P GV++NAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  101  MKPLLASIATGVILWFVPTPAGVTKNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  160

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  161  LTKTLTFAAAFSAFGDPIPWLIALAF  186



>ref|XP_008227299.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Prunus 
mume]
Length=566

 Score =   155 bits (392),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPLLASIATGVILWFVP P GV++NAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  101  MKPLLASIATGVILWFVPTPAGVTKNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  160

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  161  LTKTLTFAAAFSAFGDPIPWLIALAF  186



>ref|XP_010031793.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Eucalyptus 
grandis]
 gb|KCW51183.1| hypothetical protein EUGRSUZ_J00769 [Eucalyptus grandis]
Length=571

 Score =   155 bits (392),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            + PLLASIATGVILWFVP P GVSRNAWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  106  MGPLLASIATGVILWFVPVPAGVSRNAWQLLAIFLATIVGIITQPLPLGAVALMGLGAAV  165

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  166  LTKTLTFAAAFSAFGDPIPWLIALAF  191



>ref|XP_008449718.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Cucumis 
melo]
Length=573

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASIATG+ILWFVP P GVSRNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  108  IKPLIASIATGIILWFVPVPSGVSRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  167

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTF+AAFSAFGDPIPWLIALAF
Sbjct  168  LTKTLTFSAAFSAFGDPIPWLIALAF  193



>ref|XP_009375074.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=623

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGVILWFVP P GV++NAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  158  MKPLIASIATGVILWFVPTPAGVTKNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  217

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTF AAFSAFGDPIPWLIALAF
Sbjct  218  LTKTLTFGAAFSAFGDPIPWLIALAF  243



>gb|KHG21220.1| 2-oxoglutarate/malate translocator, chloroplastic [Gossypium 
arboreum]
Length=559

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGVILWF+P P GVSRNAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  94   LKPLIASIATGVILWFLPVPSGVSRNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  153

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTF+AAFSAFGDPIPWLIALAF
Sbjct  154  LTKTLTFSAAFSAFGDPIPWLIALAF  179



>ref|XP_010536081.1| PREDICTED: dicarboxylate transporter 1, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=560

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASIATGVILWFVP P GVSR+AWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  95   IKPLIASIATGVILWFVPVPDGVSRSAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  154

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTF+AAFSAFGDPIPWLIALAF
Sbjct  155  LTKTLTFSAAFSAFGDPIPWLIALAF  180



>ref|XP_010257247.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Nelumbo 
nucifera]
Length=571

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGVILWF+P P GV++NAWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  106  LKPLMASIATGVILWFLPVPSGVTKNAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  165

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  166  LTKTLTFAAAFSAFGDPIPWLIALAF  191



>gb|KJB35803.1| hypothetical protein B456_006G129000 [Gossypium raimondii]
Length=559

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGVILWF+P P GVSRNAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  94   LKPLIASIATGVILWFLPVPSGVSRNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  153

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTF+AAFSAFGDPIPWLIALAF
Sbjct  154  LTKTLTFSAAFSAFGDPIPWLIALAF  179



>ref|XP_006399771.1| hypothetical protein EUTSA_v10013154mg [Eutrema salsugineum]
 dbj|BAJ33726.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41224.1| hypothetical protein EUTSA_v10013154mg [Eutrema salsugineum]
Length=555

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASIATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  90   IKPLLASIATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  149

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  150  LTKTLTFAAAFSAFGDPIPWLIALAF  175



>ref|XP_004291789.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=568

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGVILWFVP P GV++NAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  103  MKPLIASIATGVILWFVPTPAGVTKNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  162

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  163  LTKTLTFAAAFSAFGDPIPWLIALAF  188



>ref|XP_008363620.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Malus 
domestica]
Length=569

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGVILWFVP P GV++NAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  104  MKPLIASIATGVILWFVPTPAGVTKNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  163

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTF AAFSAFGDPIPWLIALAF
Sbjct  164  LTKTLTFGAAFSAFGDPIPWLIALAF  189



>ref|XP_009343722.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009343726.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=569

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGVILWFVP P GV++NAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  104  MKPLIASIATGVILWFVPTPAGVTKNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  163

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTF AAFSAFGDPIPWLIALAF
Sbjct  164  LTKTLTFGAAFSAFGDPIPWLIALAF  189



>gb|KDP22090.1| hypothetical protein JCGZ_25921 [Jatropha curcas]
Length=571

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPLLASIATGVILWFVP P GVSR AWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  106  MKPLLASIATGVILWFVPVPSGVSRPAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  165

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTF+AAFSAFGDPIPWLIALAF
Sbjct  166  LTKTLTFSAAFSAFGDPIPWLIALAF  191



>sp|Q41364.1|DIT1_SPIOL RecName: Full=Dicarboxylate transporter 1, chloroplastic; Short=SODIT1; 
AltName: Full=2-oxoglutarate/malate translocator; 
Flags: Precursor [Spinacia oleracea]
 gb|AAA68148.1| 2-oxoglutarate/malate translocator [Spinacia oleracea]
Length=569

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASI TGVI+WF+P P GVSRNAWQLL+IFL+TIVGIITQPLPLGAVALMGLGA V
Sbjct  104  IKPLLASILTGVIIWFIPTPEGVSRNAWQLLAIFLSTIVGIITQPLPLGAVALMGLGASV  163

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTF+AAFSAFGDPIPWLIALAF
Sbjct  164  LTKTLTFSAAFSAFGDPIPWLIALAF  189



>ref|XP_009411283.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=562

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL ASIATGVILW VP P GVSRNAWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  97   LKPLAASIATGVILWLVPAPSGVSRNAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  156

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  157  LTKTLTFAAAFSAFGDPIPWLIALAF  182



>gb|KFK25523.1| hypothetical protein AALP_AA8G126300 [Arabis alpina]
Length=556

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASIATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  91   IKPLIASIATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  150

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  151  LTKTLTFAAAFSAFGDPIPWLIALAF  176



>ref|XP_010419844.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Camelina 
sativa]
Length=559

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+AS+ATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  94   IKPLIASLATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGATV  153

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  154  LTKTLTFAAAFSAFGDPIPWLIALAF  179



>ref|XP_010453335.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=559

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+AS+ATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  94   IKPLIASLATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGATV  153

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  154  LTKTLTFAAAFSAFGDPIPWLIALAF  179



>ref|XP_006287403.1| hypothetical protein CARUB_v10000609mg [Capsella rubella]
 gb|EOA20301.1| hypothetical protein CARUB_v10000609mg [Capsella rubella]
Length=557

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASIATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  92   IKPLIASIATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  151

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTF AAFSAFGDPIPWLIALAF
Sbjct  152  LTKTLTFTAAFSAFGDPIPWLIALAF  177



>ref|XP_010453336.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=560

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+AS+ATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  94   IKPLIASLATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGATV  153

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  154  LTKTLTFAAAFSAFGDPIPWLIALAF  179



>ref|XP_002873582.1| hypothetical protein ARALYDRAFT_909232 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49841.1| hypothetical protein ARALYDRAFT_909232 [Arabidopsis lyrata subsp. 
lyrata]
Length=554

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASIATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  89   IKPLIASIATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  148

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTF AAFSAFGDPIPWLIALAF
Sbjct  149  LTKTLTFTAAFSAFGDPIPWLIALAF  174



>ref|XP_010492022.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Camelina 
sativa]
Length=557

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+AS+ATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  92   IKPLIASLATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGATV  151

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  152  LTKTLTFAAAFSAFGDPIPWLIALAF  177



>ref|XP_009394734.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=561

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL ASIATGV+LWFVP P GVSRNAWQLL+IFLATI+GIITQPLPLGAVALMGLGA V
Sbjct  96   LKPLAASIATGVLLWFVPAPSGVSRNAWQLLAIFLATIIGIITQPLPLGAVALMGLGASV  155

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTL FAAAFSAFGDPIPWLIALAF
Sbjct  156  LTKTLPFAAAFSAFGDPIPWLIALAF  181



>dbj|BAK00367.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=559

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPLLASIATGVI+WF+P P GV+RNAWQLL++FLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  94   LKPLLASIATGVIIWFIPAPAGVARNAWQLLAVFLATIVGIITQPLPLGAVALLGLGAAV  153

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LT+TLTFAAAFSAFGDPIPWLIALAF
Sbjct  154  LTRTLTFAAAFSAFGDPIPWLIALAF  179



>ref|XP_008344435.1| PREDICTED: LOW QUALITY PROTEIN: dicarboxylate transporter 1, 
chloroplastic-like [Malus domestica]
Length=447

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            + PL+ASIATG+ILWF P P GV++NAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  102  MTPLIASIATGLILWFFPTPAGVTKNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  161

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  162  LTKTLTFAAAFSAFGDPIPWLIALAF  187



>emb|CDY53969.1| BnaA10g30010D [Brassica napus]
Length=552

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASIATGVI+WF+P P GV+R+AWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  87   IKPLLASIATGVIIWFLPVPEGVTRSAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  146

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  147  LTKTLTFAAAFSAFGDPIPWLIALAF  172



>ref|XP_009348953.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=563

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/86 (88%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            + PL+ASIATG+ILWFVP P GV++NAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  98   MTPLIASIATGLILWFVPTPAGVTKNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  157

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  158  LTKTLTFAAAFSAFGDPIPWLIALAF  183



>ref|XP_009121830.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Brassica 
rapa]
Length=548

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASIATGVI+WF+P P GV+R+AWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  83   IKPLLASIATGVIIWFLPVPEGVTRSAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  142

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  143  LTKTLTFAAAFSAFGDPIPWLIALAF  168



>ref|XP_009366121.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=588

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/86 (88%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            + PL+ASIATG+ILWFVP P GV++NAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  123  MTPLIASIATGLILWFVPTPAGVTKNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  182

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  183  LTKTLTFAAAFSAFGDPIPWLIALAF  208



>emb|CDX97208.1| BnaC09g44170D [Brassica napus]
Length=569

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASIATGVI+WF+P P GV+R+AWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  104  IKPLLASIATGVIIWFLPVPEGVTRSAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  163

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  164  LTKTLTFAAAFSAFGDPIPWLIALAF  189



>ref|XP_011025529.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Populus 
euphratica]
Length=565

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPLLASIATGVILWFVP P GV++ AWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  100  MKPLLASIATGVILWFVPVPAGVTKPAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  159

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTF+AAFSAFGDPIPWLIALAF
Sbjct  160  LTKTLTFSAAFSAFGDPIPWLIALAF  185



>ref|XP_008801951.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Phoenix 
dactylifera]
Length=558

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/86 (88%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGV+LWFVP P GVSRNAWQLL++FLATIVGIITQPLPLGAVALMGLGA V
Sbjct  93   LKPLVASIATGVLLWFVPAPAGVSRNAWQLLAVFLATIVGIITQPLPLGAVALMGLGASV  152

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTL F+AAFSAFGDPIPWLIALAF
Sbjct  153  LTKTLPFSAAFSAFGDPIPWLIALAF  178



>ref|XP_002513507.1| 2-oxoglutarate/malate translocator, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF48910.1| 2-oxoglutarate/malate translocator, chloroplast precursor, putative 
[Ricinus communis]
Length=561

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASIATGVI+WFVP P GV++ AWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  96   IKPLLASIATGVIIWFVPVPTGVTKPAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  155

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTF+AAFSAFGDPIPWLIALAF
Sbjct  156  LTKTLTFSAAFSAFGDPIPWLIALAF  181



>emb|CDP12268.1| unnamed protein product [Coffea canephora]
Length=573

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGV+LW VP P GVSRNAWQLL+IFLATI+GIITQPLPLGAVAL+GLGA V
Sbjct  108  MKPLIASIATGVLLWLVPAPAGVSRNAWQLLAIFLATIIGIITQPLPLGAVALLGLGASV  167

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFA AFSAFGDPIPWLIALAF
Sbjct  168  LTKTLTFAGAFSAFGDPIPWLIALAF  193



>ref|XP_007015046.1| Dicarboxylate transporter 1 isoform 2 [Theobroma cacao]
 gb|EOY32665.1| Dicarboxylate transporter 1 isoform 2 [Theobroma cacao]
Length=462

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  347  LASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKT  526
            +ASIATGVILWFVP P GVSRNAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA VLTKT
Sbjct  1    MASIATGVILWFVPVPSGVSRNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASVLTKT  60

Query  527  LTFAAAFSAFGDPIPWLIALAF  592
            LTF+AAFSAFGDPIPWLIALAF
Sbjct  61   LTFSAAFSAFGDPIPWLIALAF  82



>ref|XP_006446115.1| hypothetical protein CICLE_v10014769mg [Citrus clementina]
 ref|XP_006470607.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Citrus 
sinensis]
 gb|ESR59355.1| hypothetical protein CICLE_v10014769mg [Citrus clementina]
 gb|KDO61260.1| hypothetical protein CISIN_1g008538mg [Citrus sinensis]
Length=562

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATG+ILWFVP P GVS+NAWQLL+IFLATIVGII QPLPLGAVAL+GLGA V
Sbjct  97   LKPLIASIATGLILWFVPVPSGVSKNAWQLLAIFLATIVGIIAQPLPLGAVALLGLGASV  156

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTF+AAFSAFGDPIPWLIALAF
Sbjct  157  LTKTLTFSAAFSAFGDPIPWLIALAF  182



>ref|XP_011045437.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Populus 
euphratica]
Length=560

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/86 (88%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPLLASIATGVILWFVP P GV++ AWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  95   MKPLLASIATGVILWFVPVPAGVTKPAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  154

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTL F+AAFSAFGDPIPWLIALAF
Sbjct  155  LTKTLPFSAAFSAFGDPIPWLIALAF  180



>ref|XP_002442229.1| hypothetical protein SORBIDRAFT_08g016630 [Sorghum bicolor]
 gb|EES16067.1| hypothetical protein SORBIDRAFT_08g016630 [Sorghum bicolor]
Length=584

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLAS+A GV++WF+P P GV RNAWQLL+IFL+TIVGIITQPLPLGAVAL+GLGA V
Sbjct  119  IKPLLASLAIGVLIWFLPAPAGVPRNAWQLLAIFLSTIVGIITQPLPLGAVALLGLGAAV  178

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  179  LTKTLTFAAAFSAFGDPIPWLIALAF  204



>ref|NP_001066885.1| Os12g0515400 [Oryza sativa Japonica Group]
 gb|ABA98704.1| 2-oxoglutarate/malate translocator, chloroplast precursor, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF29904.1| Os12g0515400 [Oryza sativa Japonica Group]
Length=548

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+A+I TGV++W VP P GV+RNAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  83   IKPLVATIGTGVLIWLVPPPAGVARNAWQLLSIFLATIVGIITQPLPLGAVALLGLGAAV  142

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LT+TLTFAAAFSAFGDPIPWLIALAF
Sbjct  143  LTRTLTFAAAFSAFGDPIPWLIALAF  168



>gb|ABK24751.1| unknown [Picea sitchensis]
Length=594

 Score =   147 bits (372),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL ASIATGVI+W VP P GV++NAWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  129  LKPLAASIATGVIMWLVPAPAGVTKNAWQLLAIFLATIVGIITQPLPLGAVALMGLGAAV  188

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTLTFAAAFSAFGD IPWLIALAF
Sbjct  189  LTKTLTFAAAFSAFGDQIPWLIALAF  214



>ref|XP_002299910.2| hypothetical protein POPTR_0001s26580g [Populus trichocarpa]
 gb|EEE84715.2| hypothetical protein POPTR_0001s26580g [Populus trichocarpa]
Length=560

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPLLASIA GVILWFVP P GV++ AWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  95   MKPLLASIAIGVILWFVPVPSGVTKPAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  154

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTL F+AAFSAFGDPIPWLIALAF
Sbjct  155  LTKTLPFSAAFSAFGDPIPWLIALAF  180



>ref|XP_011006198.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Populus 
euphratica]
Length=560

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPLLASIATGVILW VP P GV++ AWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  95   MKPLLASIATGVILWLVPVPSGVTKPAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  154

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTL F+AAFSAFGDPIPWLIALAF
Sbjct  155  LTKTLPFSAAFSAFGDPIPWLIALAF  180



>ref|NP_001105570.1| LOC542560 [Zea mays]
 dbj|BAD06219.1| plastidic 2-oxoglutarate/malate transporter [Zea mays]
 gb|AFW56593.1| plastidic 2-oxoglutarate/malate transporter [Zea mays]
Length=578

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASIATGV++W +P P GV RNAWQLL+IFL+TIVGIITQPLPLGAVAL+GLGA V
Sbjct  113  IKPLLASIATGVLIWLIPPPAGVPRNAWQLLAIFLSTIVGIITQPLPLGAVALLGLGAAV  172

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            L++TLTFAAAFSAFGDPIPWLIALAF
Sbjct  173  LSRTLTFAAAFSAFGDPIPWLIALAF  198



>ref|XP_007132020.1| hypothetical protein PHAVU_011G059900g [Phaseolus vulgaris]
 gb|ESW04014.1| hypothetical protein PHAVU_011G059900g [Phaseolus vulgaris]
Length=559

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASIATGVILWF P P GV+RNAWQLL+IFL TIVGIITQPLPLGAVA++GLG  V
Sbjct  94   IKPLLASIATGVILWFTPVPAGVNRNAWQLLAIFLGTIVGIITQPLPLGAVAILGLGVSV  153

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTL FAAAFS FGDPIPWLIALAF
Sbjct  154  LTKTLPFAAAFSGFGDPIPWLIALAF  179



>ref|XP_003575954.1| PREDICTED: LOW QUALITY PROTEIN: dicarboxylate transporter 1, 
chloroplastic [Brachypodium distachyon]
Length=560

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASIATG+++WF+P P GV+RNAWQLL++FLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  93   IKPLLASIATGLLIWFIPAPAGVARNAWQLLAVFLATIVGIITQPLPLGAVALLGLGAAV  152

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LT+TLTFAAAFSAFGDPIPWLI  AF
Sbjct  153  LTRTLTFAAAFSAFGDPIPWLIGRAF  178



>ref|XP_010931014.1| PREDICTED: LOW QUALITY PROTEIN: dicarboxylate transporter 1, 
chloroplastic [Elaeis guineensis]
Length=557

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL A+IATGV+LW VP P GVSRNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  92   LKPLAATIATGVLLWLVPAPAGVSRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  151

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTL F+AAFSAFGDPIPWLIALAF
Sbjct  152  LTKTLPFSAAFSAFGDPIPWLIALAF  177



>ref|XP_004507091.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Cicer 
arietinum]
Length=557

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASIATGVILWFVP P GVSRNAWQLL+IFL TIVGIITQPLPLGAVA++GLG  V
Sbjct  92   IKPLLASIATGVILWFVPVPEGVSRNAWQLLAIFLGTIVGIITQPLPLGAVAILGLGVSV  151

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTL F AAFS FGDPIPWLI LAF
Sbjct  152  LTKTLPFVAAFSGFGDPIPWLICLAF  177



>ref|XP_003537966.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Glycine 
max]
Length=560

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASIATGVILWF P P GV+RNAWQLL+IFL TIVGIITQPLPLGAVA++GLG  V
Sbjct  95   IKPLIASIATGVILWFSPVPAGVNRNAWQLLAIFLGTIVGIITQPLPLGAVAILGLGVSV  154

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTL FAAAFS FGDPIPWLIALAF
Sbjct  155  LTKTLPFAAAFSGFGDPIPWLIALAF  180



>ref|XP_003539493.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Glycine 
max]
Length=553

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASIATGVILWF P P GV+RNAWQLL+IFL TIVGIITQPLPLGAVA++GLG  V
Sbjct  88   IKPLIASIATGVILWFSPVPAGVNRNAWQLLAIFLGTIVGIITQPLPLGAVAILGLGVSV  147

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTL FAAAFS FGDPIPWLIALAF
Sbjct  148  LTKTLPFAAAFSGFGDPIPWLIALAF  173



>emb|CAX65044.1| plastidic 2-oxoglutarate/malate translocator [Pisum sativum]
Length=480

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASIATGVI+WF+P P GVSRNAWQLL+IFL TIVGIITQPLPLGAVA++GLG  V
Sbjct  14   IKPLLASIATGVIIWFLPTPEGVSRNAWQLLAIFLGTIVGIITQPLPLGAVAILGLGVSV  73

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTL F AAFS FGDPIPWLI LAF
Sbjct  74   LTKTLPFVAAFSGFGDPIPWLICLAF  99



>ref|XP_010673637.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=560

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASI TGVI+W +P P GV++ AWQLL+IFL+TIVGIITQPLPLGAVALMGLGA V
Sbjct  95   IKPLLASIITGVIIWLIPTPEGVTKQAWQLLAIFLSTIVGIITQPLPLGAVALMGLGASV  154

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            +TKTL F+AAFSAFGDPIPWLIALAF
Sbjct  155  VTKTLPFSAAFSAFGDPIPWLIALAF  180



>gb|KEH30210.1| 2-oxoglutarate/malate translocator [Medicago truncatula]
Length=557

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASI TGVILWFVP P GVSRNAWQLL+IFL TIVGIITQPLPLGAVA++GLG  V
Sbjct  92   IKPLIASILTGVILWFVPTPEGVSRNAWQLLAIFLGTIVGIITQPLPLGAVAILGLGVSV  151

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTKTL F AAFS FGDPIPWLI LAF
Sbjct  152  LTKTLPFVAAFSGFGDPIPWLICLAF  177



>ref|XP_004964101.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Setaria 
italica]
Length=567

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PLLA++ATGV++   P P GV R AWQLL+IFL+TIVGIITQPLPLGAVAL+GLGA V
Sbjct  102  ITPLLATVATGVLIRLGPAPSGVPRKAWQLLAIFLSTIVGIITQPLPLGAVALLGLGAAV  161

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LT+TLTFAAAFSAFGDPIPWLIALAF
Sbjct  162  LTRTLTFAAAFSAFGDPIPWLIALAF  187



>emb|CAN74406.1| hypothetical protein VITISV_043636 [Vitis vinifera]
Length=303

 Score =   122 bits (306),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  591  NASAISQGMGSPNAENAAANVRVFVSTHAPRPINATAPSGSGWVMIPTMVARKIDSNCHA  412
             ASAIS G+GSP AE AAA VRV VST APRP +ATAPSGSG VM+PTMVARKI S+CHA
Sbjct  16   KASAISHGIGSPKAEKAAAKVRVLVSTDAPRPRSATAPSGSGCVMMPTMVARKIASSCHA  75

Query  411  FRETPPGCGTNQRITPVAMDARSGL  337
            F ETP GCGTN R+TPVA+ A SG 
Sbjct  76   FLETPAGCGTNHRMTPVAIAAASGF  100



>ref|XP_001700410.1| oxoglutarate:malate antiporter [Chlamydomonas reinhardtii]
 gb|EDO98099.1| oxoglutarate:malate antiporter [Chlamydomonas reinhardtii]
Length=553

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +K L   +     LWF+P P GV+  AW LL++F+ TIVGIIT PLPLGAVA++GLGA +
Sbjct  89   MKDLAICVGVATALWFIPPPAGVTAKAWHLLAVFIGTIVGIITTPLPLGAVAIIGLGAAM  148

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            +TK LTFA AFSAF   IPWLIA+A+
Sbjct  149  ITKVLTFAEAFSAFASEIPWLIAIAY  174



>ref|XP_001700411.1| chloroplast oxoglutarate-malate translocator [Chlamydomonas reinhardtii]
 gb|EDO98100.1| chloroplast oxoglutarate-malate translocator [Chlamydomonas reinhardtii]
Length=587

 Score =   105 bits (263),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +K L   +     LWF+P P GV+  AW LL++F+ TIVGIIT PLPLGAVA++GLGA +
Sbjct  123  MKDLAICVGVATALWFIPPPAGVTAKAWHLLAVFIGTIVGIITTPLPLGAVAIIGLGAAM  182

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            +TK LTFA AFSAF   IPWLIA+A+
Sbjct  183  ITKVLTFAEAFSAFASEIPWLIAIAY  208



>ref|XP_002955862.1| hypothetical protein VOLCADRAFT_106989 [Volvox carteri f. nagariensis]
 gb|EFJ43063.1| hypothetical protein VOLCADRAFT_106989 [Volvox carteri f. nagariensis]
Length=551

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +K L   +    +LWF+P P GV+  AW LL++F+ TIVGIIT PLPLGAVA++GLGA +
Sbjct  87   MKDLGICVGIATLLWFIPPPAGVTAKAWHLLAVFIGTIVGIITTPLPLGAVAVLGLGAAM  146

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            +TK LTFA AFSAF   IPWLIA+A+
Sbjct  147  ITKVLTFAEAFSAFASEIPWLIAIAY  172



>ref|XP_005843613.1| hypothetical protein CHLNCDRAFT_140201 [Chlorella variabilis]
 gb|EFN51511.1| hypothetical protein CHLNCDRAFT_140201 [Chlorella variabilis]
Length=536

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +K L   +A G  LW  P P GVS  AW LL++FL+TI GIIT P+PLGAVA+MGL A  
Sbjct  71   LKKLGICVAIGAALWVSPAPAGVSSQAWHLLAVFLSTICGIITTPMPLGAVAMMGLAAAQ  130

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LT  LTFA AFSAF   IPWLIA+AF
Sbjct  131  LTGVLTFAQAFSAFASEIPWLIAIAF  156



>ref|XP_005650106.1| oxoglutarate:malate antiporter, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25562.1| oxoglutarate:malate antiporter, partial [Coccomyxa subellipsoidea 
C-169]
Length=466

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +K L   +A  V +WF P P GV+  AW LL+IFL TIVGIITQPLPLGAVA++GLGA +
Sbjct  1    MKNLGICVAVAVAVWFCPPPAGVTIQAWHLLAIFLGTIVGIITQPLPLGAVAMLGLGATM  60

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LTK LTF+AAFSAF   IPWLIA+AF
Sbjct  61   LTKVLTFSAAFSAFSSEIPWLIAIAF  86



>gb|EYU18451.1| hypothetical protein MIMGU_mgv1a003725mg [Erythranthe guttata]
Length=568

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGV-ILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S+A G+ + +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL   VL
Sbjct  103  PLIISLAIGIAVRFFVPKPVEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTAVL  162

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTLTFAAAFSAF + + WLI ++F
Sbjct  163  TKTLTFAAAFSAFTNEVIWLIVISF  187



>ref|WP_038563803.1| 2-oxoglutarate translocator [Terribacillus aidingensis]
 gb|AIF67752.1| 2-oxoglutarate translocator [Terribacillus aidingensis]
Length=477

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++  GVILWF+P P GV   AW L +IF+ATI+G+I +P+P+G+VA++ L A VLT
Sbjct  16   PLLITVLIGVILWFIPSPDGVKAEAWHLFAIFVATIIGLIIKPMPMGSVAILSLTAIVLT  75

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
            KTL    A S F +   WLI +AF
Sbjct  76   KTLGLEEALSGFSNSTIWLIVIAF  99



>gb|AFK44505.1| unknown [Medicago truncatula]
Length=285

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P   SI  G+I+ +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V+
Sbjct  102  PFAISILIGLIVRFFVPKPVEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTASVV  161

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTLTF AAFSAF + + WLI ++F
Sbjct  162  TKTLTFTAAFSAFTNEVIWLIVISF  186



>ref|XP_009624586.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic [Nicotiana 
tomentosiformis]
Length=585

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+I+ +FVP+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL   VL
Sbjct  120  PLIISVSIGLIVRFFVPKPPEVSLQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSVL  179

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTLTF AAF+AF + + WLI ++F
Sbjct  180  TKTLTFTAAFNAFTNEVIWLIVISF  204



>ref|XP_011397588.1| Dicarboxylate transporter 1, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM24700.1| Dicarboxylate transporter 1, chloroplastic [Auxenochlorella protothecoides]
Length=486

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  398  GVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFAAAFSAFGDPIPWL  577
            GV   AW+LL IFL TI GIITQPLPLGAVA+MGLGA  LT  LTF AAFSAF + IPWL
Sbjct  42   GVGLPAWRLLGIFLGTIAGIITQPLPLGAVAMMGLGAAQLTGILTFQAAFSAFANEIPWL  101

Query  578  IALAF  592
            IA+AF
Sbjct  102  IAIAF  106



>ref|XP_009774993.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Nicotiana sylvestris]
 gb|AAM89397.1| glutamate/malate translocator [Nicotiana tabacum]
Length=583

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+I+ +FVP+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL   VL
Sbjct  118  PLIISVSIGLIVRFFVPKPPEVSPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSVL  177

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTLTF AAF+AF + + WLI ++F
Sbjct  178  TKTLTFTAAFNAFTNEVIWLIVISF  202



>ref|XP_011087921.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Sesamum indicum]
Length=562

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PLL SIA G+++ +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL   ++
Sbjct  97   PLLISIAIGILVRFFVPKPPEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSIV  156

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTLTF +AFSAF + + WLI ++F
Sbjct  157  TKTLTFTSAFSAFTNEVIWLIVISF  181



>gb|ABO87605.1| chloroplast glutamate/malate translocator [Pisum sativum]
Length=519

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P L SI+ G+I+ +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL   V+
Sbjct  54   PFLLSISIGLIVRFFVPKPVEVTAQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSVV  113

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTLTF AAFSAF + + WLI ++F
Sbjct  114  TKTLTFTAAFSAFTNEVIWLIVISF  138



>ref|NP_201234.1| dicarboxylate transport 2.1 [Arabidopsis thaliana]
 sp|Q9FMF7.1|DIT21_ARATH RecName: Full=Dicarboxylate transporter 2.1, chloroplastic; AltName: 
Full=AtpDCT1; AltName: Full=Glutamate/malate translocator; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09860.1| 2-oxoglutarate/malate translocator [Arabidopsis thaliana]
 gb|AAL07178.1| putative 2-oxoglutarate/malate translocator protein [Arabidopsis 
thaliana]
 gb|AAN31801.1| putative 2-oxoglutarate/malate translocator [Arabidopsis thaliana]
 gb|AAU95461.1| At5g64290 [Arabidopsis thaliana]
 gb|AED97866.1| dicarboxylate transport 2.1 [Arabidopsis thaliana]
Length=563

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ SI+ G+IL F VP P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  98   PLILSISVGLILRFAVPVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  157

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTL+F+AAFSAF   + WLI ++F
Sbjct  158  TKTLSFSAAFSAFTSEVIWLIVISF  182



>ref|XP_010315125.1| PREDICTED: LOW QUALITY PROTEIN: dicarboxylate transporter 2.1, 
chloroplastic-like [Solanum lycopersicum]
Length=584

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+I+ F VP+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL   VL
Sbjct  119  PLIISVSIGLIVRFLVPRPPEVSPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSVL  178

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTLTF++AFSAF + + WLI ++F
Sbjct  179  TKTLTFSSAFSAFTNEVIWLIVISF  203



>ref|XP_006351757.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Solanum tuberosum]
Length=584

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+I+ F VP+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL   VL
Sbjct  119  PLIISVSIGLIVRFLVPRPPEVSPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSVL  178

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTLTF++AFSAF + + WLI ++F
Sbjct  179  TKTLTFSSAFSAFTNEVIWLIVISF  203



>ref|XP_002866607.1| DCT/DIT2.1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42866.1| DCT/DIT2.1 [Arabidopsis lyrata subsp. lyrata]
Length=561

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ SI+ G+IL F VP P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  96   PLILSISVGLILRFAVPVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  155

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTL+F+AAFSAF   + WLI ++F
Sbjct  156  TKTLSFSAAFSAFTSEVIWLIVISF  180



>emb|CDY18717.1| BnaA09g06780D [Brassica napus]
Length=563

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+IL F VP P G++   WQLLSIFL+TI G++  PLP+GA A MGL A ++
Sbjct  98   PLILSLSVGLILRFAVPLPEGLTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFMGLTASIV  157

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTL+F+AAFSAF   + WLI ++F
Sbjct  158  TKTLSFSAAFSAFTSEVIWLIVISF  182



>ref|XP_007148387.1| hypothetical protein PHAVU_006G204300g [Phaseolus vulgaris]
 gb|ESW20381.1| hypothetical protein PHAVU_006G204300g [Phaseolus vulgaris]
Length=566

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGV-ILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P L SI  G+ + +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V+
Sbjct  101  PFLISICIGLAVRFFVPKPVEVTPEAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTATVV  160

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTLTF+AAFSAF + + WLI ++F
Sbjct  161  TKTLTFSAAFSAFTNEVIWLIVISF  185



>ref|XP_009112126.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Brassica rapa]
Length=563

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+IL F VP P G++   WQLLSIFL+TI G++  PLP+GA A MGL A ++
Sbjct  98   PLILSLSVGLILRFAVPLPEGLTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFMGLTASIV  157

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTL+F+AAFSAF   + WLI ++F
Sbjct  158  TKTLSFSAAFSAFTSEVIWLIVISF  182



>ref|XP_010520862.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic [Tarenaya 
hassleriana]
Length=564

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +2

Query  335  IKPLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  511
            I PL+ S+A G++L F VP+P GV+   WQLLSIFL+TI G++  PLP+GA A +GL   
Sbjct  97   ILPLILSVAVGLVLRFAVPKPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTTS  156

Query  512  VLTKTLTFAAAFSAFGDPIPWLIALAF  592
            ++T+TL FAAAFSAF   + WLI ++F
Sbjct  157  IVTRTLPFAAAFSAFTSEVIWLIVISF  183



>ref|WP_032858509.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
 gb|KDN91710.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
Length=478

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTA  74

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LT TL+     S FG+   WLI +AF
Sbjct  75   LTGTLSIENTLSGFGNKTIWLIVIAF  100



>ref|XP_010546344.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010546345.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=558

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = +2

Query  335  IKPLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  511
            I PL+ S+A G+IL F VP P GV+   WQLLSIFL+TI G++  PLP+GA A +GL   
Sbjct  91   ILPLILSVAVGIILRFAVPIPQGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTTS  150

Query  512  VLTKTLTFAAAFSAFGDPIPWLIALAF  592
            ++T+TL FAAAFSAF   + WLI ++F
Sbjct  151  IVTRTLPFAAAFSAFTSEVIWLIVISF  177



>ref|WP_013351349.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus subtilis 
group]
 emb|CBI41844.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
DSM 7]
 gb|AEB22862.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
TA208]
 gb|AEB62315.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
LL3]
 gb|AEK87860.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
XH7]
 gb|AIW32753.1| 2-oxoglutarate translocator [Bacillus subtilis]
Length=478

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTA  74

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LT TL+     S FG+   WLI +AF
Sbjct  75   LTGTLSIEDTLSGFGNKTIWLIVIAF  100



>ref|WP_003155645.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus subtilis 
group]
 emb|CCF04276.1| Citrate carrier Citrate transporter [Bacillus amyloliquefaciens 
subsp. plantarum CAU B946]
 gb|EKE46374.1| Citrate carrier Citrate transporter [Bacillus amyloliquefaciens 
subsp. plantarum M27]
 gb|AGF28678.1| Citrate carrier Citrate transporter [Bacillus amyloliquefaciens 
IT-45]
 gb|ERK81651.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens UASWS 
BA1]
 gb|AHC41276.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens LFB112]
 gb|AIU76127.1| 2-oxoglutarate translocator [Bacillus subtilis]
Length=478

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTA  74

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LT TL+     S FG+   WLI +AF
Sbjct  75   LTGTLSIENTLSGFGNKTIWLIVIAF  100



>ref|WP_038829541.1| 2-oxoglutarate translocator, partial [Bacillus subtilis]
Length=450

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TL+     S FG+   WLI +AF
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAF  100



>ref|WP_007408966.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillales]
 gb|ABS73157.1| YflS [Bacillus amyloliquefaciens subsp. plantarum str. FZB42]
 emb|CCG48710.1| Citrate carrier Citrate transporter [Bacillus amyloliquefaciens 
subsp. plantarum YAU B9601-Y2]
 gb|EIF12295.1| 2-oxoglutarate/malate translocator [Bacillus sp. 5B6]
 gb|AFJ60820.1| divalent anion:Na+ symporter, DASS family [Bacillus amyloliquefaciens 
Y2]
 gb|EJD67601.1| YflS [Bacillus sp. 916]
 gb|AFZ89764.1| divalent anion:Na+ symporter, DASS family protein [Bacillus amyloliquefaciens 
subsp. plantarum AS43.3]
 emb|CDG28718.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
subsp. plantarum UCMB5033]
 emb|CDG25023.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
subsp. plantarum UCMB5113]
 gb|ERH50988.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens EGD-AQ14]
 emb|CDH94478.1| Citrate carrier [Bacillus amyloliquefaciens subsp. plantarum 
NAU-B3]
 gb|AGZ55461.1| 2-oxoglutarate/malate translocator [Bacillus amyloliquefaciens 
CC178]
 gb|AHK48341.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens subsp. 
plantarum TrigoCor1448]
 gb|EYB35514.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens EBL11]
 gb|AHZ14735.1| Citrate carrier Citrate transporter [Bacillus amyloliquefaciens 
SQR9]
 gb|KFI14833.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|KFX40261.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
 gb|AIU80898.1| Putative malate transporter YflS [Bacillus methylotrophicus]
 gb|AIW29039.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|AIW36630.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|AJE77762.1| 2-oxoglutarate translocator [Bacillus sp. BH072]
 gb|KIR06440.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens subsp. 
plantarum]
 gb|KJD58150.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
Length=478

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTA  74

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LT TL+     S FG+   WLI +AF
Sbjct  75   LTGTLSIENTLSGFGNKTIWLIVIAF  100



>ref|WP_015417012.1| MULTISPECIES: 2-oxoglutarate/malate transporter [Bacillus]
 emb|CCP20741.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
subsp. plantarum UCMB5036]
 gb|AJC24759.1| 2-oxoglutarate translocator [Bacillus sp. Pc3]
 gb|AJH23098.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
Length=478

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTA  74

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LT TL+     S FG+   WLI +AF
Sbjct  75   LTGTLSIENTLSGFGNKTIWLIVIAF  100



>ref|WP_042744509.1| 2-oxoglutarate translocator, partial [Oenococcus oeni]
Length=163

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +2

Query  356  IATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLTF  535
            IA G+ILW +P P G+  +AW LL+IF+ TIVGIIT PLP+GAV+++GL   +LT TLT 
Sbjct  9    IAVGIILWLIPAPVGIKIHAWHLLAIFIGTIVGIITGPLPMGAVSMLGLVLVMLTGTLTP  68

Query  536  AAAFSAFGDPIPWLIALAF  592
             AAF+ F     WLI  AF
Sbjct  69   DAAFTGFSQETVWLIVAAF  87



>dbj|BAD91178.1| putative plastidic 2-oxoglutarate/malate translocator [Mesembryanthemum 
crystallinum]
Length=426

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/46 (98%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +2

Query  455  IITQPLPLGAVALMGLGACVLTKTLTFAAAFSAFGDPIPWLIALAF  592
            IITQPLPLGAVALMGLGA VLTKTLTFAAAFSAFGDPIPWLIALAF
Sbjct  1    IITQPLPLGAVALMGLGAAVLTKTLTFAAAFSAFGDPIPWLIALAF  46



>ref|WP_042634956.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
 gb|AJK64496.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
subsp. amyloliquefaciens KHG19]
Length=478

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLLITVAAGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTA  74

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LT TL+     S FG+   WLI +AF
Sbjct  75   LTGTLSIENTLSGFGNKTIWLIVIAF  100



>gb|EPS71302.1| glutamate/malate translocator [Genlisea aurea]
Length=548

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PLL S+A G++  +F+P+P  V+  AWQLLSIFL+T+ G++  PLP+GA A +GL   V+
Sbjct  83   PLLISLAVGIVTRYFIPKPPEVTPQAWQLLSIFLSTVAGLVLSPLPVGAWAFIGLTTAVV  142

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTL FAAAFSAF   + WLI ++F
Sbjct  143  TKTLRFAAAFSAFTSDVIWLIVISF  167



>ref|XP_003593234.1| 2-oxoglutarate/malate translocator [Medicago truncatula]
 gb|AES63485.1| 2-oxoglutarate/malate translocator [Medicago truncatula]
Length=567

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P   SI  G+I+ +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V+
Sbjct  102  PFAISILIGLIVRFFVPKPVEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTASVV  161

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTLTF AAFSAF + + WLI ++F
Sbjct  162  TKTLTFTAAFSAFTNEVIWLIVISF  186



>ref|XP_004485598.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Cicer arietinum]
Length=566

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P + SIA G+I+ +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V+
Sbjct  101  PFVISIAIGLIVRFFVPKPVEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTASVV  160

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTL+F  AFSAF + + WLI ++F
Sbjct  161  TKTLSFTDAFSAFTNEVIWLIVISF  185



>gb|KGH77071.1| 2-oxoglutarate translocator, partial [Oenococcus oeni IOEB_9304]
Length=179

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +2

Query  356  IATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLTF  535
            IA G+ILW +P P G+  +AW LL+IF+ TIVGIIT PLP+GAV+++GL   +LT TLT 
Sbjct  25   IAVGIILWLIPAPVGIKIHAWHLLAIFIGTIVGIITGPLPMGAVSMLGLVLVMLTGTLTP  84

Query  536  AAAFSAFGDPIPWLIALAF  592
             AAF+ F     WLI  AF
Sbjct  85   DAAFTGFSQETVWLIVAAF  103



>gb|KFK28120.1| hypothetical protein AALP_AA8G475200 [Arabis alpina]
Length=559

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+IL F VP P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  94   PLILSVSVGLILRFAVPVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  153

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T+TL+F+AAFSAF   + WLI ++F
Sbjct  154  TRTLSFSAAFSAFTSEVIWLIVISF  178



>gb|KIN32538.1| hypothetical protein B4069_0846 [Bacillus subtilis]
 gb|KIN44477.1| hypothetical protein B4071_0845 [Bacillus subtilis]
 gb|KIN49092.1| hypothetical protein B4072_0842 [Bacillus subtilis]
Length=493

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  32   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  91

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TL+     S FG+   WLI +AF
Sbjct  92   GTLSIEDTLSGFGNKTIWLIVIAF  115



>gb|EYU39124.1| hypothetical protein MIMGU_mgv1a003844mg [Erythranthe guttata]
Length=560

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL++S+A G  ++F +P+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A +L
Sbjct  95   PLISSLAIGAAVFFLIPRPPEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTATIL  154

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T TL FAAAFSAF + + WLI ++F
Sbjct  155  TNTLPFAAAFSAFTNEVIWLIVISF  179



>ref|WP_041057032.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|KIL30211.1| hypothetical protein B4067_0819 [Bacillus subtilis subsp. subtilis]
 gb|KIN58890.1| hypothetical protein B4145_0772 [Bacillus subtilis]
Length=478

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TL+     S FG+   WLI +AF
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAF  100



>ref|WP_024572847.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|KIU10460.1| 2-oxoglutarate/malate transporter [Bacillus subtilis]
Length=478

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TL+     S FG+   WLI +AF
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAF  100



>ref|WP_015383080.1| MULTISPECIES: 2-oxoglutarate/malate transporter [Bacillus]
 gb|AGE62620.1| 2-oxoglutarate/malate transporter [Bacillus subtilis XF-1]
 gb|AGI28021.1| 2-oxoglutarate/malate transporter [Bacillus subtilis subsp. subtilis 
str. BAB-1]
 gb|ERI42751.1| 2-oxoglutarate translocator [Bacillus sp. EGD-AK10]
 gb|AID00435.1| 2-oxoglutarate translocator [Bacillus subtilis subsp. subtilis 
str. OH 131.1]
 emb|CCU59962.1| 2-oxoglutarate/malate translocator [Bacillus subtilis E1]
 gb|KFF56609.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|KIN32357.1| hypothetical protein B4068_0716 [Bacillus subtilis]
 gb|KIN34108.1| hypothetical protein B4070_0771 [Bacillus subtilis]
 gb|KIN49661.1| hypothetical protein B4146_0798 [Bacillus subtilis]
 gb|KIN53365.1| hypothetical protein B4073_0722 [Bacillus subtilis]
 gb|KIO54969.1| hypothetical protein B4143_0730 [Bacillus subtilis]
 gb|AJO57407.1| 2-oxoglutarate translocator [Bacillus sp. YP1]
Length=478

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TL+     S FG+   WLI +AF
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAF  100



>ref|WP_044163592.1| 2-oxoglutarate translocator [Salinibacillus aidingensis]
Length=478

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TL+     S FG+   WLI +AF
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAF  100



>ref|WP_003233725.1| 2-oxoglutarate translocator [Bacillus subtilis]
 ref|NP_388638.1| malate transporter YflS [Bacillus subtilis subsp. subtilis str. 
168]
 sp|O34726.1|YFLS_BACSU RecName: Full=Putative malate transporter YflS [Bacillus subtilis 
subsp. subtilis str. 168]
 dbj|BAA22312.1| YflS [Bacillus subtilis]
 emb|CAB12586.1| 2-oxoglutarate/malate transporter [Bacillus subtilis subsp. subtilis 
str. 168]
 dbj|BAI84272.1| hypothetical protein BSNT_07134 [Bacillus subtilis subsp. natto 
BEST195]
 gb|ADV95745.1| 2-oxoglutarate/malate transporter [Bacillus subtilis BSn5]
 gb|AEP89842.1| 2-oxoglutarate/malate translocator [Bacillus subtilis subsp. 
subtilis str. RO-NN-1]
 gb|EHA29288.1| hypothetical protein BSSC8_35680 [Bacillus subtilis subsp. subtilis 
str. SC-8]
 gb|AFQ56676.1| 2-oxoglutarate/malate transporter [Bacillus subtilis QB928]
 dbj|BAM49680.1| 2-oxoglutarate/malate transporter [Bacillus subtilis BEST7613]
 dbj|BAM56950.1| 2-oxoglutarate/malate transporter [Bacillus subtilis BEST7003]
 gb|AGA21274.1| Malate transporter YflS [Bacillus subtilis subsp. subtilis str. 
BSP1]
 gb|EME07702.1| Na+ symporter (DASS) family protein [Bacillus subtilis MB73/2]
 gb|AGG60110.1| 2-oxoglutarate/malate transporter YflS [Bacillus subtilis subsp. 
subtilis 6051-HGW]
 gb|AHA76716.1| Putative malate transporter yflS [Bacillus subtilis PY79]
 gb|EXF51708.1| 2-oxoglutarate translocator [Bacillus subtilis QH-1]
 gb|KDE24759.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|AIC39140.1| 2-oxoglutarate/malate transporter [Bacillus subtilis subsp. subtilis 
str. JH642 substr. AG174]
 gb|AIC43372.1| 2-oxoglutarate/malate transporter [Bacillus subtilis subsp. subtilis 
str. AG1839]
 gb|KFC28723.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|KFH30358.1| 2-oxoglutarate translocator [Bacillus subtilis subsp. subtilis]
 gb|KFH30640.1| 2-oxoglutarate translocator [Bacillus subtilis subsp. subtilis]
 dbj|GAK79227.1| 2-oxoglutarate/malate transporter [Bacillus subtilis Miyagi-4]
 gb|AIX06521.1| Putative malate transporter YflS [Bacillus subtilis]
 emb|CEI55895.1| malate transporter YflS [Bacillus subtilis]
 emb|CEJ76320.1| malate transporter YflS [Bacillus sp.]
 gb|AIY92047.1| 2-oxoglutarate translocator [Bacillus subtilis subsp. subtilis 
str. 168]
 gb|AIY96359.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|AJE93426.1| 2-oxoglutarate translocator [Bacillus subtilis subsp. subtilis]
 gb|KIX81986.1| Putative malate transporter YflS [Bacillus subtilis]
Length=478

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TL+     S FG+   WLI +AF
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAF  100



>ref|WP_024120552.1| 2-oxoglutarate translocator [Bacillus mojavensis]
Length=478

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TL+     S FG+   WLI +AF
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAF  100



>ref|WP_040083848.1| 2-oxoglutarate translocator [Bacillus sp. A053]
 gb|KIH38638.1| 2-oxoglutarate translocator [Bacillus sp. A053]
Length=478

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TL+     S FG+   WLI +AF
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAF  100



>ref|WP_010330322.1| 2-oxoglutarate translocator [Bacillus vallismortis]
Length=478

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TL+     S FG+   WLI +AF
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAF  100



>ref|WP_003239908.1| hypothetical protein [Bacillus subtilis]
 gb|ELS60507.1| hypothetical protein BSI_29070 [Bacillus subtilis subsp. inaquosorum 
KCTC 13429]
Length=478

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TL+     S FG+   WLI +AF
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAF  100



>ref|WP_014113016.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|AEP85700.1| 2-oxoglutarate/malate translocator [Bacillus subtilis subsp. 
spizizenii TU-B-10]
Length=478

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TL+     S FG+   WLI +AF
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAF  100



>ref|WP_019257759.1| 2-oxoglutarate translocator [Bacillus subtilis]
Length=478

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TL+     S FG+   WLI +AF
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAF  100



>ref|WP_010333359.1| 2-oxoglutarate translocator [Bacillus mojavensis]
Length=478

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TL+     S FG+   WLI +AF
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAF  100



>ref|WP_039076181.1| 2-oxoglutarate translocator [Bacillus sp. MSP13]
Length=478

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TL+     S FG+   WLI +AF
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAF  100



>ref|WP_041906771.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus]
 gb|KFI01861.1| 2-oxoglutarate translocator [Bacillus sp. BSC154]
Length=478

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TL+     S FG+   WLI +AF
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAF  100



>ref|WP_010787924.1| 2-oxoglutarate/malate translocator [Bacillus atrophaeus]
 gb|EOB38136.1| 2-oxoglutarate/malate translocator [Bacillus atrophaeus UCMB-5137]
Length=478

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TL+     S FG+   WLI +AF
Sbjct  77   GTLSIENTLSGFGNKTIWLIVIAF  100



>ref|WP_019713597.1| 2-oxoglutarate translocator [Bacillus subtilis]
Length=478

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TL+     S FG+   WLI +AF
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAF  100



>ref|WP_024715768.1| 2-oxoglutarate translocator [Bacillus tequilensis]
Length=478

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TL+     S FG+   WLI +AF
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAF  100



>ref|WP_013390434.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus subtilis 
group]
 gb|ADP31232.1| 2-oxoglutarate/malate transporter [Bacillus atrophaeus 1942]
 gb|AIK49393.1| 2-oxoglutarate/malate translocator [Bacillus atrophaeus subsp. 
globigii]
 gb|KFK81246.1| 2-oxoglutarate/malate translocator, chloroplastic [Bacillus subtilis 
subsp. niger]
 gb|AJF84091.1| 2-oxoglutarate translocator [Bacillus atrophaeus]
Length=478

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TL+     S FG+   WLI +AF
Sbjct  77   GTLSIENTLSGFGNKTIWLIVIAF  100



>ref|XP_010484204.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic [Camelina 
sativa]
Length=563

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+IL F V  P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  98   PLILSVSVGLILRFAVSVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  157

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTLTF+AAFSAF   + WLI ++F
Sbjct  158  TKTLTFSAAFSAFTSEVIWLIVISF  182



>ref|WP_003328331.1| 2-oxoglutarate translocator [Bacillus atrophaeus]
 gb|EIM09398.1| 2-oxoglutarate/malate transporter [Bacillus atrophaeus C89]
Length=478

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TL+     S FG+   WLI +AF
Sbjct  77   GTLSIENTLSGFGNKTIWLIVIAF  100



>ref|XP_010461628.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Camelina sativa]
Length=560

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+IL F V  P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  95   PLILSVSVGLILRFAVSVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  154

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTLTF+AAFSAF   + WLI ++F
Sbjct  155  TKTLTFSAAFSAFTSEVIWLIVISF  179



>gb|KFM93392.1| transporter, divalent anion:Na+ symporter family protein [Bacillus 
licheniformis]
Length=295

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PL  +I  G ++WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLAVTILVGAVIWFIPSPAGLDPKAWHLFAIFVATIIGFISKPLPMGAIAVFALAVTA  74

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LT TL+     S FG+   WLI +AF
Sbjct  75   LTGTLSIEETLSGFGNKTIWLIVIAF  100



>ref|XP_009381488.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=528

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 60/85 (71%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL  S+A G+ +WF VP P  V+  AWQLL+IFL+TI G I  PLP+ A A +GL A V 
Sbjct  94   PLAISLAVGLAIWFLVPTPAEVTPQAWQLLAIFLSTITGFILGPLPIAAWAFLGLTASVA  153

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTLTF+AAF AF + + WLI ++F
Sbjct  154  TKTLTFSAAFDAFENEVIWLIVISF  178



>ref|XP_009381487.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=559

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 60/85 (71%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL  S+A G+ +WF VP P  V+  AWQLL+IFL+TI G I  PLP+ A A +GL A V 
Sbjct  94   PLAISLAVGLAIWFLVPTPAEVTPQAWQLLAIFLSTITGFILGPLPIAAWAFLGLTASVA  153

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTLTF+AAF AF + + WLI ++F
Sbjct  154  TKTLTFSAAFDAFENEVIWLIVISF  178



>ref|XP_009381486.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=565

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 60/85 (71%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL  S+A G+ +WF VP P  V+  AWQLL+IFL+TI G I  PLP+ A A +GL A V 
Sbjct  94   PLAISLAVGLAIWFLVPTPAEVTPQAWQLLAIFLSTITGFILGPLPIAAWAFLGLTASVA  153

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTLTF+AAF AF + + WLI ++F
Sbjct  154  TKTLTFSAAFDAFENEVIWLIVISF  178



>emb|CDY43805.1| BnaA06g23410D [Brassica napus]
Length=555

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+IL F V  P GV+   WQLLSIFLATI G++  PLP+GA A +GL A ++
Sbjct  90   PLILSLSVGLILRFAVSVPEGVTPQGWQLLSIFLATIAGLVLSPLPVGAWAFIGLTASIV  149

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTL+F+AAFSAF   + WLI ++F
Sbjct  150  TKTLSFSAAFSAFTSEVIWLIVISF  174



>ref|WP_025752426.1| 2-oxoglutarate translocator [Bacillus flexus]
Length=477

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL  +ATG++LWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLATGLVLWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TLT   + S F +   WLI +AF
Sbjct  76   NTLTLEQSLSGFQNTTIWLIVIAF  99



>ref|XP_002507903.1| divalent Anion:Na+ symporter family [Micromonas sp. RCC299]
 gb|ACO69161.1| divalent Anion:Na+ symporter family [Micromonas sp. RCC299]
Length=563

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL  S+  G+++W +P P GVS  AW LL++F+ TIVGIIT PLPLGA A++GLG  +
Sbjct  98   LKPLGYSVLAGLLIWLIPAPAGVSAQAWHLLAVFVGTIVGIITNPLPLGATAMIGLGVSM  157

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            +T  L FAAAFSAF   IPWLIALAF
Sbjct  158  VTGLLPFAAAFSAFSSEIPWLIALAF  183



>ref|XP_002323748.1| putative oxoglutarate-malate-translocase family protein [Populus 
trichocarpa]
 gb|EEF03881.1| putative oxoglutarate-malate-translocase family protein [Populus 
trichocarpa]
Length=569

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PLL S++ G+I+ F VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL   V+
Sbjct  104  PLLISVSIGLIVRFAVPKPIEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSVV  163

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T+TLTF+ AFSAF   + WLI ++F
Sbjct  164  TRTLTFSTAFSAFTSEVIWLIVISF  188



>ref|XP_010108404.1| 2-oxoglutarate/malate translocator [Morus notabilis]
 gb|EXC19408.1| 2-oxoglutarate/malate translocator [Morus notabilis]
Length=565

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S+A GV++ +FVP+P  VS  AWQLL+IFL+TI G++  PLP+GA A +GL   ++
Sbjct  100  PLVISVAIGVLVRFFVPKPVEVSAQAWQLLAIFLSTIAGLVLSPLPVGAWAFIGLTTSIV  159

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTL+F  AFSAF   + WLI ++F
Sbjct  160  TKTLSFTTAFSAFTSEVIWLIVISF  184



>ref|XP_010266911.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Nelumbo nucifera]
Length=578

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S+A GVI+ +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL   ++
Sbjct  113  PLVISVAIGVIVRFFVPKPVEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSIV  172

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTL+F+ AF AF   + WLI ++F
Sbjct  173  TKTLSFSTAFGAFTSEVIWLIVISF  197



>ref|XP_010444361.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Camelina sativa]
Length=563

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+IL F V  P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A V+
Sbjct  98   PLILSVSVGLILRFAVSVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASVV  157

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTL+F+AAFSAF   + WLI ++F
Sbjct  158  TKTLSFSAAFSAFTSEVIWLIVISF  182



>ref|XP_003547089.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Glycine max]
Length=562

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +2

Query  368  VILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFAAAF  547
            ++ +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V+TKTLTF AAF
Sbjct  107  IVRFFVPKPVEVTPEAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTASVVTKTLTFTAAF  166

Query  548  SAFGDPIPWLIALAF  592
            SAF + + WLI ++F
Sbjct  167  SAFTNEVIWLIVISF  181



>ref|XP_006280257.1| hypothetical protein CARUB_v10026173mg [Capsella rubella]
 gb|EOA13155.1| hypothetical protein CARUB_v10026173mg [Capsella rubella]
Length=560

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+IL F V  P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  95   PLILSVSVGLILRFAVSVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  154

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTL+F+AAFSAF   + WLI ++F
Sbjct  155  TKTLSFSAAFSAFTSEVIWLIVISF  179



>emb|CDX81219.1| BnaC09g06300D [Brassica napus]
Length=556

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+IL F V  P G++   WQLLSIFL+TI G++  PLP+GA A MGL A ++
Sbjct  91   PLILSLSVGLILRFAVSLPEGLTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFMGLTASIV  150

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTL+F+AAFSAF   + WLI ++F
Sbjct  151  TKTLSFSAAFSAFTSEVIWLIVISF  175



>ref|XP_008346519.1| PREDICTED: dicarboxylate transporter 2, chloroplastic-like [Malus 
domestica]
Length=279

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 62/85 (73%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P + SIA G+++ +FVP+P  V+  AWQLL+IFL+TI G++  PLP+GA A +GL   V+
Sbjct  99   PFIISIAIGIVVRFFVPKPVEVTPQAWQLLAIFLSTIAGLVLSPLPVGAWAFLGLTTSVV  158

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T TL+F  AFSAF + + WLI ++F
Sbjct  159  TGTLSFPTAFSAFTNEVIWLIVISF  183



>ref|XP_010272978.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Nelumbo nucifera]
Length=572

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 62/85 (73%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P L S++ GVI+ F VP+P  VS  AWQLL+IFL+TI G++  PLP+GA A +GL   ++
Sbjct  107  PFLISVSIGVIVRFIVPKPVEVSLQAWQLLAIFLSTIAGLVLNPLPVGAWAFLGLTTSIV  166

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTLTF+ AF AF + + WLI ++F
Sbjct  167  TKTLTFSTAFEAFTNEVIWLIVISF  191



>ref|XP_006394170.1| hypothetical protein EUTSA_v10003922mg [Eutrema salsugineum]
 dbj|BAJ34188.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31456.1| hypothetical protein EUTSA_v10003922mg [Eutrema salsugineum]
Length=561

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PLL S++ G+IL F V  P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  96   PLLLSVSVGLILRFAVSVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  155

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T+TL+F+AAFSAF   + WLI ++F
Sbjct  156  TRTLSFSAAFSAFTSEVIWLIVISF  180



>ref|XP_009150500.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic [Brassica 
rapa]
Length=555

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+IL F V  P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  90   PLILSLSVGLILRFAVSVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  149

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTL+F+AAFSAF   + WLI ++F
Sbjct  150  TKTLSFSAAFSAFTSEVIWLIVISF  174



>ref|WP_014663179.1| 2-oxoglutarate translocator [Bacillus sp. JS]
 gb|AFI27386.1| 2-oxoglutarate/malate translocator [Bacillus sp. JS]
Length=478

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TL+       FG+   WLI +AF
Sbjct  77   GTLSIEDTLIGFGNKTIWLIVIAF  100



>ref|WP_043977584.1| 2-oxoglutarate translocator [Bacillus aryabhattai]
Length=477

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL  +A G+ILWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLILWFITPPSGLDLKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TLT   + S F +   WLI +AF
Sbjct  76   NTLTLEQSLSGFQNTTIWLIVIAF  99



>ref|WP_028409745.1| 2-oxoglutarate translocator [Bacillus sp. 171095_106]
Length=477

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL  +A G+ILWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLILWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TLT   + S F +   WLI +AF
Sbjct  76   NTLTLEQSLSGFQNTTIWLIVIAF  99



>ref|WP_034648188.1| 2-oxoglutarate translocator [Bacillus megaterium]
 gb|KFN06787.1| 2-oxoglutarate/malate translocator, chloroplastic [Bacillus megaterium]
 gb|KGJ85087.1| 2-oxoglutarate translocator [Bacillus megaterium NBRC 15308 = 
ATCC 14581]
 gb|AJI23694.1| transporter, divalent anion:Na+ symporter family protein [Bacillus 
megaterium NBRC 15308 = ATCC 14581]
Length=477

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL  +A G+ILWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLILWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TLT   + S F +   WLI +AF
Sbjct  76   NTLTLEQSLSGFQNTTIWLIVIAF  99



>ref|WP_013085539.1| 2-oxoglutarate translocator [Bacillus megaterium]
 gb|ADF42029.1| transporter, divalent anion:Na+ symporter (DASS) family protein 
[Bacillus megaterium DSM 319]
Length=477

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL  +A G+ILWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLILWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TLT   + S F +   WLI +AF
Sbjct  76   NTLTLEQSLSGFQNTTIWLIVIAF  99



>ref|WP_016765975.1| 2-oxoglutarate translocator [Bacillus megaterium]
Length=477

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL  +A G+ILWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLILWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TLT   + S F +   WLI +AF
Sbjct  76   NTLTLEQSLSGFQNTTIWLIVIAF  99



>gb|KIY93848.1| hypothetical protein MNEG_14114 [Monoraphidium neglectum]
Length=79

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +2

Query  398  GVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFAAAFSAFGDPIP  571
            GV+  AW LL+IF  TIVGIIT PLPLGAVA++GLG  +LTKTLTFA AFSAF   IP
Sbjct  22   GVTVKAWNLLAIFTGTIVGIITTPLPLGAVAVLGLGVSMLTKTLTFAEAFSAFATEIP  79



>gb|EMT05118.1| 2-oxoglutarate/malate translocator, chloroplastic [Aegilops tauschii]
Length=278

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 61/85 (72%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ASIA G+ + F+ P+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  91   PLIASIAVGLAVRFLAPRPPEVTPQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTATVA  150

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T TL F AAF AF + + WLI ++F
Sbjct  151  TGTLPFTAAFGAFTNEVIWLIVISF  175



>ref|WP_028402895.1| 2-oxoglutarate translocator [Bacillus panaciterrae]
Length=483

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL  +A G+ILWF+  P G+   AW L +IF+ATI+G+I +PLPLG++A++ L   VLT
Sbjct  22   PLLTCVAIGLILWFITPPSGLDVKAWHLFAIFVATIIGLIIKPLPLGSIAVLSLTIIVLT  81

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TLT   + S F +   WLI +AF
Sbjct  82   NTLTLEKSLSGFQNTTIWLIVIAF  105



>dbj|BAD19756.1| putative plastidic general dicarboxylate transporter [Oryza sativa 
Japonica Group]
 dbj|BAD22267.1| putative plastidic general dicarboxylate transporter [Oryza sativa 
Japonica Group]
Length=550

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = +2

Query  335  IKPLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  511
            + PLL S+A G+ + F+ P+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL A 
Sbjct  83   LAPLLVSLAVGLAVRFLAPRPPEVSPQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTAA  142

Query  512  VLTKTLTFAAAFSAFGDPIPWLIALAF  592
            V T TL FAAAFSAF + + WLI ++F
Sbjct  143  VATHTLPFAAAFSAFTNEVIWLIVISF  169



>ref|WP_020450525.1| MULTISPECIES: 2-oxoglutarate/malate transporter YflS [Bacillus]
 gb|AGN35273.1| 2-oxoglutarate/malate transporter YflS [Bacillus licheniformis 
9945A]
 gb|ETB72216.1| 2-oxoglutarate translocator [Bacillus sp. CPSM8]
 gb|KJD54202.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
Length=478

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PL  +I  G ++WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLTVTILVGAVIWFIPSPAGLDPKAWHLFAIFVATIIGFISKPLPMGAIAVFALAVTA  74

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LT TL+     S FG+   WLI +AF
Sbjct  75   LTGTLSIEETLSGFGNKTIWLIVIAF  100



>ref|XP_006827969.1| hypothetical protein AMTR_s00008p00213760 [Amborella trichopoda]
 gb|ERM95385.1| hypothetical protein AMTR_s00008p00213760 [Amborella trichopoda]
Length=563

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 62/85 (73%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P + S+A G+++ + VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A MGL   V+
Sbjct  98   PFILSVAVGLVVRYLVPKPVEVTTQAWQLLSIFLSTITGLVLSPLPVGAWAFMGLTTAVI  157

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T+TL+F+ AF AF + + WLI ++F
Sbjct  158  TRTLSFSLAFEAFTNEVIWLIVISF  182



>gb|EAZ09443.1| hypothetical protein OsI_31717 [Oryza sativa Indica Group]
Length=550

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = +2

Query  335  IKPLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  511
            + PLL S+A G+ + F+ P+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL A 
Sbjct  83   LAPLLVSLAVGLAVRFLAPRPPEVSPQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTAA  142

Query  512  VLTKTLTFAAAFSAFGDPIPWLIALAF  592
            V T TL FAAAFSAF + + WLI ++F
Sbjct  143  VATHTLPFAAAFSAFTNEVIWLIVISF  169



>ref|WP_018664356.1| hypothetical protein [Bacillus acidiproducens]
Length=164

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = +2

Query  344  LLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTK  523
            L  ++A GVI+W +  P G+   AW L +IF+ATI+G+I +PLP+G +A++ + A VLT 
Sbjct  25   LFITLAAGVIIWLIGAPAGLDEKAWHLFAIFVATIIGLIIKPLPMGGIAILSITAVVLTG  84

Query  524  TLTFAAAFSAFGDPIPWLIALAF  592
            TL    A S F +   WLI +AF
Sbjct  85   TLELQQALSGFQNTTIWLIVIAF  107



>emb|CDP01518.1| unnamed protein product [Coffea canephora]
Length=518

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 60/85 (71%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P + S++ G+I  F VP+P  +SR +WQLLSIFL TI G+I  PLP+GA A+  L   V+
Sbjct  53   PFIISVSIGIIFNFAVPKPHQLSRKSWQLLSIFLTTISGLILSPLPVGAWAMFCLTLTVI  112

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTLTF  AFSAF + + WLI ++F
Sbjct  113  TKTLTFMQAFSAFTNEVIWLIVISF  137



>ref|WP_019392157.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus]
Length=466

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            + P L +IA GV++WF+P+P GV   AW LL+IF+ATI+G I +PLP+G++A++ L    
Sbjct  3    VVPFLITIAIGVLIWFIPEPSGVDPKAWHLLAIFVATIIGFILKPLPMGSLAILSLAVVA  62

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            +T  LT     S F +   WLI +AF
Sbjct  63   VTGVLTIDQTLSGFANTTIWLIVIAF  88



>ref|WP_039073282.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus]
 gb|AJO17019.1| YflS protein [Bacillus licheniformis]
Length=478

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PL  +I  G ++WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLAVTILVGAVIWFIPSPAGLDPKAWHLFAIFVATIIGFISKPLPMGAIAVFALAVTA  74

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LT TL+     S FG+   WLI +AF
Sbjct  75   LTGTLSIEETLSGFGNKTIWLIVIAF  100



>ref|WP_014457694.1| 2-oxoglutarate translocator [Bacillus megaterium]
 gb|AEN86919.1| Dicarboxylase translocator [Bacillus megaterium WSH-002]
Length=477

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL  +A G++LWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLVLWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TLT   + S F +   WLI +AF
Sbjct  76   NTLTLEQSLSGFQNTTIWLIVIAF  99



>ref|WP_043925701.1| 2-oxoglutarate translocator [Bacillus licheniformis]
 gb|EWH23105.1| 2-oxoglutarate translocator [Bacillus licheniformis S 16]
Length=478

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PL  +I  G ++WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLAVTILVGAVIWFIPSPAGLDPKAWHLFAIFVATIIGFISKPLPMGAIAVFALAVTA  74

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LT TL+     S FG+   WLI +AF
Sbjct  75   LTGTLSIEETLSGFGNKTIWLIVIAF  100



>ref|WP_029319476.1| 2-oxoglutarate translocator [Bacillus sp. RP1137]
Length=477

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL  +A G++LWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLVLWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TLT   + S F +   WLI +AF
Sbjct  76   NTLTLEQSLSGFQNTTIWLIVIAF  99



>ref|WP_013059892.1| 2-oxoglutarate translocator [Bacillus megaterium]
 gb|ADE72219.1| transporter, divalent anion:Na+ symporter (DASS) family protein 
[Bacillus megaterium QM B1551]
Length=477

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL  +A G++LWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLVLWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TLT   + S F +   WLI +AF
Sbjct  76   NTLTLEQSLSGFQNTTIWLIVIAF  99



>ref|WP_028411930.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus]
Length=477

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL  +A G++LWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLVLWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TLT   + S F +   WLI +AF
Sbjct  76   NTLTLEQSLSGFQNTTIWLIVIAF  99



>emb|CDX84512.1| BnaC03g49880D [Brassica napus]
Length=562

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+IL F V  P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  97   PLILSLSVGLILRFAVSVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  156

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T+TL+F+AAFSAF   + WLI ++F
Sbjct  157  TRTLSFSAAFSAFTSEVIWLIVISF  181



>ref|XP_010942614.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic [Elaeis 
guineensis]
Length=563

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL  S+A G+++ F VP+P  V+  AWQLL+IFL+TI G++  PLP+GA A +GL A V+
Sbjct  98   PLAISVAIGLVVRFLVPRPVEVTPQAWQLLAIFLSTIAGLVLSPLPVGAWAFLGLTASVV  157

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTL+F+AAF AF + + WLI ++F
Sbjct  158  TKTLSFSAAFRAFTNEVIWLIVISF  182



>ref|WP_003179716.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus]
 gb|EFV71632.1| YflS protein [Bacillus sp. BT1B_CT2]
 gb|EID49989.1| 2-oxoglutarate/malate translocator [Bacillus licheniformis WX-02]
 gb|EQM29468.1| 2-oxoglutarate translocator [Bacillus licheniformis CG-B52]
Length=478

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PL  +I  G ++WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLAVTILVGAVIWFIPSPAGLDPKAWHLFAIFVATIIGFISKPLPMGAIAVFALAITA  74

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LT TL+     S FG+   WLI +AF
Sbjct  75   LTGTLSIEETLSGFGNKTIWLIVIAF  100



>ref|WP_011197641.1| 2-oxoglutarate translocator [Bacillus licheniformis]
 gb|AAU39715.1| putative malate transporter YflS [Bacillus licheniformis DSM 
13 = ATCC 14580]
 gb|AAU22366.2| putative 2-oxoglutarate/malate translocator [Bacillus licheniformis 
DSM 13 = ATCC 14580]
 gb|KJE31653.1| transporter, divalent anion:Na+ symporter family protein [Bacillus 
licheniformis]
Length=478

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PL  +I  G ++WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLAVTILVGAVIWFIPSPAGLDPKAWHLFAIFVATIIGFISKPLPMGAIAVFALAITA  74

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LT TL+     S FG+   WLI +AF
Sbjct  75   LTGTLSIEETLSGFGNKTIWLIVIAF  100



>emb|CDO97413.1| unnamed protein product [Coffea canephora]
Length=562

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = +2

Query  335  IKPLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  511
            I PL+ S++ G+I+ F VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL   
Sbjct  95   IIPLIISVSIGLIVRFLVPKPPEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTA  154

Query  512  VLTKTLTFAAAFSAFGDPIPWLIALAF  592
            +LT+TL F  AFSAF + + WLI ++F
Sbjct  155  ILTRTLPFTIAFSAFTNEVIWLIVISF  181



>ref|XP_011043103.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Populus euphratica]
Length=569

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 62/85 (73%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PLL S++ G+I+ F VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL   V+
Sbjct  104  PLLISVSIGLIVRFAVPKPIEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSVV  163

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T+TL F+ AFSAF   + WLI ++F
Sbjct  164  TRTLPFSTAFSAFTSEVIWLIVISF  188



>ref|WP_036200998.1| 2-oxoglutarate translocator [Lysinibacillus sinduriensis]
 gb|KGR75386.1| 2-oxoglutarate translocator [Lysinibacillus sinduriensis BLB-1 
= JCM 15800]
Length=478

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PLL  I  G ++W +P PGG+   AW L +IF+ATI+G+I +P+P+G++A++ L    
Sbjct  15   IIPLLVVILIGAVIWLIPPPGGLQVQAWHLFAIFVATIIGLIIKPIPMGSMAILALTVIT  74

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            +TKTLT   A S F +   WLI +AF
Sbjct  75   VTKTLTLEEALSGFQNSTIWLIVIAF  100



>ref|WP_026578902.1| 2-oxoglutarate translocator [Bacillus sp. SB47]
Length=478

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PL  +I  G ++WF+P P G+   AW L +IF++TI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLTVTILVGAVIWFIPSPAGLDPKAWHLFAIFVSTIIGFISKPLPMGAIAVFALAVTA  74

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LT TL+     S FG+   WLI +AF
Sbjct  75   LTGTLSIEETLSGFGNKTIWLIVIAF  100



>ref|WP_003223030.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|EFG91812.1| 2-oxoglutarate/malate transporter [Bacillus subtilis subsp. spizizenii 
ATCC 6633]
 gb|ADM36825.1| 2-oxoglutarate/malate transporter [Bacillus subtilis subsp. spizizenii 
str. W23]
 gb|KFK80732.1| 2-oxoglutarate/malate translocator [Bacillus subtilis]
 gb|AJD35451.1| 2-oxoglutarate translocator [Bacillus subtilis subsp. spizizenii]
Length=477

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLL-TVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  75

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TL+     S FG+   WLI +AF
Sbjct  76   GTLSIEDTLSGFGNKTIWLIVIAF  99



>ref|XP_009401226.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=562

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL  S+A G+ + F VP+P  V+  AWQLL+IFL+TI G++  PLP+GA A +GL A V+
Sbjct  97   PLAISLAVGLAVRFLVPRPVEVTPQAWQLLAIFLSTIAGLVLSPLPVGAWAFIGLTASVI  156

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTLTF+AAF AF + + WLI ++F
Sbjct  157  TKTLTFSAAFGAFTNEVIWLIVISF  181



>ref|XP_007512423.1| 2-oxoglutarate/malate translocator [Bathycoccus prasinos]
 emb|CCO17023.1| 2-oxoglutarate/malate translocator [Bathycoccus prasinos]
Length=594

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +2

Query  338  KPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            K L  S+  G++LW  P P GV+  AW L ++F+ATIVGIITQPLPLGAVA++GLG  + 
Sbjct  130  KNLGYSVLAGLLLWICPAPAGVTAQAWHLFAVFVATIVGIITQPLPLGAVAMIGLGVSMT  189

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T  L F+AAFSAF   IPWLIA+AF
Sbjct  190  TGLLPFSAAFSAFASEIPWLIAIAF  214



>gb|EEE53308.1| hypothetical protein OsJ_36283 [Oryza sativa Japonica Group]
Length=497

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 55/86 (64%), Gaps = 28/86 (33%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+A+I TGV++W                             PLPLGAVAL+GLGA V
Sbjct  83   IKPLVATIGTGVLIWL----------------------------PLPLGAVALLGLGAAV  114

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LT+TLTFAAAFSAFGDPIPWLIALAF
Sbjct  115  LTRTLTFAAAFSAFGDPIPWLIALAF  140



>ref|XP_009366350.1| PREDICTED: dicarboxylate transporter 2, chloroplastic-like, partial 
[Pyrus x bretschneideri]
Length=550

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 62/85 (73%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P + SIA G+++ +FVP+P  V+  AWQLL+IFL+TI G++  PLP+GA A +GL   V+
Sbjct  99   PFIISIAIGIVVRFFVPKPVQVTPQAWQLLAIFLSTIAGLVLSPLPVGAWAFLGLTTSVV  158

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T TL+F  AFSAF + + WLI ++F
Sbjct  159  TGTLSFPTAFSAFTNEVIWLIVISF  183



>ref|WP_000493040.1| 2-oxoglutarate translocator [Vibrio cholerae]
 gb|EDM55699.1| 2-oxoglutarate/malate translocator [Vibrio cholerae MZO-2]
Length=468

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +2

Query  344  LLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTK  523
            LLA I  G ILWF+P P G+   AWQ++++F+ T+V +I  PLPLGA+ALMGL A VL  
Sbjct  9    LLALIFFGSILWFIPTPEGLEPEAWQMMTVFVTTVVSLILAPLPLGAMALMGLCATVLLG  68

Query  524  TLTFAAAFSAFGDPIPWLIALAF  592
             L   +A + F DP  W+IA AF
Sbjct  69   ILPIKSALAGFSDPTIWMIAAAF  91



>ref|WP_000493041.1| 2-oxoglutarate translocator [Vibrio cholerae]
 gb|EFH74421.1| 2-oxoglutarate/malate translocator [Vibrio cholerae RC385]
Length=468

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +2

Query  344  LLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTK  523
            LLA I  G ILWF+P P G+   AWQ++++F+ T+V +I  PLPLGA+ALMGL A VL  
Sbjct  9    LLALIFFGSILWFIPTPEGLEPKAWQMMTVFVTTVVSLILAPLPLGAMALMGLCATVLLG  68

Query  524  TLTFAAAFSAFGDPIPWLIALAF  592
             L   +A + F DP  W+IA AF
Sbjct  69   ILPIKSALAGFSDPTIWMIAAAF  91



>ref|XP_002445989.1| hypothetical protein SORBIDRAFT_07g029165 [Sorghum bicolor]
 gb|EES15484.1| hypothetical protein SORBIDRAFT_07g029165 [Sorghum bicolor]
Length=497

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 61/85 (72%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL  S+A G+ + F VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL   V 
Sbjct  32   PLFISLALGLAVRFLVPRPAQVTSQAWQLLSIFLSTIAGLVLAPLPVGAWAFLGLTVTVA  91

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T+TL+FAAAF AF + + WLI ++F
Sbjct  92   TRTLSFAAAFGAFTNEVIWLIVISF  116



>ref|XP_003574657.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic [Brachypodium 
distachyon]
Length=556

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 62/85 (73%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+AS+A G+ + F+ P+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  91   PLIASVAVGLAVRFLAPRPAEVTPEAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTATVA  150

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T+TL F AAF AF + + WLI ++F
Sbjct  151  TRTLPFTAAFGAFTNEVIWLIVISF  175



>ref|WP_000493042.1| 2-oxoglutarate translocator [Vibrio cholerae]
 gb|EDN17198.1| 2-oxoglutarate/malate translocator [Vibrio cholerae AM-19226]
 gb|EJH60830.1| 2-oxoglutarate/malate translocator [Vibrio cholerae HE-45]
Length=468

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +2

Query  344  LLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTK  523
            LLA I  G ILWF+P P G+   AWQ++++F+ T+V +I  PLPLGA+ALMGL A VL  
Sbjct  9    LLALIFFGSILWFIPTPEGLEPKAWQMMTVFVTTVVSLILAPLPLGAMALMGLCATVLLG  68

Query  524  TLTFAAAFSAFGDPIPWLIALAF  592
             L   +A + F DP  W+IA AF
Sbjct  69   ILPIKSALAGFSDPTIWMIAAAF  91



>gb|KJB32094.1| hypothetical protein B456_005G223500 [Gossypium raimondii]
Length=562

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL  S++ G+I+ F VP+P  V+  AWQLL+IFL+TI G++  PLP+GA A +GL   ++
Sbjct  97   PLFLSVSIGLIVRFLVPKPVEVTPQAWQLLAIFLSTIAGLVLSPLPVGAWAFIGLTTSIV  156

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTL FA+AFSAF + + WLI ++F
Sbjct  157  TKTLPFASAFSAFTNEVIWLIVISF  181



>ref|XP_008805911.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic [Phoenix 
dactylifera]
Length=590

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL  S+A G+ + F VP+P  V+  AWQLL+IFL+TI G++  PLP+GA A +GL A V+
Sbjct  125  PLAISLAIGLAVRFLVPRPIEVTSQAWQLLAIFLSTIAGLVLSPLPVGAWAFLGLTASVV  184

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTL+F+AAF AF + + WLI ++F
Sbjct  185  TKTLSFSAAFGAFTNEVIWLIVISF  209



>ref|WP_026589611.1| 2-oxoglutarate translocator [Bacillus sp. NSP9.1]
Length=478

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PL  +I  G ++W +P PGG+   AW L +IF+ATI+G I++PLP+GAVA+  L    
Sbjct  15   ILPLAVTILAGAVIWLIPPPGGLDPKAWHLFAIFVATIIGFISKPLPMGAVAIFALAMTA  74

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LT TL+     S FG+   WLI +AF
Sbjct  75   LTGTLSIEDTLSGFGNKTIWLIVIAF  100



>ref|WP_025553155.1| hypothetical protein, partial [Vibrio parahaemolyticus]
Length=194

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = +2

Query  344  LLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTK  523
            +L  +ATG ILWF+P P G++  AWQ+++IF+ T++ +I  PLPLGA+ALMGL    L  
Sbjct  8    MLLLVATGCILWFIPTPEGLTDQAWQMMAIFVTTVLSLILAPLPLGAMALMGLTLATLLG  67

Query  524  TLTFAAAFSAFGDPIPWLIALAF  592
             L    A + F  P  W+IA AF
Sbjct  68   VLPIKTALTGFAHPTIWMIAAAF  90



>gb|AGK55800.1| divalent anion:Na+ symporter (DASS) family transporter [Bacillus 
sp. 1NLA3E]
Length=491

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL +I  GV LW +  P G+   AW L +IF+ATIVG++++P+P+G+VA++ L A VLT
Sbjct  30   PLLITIIVGVALWMITPPAGLDVQAWHLFAIFVATIVGLVSKPMPMGSVAILALTATVLT  89

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
            +TLT   A + F +   WLI +AF
Sbjct  90   QTLTIDQALTGFQNSTIWLIVIAF  113



>gb|ACL52604.1| unknown [Zea mays]
 tpg|DAA40305.1| TPA: 2-oxoglutarate/malate translocator [Zea mays]
Length=530

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 62/85 (73%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ SIA G+ + F+ P+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  65   PLVISIAIGLAVRFLAPRPVEVSPQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTAAVA  124

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T+TL F AAFSAF + + WLI ++F
Sbjct  125  TRTLPFTAAFSAFTNEVIWLIVISF  149



>ref|WP_041581256.1| 2-oxoglutarate translocator [Bacillus sp. 1NLA3E]
Length=481

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL +I  GV LW +  P G+   AW L +IF+ATIVG++++P+P+G+VA++ L A VLT
Sbjct  20   PLLITIIVGVALWMITPPAGLDVQAWHLFAIFVATIVGLVSKPMPMGSVAILALTATVLT  79

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
            +TLT   A + F +   WLI +AF
Sbjct  80   QTLTIDQALTGFQNSTIWLIVIAF  103



>ref|XP_002445990.1| hypothetical protein SORBIDRAFT_07g029170 [Sorghum bicolor]
 gb|EES15485.1| hypothetical protein SORBIDRAFT_07g029170 [Sorghum bicolor]
Length=551

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 61/85 (72%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PLL S+A G+ + F VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  86   PLLISLAAGLAVRFLVPRPAEVTPEAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTATVA  145

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T+TL F AAF AF + + WLI ++F
Sbjct  146  TRTLPFTAAFGAFTNEVIWLIVISF  170



>gb|KDP40929.1| hypothetical protein JCGZ_24928 [Jatropha curcas]
Length=569

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +2

Query  335  IKPLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  511
            I PL+ S++ G++L F +P+P  ++  AWQLL+IF++TI G++  PLP+GA A +GL   
Sbjct  102  IFPLVISVSIGLVLRFCIPRPVEITPQAWQLLAIFISTIAGLVLNPLPVGAWAFLGLTTS  161

Query  512  VLTKTLTFAAAFSAFGDPIPWLIALAF  592
            ++T+TLTF+ AFSAF + + WLI ++F
Sbjct  162  IVTRTLTFSTAFSAFTNEVIWLIVISF  188



>ref|WP_000493039.1| 2-oxoglutarate translocator [Vibrio cholerae]
 gb|EDL74860.1| 2-oxoglutarate/malate translocator [Vibrio cholerae 623-39]
 gb|EJH66801.1| 2-oxoglutarate/malate translocator [Vibrio cholerae HE-25]
 gb|EMQ59695.1| na+ symporter family protein [Vibrio cholerae O1 str. EM-1676A]
Length=468

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +2

Query  344  LLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTK  523
            LLA I  G ILWF+P P G+   AWQ++++F+ T+V +I  PLPLGA+ALMGL A VL  
Sbjct  9    LLALIFFGSILWFIPPPEGLEPKAWQMMTVFVTTVVSLILAPLPLGAMALMGLCATVLLG  68

Query  524  TLTFAAAFSAFGDPIPWLIALAF  592
             L   +A + F DP  W+IA AF
Sbjct  69   ILPIKSALAGFSDPTIWMIAAAF  91



>ref|XP_004973727.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Setaria italica]
Length=554

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 61/85 (72%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PLL S+A G+ + F VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  89   PLLISLAAGLAVRFLVPRPAEVTPQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTATVA  148

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T+TL F AAF AF + + WLI ++F
Sbjct  149  TRTLPFTAAFGAFTNEVIWLIVISF  173



>gb|ACN34632.1| unknown [Zea mays]
 tpg|DAA40306.1| TPA: plastidic general dicarboxylate transporter [Zea mays]
Length=554

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 62/85 (73%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ SIA G+ + F+ P+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  89   PLVISIAIGLAVRFLAPRPVEVSPQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTAAVA  148

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T+TL F AAFSAF + + WLI ++F
Sbjct  149  TRTLPFTAAFSAFTNEVIWLIVISF  173



>ref|NP_001104868.1| plastidic general dicarboxylate transporter [Zea mays]
 dbj|BAD06220.1| plastidic general dicarboxylate transporter [Zea mays]
Length=554

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 62/85 (73%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ SIA G+ + F+ P+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  89   PLVISIAIGLAVRFLAPRPVEVSPQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTAAVA  148

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T+TL F AAFSAF + + WLI ++F
Sbjct  149  TRTLPFTAAFSAFTNEVIWLIVISF  173



>ref|WP_033930314.1| 2-oxoglutarate translocator [Vibrio cholerae]
Length=468

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +2

Query  344  LLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTK  523
            LLA I  G ILWF+P P G+   AWQ++++F+ T+V +I  PLPLGA+ALMGL A VL  
Sbjct  9    LLALIFFGSILWFIPPPEGLEPKAWQMMTVFVTTVVSLILAPLPLGAMALMGLCATVLLG  68

Query  524  TLTFAAAFSAFGDPIPWLIALAF  592
             L   +A + F DP  W+IA AF
Sbjct  69   ILPIKSALAGFSDPTIWMIAAAF  91



>ref|WP_018712252.1| hypothetical protein [Campylobacter ureolyticus]
Length=466

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = +2

Query  338  KPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            K L+     G+++WF+P    VS+ AWQL +I +ATI+G+I QPLP+GAVA +G+ A +L
Sbjct  5    KKLITLFVVGLVIWFIPHSDAVSKEAWQLFAIVVATILGLILQPLPIGAVAFIGVAAAML  64

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T TL+   A + FG    WLI  AF
Sbjct  65   TNTLSVKEALTGFGSGTIWLIVSAF  89



>ref|WP_006555548.1| divalent anion:Na+ symporter (DASS) family transporter [Veillonella 
ratti]
 gb|EKU78851.1| divalent anion:Na+ symporter (DASS) family transporter [Veillonella 
ratti ACS-216-V-Col6b]
Length=470

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I+ LL +IA GV++WF+P P G++  AW L ++F++TI+G I  PLP+GAVA +G+    
Sbjct  6    IRNLLITIAVGVVIWFLPVPNGITDQAWHLFAVFVSTILGFILAPLPIGAVAFLGVTIAA  65

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
            LT  +T + A S FG+   WLI  AF
Sbjct  66   LTGVITTSVAISGFGNSTIWLIICAF  91



>ref|XP_002460379.1| hypothetical protein SORBIDRAFT_02g027290 [Sorghum bicolor]
 gb|EER96900.1| hypothetical protein SORBIDRAFT_02g027290 [Sorghum bicolor]
Length=557

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 62/85 (73%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P + S+A G+ + F+ P+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  92   PFVISVAVGLAVRFLAPRPVEVSPQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTAAVA  151

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T+TL FAAAFSAF + + WLI ++F
Sbjct  152  TRTLPFAAAFSAFTNEVIWLIVISF  176



>ref|XP_003078785.1| 2-oxoglutarate/malate translocator (ISS) [Ostreococcus tauri]
 emb|CAL51665.1| Sodium/sulphate symporter [Ostreococcus tauri]
Length=565

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL  S+  G++++ +P P GV+  AW LL++F+ATIVGIIT PLPLGAVA++GLG  +
Sbjct  100  LKPLGYSVLAGLLIYLIPTPAGVTVKAWNLLAVFVATIVGIITNPLPLGAVAMIGLGVSM  159

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
                L F+AAFSAF   IPWLIALAF
Sbjct  160  TAGILPFSAAFSAFSSEIPWLIALAF  185



>ref|XP_006423815.1| hypothetical protein CICLE_v10028114mg [Citrus clementina]
 gb|ESR37055.1| hypothetical protein CICLE_v10028114mg [Citrus clementina]
Length=562

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 61/85 (72%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P + SI+ G+IL F VP+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL   ++
Sbjct  97   PFVISISIGLILRFLVPKPVEVSPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSIV  156

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T+TL F  AF+AF + + WLI ++F
Sbjct  157  TRTLAFPTAFAAFTNEVIWLIVISF  181



>ref|XP_004290424.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=545

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = +2

Query  335  IKPLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  511
            I PL+ S+A G+ + F VP+P  V+  AWQLL+IFL+TI G++  PLP+GA A +GL   
Sbjct  78   IAPLILSVAIGLAVRFLVPKPVQVTPQAWQLLAIFLSTIAGLVLSPLPVGAWAFLGLTTS  137

Query  512  VLTKTLTFAAAFSAFGDPIPWLIALAF  592
            V++ TLTF AAFSAF   + WLI ++F
Sbjct  138  VVSGTLTFPAAFSAFTSEVIWLIVISF  164



>ref|WP_042479679.1| 2-oxoglutarate translocator [Vibrio diazotrophicus]
Length=468

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +2

Query  365  GVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFAAA  544
            GVILWFVP P G++ NAWQ++ IF+ T++ +I  PLPLGA+AL+GL AC +   L    A
Sbjct  16   GVILWFVPVPDGLTDNAWQMMVIFVITVLSLILAPLPLGAMALIGLVACTVLGVLPIKTA  75

Query  545  FSAFGDPIPWLIALAF  592
             S F +P  W+IA AF
Sbjct  76   LSGFANPTIWMIAAAF  91



>ref|XP_006492620.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Citrus sinensis]
 gb|KDO45021.1| hypothetical protein CISIN_1g008532mg [Citrus sinensis]
Length=562

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 61/85 (72%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P + SI+ G+IL F VP+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL   ++
Sbjct  97   PFVISISIGLILRFLVPKPVEVSPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSIV  156

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T+TL F  AF+AF + + WLI ++F
Sbjct  157  TRTLAFPTAFAAFTNEVIWLIVISF  181



>ref|WP_041017059.1| 2-oxoglutarate translocator [Criblamydia sequanensis]
 emb|CDR33597.1| Na+-dependent transporter [Criblamydia sequanensis CRIB-18]
Length=467

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 54/86 (63%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            + P   + A G ++W +P P G++  +W L +IF+ATI G++ +PLP+G VA M L A +
Sbjct  5    VMPFFLTFAVGFLIWLLPIPEGITEQSWHLFAIFVATIFGVVARPLPMGGVAFMALAALI  64

Query  515  LTKTLTFAAAFSAFGDPIPWLIALAF  592
             TKTL F  AFS F +   WLI  A+
Sbjct  65   WTKTLPFDVAFSGFSNESVWLIVFAY  90



>dbj|BAD09285.1| putative glutamate/malate translocator [Oryza sativa Japonica 
Group]
 dbj|BAD10286.1| putative glutamate/malate translocator [Oryza sativa Japonica 
Group]
 gb|EAZ43108.1| hypothetical protein OsJ_27699 [Oryza sativa Japonica Group]
Length=555

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 60/85 (71%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PLL S+A G+ + F+ P+P  V+  AWQLLSIFL TI G++  PLP+GA A +GL A V 
Sbjct  90   PLLVSLAVGLAVRFLAPRPAEVTPQAWQLLSIFLTTIAGLVLGPLPVGAWAFLGLTATVA  149

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T+TL F AAF AF + + WLI ++F
Sbjct  150  TRTLPFTAAFGAFTNEVIWLIVISF  174



>emb|CAN78375.1| hypothetical protein VITISV_000698 [Vitis vinifera]
Length=564

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 61/85 (72%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P + SI+ G+I+ F VP+P  VS  AWQLL+IFL+T+ G++  PLP+GA A +GL   +L
Sbjct  99   PFIISISIGLIVRFLVPKPVQVSMQAWQLLAIFLSTVAGLVLNPLPVGAWAFLGLXTSIL  158

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T TL+F+ AF AF + + WLI ++F
Sbjct  159  TNTLSFSTAFGAFTNEVIWLIVISF  183



>ref|XP_004957073.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Setaria italica]
Length=549

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 61/85 (72%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S+A G+ + F+ P+P  VS   WQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  84   PLVISVAIGLAVRFLAPRPAEVSLQGWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTAAVA  143

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T+TL F AAFSAF + + WLI ++F
Sbjct  144  TRTLPFTAAFSAFTNEVIWLIVISF  168



>ref|WP_006637412.1| sodium/sulfate symporter YflS [Bacillus sonorensis]
 gb|EME75561.1| sodium/sulfate symporter YflS [Bacillus sonorensis L12]
Length=478

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            P +  +  GV++WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PFIIMVLAGVVIWFIPVPAGLDVKAWHLFAIFVATIIGFISKPLPMGAIAVFALAVTALT  76

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TL+     S FG+   WLI +AF
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAF  100



>ref|XP_010648147.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Vitis vinifera]
Length=573

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 61/85 (72%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P + SI+ G+I+ F VP+P  VS  AWQLL+IFL+T+ G++  PLP+GA A +GL   +L
Sbjct  108  PFIISISIGLIVRFLVPKPVQVSMQAWQLLAIFLSTVAGLVLNPLPVGAWAFLGLTTSIL  167

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T TL+F+ AF AF + + WLI ++F
Sbjct  168  TNTLSFSTAFGAFTNEVIWLIVISF  192



>ref|WP_029859134.1| hypothetical protein, partial [Vibrio parahaemolyticus]
Length=180

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +2

Query  344  LLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTK  523
            +L  +A G ILWF+P P G++  AWQ+++IF+ T++ +I  PLPLGA+ALMGL    L  
Sbjct  44   MLLLVAIGCILWFIPTPEGLTDQAWQMMAIFVTTVLSLILAPLPLGAMALMGLTLATLLG  103

Query  524  TLTFAAAFSAFGDPIPWLIALAF  592
             L    A + F  P  W+IA AF
Sbjct  104  VLPIKTALTGFAHPTIWMIAAAF  126



>ref|XP_010520600.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Tarenaya hassleriana]
Length=498

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 62/84 (74%), Gaps = 1/84 (1%)
 Frame = +2

Query  344  LLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            L+ S+A G+IL F VP+P  V+   W+LLSIFL+TI G++  PLP+GA A +GL   +++
Sbjct  34   LIISVAIGLILCFAVPKPKAVTSQGWRLLSIFLSTIAGLVLSPLPVGAWAFIGLTTSIVS  93

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
            +TL FAAAFSAF + + WLI ++F
Sbjct  94   RTLPFAAAFSAFLNEVIWLIVISF  117



>ref|WP_036800605.1| 2-oxoglutarate translocator [Pleurocapsa sp. PCC 7319]
Length=472

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  338  KPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            K  +  +  G++LWF+P P GV+  AW LL+IFLATI+G IT+PLP+GAVA++ L   V+
Sbjct  9    KSFIFPLFVGILLWFIPSPEGVNEQAWHLLAIFLATIIGFITKPLPIGAVAVIALTVSVI  68

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T TLT     S F     WL   +F
Sbjct  69   TDTLTIEQGLSGFSHKTAWLTVCSF  93



>dbj|BAJ99052.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=556

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 61/85 (72%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ASIA G+ + F+ P+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  91   PLVASIAVGLAVRFLAPRPPEVTPQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTATVA  150

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T TL F AAF AF + + WLI ++F
Sbjct  151  TGTLPFTAAFGAFTNEVIWLIVISF  175



>ref|WP_042357669.1| 2-oxoglutarate translocator [Bacillus sp. MT2]
Length=490

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL +IA G   W +P P G+  NAW LL IF+ATI G+I++PLP+GA+ ++ +   VLT
Sbjct  29   PLLITIAIGAAFWIIPAPSGLEVNAWHLLGIFIATIFGVISKPLPMGAICIVAITITVLT  88

Query  521  KTLTFAAAFSAFGDPIPWLIALAF  592
             TL    A S F +   WLI  AF
Sbjct  89   GTLKLEEALSGFSNSTIWLIVCAF  112



>dbj|BAK03702.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89524.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=556

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 61/85 (72%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ASIA G+ + F+ P+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  91   PLVASIAVGLAVRFLAPRPPEVTPQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTATVA  150

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T TL F AAF AF + + WLI ++F
Sbjct  151  TGTLPFTAAFGAFTNEVIWLIVISF  175



>ref|XP_001773473.1| predicted protein [Physcomitrella patens]
 gb|EDQ61673.1| predicted protein [Physcomitrella patens]
Length=494

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P + S+  G+ L F V +P  VS  AWQLL+IF +TI G++  PLP+GA A +GL   V+
Sbjct  29   PFVLSVGVGLALRFLVKKPEAVSMQAWQLLAIFASTITGLVLSPLPVGAWAFLGLTVAVV  88

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTLTFAAAF AF + + WLI ++F
Sbjct  89   TKTLTFAAAFGAFTNDVIWLIVISF  113



>ref|WP_016645858.1| divalent anion:Na+ symporter (DASS) family transporter [Campylobacter 
ureolyticus]
 gb|EPH10223.1| divalent anion:Na+ symporter (DASS) family transporter [Campylobacter 
ureolyticus ACS-301-V-Sch3b]
Length=466

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = +2

Query  338  KPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            K L+     G+++WF+P    +S+ AWQL +I +ATI+G+I QPLP+GAVA +G+ A +L
Sbjct  5    KKLITLFVVGLVIWFIPHSDALSKEAWQLFAIVVATILGLILQPLPIGAVAFIGVAAAML  64

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T TL+   A + FG    WLI  AF
Sbjct  65   TNTLSVKEALTGFGSGTIWLIVSAF  89



>ref|XP_007199747.1| hypothetical protein PRUPE_ppa003588mg [Prunus persica]
 gb|EMJ00946.1| hypothetical protein PRUPE_ppa003588mg [Prunus persica]
Length=563

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 61/85 (72%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P + SIA G+++ F VP+P  VS  AWQLL+IFL+TI G++  PLP+GA A +GL + ++
Sbjct  98   PFIISIAIGLVVRFLVPKPVEVSPQAWQLLAIFLSTIAGLVLSPLPVGAWAFLGLTSSIV  157

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T TL F  AFSAF + + WLI ++F
Sbjct  158  TGTLPFTTAFSAFTNEVIWLIVISF  182



>tpg|DAA47747.1| TPA: hypothetical protein ZEAMMB73_941040 [Zea mays]
Length=513

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 60/85 (71%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL  S+A G+ + F VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  86   PLFLSLAAGLAVRFLVPRPAEVTPEAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTATVA  145

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T+TL F AAF AF + + WLI ++F
Sbjct  146  TRTLPFTAAFGAFTNEVIWLIVISF  170



>ref|XP_007042895.1| Dicarboxylate transport 2.1 [Theobroma cacao]
 gb|EOX98726.1| Dicarboxylate transport 2.1 [Theobroma cacao]
Length=564

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 60/85 (71%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P   SI+ G+I+ F VP+P  V+  AWQLL+IFL+TI G++  PLP+GA A +GL   ++
Sbjct  99   PFFVSISIGLIVHFLVPKPVDVTPQAWQLLAIFLSTIAGLVLSPLPVGAWAFLGLTTSIV  158

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T+TL F  AFSAF + + WLI ++F
Sbjct  159  TRTLPFTTAFSAFTNEVIWLIVISF  183



>ref|XP_006660729.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Oryza brachyantha]
Length=552

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 61/85 (72%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PLL S+A G+ + F+ P+P  VS  AWQ LS+FL+TI G++  PLP+GA A +GL A V 
Sbjct  87   PLLVSLAVGLAVRFLAPRPPEVSPQAWQRLSVFLSTIAGLVLGPLPVGAWAFLGLTAAVA  146

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T TL FAAAFSAF + + WLI ++F
Sbjct  147  THTLPFAAAFSAFTNEVIWLIVISF  171



>dbj|BAJ86680.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=554

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 61/85 (72%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S+A G+ + F+ P+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL   V 
Sbjct  89   PLVVSLAAGLAVRFLAPRPAEVTLQAWQLLSIFLSTIAGLVLGPLPVGAWAFVGLTTAVA  148

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T+TL F AAFSAF + + WLI ++F
Sbjct  149  TQTLPFEAAFSAFTNEVIWLIVISF  173



>ref|XP_007511000.1| 2-oxoglutarate/malate translocator [Bathycoccus prasinos]
 emb|CCO66560.1| 2-oxoglutarate/malate translocator [Bathycoccus prasinos]
Length=573

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = +2

Query  335  IKPLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  511
            +K    S+  G+ + FV P+P GV   AW LLSIFLAT+ G++  PLP+GA A +GL   
Sbjct  108  LKAAAMSVGFGLFVCFVVPRPDGVVPQAWNLLSIFLATVAGLVLSPLPVGAWAFLGLTTA  167

Query  512  VLTKTLTFAAAFSAFGDPIPWLIALAF  592
            V+TKTLTFA AF A  + + WLI LAF
Sbjct  168  VVTKTLTFAQAFGAMTNDVIWLIVLAF  194



>emb|CDY31328.1| BnaA02g34130D [Brassica napus]
Length=557

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL  SI+ G+I+ F +P+P  V+   WQLLS+FL TI G++  PLP+GA A +GL A ++
Sbjct  92   PLAISISIGLIVRFLIPKPEQVTSQGWQLLSVFLFTISGLVLGPLPVGAWAFIGLTASIV  151

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T+TL+F+ AF+AF + + WLIA++F
Sbjct  152  TRTLSFSTAFAAFTNELIWLIAISF  176



>ref|WP_031828591.1| 2-oxoglutarate translocator, partial [Vibrio parahaemolyticus]
Length=192

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +2

Query  344  LLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTK  523
            +L  +A G ILWF+P P G++  AWQ+++IF+ T++ +I  PLPLGA+ALMGL    L  
Sbjct  8    MLLLVAIGCILWFIPTPEGLTDQAWQMMAIFVTTVLSLILAPLPLGAMALMGLTLATLLG  67

Query  524  TLTFAAAFSAFGDPIPWLIALAF  592
             L    A + F  P  W+IA AF
Sbjct  68   VLPIKTALTGFAHPTIWMIAAAF  90



>ref|NP_001104869.1| plastidic general dicarboxylate transporter [Zea mays]
 dbj|BAD06221.1| plastidic general dicarboxylate transporter [Zea mays]
 gb|ACN30635.1| unknown [Zea mays]
 tpg|DAA47746.1| TPA: plastidic general dicarboxylate transporter [Zea mays]
Length=551

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 60/85 (71%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL  S+A G+ + F VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  86   PLFLSLAAGLAVRFLVPRPAEVTPEAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTATVA  145

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T+TL F AAF AF + + WLI ++F
Sbjct  146  TRTLPFTAAFGAFTNEVIWLIVISF  170



>dbj|BAD06222.1| plastidic general dicarboxylate transporter [Zea mays]
Length=551

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 60/85 (71%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL  S+A G+ + F VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  86   PLFLSLAAGLAVRFLVPRPAEVTPEAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTATVA  145

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T+TL F AAF AF + + WLI ++F
Sbjct  146  TRTLPFTAAFGAFTNEVIWLIVISF  170



>ref|XP_008237290.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Prunus mume]
Length=563

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 61/85 (72%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P + S+A G+++ F VP+P  VS  AWQLL+IFL+TI G++  PLP+GA A +GL + ++
Sbjct  98   PFIISVAIGLVVRFLVPKPVEVSPQAWQLLAIFLSTIAGLVLSPLPVGAWAFLGLTSSIV  157

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            T TL F  AFSAF + + WLI ++F
Sbjct  158  TGTLPFTTAFSAFTNEVIWLIVISF  182



>ref|WP_025518842.1| hypothetical protein, partial [Vibrio parahaemolyticus]
Length=194

 Score = 79.3 bits (194),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +2

Query  344  LLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTK  523
            +L  +A G ILWF+P P G++  AWQ+++IF+ T++ +I  PLPLGA+ALMGL    L  
Sbjct  8    MLLLVAIGCILWFIPTPEGLTDQAWQMMAIFVTTVLSLILAPLPLGAMALMGLTLATLLG  67

Query  524  TLTFAAAFSAFGDPIPWLIALAF  592
             L    A + F  P  W+IA AF
Sbjct  68   VLPIKTALTGFAHPTIWMIAAAF  90



>ref|XP_002866606.1| DIT2.2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42865.1| DIT2.2 [Arabidopsis lyrata subsp. lyrata]
Length=551

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 62/85 (73%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL  SI+ G+I+ F +P+P  V+   WQLLSIFL TI G++  PLP+GA A +GL A ++
Sbjct  86   PLTISISIGLIVRFLIPRPEQVTSQGWQLLSIFLFTISGLVLGPLPVGAWAFIGLTASIV  145

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTL F+ AF+AF + + WLIA++F
Sbjct  146  TKTLPFSTAFAAFTNELIWLIAISF  170



>ref|XP_010461605.1| PREDICTED: dicarboxylate transporter 2.2, chloroplastic [Camelina 
sativa]
Length=549

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 62/85 (73%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL  SI+ G+I+ F+ P+P  V+   WQLLS+FL TI G++  PLP+GA A +GL A ++
Sbjct  84   PLAISISIGLIVRFIIPRPEQVTSQGWQLLSVFLFTISGLVLGPLPVGAWAFIGLTASIV  143

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTL F+ AF+AF + + WLIA++F
Sbjct  144  TKTLPFSTAFAAFTNELIWLIAISF  168



>sp|Q8L7Z9.1|DIT2_SPIOL RecName: Full=Dicarboxylate transporter 2, chloroplastic; AltName: 
Full=Glutamate/malate translocator; Flags: Precursor [Spinacia 
oleracea]
 gb|AAM89396.1| glutamate/malate translocator [Spinacia oleracea]
Length=564

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 62/85 (73%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G++L F VP+P  ++  AWQLL+IFL+T+ G++  PLP+GA A +G+ A V+
Sbjct  99   PLILSVSVGLLLRFAVPKPAELTPQAWQLLAIFLSTVAGLVLSPLPVGAWAFLGVTASVV  158

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTL F  AF AF + + WLI ++F
Sbjct  159  TKTLPFPTAFCAFTNEVIWLIVISF  183



>ref|XP_005850013.1| hypothetical protein CHLNCDRAFT_20518 [Chlorella variabilis]
 gb|EFN57911.1| hypothetical protein CHLNCDRAFT_20518 [Chlorella variabilis]
Length=561

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +2

Query  359  ATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFA  538
            A G  +W +P P GV+  AW+L ++FL+TI GII  PLPLGAV L+GL + +LT  +  +
Sbjct  72   AVGASVWLLPPPHGVAPAAWRLFAVFLSTITGIILTPLPLGAVCLLGLCSAMLTGAIPPS  131

Query  539  AAFSAFGDPIPWLIALAF  592
            AAFSAF   +PWL+A AF
Sbjct  132  AAFSAFASDLPWLVAAAF  149



>ref|XP_003531538.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Glycine max]
Length=557

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +2

Query  368  VILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFAAAF  547
            ++ + VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V+TKTLTF  AF
Sbjct  102  IVRFLVPKPVQVTPEAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTASVVTKTLTFTEAF  161

Query  548  SAFGDPIPWLIALAF  592
             AF + + WLI ++F
Sbjct  162  GAFTNEVIWLIVISF  176



>gb|KFK28119.1| hypothetical protein AALP_AA8G475100 [Arabis alpina]
Length=556

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL  SI+ G+I+ F+ P+P  V+   WQLLSIF+ TI+G++  PLP+GA A +GL A ++
Sbjct  91   PLAISISIGLIVRFIIPKPEPVTSQGWQLLSIFIFTILGLVLGPLPVGAWAFIGLTASIV  150

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTL F+ AF+AF + + WLIA++F
Sbjct  151  TKTLPFSTAFAAFTNELIWLIAISF  175



>dbj|BAK44253.1| dicarboxylate transporter [Eggerthella sp. YY7918]
Length=492

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +2

Query  353  SIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLT  532
            S+A GV+LWFVP P G+   AW + +IF ATIV +I +P+P+G++A+  +  CVLT T +
Sbjct  35   SVAIGVVLWFVPTPAGLETQAWHMFAIFAATIVALIIKPMPMGSIAICAIALCVLTNTTS  94

Query  533  FAAAFSAFGDPIPWLIALAF  592
                 S F +   WLI +AF
Sbjct  95   LKDGLSGFSNTTIWLIVIAF  114



>ref|NP_201233.1| dicarboxylate transporter 2.2 [Arabidopsis thaliana]
 sp|Q9FMF8.1|DIT22_ARATH RecName: Full=Dicarboxylate transporter 2.2, chloroplastic; AltName: 
Full=AtpDCT2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09859.1| 2-oxoglutarate/malate translocator [Arabidopsis thaliana]
 gb|AAK76567.1| putative 2-oxoglutarate/malate translocator protein [Arabidopsis 
thaliana]
 gb|AAM91759.1| putative 2-oxoglutarate/malate translocator protein [Arabidopsis 
thaliana]
 gb|AED97865.1| dicarboxylate transporter 2.2 [Arabidopsis thaliana]
Length=549

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 62/85 (73%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL  S++ G+I+ F +P+P  V+   WQLLSIFL TI G++  PLP+GA A +GL A ++
Sbjct  84   PLAISVSIGLIVRFLIPRPEQVTSQGWQLLSIFLFTISGLVLGPLPVGAWAFIGLTASIV  143

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTL F+ AF+AF + + WLIA++F
Sbjct  144  TKTLPFSTAFAAFTNELIWLIAISF  168



>ref|WP_029862441.1| 2-oxoglutarate translocator, partial [Vibrio parahaemolyticus]
Length=194

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +2

Query  344  LLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTK  523
            +L  +A G ILWF+P P G++  AWQ+++IF+ T++ +I  PLPLGA+ALMGL    L  
Sbjct  8    ILLLVAIGCILWFIPTPEGLTDQAWQMMAIFVTTVLSLILAPLPLGAMALMGLTLATLLG  67

Query  524  TLTFAAAFSAFGDPIPWLIALAF  592
             L    A + F  P  W+IA AF
Sbjct  68   VLPIKTALTGFAHPTIWMIAAAF  90



>ref|WP_029810646.1| 2-oxoglutarate translocator, partial [Vibrio parahaemolyticus]
Length=194

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +2

Query  356  IATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLTF  535
            +A G ILWF+P P G++  AWQ+++IF+ T++ +I  PLPLGA+ALMGL    L   L  
Sbjct  12   VAIGCILWFIPTPEGLTDQAWQMMAIFVTTVLSLILAPLPLGAMALMGLTLATLLGVLPI  71

Query  536  AAAFSAFGDPIPWLIALAF  592
              A + F  P  W+IA AF
Sbjct  72   KTALTGFAHPTIWMIAAAF  90



>ref|WP_041690951.1| 2-oxoglutarate translocator [Eggerthella sp. YY7918]
Length=473

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +2

Query  353  SIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLT  532
            S+A GV+LWFVP P G+   AW + +IF ATIV +I +P+P+G++A+  +  CVLT T +
Sbjct  16   SVAIGVVLWFVPTPAGLETQAWHMFAIFAATIVALIIKPMPMGSIAICAIALCVLTNTTS  75

Query  533  FAAAFSAFGDPIPWLIALAF  592
                 S F +   WLI +AF
Sbjct  76   LKDGLSGFSNTTIWLIVIAF  95



>ref|XP_010690536.1| PREDICTED: dicarboxylate transporter 2, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=559

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 62/85 (73%), Gaps = 1/85 (1%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ SI+ G+IL F VP+P  ++  AWQLL+IFL+T+ G++  PLP+GA A +G+ A V+
Sbjct  94   PLILSISIGLILRFIVPRPVELTLQAWQLLAIFLSTVAGLVLNPLPVGAWAFLGVTASVV  153

Query  518  TKTLTFAAAFSAFGDPIPWLIALAF  592
            TKTL F  AF AF + + WLI ++F
Sbjct  154  TKTLPFPTAFCAFTNEVIWLIVISF  178



>ref|WP_000493055.1| 2-oxoglutarate translocator [Vibrio mimicus]
 gb|EEW08270.1| di- and tricarboxylate transporter [Vibrio mimicus VM603]
Length=468

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +2

Query  344  LLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTK  523
            LLA I  G +LWF+P P G+   AWQ++ +F+ T++ +I  PLPLGA+ALMGL A VL  
Sbjct  9    LLALIVFGGLLWFMPVPEGLEPKAWQMMIVFITTVLSLILAPLPLGAMALMGLCATVLLD  68

Query  524  TLTFAAAFSAFGDPIPWLIALAF  592
             L   AA + F DP  W+IA AF
Sbjct  69   ILPIKAALAGFSDPTIWMIAAAF  91



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160