BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF008B17

Length=594
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KEH32684.1|  oligopeptide transporter OPT family protein             295   1e-93   Medicago truncatula
ref|XP_009590288.1|  PREDICTED: oligopeptide transporter 3              295   2e-91   Nicotiana tomentosiformis
gb|KEH32683.1|  oligopeptide transporter OPT family protein             293   5e-91   Medicago truncatula
ref|XP_006352325.1|  PREDICTED: oligopeptide transporter 3-like         293   5e-91   Solanum tuberosum [potatoes]
ref|XP_011095913.1|  PREDICTED: oligopeptide transporter 3              292   1e-90   Sesamum indicum [beniseed]
ref|XP_004250295.1|  PREDICTED: oligopeptide transporter 3              290   1e-89   Solanum lycopersicum
emb|CDP04526.1|  unnamed protein product                                290   2e-89   Coffea canephora [robusta coffee]
gb|EYU27660.1|  hypothetical protein MIMGU_mgv1a001879mg                287   1e-88   Erythranthe guttata [common monkey flower]
gb|KDO78545.1|  hypothetical protein CISIN_1g004659mg                   276   3e-88   Citrus sinensis [apfelsine]
ref|XP_010939248.1|  PREDICTED: oligopeptide transporter 3-like         285   6e-88   Elaeis guineensis
ref|XP_008785648.1|  PREDICTED: oligopeptide transporter 3-like         285   8e-88   Phoenix dactylifera
ref|XP_011040169.1|  PREDICTED: oligopeptide transporter 3              285   8e-88   Populus euphratica
ref|XP_002308764.1|  OLIGOPEPTIDE TRANSPORTER family protein            285   1e-87   Populus trichocarpa [western balsam poplar]
ref|XP_011002374.1|  PREDICTED: oligopeptide transporter 3-like         284   1e-87   Populus euphratica
gb|KDO78543.1|  hypothetical protein CISIN_1g004659mg                   278   1e-87   Citrus sinensis [apfelsine]
ref|XP_002273768.2|  PREDICTED: oligopeptide transporter 3              283   7e-87   Vitis vinifera
gb|KDO78544.1|  hypothetical protein CISIN_1g004659mg                   278   9e-87   Citrus sinensis [apfelsine]
ref|XP_004507597.1|  PREDICTED: oligopeptide transporter 3-like         282   9e-87   Cicer arietinum [garbanzo]
emb|CBI18634.3|  unnamed protein product                                282   1e-86   Vitis vinifera
ref|XP_007026363.1|  Oligopeptide transporter isoform 2                 280   1e-86   
ref|XP_007026362.1|  Oligopeptide transporter isoform 1                 280   5e-86   
ref|XP_009380132.1|  PREDICTED: oligopeptide transporter 3-like         280   6e-86   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007154044.1|  hypothetical protein PHAVU_003G086500g             280   8e-86   Phaseolus vulgaris [French bean]
ref|XP_010907563.1|  PREDICTED: oligopeptide transporter 3-like         279   9e-86   Elaeis guineensis
gb|KJB67417.1|  hypothetical protein B456_010G190300                    279   1e-85   Gossypium raimondii
ref|XP_006283198.1|  hypothetical protein CARUB_v10004230mg             277   6e-85   Capsella rubella
ref|XP_009773627.1|  PREDICTED: oligopeptide transporter 3              277   8e-85   Nicotiana sylvestris
gb|KHG20373.1|  Oligopeptide transporter 3 -like protein                277   8e-85   Gossypium arboreum [tree cotton]
sp|O23482.3|OPT3_ARATH  RecName: Full=Oligopeptide transporter 3;...    277   8e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008780991.1|  PREDICTED: oligopeptide transporter 3-like         276   1e-84   Phoenix dactylifera
ref|NP_567493.5|  oligopeptide transporter                              276   1e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003529676.1|  PREDICTED: oligopeptide transporter 3-like         276   1e-84   Glycine max [soybeans]
ref|XP_006414361.1|  hypothetical protein EUTSA_v10024512mg             276   2e-84   Eutrema salsugineum [saltwater cress]
gb|KDO78542.1|  hypothetical protein CISIN_1g004659mg                   276   2e-84   Citrus sinensis [apfelsine]
ref|XP_006449924.1|  hypothetical protein CICLE_v10014396mg             276   2e-84   Citrus clementina [clementine]
ref|XP_006467278.1|  PREDICTED: oligopeptide transporter 3-like         276   3e-84   Citrus sinensis [apfelsine]
ref|XP_002868139.1|  hypothetical protein ARALYDRAFT_355122             275   3e-84   Arabidopsis lyrata subsp. lyrata
ref|XP_010449801.1|  PREDICTED: oligopeptide transporter 3              275   4e-84   Camelina sativa [gold-of-pleasure]
ref|XP_003549274.1|  PREDICTED: oligopeptide transporter 3-like         275   4e-84   Glycine max [soybeans]
gb|AAK96781.1|  Unknown protein                                         275   4e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010440168.1|  PREDICTED: oligopeptide transporter 3-like         275   4e-84   Camelina sativa [gold-of-pleasure]
gb|KFK26550.1|  hypothetical protein AALP_AA8G263100                    275   4e-84   Arabis alpina [alpine rockcress]
ref|XP_010087657.1|  Oligopeptide transporter 3                         274   9e-84   
ref|XP_008224626.1|  PREDICTED: oligopeptide transporter 3              273   2e-83   Prunus mume [ume]
ref|XP_009124517.1|  PREDICTED: oligopeptide transporter 3              273   2e-83   Brassica rapa
ref|XP_010270227.1|  PREDICTED: oligopeptide transporter 3              273   2e-83   Nelumbo nucifera [Indian lotus]
ref|XP_007211357.1|  hypothetical protein PRUPE_ppa001984mg             273   2e-83   
ref|XP_010436532.1|  PREDICTED: oligopeptide transporter 3              273   3e-83   Camelina sativa [gold-of-pleasure]
gb|ABF70152.1|  oligopeptide transporter OPT family protein             273   4e-83   Musa acuminata [banana]
ref|XP_008464311.1|  PREDICTED: oligopeptide transporter 3              271   2e-82   Cucumis melo [Oriental melon]
ref|XP_009397220.1|  PREDICTED: oligopeptide transporter 3-like         271   2e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004139520.1|  PREDICTED: oligopeptide transporter 3-like         269   7e-82   Cucumis sativus [cucumbers]
emb|CDY42539.1|  BnaC08g10640D                                          269   7e-82   Brassica napus [oilseed rape]
gb|ADW09325.1|  oligopeptide transporter 3                              269   7e-82   Noccaea caerulescens
ref|XP_010686627.1|  PREDICTED: oligopeptide transporter 3              269   9e-82   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008345787.1|  PREDICTED: oligopeptide transporter 3-like         269   1e-81   Malus domestica [apple tree]
ref|XP_010039442.1|  PREDICTED: oligopeptide transporter 3-like         269   1e-81   Eucalyptus grandis [rose gum]
gb|KDP35505.1|  hypothetical protein JCGZ_08943                         268   2e-81   Jatropha curcas
ref|XP_009404107.1|  PREDICTED: oligopeptide transporter 3-like         267   5e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003559475.2|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    261   5e-81   
ref|XP_010057794.1|  PREDICTED: oligopeptide transporter 3-like         266   2e-80   Eucalyptus grandis [rose gum]
ref|XP_009374520.1|  PREDICTED: oligopeptide transporter 3              266   2e-80   Pyrus x bretschneideri [bai li]
ref|XP_010542186.1|  PREDICTED: oligopeptide transporter 3              261   4e-79   Tarenaya hassleriana [spider flower]
gb|AAO32313.1|  putative oligopeptide transporter protein               261   5e-79   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004295330.1|  PREDICTED: oligopeptide transporter 3              261   6e-79   Fragaria vesca subsp. vesca
ref|NP_001051290.1|  Os03g0751100                                       261   8e-79   
dbj|BAK07444.1|  predicted protein                                      261   1e-78   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008349335.1|  PREDICTED: oligopeptide transporter 3-like         259   3e-78   
ref|XP_009374859.1|  PREDICTED: oligopeptide transporter 3-like         259   5e-78   Pyrus x bretschneideri [bai li]
ref|XP_006651827.1|  PREDICTED: oligopeptide transporter 3-like         259   6e-78   
gb|KCW45990.1|  hypothetical protein EUGRSUZ_L00158                     257   3e-77   Eucalyptus grandis [rose gum]
ref|XP_002463867.1|  hypothetical protein SORBIDRAFT_01g007880          256   6e-77   Sorghum bicolor [broomcorn]
gb|ACL82964.1|  glutathione transporter                                 256   6e-77   Zea mays [maize]
gb|EMS48793.1|  Oligopeptide transporter 3                              252   9e-77   Triticum urartu
ref|XP_006856263.1|  hypothetical protein AMTR_s00047p00062520          255   1e-76   Amborella trichopoda
gb|EMT33592.1|  Oligopeptide transporter 3                              255   1e-76   
ref|XP_004981750.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    255   1e-76   
ref|XP_002522882.1|  Oligopeptide transporter, putative                 254   3e-76   
ref|XP_010039444.1|  PREDICTED: oligopeptide transporter 3-like i...    254   4e-76   Eucalyptus grandis [rose gum]
ref|XP_008665425.1|  PREDICTED: oligopeptide transporter 3              253   1e-75   
gb|ABB55328.1|  small oligopeptide transporter, OPT family              251   8e-75   Asparagus officinalis
gb|AAQ91200.1|  putative glutathione transporter                        246   2e-73   Zea mays [maize]
gb|ADW66457.1|  oligopeptide transporter                                236   2e-69   Phytolacca americana [common pokeberry]
gb|KHN42268.1|  Oligopeptide transporter 3                              232   3e-68   Glycine soja [wild soybean]
ref|XP_010039443.1|  PREDICTED: oligopeptide transporter 3-like         219   3e-63   Eucalyptus grandis [rose gum]
ref|XP_008374100.1|  PREDICTED: oligopeptide transporter 7-like i...    199   3e-59   
gb|KJB32170.1|  hypothetical protein B456_005G227300                    207   8e-59   Gossypium raimondii
ref|XP_010090590.1|  Oligopeptide transporter 7                         206   1e-58   
emb|CAB10414.1|  isp4 like protein                                      206   2e-58   Arabidopsis thaliana [mouse-ear cress]
gb|AEJ88342.1|  putative oligopeptide transporter                       202   3e-58   Tamarix hispida
ref|XP_008361590.1|  PREDICTED: oligopeptide transporter 2-like         202   4e-58   
ref|XP_002283680.1|  PREDICTED: oligopeptide transporter 4              204   9e-58   Vitis vinifera
ref|XP_010553673.1|  PREDICTED: oligopeptide transporter 2              204   9e-58   Tarenaya hassleriana [spider flower]
ref|XP_011070370.1|  PREDICTED: oligopeptide transporter 7              204   1e-57   Sesamum indicum [beniseed]
ref|XP_011078507.1|  PREDICTED: oligopeptide transporter 4-like         204   1e-57   Sesamum indicum [beniseed]
gb|KJB32172.1|  hypothetical protein B456_005G227300                    199   2e-57   Gossypium raimondii
emb|CBI19304.3|  unnamed protein product                                203   2e-57   Vitis vinifera
gb|EYU33488.1|  hypothetical protein MIMGU_mgv1a0023121mg               200   3e-57   Erythranthe guttata [common monkey flower]
gb|KDP41518.1|  hypothetical protein JCGZ_15925                         203   3e-57   Jatropha curcas
ref|XP_004136415.1|  PREDICTED: oligopeptide transporter 2-like         202   4e-57   Cucumis sativus [cucumbers]
ref|XP_011087976.1|  PREDICTED: oligopeptide transporter 4              202   4e-57   Sesamum indicum [beniseed]
gb|EMT01286.1|  Oligopeptide transporter 4                              202   5e-57   
ref|XP_002963418.1|  hypothetical protein SELMODRAFT_166204             202   6e-57   Selaginella moellendorffii
ref|XP_009775420.1|  PREDICTED: oligopeptide transporter 2-like         202   6e-57   Nicotiana sylvestris
emb|CDY06509.1|  BnaC06g11350D                                          191   6e-57   
ref|XP_002313213.2|  hypothetical protein POPTR_0009s08290g             202   7e-57   Populus trichocarpa [western balsam poplar]
ref|XP_008338986.1|  PREDICTED: oligopeptide transporter 2-like         201   7e-57   
ref|XP_006851884.1|  hypothetical protein AMTR_s00041p00121000          201   9e-57   
ref|XP_002981747.1|  hypothetical protein SELMODRAFT_179057             201   1e-56   Selaginella moellendorffii
ref|XP_009366376.1|  PREDICTED: oligopeptide transporter 2-like         201   1e-56   Pyrus x bretschneideri [bai li]
ref|XP_011016978.1|  PREDICTED: oligopeptide transporter 2              201   1e-56   Populus euphratica
ref|XP_009619170.1|  PREDICTED: oligopeptide transporter 2-like         201   1e-56   Nicotiana tomentosiformis
ref|XP_002967597.1|  hypothetical protein SELMODRAFT_88962              201   1e-56   Selaginella moellendorffii
ref|XP_008466130.1|  PREDICTED: oligopeptide transporter 2              201   1e-56   Cucumis melo [Oriental melon]
gb|EMS68344.1|  Oligopeptide transporter 4                              201   2e-56   Triticum urartu
ref|XP_009790410.1|  PREDICTED: oligopeptide transporter 4              201   2e-56   Nicotiana sylvestris
gb|EPS66512.1|  hypothetical protein M569_08265                         187   2e-56   Genlisea aurea
ref|XP_010676880.1|  PREDICTED: oligopeptide transporter 7-like         201   2e-56   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO67986.1|  hypothetical protein CISIN_1g029091mg                   188   2e-56   Citrus sinensis [apfelsine]
ref|XP_002301110.1|  oligopeptide transporter OPT family protein        200   2e-56   
emb|CAN79818.1|  hypothetical protein VITISV_040328                     200   3e-56   Vitis vinifera
gb|KJB24153.1|  hypothetical protein B456_004G130200                    200   3e-56   Gossypium raimondii
ref|XP_010254620.1|  PREDICTED: oligopeptide transporter 4-like         200   3e-56   Nelumbo nucifera [Indian lotus]
ref|XP_002263530.1|  PREDICTED: oligopeptide transporter 4              200   3e-56   Vitis vinifera
ref|XP_002971556.1|  hypothetical protein SELMODRAFT_172313             200   3e-56   Selaginella moellendorffii
ref|XP_004163578.1|  PREDICTED: oligopeptide transporter 7-like         200   3e-56   
ref|XP_011003045.1|  PREDICTED: oligopeptide transporter 4              200   3e-56   Populus euphratica
ref|XP_004143945.1|  PREDICTED: oligopeptide transporter 7-like         200   3e-56   Cucumis sativus [cucumbers]
ref|XP_004238028.1|  PREDICTED: oligopeptide transporter 4-like         200   4e-56   Solanum lycopersicum
dbj|BAJ97716.1|  predicted protein                                      197   4e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006364982.1|  PREDICTED: oligopeptide transporter 4-like         199   4e-56   Solanum tuberosum [potatoes]
ref|XP_004252726.1|  PREDICTED: oligopeptide transporter 2-like         199   4e-56   Solanum lycopersicum
ref|XP_002267184.1|  PREDICTED: oligopeptide transporter 1-like         199   5e-56   Vitis vinifera
ref|XP_007200086.1|  hypothetical protein PRUPE_ppa021086mg             199   6e-56   Prunus persica
gb|KHG17687.1|  Oligopeptide transporter 7                              199   6e-56   Gossypium arboreum [tree cotton]
ref|XP_002272972.2|  PREDICTED: oligopeptide transporter 7              199   7e-56   Vitis vinifera
gb|KHG17686.1|  Oligopeptide transporter 7                              199   7e-56   Gossypium arboreum [tree cotton]
ref|XP_002283674.1|  PREDICTED: oligopeptide transporter 4-like         199   7e-56   Vitis vinifera
ref|XP_010691453.1|  PREDICTED: oligopeptide transporter 4              199   8e-56   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP12213.1|  unnamed protein product                                199   9e-56   Coffea canephora [robusta coffee]
emb|CAN81605.1|  hypothetical protein VITISV_025060                     198   9e-56   Vitis vinifera
ref|XP_006417516.1|  hypothetical protein EUTSA_v10009349mg             198   9e-56   Eutrema salsugineum [saltwater cress]
ref|XP_009359568.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    199   1e-55   Pyrus x bretschneideri [bai li]
gb|EPS60835.1|  hypothetical protein M569_13965                         198   1e-55   Genlisea aurea
emb|CDO97358.1|  unnamed protein product                                190   1e-55   Coffea canephora [robusta coffee]
ref|XP_006351838.1|  PREDICTED: oligopeptide transporter 4-like         198   1e-55   Solanum tuberosum [potatoes]
emb|CDP19589.1|  unnamed protein product                                198   2e-55   Coffea canephora [robusta coffee]
ref|XP_010501399.1|  PREDICTED: oligopeptide transporter 2              198   2e-55   Camelina sativa [gold-of-pleasure]
gb|KDP25233.1|  hypothetical protein JCGZ_20389                         198   2e-55   Jatropha curcas
ref|XP_010475851.1|  PREDICTED: oligopeptide transporter 2-like         198   2e-55   Camelina sativa [gold-of-pleasure]
gb|KJB32169.1|  hypothetical protein B456_005G227300                    198   2e-55   Gossypium raimondii
ref|XP_006343795.1|  PREDICTED: oligopeptide transporter 7-like         198   2e-55   Solanum tuberosum [potatoes]
ref|XP_006376658.1|  hypothetical protein POPTR_0012s02660g             191   2e-55   
ref|XP_009801973.1|  PREDICTED: oligopeptide transporter 6-like         197   2e-55   Nicotiana sylvestris
gb|KHG09371.1|  Oligopeptide transporter 4 -like protein                197   2e-55   Gossypium arboreum [tree cotton]
emb|CBI39770.3|  unnamed protein product                                197   2e-55   Vitis vinifera
ref|XP_004245468.1|  PREDICTED: oligopeptide transporter 7-like         197   2e-55   Solanum lycopersicum
ref|XP_009368318.1|  PREDICTED: oligopeptide transporter 4              197   2e-55   Pyrus x bretschneideri [bai li]
ref|XP_004231372.1|  PREDICTED: oligopeptide transporter 4              197   3e-55   Solanum lycopersicum
ref|XP_010644607.1|  PREDICTED: oligopeptide transporter 1-like         197   3e-55   Vitis vinifera
ref|XP_008239235.1|  PREDICTED: oligopeptide transporter 7-like         197   3e-55   Prunus mume [ume]
ref|XP_006851891.1|  hypothetical protein AMTR_s00041p00133990          197   3e-55   
ref|XP_003581597.1|  PREDICTED: oligopeptide transporter 4-like         197   3e-55   Brachypodium distachyon [annual false brome]
gb|KJB32171.1|  hypothetical protein B456_005G227300                    198   3e-55   Gossypium raimondii
ref|XP_002892535.1|  ATOPT2                                             197   3e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_008390300.1|  PREDICTED: oligopeptide transporter 7 isofor...    196   4e-55   
ref|XP_010065750.1|  PREDICTED: oligopeptide transporter 4-like         197   4e-55   Eucalyptus grandis [rose gum]
ref|XP_010458316.1|  PREDICTED: oligopeptide transporter 2-like         197   4e-55   Camelina sativa [gold-of-pleasure]
ref|XP_006364985.1|  PREDICTED: oligopeptide transporter 2-like i...    196   5e-55   
ref|XP_006394156.1|  hypothetical protein EUTSA_v10003716mg             196   5e-55   Eutrema salsugineum [saltwater cress]
ref|XP_009612437.1|  PREDICTED: oligopeptide transporter 4              196   5e-55   Nicotiana tomentosiformis
ref|XP_008390299.1|  PREDICTED: oligopeptide transporter 7 isofor...    196   6e-55   Malus domestica [apple tree]
gb|EMS65129.1|  Oligopeptide transporter 7                              197   6e-55   Triticum urartu
ref|XP_009358688.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    196   6e-55   
ref|XP_006304646.1|  hypothetical protein CARUB_v10011782mg             196   6e-55   Capsella rubella
ref|XP_007039426.1|  Oligopeptide transporter 7 isoform 1               196   7e-55   
ref|XP_004309115.1|  PREDICTED: oligopeptide transporter 6-like         196   7e-55   Fragaria vesca subsp. vesca
ref|XP_004309550.1|  PREDICTED: oligopeptide transporter 7              196   7e-55   Fragaria vesca subsp. vesca
ref|XP_008437437.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    196   7e-55   Cucumis melo [Oriental melon]
ref|XP_010538850.1|  PREDICTED: oligopeptide transporter 7              196   8e-55   Tarenaya hassleriana [spider flower]
ref|XP_010029951.1|  PREDICTED: oligopeptide transporter 4-like         196   8e-55   Eucalyptus grandis [rose gum]
ref|XP_009765351.1|  PREDICTED: oligopeptide transporter 7-like         196   8e-55   Nicotiana sylvestris
ref|XP_008237085.1|  PREDICTED: oligopeptide transporter 4-like         196   9e-55   Prunus mume [ume]
ref|XP_008349603.1|  PREDICTED: oligopeptide transporter 5-like         190   9e-55   
ref|XP_002283691.1|  PREDICTED: oligopeptide transporter 2              196   9e-55   Vitis vinifera
gb|ABE65610.1|  oligopeptide transporter OPT family protein             196   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006364984.1|  PREDICTED: oligopeptide transporter 2-like i...    196   1e-54   Solanum tuberosum [potatoes]
ref|XP_010676881.1|  PREDICTED: oligopeptide transporter 7              196   1e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_172464.1|  oligopeptide transporter 2                            196   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009615073.1|  PREDICTED: oligopeptide transporter 4-like         196   1e-54   Nicotiana tomentosiformis
ref|XP_002437735.1|  hypothetical protein SORBIDRAFT_10g001530          196   1e-54   Sorghum bicolor [broomcorn]
ref|XP_004288878.1|  PREDICTED: oligopeptide transporter 2-like         196   1e-54   Fragaria vesca subsp. vesca
emb|CBI19303.3|  unnamed protein product                                196   1e-54   Vitis vinifera
emb|CDP00949.1|  unnamed protein product                                195   1e-54   Coffea canephora [robusta coffee]
gb|KJB58808.1|  hypothetical protein B456_009G227000                    195   1e-54   Gossypium raimondii
gb|KJB58807.1|  hypothetical protein B456_009G227000                    195   1e-54   Gossypium raimondii
emb|CDY31321.1|  BnaA02g34200D                                          195   1e-54   Brassica napus [oilseed rape]
ref|XP_009608843.1|  PREDICTED: oligopeptide transporter 7-like         195   1e-54   Nicotiana tomentosiformis
ref|XP_009130453.1|  PREDICTED: oligopeptide transporter 4              195   1e-54   Brassica rapa
ref|XP_010267481.1|  PREDICTED: oligopeptide transporter 7-like         195   2e-54   Nelumbo nucifera [Indian lotus]
emb|CDY46800.1|  BnaC02g43080D                                          195   2e-54   Brassica napus [oilseed rape]
ref|XP_007210345.1|  hypothetical protein PRUPE_ppa001827mg             195   2e-54   Prunus persica
gb|EMT31419.1|  Oligopeptide transporter 7                              184   2e-54   
ref|XP_010065749.1|  PREDICTED: oligopeptide transporter 4-like         195   2e-54   
ref|XP_008803573.1|  PREDICTED: oligopeptide transporter 4-like i...    194   2e-54   Phoenix dactylifera
gb|AAM64614.1|  Isp4-like protein                                       195   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201246.1|  oligopeptide transporter 4                            195   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008803572.1|  PREDICTED: oligopeptide transporter 4-like i...    194   2e-54   Phoenix dactylifera
ref|XP_006397011.1|  hypothetical protein EUTSA_v10028453mg             195   2e-54   Eutrema salsugineum [saltwater cress]
gb|EEE68909.1|  hypothetical protein OsJ_27765                          194   2e-54   Oryza sativa Japonica Group [Japonica rice]
gb|KHG27446.1|  Oligopeptide transporter 4 -like protein                195   2e-54   Gossypium arboreum [tree cotton]
gb|KCW63396.1|  hypothetical protein EUGRSUZ_G01042                     194   2e-54   Eucalyptus grandis [rose gum]
ref|XP_010461766.1|  PREDICTED: oligopeptide transporter 4-like         194   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010444374.1|  PREDICTED: oligopeptide transporter 4-like         194   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_004147543.1|  PREDICTED: oligopeptide transporter 4-like         194   2e-54   Cucumis sativus [cucumbers]
ref|XP_009601745.1|  PREDICTED: oligopeptide transporter 7-like         194   2e-54   Nicotiana tomentosiformis
ref|XP_010484229.1|  PREDICTED: oligopeptide transporter 4              194   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_009132469.1|  PREDICTED: oligopeptide transporter 9-like         194   3e-54   Brassica rapa
gb|KGN53886.1|  hypothetical protein Csa_4G179700                       194   3e-54   Cucumis sativus [cucumbers]
ref|XP_009108224.1|  PREDICTED: oligopeptide transporter 7              194   3e-54   Brassica rapa
ref|XP_006280078.1|  hypothetical protein CARUB_v10025959mg             194   3e-54   Capsella rubella
emb|CDX86844.1|  BnaA09g22340D                                          194   3e-54   
ref|XP_008239237.1|  PREDICTED: oligopeptide transporter 7              194   3e-54   Prunus mume [ume]
emb|CDP19590.1|  unnamed protein product                                194   3e-54   Coffea canephora [robusta coffee]
ref|XP_002303684.2|  hypothetical protein POPTR_0003s14540g             194   3e-54   
ref|XP_006289826.1|  hypothetical protein CARUB_v10003431mg             194   3e-54   Capsella rubella
ref|XP_002447030.1|  hypothetical protein SORBIDRAFT_06g027230          194   3e-54   Sorghum bicolor [broomcorn]
ref|XP_002866614.1|  hypothetical protein ARALYDRAFT_496649             194   4e-54   Arabidopsis lyrata subsp. lyrata
gb|KFK31865.1|  hypothetical protein AALP_AA6G168500                    194   4e-54   Arabis alpina [alpine rockcress]
ref|XP_010455470.1|  PREDICTED: oligopeptide transporter 7-like         194   4e-54   Camelina sativa [gold-of-pleasure]
ref|NP_001062118.1|  Os08g0492000                                       194   4e-54   
ref|XP_003555686.1|  PREDICTED: oligopeptide transporter 7              194   4e-54   Glycine max [soybeans]
ref|XP_009616769.1|  PREDICTED: oligopeptide transporter 2-like         193   6e-54   Nicotiana tomentosiformis
ref|XP_010422002.1|  PREDICTED: oligopeptide transporter 7              194   6e-54   Camelina sativa [gold-of-pleasure]
ref|NP_192815.1|  oligopeptide transporter 7                            193   7e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006376659.1|  hypothetical protein POPTR_0012s02660g             191   7e-54   
ref|XP_009128701.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    193   8e-54   Brassica rapa
ref|XP_010436760.1|  PREDICTED: oligopeptide transporter 7-like         193   8e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010104574.1|  Oligopeptide transporter 4                         193   1e-53   Morus notabilis
ref|XP_010267482.1|  PREDICTED: oligopeptide transporter 7-like         193   1e-53   Nelumbo nucifera [Indian lotus]
ref|XP_010246854.1|  PREDICTED: oligopeptide transporter 7-like         192   1e-53   Nelumbo nucifera [Indian lotus]
ref|XP_008663549.1|  PREDICTED: oligopeptide transporter 4-like         192   1e-53   Zea mays [maize]
ref|XP_010520948.1|  PREDICTED: oligopeptide transporter 6              192   2e-53   Tarenaya hassleriana [spider flower]
ref|XP_009407958.1|  PREDICTED: oligopeptide transporter 7-like         192   2e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011022429.1|  PREDICTED: oligopeptide transporter 7-like         192   2e-53   Populus euphratica
dbj|BAJ87692.1|  predicted protein                                      192   2e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008803571.1|  PREDICTED: oligopeptide transporter 4-like i...    192   2e-53   Phoenix dactylifera
ref|XP_010053083.1|  PREDICTED: oligopeptide transporter 7              192   2e-53   Eucalyptus grandis [rose gum]
emb|CDY35662.1|  BnaC09g29840D                                          192   2e-53   Brassica napus [oilseed rape]
emb|CDY14374.1|  BnaA10g06810D                                          192   2e-53   Brassica napus [oilseed rape]
gb|EPS60258.1|  hypothetical protein M569_14546                         192   2e-53   Genlisea aurea
ref|XP_002527347.1|  Oligopeptide transporter, putative                 192   2e-53   Ricinus communis
emb|CDY25261.1|  BnaA02g21950D                                          192   2e-53   Brassica napus [oilseed rape]
ref|XP_006655737.1|  PREDICTED: oligopeptide transporter 7-like         192   2e-53   
ref|XP_009119900.1|  PREDICTED: oligopeptide transporter 9              192   2e-53   Brassica rapa
ref|XP_010244695.1|  PREDICTED: oligopeptide transporter 4-like         192   3e-53   Nelumbo nucifera [Indian lotus]
ref|XP_008790539.1|  PREDICTED: oligopeptide transporter 7-like         192   3e-53   Phoenix dactylifera
gb|KJB40152.1|  hypothetical protein B456_007G049100                    191   3e-53   Gossypium raimondii
ref|XP_006433763.1|  hypothetical protein CICLE_v10003230mg             191   3e-53   
gb|KCW70462.1|  hypothetical protein EUGRSUZ_F03679                     191   3e-53   Eucalyptus grandis [rose gum]
ref|XP_010934151.1|  PREDICTED: oligopeptide transporter 7-like         191   3e-53   
gb|KFK26970.1|  hypothetical protein AALP_AA8G317000                    191   4e-53   Arabis alpina [alpine rockcress]
ref|XP_010064976.1|  PREDICTED: oligopeptide transporter 1-like         191   4e-53   Eucalyptus grandis [rose gum]
ref|XP_010029956.1|  PREDICTED: oligopeptide transporter 4-like         191   4e-53   Eucalyptus grandis [rose gum]
ref|XP_008454451.1|  PREDICTED: oligopeptide transporter 4              191   4e-53   Cucumis melo [Oriental melon]
gb|KCW56912.1|  hypothetical protein EUGRSUZ_I02589                     191   4e-53   Eucalyptus grandis [rose gum]
ref|XP_004964383.1|  PREDICTED: oligopeptide transporter 7-like i...    191   4e-53   Setaria italica
ref|XP_010537060.1|  PREDICTED: oligopeptide transporter 6-like         191   4e-53   Tarenaya hassleriana [spider flower]
ref|XP_004235114.1|  PREDICTED: oligopeptide transporter 6              191   4e-53   Solanum lycopersicum
ref|XP_004502063.1|  PREDICTED: oligopeptide transporter 7-like         191   4e-53   Cicer arietinum [garbanzo]
ref|XP_009349149.1|  PREDICTED: oligopeptide transporter 1-like         191   5e-53   Pyrus x bretschneideri [bai li]
gb|EEC79904.1|  hypothetical protein OsI_21444                          191   5e-53   Oryza sativa Indica Group [Indian rice]
ref|XP_008800083.1|  PREDICTED: oligopeptide transporter 4-like         191   5e-53   Phoenix dactylifera
ref|XP_006376657.1|  hypothetical protein POPTR_0012s02650g             191   5e-53   
ref|XP_004138881.1|  PREDICTED: oligopeptide transporter 6-like         191   6e-53   
ref|XP_004160803.1|  PREDICTED: oligopeptide transporter 6-like         191   6e-53   
ref|XP_006350626.1|  PREDICTED: oligopeptide transporter 7-like         191   6e-53   Solanum tuberosum [potatoes]
gb|KDO76687.1|  hypothetical protein CISIN_1g010747mg                   186   6e-53   Citrus sinensis [apfelsine]
gb|EMT05384.1|  Oligopeptide transporter 4                              180   6e-53   
ref|XP_011043664.1|  PREDICTED: oligopeptide transporter 9-like         191   6e-53   
ref|XP_006452634.1|  hypothetical protein CICLE_v10007552mg             191   7e-53   
ref|XP_006474840.1|  PREDICTED: oligopeptide transporter 1-like         191   7e-53   
ref|XP_007145948.1|  hypothetical protein PHAVU_006G000100g             191   7e-53   
ref|XP_008806360.1|  PREDICTED: oligopeptide transporter 7-like         191   8e-53   
gb|KDO76688.1|  hypothetical protein CISIN_1g010747mg                   186   8e-53   
gb|KDO59178.1|  hypothetical protein CISIN_1g0044241mg                  190   8e-53   
ref|XP_010048814.1|  PREDICTED: oligopeptide transporter 6              190   8e-53   
ref|XP_006380596.1|  hypothetical protein POPTR_0007s09650g             190   8e-53   
dbj|BAJ85948.1|  predicted protein                                      190   8e-53   
ref|XP_002306519.1|  hypothetical protein POPTR_0005s19410g             190   9e-53   
ref|XP_011078828.1|  PREDICTED: oligopeptide transporter 7-like i...    190   1e-52   
ref|XP_011078837.1|  PREDICTED: oligopeptide transporter 7-like i...    190   1e-52   
ref|NP_001056665.1|  Os06g0127700                                       190   1e-52   
ref|XP_010244696.1|  PREDICTED: oligopeptide transporter 4-like         190   1e-52   
ref|XP_003601453.1|  Oligopeptide transporter                           190   1e-52   
ref|XP_008394097.1|  PREDICTED: oligopeptide transporter 7-like         190   1e-52   
ref|XP_007042780.1|  Oligopeptide transporter 4                         191   1e-52   
ref|XP_002518892.1|  Oligopeptide transporter, putative                 190   1e-52   
gb|AES71704.2|  oligopeptide transporter OPT family protein             189   1e-52   
ref|XP_009412736.1|  PREDICTED: oligopeptide transporter 7-like         190   1e-52   
gb|KJB40153.1|  hypothetical protein B456_007G049100                    189   2e-52   
ref|XP_002317799.2|  hypothetical protein POPTR_0012s02660g             189   2e-52   
ref|XP_006475109.1|  PREDICTED: oligopeptide transporter 1-like         189   2e-52   
ref|XP_009126974.1|  PREDICTED: oligopeptide transporter 1              189   2e-52   
ref|XP_011015796.1|  PREDICTED: oligopeptide transporter 4-like         189   2e-52   
emb|CDY06549.1|  BnaC02g12730D                                          189   2e-52   
ref|XP_006401695.1|  hypothetical protein EUTSA_v10016096mg             189   2e-52   
ref|XP_010064977.1|  PREDICTED: oligopeptide transporter 1-like         189   2e-52   
ref|XP_002874647.1|  ATOPT7                                             189   2e-52   
gb|KDP42149.1|  hypothetical protein JCGZ_03016                         189   2e-52   
ref|XP_003564333.1|  PREDICTED: oligopeptide transporter 7-like         189   2e-52   
ref|XP_008349390.1|  PREDICTED: oligopeptide transporter 1-like         183   2e-52   
ref|XP_007220230.1|  hypothetical protein PRUPE_ppa002014mg             189   2e-52   
emb|CDY19030.1|  BnaC01g20380D                                          189   3e-52   
gb|KHG27803.1|  Oligopeptide transporter 7 -like protein                189   3e-52   
ref|XP_006472404.1|  PREDICTED: oligopeptide transporter 4-like         189   3e-52   
ref|XP_006856596.1|  hypothetical protein AMTR_s00046p00213370          189   3e-52   
ref|XP_008234693.1|  PREDICTED: oligopeptide transporter 6-like         189   3e-52   
ref|XP_006452632.1|  hypothetical protein CICLE_v10010604mg             189   3e-52   
ref|XP_008806363.1|  PREDICTED: oligopeptide transporter 7-like         189   3e-52   
ref|XP_010112260.1|  Oligopeptide transporter 4                         189   3e-52   
emb|CDP01884.1|  unnamed protein product                                189   3e-52   
ref|XP_006474839.1|  PREDICTED: oligopeptide transporter 1-like         189   3e-52   
ref|XP_002275134.2|  PREDICTED: oligopeptide transporter 6-like         188   3e-52   
dbj|BAD08159.1|  sexual differentiation process protein isp4-like       178   3e-52   
gb|KDO76686.1|  hypothetical protein CISIN_1g010747mg                   186   4e-52   
ref|XP_010320236.1|  PREDICTED: oligopeptide transporter 2-like         188   4e-52   
ref|XP_007207290.1|  hypothetical protein PRUPE_ppa014997mg             188   4e-52   
ref|XP_010671041.1|  PREDICTED: oligopeptide transporter 2              188   4e-52   
gb|KDP35526.1|  hypothetical protein JCGZ_08964                         188   4e-52   
ref|XP_008445076.1|  PREDICTED: oligopeptide transporter 6-like         188   4e-52   
ref|XP_008378664.1|  PREDICTED: oligopeptide transporter 2-like         188   5e-52   
ref|XP_004289821.1|  PREDICTED: oligopeptide transporter 4              188   5e-52   
ref|XP_004288877.2|  PREDICTED: oligopeptide transporter 2-like         188   5e-52   
ref|XP_008241834.1|  PREDICTED: oligopeptide transporter 7-like         188   5e-52   
ref|XP_009795358.1|  PREDICTED: oligopeptide transporter 2-like         188   6e-52   
ref|XP_006660244.1|  PREDICTED: oligopeptide transporter 5-like         188   6e-52   
ref|XP_002518328.1|  Oligopeptide transporter, putative                 188   6e-52   
ref|XP_008445079.1|  PREDICTED: oligopeptide transporter 6-like         187   7e-52   
gb|KHN03544.1|  Oligopeptide transporter 3                              187   7e-52   
ref|XP_004973781.1|  PREDICTED: oligopeptide transporter 1-like         187   8e-52   
ref|XP_006340746.1|  PREDICTED: oligopeptide transporter 7-like         187   8e-52   
ref|XP_010520694.1|  PREDICTED: oligopeptide transporter 4              187   8e-52   
ref|XP_010933427.1|  PREDICTED: oligopeptide transporter 4-like         187   8e-52   
gb|KFK28135.1|  hypothetical protein AALP_AA8G476800                    189   8e-52   
ref|NP_200163.1|  oligopeptide transporter 9                            187   9e-52   
gb|KDO59179.1|  hypothetical protein CISIN_1g004845mg                   187   9e-52   
ref|NP_001056651.1|  Os06g0125500                                       187   1e-51   
ref|XP_007039133.1|  Oligopeptide transporter 1 isoform 2               186   1e-51   
ref|XP_006474841.1|  PREDICTED: oligopeptide transporter 1-like         187   1e-51   
ref|XP_006486776.1|  PREDICTED: oligopeptide transporter 4-like         187   1e-51   
ref|XP_004160804.1|  PREDICTED: oligopeptide transporter 6-like         187   1e-51   
ref|XP_004953568.1|  PREDICTED: oligopeptide transporter 4-like i...    187   1e-51   
ref|XP_004953567.1|  PREDICTED: oligopeptide transporter 4-like i...    187   1e-51   
ref|XP_007204095.1|  hypothetical protein PRUPE_ppa002122mg             187   1e-51   
ref|XP_009379386.1|  PREDICTED: oligopeptide transporter 7-like         187   1e-51   
ref|XP_007039132.1|  Oligopeptide transporter 1 isoform 1               187   1e-51   
ref|XP_009367290.1|  PREDICTED: oligopeptide transporter 1-like         187   1e-51   
ref|XP_009379497.1|  PREDICTED: oligopeptide transporter 1-like         187   1e-51   
ref|XP_002864247.1|  ATOPT9                                             187   2e-51   
gb|EPS62495.1|  hypothetical protein M569_12295                         186   2e-51   
ref|XP_002529653.1|  Oligopeptide transporter, putative                 187   2e-51   
ref|XP_006452635.1|  hypothetical protein CICLE_v10007550mg             186   2e-51   
gb|EMT07894.1|  Oligopeptide transporter 7                              186   2e-51   
ref|XP_010252553.1|  PREDICTED: oligopeptide transporter 7-like         186   2e-51   
ref|XP_002515831.1|  Oligopeptide transporter, putative                 186   3e-51   
gb|KCW56911.1|  hypothetical protein EUGRSUZ_I02587                     186   3e-51   
ref|XP_002960906.1|  hypothetical protein SELMODRAFT_229868             186   3e-51   
ref|XP_008374101.1|  PREDICTED: oligopeptide transporter 7-like i...    175   3e-51   
ref|XP_010934487.1|  PREDICTED: oligopeptide transporter 7              186   3e-51   
ref|XP_007137663.1|  hypothetical protein PHAVU_009G145300g             186   3e-51   
ref|XP_011074283.1|  PREDICTED: oligopeptide transporter 4-like         186   3e-51   
ref|XP_008219410.1|  PREDICTED: oligopeptide transporter 1-like         186   3e-51   
ref|XP_003603705.1|  Oligopeptide transporter                           186   3e-51   
ref|XP_009118291.1|  PREDICTED: oligopeptide transporter 2              186   3e-51   
ref|XP_010030911.1|  PREDICTED: oligopeptide transporter 4-like         186   3e-51   
emb|CDY11969.1|  BnaC03g13950D                                          186   3e-51   
ref|XP_009391956.1|  PREDICTED: oligopeptide transporter 7-like         186   3e-51   
emb|CDY69955.1|  BnaCnng66090D                                          186   4e-51   
gb|KFK29294.1|  hypothetical protein AALP_AA7G114600                    186   4e-51   
ref|XP_010482752.1|  PREDICTED: oligopeptide transporter 9              186   4e-51   
ref|XP_006401399.1|  hypothetical protein EUTSA_v10012759mg             186   4e-51   
ref|XP_010649021.1|  PREDICTED: oligopeptide transporter 7-like         186   4e-51   
ref|XP_006422648.1|  hypothetical protein CICLE_v10027887mg             185   4e-51   
ref|NP_194389.1|  oligopeptide transporter 5                            186   4e-51   
dbj|BAD67732.1|  putative sexual differentiation process protein ...    186   4e-51   
ref|XP_006422647.1|  hypothetical protein CICLE_v10027887mg             185   4e-51   
ref|NP_001130398.1|  uncharacterized protein LOC100191494               186   5e-51   
gb|EYU45286.1|  hypothetical protein MIMGU_mgv1a0020142mg               183   5e-51   
gb|KJB39494.1|  hypothetical protein B456_007G016300                    185   5e-51   
ref|XP_006452637.1|  hypothetical protein CICLE_v10007550mg             185   6e-51   
ref|XP_004972025.1|  PREDICTED: oligopeptide transporter 4-like         185   6e-51   
ref|XP_007046673.1|  Oligopeptide transporter 7 isoform 1               185   6e-51   
ref|XP_003572326.1|  PREDICTED: oligopeptide transporter 5-like         185   6e-51   
ref|XP_002298878.2|  hypothetical protein POPTR_0001s37840g             185   6e-51   
ref|XP_008663011.1|  PREDICTED: oligopeptide transporter 5-like         185   6e-51   
ref|XP_004287803.1|  PREDICTED: oligopeptide transporter 7-like         185   7e-51   
ref|XP_002864417.1|  ATOPT1                                             185   7e-51   
ref|XP_002452706.1|  hypothetical protein SORBIDRAFT_04g031070          185   8e-51   
ref|XP_009795933.1|  PREDICTED: oligopeptide transporter 7-like i...    184   9e-51   
ref|XP_009143920.1|  PREDICTED: oligopeptide transporter 6              184   9e-51   
ref|XP_010064240.1|  PREDICTED: oligopeptide transporter 4-like         184   9e-51   
ref|XP_010030910.1|  PREDICTED: oligopeptide transporter 4-like         184   9e-51   
ref|XP_002967106.1|  hypothetical protein SELMODRAFT_87413              184   1e-50   
ref|XP_004953566.1|  PREDICTED: oligopeptide transporter 4-like         184   1e-50   
ref|XP_009591882.1|  PREDICTED: oligopeptide transporter 7-like         184   1e-50   
ref|XP_009413226.1|  PREDICTED: oligopeptide transporter 4-like         184   1e-50   
ref|XP_007020440.1|  Oligopeptide transporter 5                         184   1e-50   
ref|XP_006476310.1|  PREDICTED: oligopeptide transporter 7-like i...    184   1e-50   
ref|XP_004976663.1|  PREDICTED: oligopeptide transporter 4-like         184   1e-50   
ref|XP_010040072.1|  PREDICTED: oligopeptide transporter 7-like         184   1e-50   
gb|KCW53168.1|  hypothetical protein EUGRSUZ_J02449                     182   1e-50   
ref|XP_010445886.1|  PREDICTED: oligopeptide transporter 8              184   1e-50   
gb|EPS68970.1|  hypothetical protein M569_05793                         184   1e-50   
ref|XP_006476309.1|  PREDICTED: oligopeptide transporter 7-like i...    184   1e-50   
ref|XP_008366119.1|  PREDICTED: oligopeptide transporter 1-like         182   1e-50   
ref|XP_011043662.1|  PREDICTED: oligopeptide transporter 9-like         184   1e-50   
gb|AES90550.2|  oligopeptide transporter OPT family protein             184   1e-50   
emb|CDY22616.1|  BnaC08g42500D                                          185   2e-50   
ref|XP_010545870.1|  PREDICTED: oligopeptide transporter 1-like         184   2e-50   
ref|XP_008646108.1|  PREDICTED: oligopeptide transporter 4-like         184   2e-50   
ref|NP_001152089.1|  oligopeptide transporter 4                         184   2e-50   
emb|CDP04527.1|  unnamed protein product                                183   2e-50   
ref|XP_006439250.1|  hypothetical protein CICLE_v10018971mg             184   2e-50   
gb|KFK27168.1|  hypothetical protein AALP_AA8G344300                    184   2e-50   
emb|CCO06497.1|  oligopeptide transporter                               184   2e-50   
gb|KCW53167.1|  hypothetical protein EUGRSUZ_J02449                     182   2e-50   
ref|XP_004151247.1|  PREDICTED: oligopeptide transporter 1-like         184   2e-50   
ref|XP_008339039.1|  PREDICTED: oligopeptide transporter 2-like         184   2e-50   
ref|XP_004138770.1|  PREDICTED: oligopeptide transporter 6-like         184   2e-50   
gb|KGN44392.1|  hypothetical protein Csa_7G279240                       184   2e-50   
ref|XP_003608353.1|  Oligopeptide transporter                           183   2e-50   
gb|KFK29177.1|  hypothetical protein AALP_AA7G099400                    184   2e-50   
ref|XP_010446080.1|  PREDICTED: oligopeptide transporter 9-like         183   2e-50   
gb|EMS45172.1|  Oligopeptide transporter 7                              185   2e-50   
ref|XP_006439249.1|  hypothetical protein CICLE_v10018971mg             184   2e-50   
gb|EYU21027.1|  hypothetical protein MIMGU_mgv1a026700mg                183   2e-50   
ref|XP_009773684.1|  PREDICTED: oligopeptide transporter 7-like i...    183   2e-50   
ref|XP_008677393.1|  PREDICTED: oligopeptide transporter 4 isofor...    183   2e-50   
ref|XP_002452707.1|  hypothetical protein SORBIDRAFT_04g031080          183   2e-50   
ref|XP_010483061.1|  PREDICTED: oligopeptide transporter 1              183   3e-50   
ref|XP_003522539.1|  PREDICTED: oligopeptide transporter 9-like         183   3e-50   
ref|XP_010443233.1|  PREDICTED: oligopeptide transporter 1-like         183   3e-50   
ref|XP_010109222.1|  Oligopeptide transporter 6                         183   3e-50   
ref|XP_002530420.1|  Oligopeptide transporter, putative                 182   3e-50   
ref|XP_006343361.1|  PREDICTED: oligopeptide transporter 7-like         183   3e-50   
ref|XP_008440830.1|  PREDICTED: oligopeptide transporter 7-like         183   3e-50   
ref|XP_002445962.1|  hypothetical protein SORBIDRAFT_07g028740          183   3e-50   
ref|XP_003547106.1|  PREDICTED: oligopeptide transporter 4-like         183   3e-50   
ref|XP_011008821.1|  PREDICTED: oligopeptide transporter 7-like         183   4e-50   
ref|XP_003557106.2|  PREDICTED: oligopeptide transporter 7-like i...    183   4e-50   
gb|EYU33719.1|  hypothetical protein MIMGU_mgv1a024635mg                182   4e-50   
ref|XP_010052485.1|  PREDICTED: oligopeptide transporter 1-like         182   4e-50   
ref|XP_010450442.1|  PREDICTED: oligopeptide transporter 1-like         182   4e-50   
ref|XP_003519862.1|  PREDICTED: oligopeptide transporter 7-like         182   4e-50   
gb|KCW76554.1|  hypothetical protein EUGRSUZ_D00943                     182   5e-50   
ref|XP_010442919.1|  PREDICTED: oligopeptide transporter 8-like         182   5e-50   
ref|XP_011038841.1|  PREDICTED: oligopeptide transporter 1 isofor...    182   5e-50   
ref|XP_006425444.1|  hypothetical protein CICLE_v10024968mg             181   5e-50   
ref|XP_003527991.1|  PREDICTED: oligopeptide transporter 9-like         182   5e-50   
ref|XP_008466652.1|  PREDICTED: oligopeptide transporter 4-like         182   5e-50   
ref|NP_200164.1|  oligopeptide transporter 8                            182   5e-50   
ref|XP_002864248.1|  predicted protein                                  182   5e-50   
ref|XP_004135024.1|  PREDICTED: oligopeptide transporter 7-like         183   5e-50   
ref|XP_006655730.1|  PREDICTED: oligopeptide transporter 7-like         182   5e-50   
ref|XP_002298879.1|  oligopeptide transporter OPT family protein        182   6e-50   
gb|KGN48927.1|  hypothetical protein Csa_6G506530                       182   6e-50   
ref|XP_006285678.1|  hypothetical protein CARUB_v10007142mg             182   6e-50   
ref|XP_010228050.1|  PREDICTED: oligopeptide transporter 7-like i...    182   6e-50   
ref|XP_004169608.1|  PREDICTED: oligopeptide transporter 7-like         182   7e-50   
ref|XP_007136469.1|  hypothetical protein PHAVU_009G047800g             182   7e-50   
ref|XP_009366375.1|  PREDICTED: oligopeptide transporter 2-like         182   7e-50   
gb|EYU33718.1|  hypothetical protein MIMGU_mgv1a002007mg                182   8e-50   
ref|XP_011097739.1|  PREDICTED: oligopeptide transporter 1-like         182   8e-50   
ref|XP_008219210.1|  PREDICTED: oligopeptide transporter 2-like         182   8e-50   
ref|XP_006433764.1|  hypothetical protein CICLE_v10003491mg             182   8e-50   
ref|XP_011075935.1|  PREDICTED: oligopeptide transporter 6              182   8e-50   
ref|XP_006472993.1|  PREDICTED: oligopeptide transporter 2-like         182   8e-50   
ref|XP_003617851.1|  Oligopeptide transporter OPT family                182   8e-50   
ref|XP_003570148.1|  PREDICTED: oligopeptide transporter 4-like         182   8e-50   
ref|XP_010064243.1|  PREDICTED: oligopeptide transporter 4-like         182   9e-50   
gb|AET00810.2|  oligopeptide transporter OPT family protein             182   9e-50   
ref|XP_003519637.1|  PREDICTED: oligopeptide transporter 1-like         182   9e-50   
gb|KCW66677.1|  hypothetical protein EUGRSUZ_F00450                     182   9e-50   
ref|XP_011038843.1|  PREDICTED: oligopeptide transporter 1 isofor...    182   9e-50   
ref|XP_007142437.1|  hypothetical protein PHAVU_008G280400g             182   9e-50   
ref|XP_007224505.1|  hypothetical protein PRUPE_ppa022679mg             181   1e-49   
ref|XP_002867483.1|  ATOPT6                                             181   1e-49   
ref|XP_006279740.1|  hypothetical protein CARUB_v10027572mg             181   1e-49   
ref|XP_009361323.1|  PREDICTED: oligopeptide transporter 6-like         181   1e-49   
ref|XP_003520525.1|  PREDICTED: oligopeptide transporter 5-like i...    182   1e-49   
ref|XP_010448085.1|  PREDICTED: oligopeptide transporter 6              181   1e-49   
ref|XP_010438561.1|  PREDICTED: oligopeptide transporter 6              181   1e-49   
ref|NP_194503.1|  oligopeptide transporter                              181   1e-49   
ref|XP_004502694.1|  PREDICTED: oligopeptide transporter 6-like         181   1e-49   
ref|XP_006425445.1|  hypothetical protein CICLE_v10024968mg             181   1e-49   
ref|XP_006576835.1|  PREDICTED: oligopeptide transporter 5-like i...    181   1e-49   
ref|XP_010113336.1|  Oligopeptide transporter 7                         183   2e-49   
dbj|BAJ90957.1|  predicted protein                                      181   2e-49   
ref|XP_006652734.1|  PREDICTED: oligopeptide transporter 4-like         181   2e-49   



>gb|KEH32684.1| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=546

 Score =   295 bits (756),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 160/182 (88%), Gaps = 3/182 (2%)
 Frame = +1

Query  58   MSGLNPATAGEKTA---PSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIF  228
            M+ +NP    EK +   P   RCP+EEVALVVPETDDP+LPV+TFR+WFLGITSCIILIF
Sbjct  1    MAPMNPTPDTEKASNGVPPDDRCPIEEVALVVPETDDPSLPVMTFRSWFLGITSCIILIF  60

Query  229  LNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHV  408
            LNTFF +RTQPL+ISAILMQI+VLPIGKFMAATLP +++  FGRW FTLNPGPFN+KEHV
Sbjct  61   LNTFFTFRTQPLTISAILMQIAVLPIGKFMAATLPTKEYNFFGRWRFTLNPGPFNMKEHV  120

Query  409  IITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRY  588
            IIT+ ANCGVS GGGDAYSIGAITIMKAYYKQ+LSFL  L IVLTTQ++GYGWAG+LRRY
Sbjct  121  IITIFANCGVSQGGGDAYSIGAITIMKAYYKQSLSFLLALFIVLTTQILGYGWAGILRRY  180

Query  589  LV  594
            LV
Sbjct  181  LV  182



>ref|XP_009590288.1| PREDICTED: oligopeptide transporter 3 [Nicotiana tomentosiformis]
Length=751

 Score =   295 bits (754),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 161/179 (90%), Gaps = 3/179 (2%)
 Frame = +1

Query  67   LNPATAGE---KTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  237
            L P+ AG+   +      RCPVEEVALVVPETDDPTLPV+TFRAWFLG+TSC +LIFLNT
Sbjct  14   LPPSAAGKLNGEPPADHERCPVEEVALVVPETDDPTLPVMTFRAWFLGLTSCTLLIFLNT  73

Query  238  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  417
            FFIYRTQPL+ISAILMQI+VLPIGKFMAATLP++ +  FGRW F+LNPGPFNIKEHVIIT
Sbjct  74   FFIYRTQPLTISAILMQIAVLPIGKFMAATLPKKNYTLFGRWGFSLNPGPFNIKEHVIIT  133

Query  418  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            VMANCGVS GGGDAYSIGAIT+MKAYYKQ+L+FLC L+IVLTTQ++GYGWAG+LRRYLV
Sbjct  134  VMANCGVSIGGGDAYSIGAITVMKAYYKQSLNFLCALLIVLTTQIVGYGWAGMLRRYLV  192



>gb|KEH32683.1| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=741

 Score =   293 bits (751),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 160/182 (88%), Gaps = 3/182 (2%)
 Frame = +1

Query  58   MSGLNPATAGEKTA---PSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIF  228
            M+ +NP    EK +   P   RCP+EEVALVVPETDDP+LPV+TFR+WFLGITSCIILIF
Sbjct  1    MAPMNPTPDTEKASNGVPPDDRCPIEEVALVVPETDDPSLPVMTFRSWFLGITSCIILIF  60

Query  229  LNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHV  408
            LNTFF +RTQPL+ISAILMQI+VLPIGKFMAATLP +++  FGRW FTLNPGPFN+KEHV
Sbjct  61   LNTFFTFRTQPLTISAILMQIAVLPIGKFMAATLPTKEYNFFGRWRFTLNPGPFNMKEHV  120

Query  409  IITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRY  588
            IIT+ ANCGVS GGGDAYSIGAITIMKAYYKQ+LSFL  L IVLTTQ++GYGWAG+LRRY
Sbjct  121  IITIFANCGVSQGGGDAYSIGAITIMKAYYKQSLSFLLALFIVLTTQILGYGWAGILRRY  180

Query  589  LV  594
            LV
Sbjct  181  LV  182



>ref|XP_006352325.1| PREDICTED: oligopeptide transporter 3-like [Solanum tuberosum]
Length=752

 Score =   293 bits (751),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 158/171 (92%), Gaps = 1/171 (1%)
 Frame = +1

Query  85   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  264
            G+  +    RCPVEEVALVVPETDDPTLPV+TFRAWFLG++SC ILIFLNTFFIYRTQPL
Sbjct  23   GDTLSSDDDRCPVEEVALVVPETDDPTLPVMTFRAWFLGLSSCTILIFLNTFFIYRTQPL  82

Query  265  SISAILMQISVLPIGKFMAATLPERKFAPFGRW-SFTLNPGPFNIKEHVIITVMANCGVS  441
            +ISAILMQI+VLPIGKFMAATLP++ FA FGRW SF+LNPGPFNIKEHV+ITVMANCGVS
Sbjct  83   TISAILMQIAVLPIGKFMAATLPKKNFALFGRWGSFSLNPGPFNIKEHVVITVMANCGVS  142

Query  442  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             GGGDAYSIGAIT+M+AYY Q++SFLC LIIVLTTQ++GYGWAG+LRRYLV
Sbjct  143  IGGGDAYSIGAITVMRAYYNQSVSFLCSLIIVLTTQILGYGWAGMLRRYLV  193



>ref|XP_011095913.1| PREDICTED: oligopeptide transporter 3 [Sesamum indicum]
Length=740

 Score =   292 bits (748),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 159/175 (91%), Gaps = 2/175 (1%)
 Frame = +1

Query  70   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  249
             PA+ GE  A +  RC VEEVALVVPETDDPTLPV+TFRAW LG+ SCIILIFLNTFFIY
Sbjct  9    KPASNGE--AETEERCSVEEVALVVPETDDPTLPVMTFRAWVLGLASCIILIFLNTFFIY  66

Query  250  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  429
            RTQPL+ISAILMQI VLPIGKFMAATLP +++  FGRWSF+LNPGPFNIKEHVIITVMAN
Sbjct  67   RTQPLTISAILMQIGVLPIGKFMAATLPTKQYTVFGRWSFSLNPGPFNIKEHVIITVMAN  126

Query  430  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            CGVS GGGDAYSIGAIT+MKAYYKQ+++FLC L+IVLTTQ++GYGWAG+LR+YLV
Sbjct  127  CGVSIGGGDAYSIGAITVMKAYYKQSVNFLCALLIVLTTQILGYGWAGMLRKYLV  181



>ref|XP_004250295.1| PREDICTED: oligopeptide transporter 3 [Solanum lycopersicum]
Length=755

 Score =   290 bits (742),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 159/171 (93%), Gaps = 1/171 (1%)
 Frame = +1

Query  85   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  264
            G+ ++ +  RC VEEVALVVPETDDP+LPV+TFRAWFLG++SC ILIFLNTFFIYRTQPL
Sbjct  26   GDASSTNDERCSVEEVALVVPETDDPSLPVMTFRAWFLGLSSCTILIFLNTFFIYRTQPL  85

Query  265  SISAILMQISVLPIGKFMAATLPERKFAPFGRW-SFTLNPGPFNIKEHVIITVMANCGVS  441
            +ISAILMQI+VLPIGKFMAATLP++ FA FGRW SF+LNPGPFNIKEHV+ITVMANCGVS
Sbjct  86   TISAILMQIAVLPIGKFMAATLPKKSFAIFGRWGSFSLNPGPFNIKEHVVITVMANCGVS  145

Query  442  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             GGGDAYSIGAIT+M+AYY Q++SFLC LIIVLTTQ++GYGWAG+LRRYLV
Sbjct  146  IGGGDAYSIGAITVMRAYYNQSVSFLCSLIIVLTTQILGYGWAGMLRRYLV  196



>emb|CDP04526.1| unnamed protein product [Coffea canephora]
Length=755

 Score =   290 bits (741),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 156/174 (90%), Gaps = 2/174 (1%)
 Frame = +1

Query  79   TAGEKTAPSG--GRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  252
              G+  AP+    RC VEEVALVVPETDDPTLPV+TFRAWFLG+TSC ILIFLNTFFIYR
Sbjct  23   NGGDAPAPTDHKDRCAVEEVALVVPETDDPTLPVMTFRAWFLGLTSCTILIFLNTFFIYR  82

Query  253  TQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANC  432
            TQPL+ISAILMQI+VLPIGKFMA+ LP + +  FGRWSF+LNPGPFNIKEHVIITVMANC
Sbjct  83   TQPLTISAILMQIAVLPIGKFMASALPTKTYTLFGRWSFSLNPGPFNIKEHVIITVMANC  142

Query  433  GVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            GVS GGGDAYSIGAIT+M+AYYKQ LSFLC L+IVLTTQ++GYGWAG+LR+YLV
Sbjct  143  GVSIGGGDAYSIGAITVMRAYYKQTLSFLCALLIVLTTQILGYGWAGMLRKYLV  196



>gb|EYU27660.1| hypothetical protein MIMGU_mgv1a001879mg [Erythranthe guttata]
Length=745

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
            RC VEEVALVVPETDDPTLPV+TFRAW LG+ SC ILIFLNTFFIYRTQPLSISAILMQI
Sbjct  26   RCSVEEVALVVPETDDPTLPVMTFRAWVLGLVSCTILIFLNTFFIYRTQPLSISAILMQI  85

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +VLP+G+FMAATLP +++A FGRW F+LNPGPFNIKEHVIITVMANCGVS GGGDAYSIG
Sbjct  86   AVLPVGRFMAATLPTKEYALFGRWRFSLNPGPFNIKEHVIITVMANCGVSVGGGDAYSIG  145

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AIT+MKAYYKQ+L+FLC L+IVLTTQ++GYGWAG+LR+YLV
Sbjct  146  AITVMKAYYKQSLNFLCALLIVLTTQILGYGWAGMLRKYLV  186



>gb|KDO78545.1| hypothetical protein CISIN_1g004659mg [Citrus sinensis]
Length=388

 Score =   276 bits (707),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 153/175 (87%), Gaps = 4/175 (2%)
 Frame = +1

Query  70   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  249
            N    G+ T     RCP+EEVAL+VPETDDPT+PV+TFRAWFLG+TSC +LIFLNTFF +
Sbjct  10   NENPNGDSTEE---RCPIEEVALIVPETDDPTMPVMTFRAWFLGLTSCTLLIFLNTFFTF  66

Query  250  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  429
            RTQPL+ISAILMQI+VLPIGKFMA  LP ++F   G W F+LNPGPFNIKEHVIIT+ AN
Sbjct  67   RTQPLTISAILMQIAVLPIGKFMARILPNKEFQVLG-WRFSLNPGPFNIKEHVIITIFAN  125

Query  430  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            CGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLV
Sbjct  126  CGVSFGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLV  180



>ref|XP_010939248.1| PREDICTED: oligopeptide transporter 3-like [Elaeis guineensis]
Length=729

 Score =   285 bits (729),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +1

Query  85   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  264
             EK      RCPVEEVALVVPETDD +LPV+TFRAWFLGITSC +LIFLNTFF YRTQPL
Sbjct  2    AEKQEVDQERCPVEEVALVVPETDDMSLPVMTFRAWFLGITSCTVLIFLNTFFTYRTQPL  61

Query  265  SISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSP  444
            +ISAILMQISVLP+G+FMA+ LP ++   FG+W F LNPGPFNIKEHVIITV ANCGVSP
Sbjct  62   TISAILMQISVLPLGRFMASALPNKEVKVFGQWGFNLNPGPFNIKEHVIITVFANCGVSP  121

Query  445  GGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            GGGDAYSIGAIT+MKAYY+Q+LSFLCGLIIV+TTQL+GYGWAG++R++LV
Sbjct  122  GGGDAYSIGAITVMKAYYRQSLSFLCGLIIVMTTQLLGYGWAGMMRKFLV  171



>ref|XP_008785648.1| PREDICTED: oligopeptide transporter 3-like [Phoenix dactylifera]
Length=730

 Score =   285 bits (728),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +1

Query  85   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  264
             EK      RCPVEEVALVVPE DDP+LPV+TFRAWFLGITSC +LIFLNTFF YRTQPL
Sbjct  2    AEKQEVEQERCPVEEVALVVPENDDPSLPVMTFRAWFLGITSCTVLIFLNTFFTYRTQPL  61

Query  265  SISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSP  444
            +ISAILMQISVLP+G+ MA+ LP ++   FGRW F LNPGPFN+KEH IITV ANCGVSP
Sbjct  62   TISAILMQISVLPLGRLMASALPNKEVKVFGRWGFNLNPGPFNVKEHTIITVFANCGVSP  121

Query  445  GGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            GGGDAYSIGAIT+MKAYY+Q+LSFLCGLIIV+TTQL+GYGWAG+LR++LV
Sbjct  122  GGGDAYSIGAITVMKAYYRQSLSFLCGLIIVITTQLLGYGWAGMLRKFLV  171



>ref|XP_011040169.1| PREDICTED: oligopeptide transporter 3 [Populus euphratica]
Length=743

 Score =   285 bits (729),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 153/169 (91%), Gaps = 1/169 (1%)
 Frame = +1

Query  88   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  267
            +  A    RCPVEEVALVVPETDDPTLPVLTFRAWFLG+TSC+ILIFLNTFF YRTQPL+
Sbjct  18   DSAAEHHERCPVEEVALVVPETDDPTLPVLTFRAWFLGLTSCVILIFLNTFFTYRTQPLT  77

Query  268  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  447
            ISAILMQI+VLPIGKFMA TLP + +   G WSF+LNPGPFN+KEHVIIT+ ANCGVS G
Sbjct  78   ISAILMQIAVLPIGKFMAKTLPTKDYRILG-WSFSLNPGPFNMKEHVIITIFANCGVSYG  136

Query  448  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            GGDAYSIGAIT+MKAYY+Q+LSFLCGL+IVLTTQ++GYGWAG+LRRYLV
Sbjct  137  GGDAYSIGAITVMKAYYRQSLSFLCGLLIVLTTQILGYGWAGMLRRYLV  185



>ref|XP_002308764.1| OLIGOPEPTIDE TRANSPORTER family protein [Populus trichocarpa]
 gb|EEE92287.1| OLIGOPEPTIDE TRANSPORTER family protein [Populus trichocarpa]
Length=744

 Score =   285 bits (728),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 156/180 (87%), Gaps = 4/180 (2%)
 Frame = +1

Query  55   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  234
              +GL   ++ E+      RCPVEEVALVVPETDDPTLPVLTFRAWFLG+TSCIILIFLN
Sbjct  11   HTNGLGLDSSAEEQHE---RCPVEEVALVVPETDDPTLPVLTFRAWFLGLTSCIILIFLN  67

Query  235  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  414
            TFF YRTQPL+ISAILMQI+VLPIGKFMA TLP R +   G WSF+LNPGPFN+KEHVII
Sbjct  68   TFFTYRTQPLTISAILMQIAVLPIGKFMAKTLPTRDYRILG-WSFSLNPGPFNMKEHVII  126

Query  415  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            T+ ANCGVS GGGDAYSIGAIT+MKAYYKQ LSFLCGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  127  TIFANCGVSFGGGDAYSIGAITVMKAYYKQNLSFLCGLFIVLTTQILGYGWAGMLRRYLV  186



>ref|XP_011002374.1| PREDICTED: oligopeptide transporter 3-like [Populus euphratica]
Length=744

 Score =   284 bits (727),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 156/180 (87%), Gaps = 4/180 (2%)
 Frame = +1

Query  55   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  234
              +GL   ++ E+      RCPVEEVALVVPETDDPTLPVLTFRAWFLG+TSCIILIFLN
Sbjct  11   HTNGLGLDSSAEEQHE---RCPVEEVALVVPETDDPTLPVLTFRAWFLGLTSCIILIFLN  67

Query  235  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  414
            TFF YRTQPL+ISAILMQI+VLPIGKFMA TLP R +   G WSF+LNPGPFN+KEHVII
Sbjct  68   TFFTYRTQPLTISAILMQIAVLPIGKFMAKTLPPRDYRILG-WSFSLNPGPFNMKEHVII  126

Query  415  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            T+ ANCGVS GGGDAYSIGAIT+MKAYYKQ LSFLCGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  127  TIFANCGVSFGGGDAYSIGAITVMKAYYKQNLSFLCGLFIVLTTQILGYGWAGMLRRYLV  186



>gb|KDO78543.1| hypothetical protein CISIN_1g004659mg [Citrus sinensis]
Length=490

 Score =   278 bits (710),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 153/175 (87%), Gaps = 4/175 (2%)
 Frame = +1

Query  70   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  249
            N    G+ T     RCP+EEVAL+VPETDDPT+PV+TFRAWFLG+TSC +LIFLNTFF +
Sbjct  10   NENPNGDSTEE---RCPIEEVALIVPETDDPTMPVMTFRAWFLGLTSCTLLIFLNTFFTF  66

Query  250  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  429
            RTQPL+ISAILMQI+VLPIGKFMA  LP ++F   G W F+LNPGPFNIKEHVIIT+ AN
Sbjct  67   RTQPLTISAILMQIAVLPIGKFMARILPNKEFQVLG-WRFSLNPGPFNIKEHVIITIFAN  125

Query  430  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            CGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLV
Sbjct  126  CGVSFGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLV  180



>ref|XP_002273768.2| PREDICTED: oligopeptide transporter 3 [Vitis vinifera]
Length=748

 Score =   283 bits (723),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 157/176 (89%), Gaps = 3/176 (2%)
 Frame = +1

Query  73   PATAGEKT--APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  246
            P T G++   AP G R PVEEVALVVPETDD TLPV+TFRAWFLGI SC +LIFLNTFF 
Sbjct  15   PTTNGKEATQAPEGERTPVEEVALVVPETDDQTLPVMTFRAWFLGIISCSLLIFLNTFFS  74

Query  247  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  426
            YRTQPL+ISAILMQI+VLP+GKFMA+TLP R+F  FG W F+LNPGPFN+KEHVIITV A
Sbjct  75   YRTQPLTISAILMQIAVLPVGKFMASTLPRREFKVFG-WGFSLNPGPFNMKEHVIITVFA  133

Query  427  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            NCGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LR+YLV
Sbjct  134  NCGVSYGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRKYLV  189



>gb|KDO78544.1| hypothetical protein CISIN_1g004659mg [Citrus sinensis]
Length=554

 Score =   278 bits (710),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 153/175 (87%), Gaps = 4/175 (2%)
 Frame = +1

Query  70   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  249
            N    G+ T     RCP+EEVAL+VPETDDPT+PV+TFRAWFLG+TSC +LIFLNTFF +
Sbjct  10   NENPNGDSTEE---RCPIEEVALIVPETDDPTMPVMTFRAWFLGLTSCTLLIFLNTFFTF  66

Query  250  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  429
            RTQPL+ISAILMQI+VLPIGKFMA  LP ++F   G W F+LNPGPFNIKEHVIIT+ AN
Sbjct  67   RTQPLTISAILMQIAVLPIGKFMARILPNKEFQVLG-WRFSLNPGPFNIKEHVIITIFAN  125

Query  430  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            CGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLV
Sbjct  126  CGVSFGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLV  180



>ref|XP_004507597.1| PREDICTED: oligopeptide transporter 3-like [Cicer arietinum]
Length=739

 Score =   282 bits (721),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 158/182 (87%), Gaps = 4/182 (2%)
 Frame = +1

Query  58   MSGLNPATAGEKTA---PSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIF  228
            M+  N  T  EK A   P   RCP+EEVALVVPETDDPTLPV+TFR+WFLGI SCI+LIF
Sbjct  1    MAPKNQTTDTEKAANGAPPDDRCPIEEVALVVPETDDPTLPVMTFRSWFLGIASCILLIF  60

Query  229  LNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHV  408
            LNTFF +RTQPL+ISAILMQI+VLPIG+FMA+TLP ++++  G W F+LNPGPFN+KEHV
Sbjct  61   LNTFFTFRTQPLAISAILMQIAVLPIGRFMASTLPTKEYSVLG-WRFSLNPGPFNMKEHV  119

Query  409  IITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRY  588
            IIT+ ANCGVS GGGDAYSIGAITIMKAYYKQ++SFLC L IVLTTQ++GYGWAG+LRRY
Sbjct  120  IITIFANCGVSYGGGDAYSIGAITIMKAYYKQSISFLCALFIVLTTQILGYGWAGILRRY  179

Query  589  LV  594
            LV
Sbjct  180  LV  181



>emb|CBI18634.3| unnamed protein product [Vitis vinifera]
Length=752

 Score =   282 bits (722),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 157/176 (89%), Gaps = 3/176 (2%)
 Frame = +1

Query  73   PATAGEKT--APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  246
            P T G++   AP G R PVEEVALVVPETDD TLPV+TFRAWFLGI SC +LIFLNTFF 
Sbjct  15   PTTNGKEATQAPEGERTPVEEVALVVPETDDQTLPVMTFRAWFLGIISCSLLIFLNTFFS  74

Query  247  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  426
            YRTQPL+ISAILMQI+VLP+GKFMA+TLP R+F  FG W F+LNPGPFN+KEHVIITV A
Sbjct  75   YRTQPLTISAILMQIAVLPVGKFMASTLPRREFKVFG-WGFSLNPGPFNMKEHVIITVFA  133

Query  427  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            NCGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LR+YLV
Sbjct  134  NCGVSYGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRKYLV  189



>ref|XP_007026363.1| Oligopeptide transporter isoform 2 [Theobroma cacao]
 gb|EOY28985.1| Oligopeptide transporter isoform 2 [Theobroma cacao]
Length=680

 Score =   280 bits (717),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = +1

Query  94   TAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSIS  273
             A    R PVEEVALVVPETDDPTLPV+TFRAWFLG+TSC++LIFLNTFF YRTQPL+IS
Sbjct  15   NAAEDDRSPVEEVALVVPETDDPTLPVMTFRAWFLGLTSCMLLIFLNTFFTYRTQPLTIS  74

Query  274  AILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGG  453
            AILMQISVLPIGKFMA TLP R+++  GR SF+LNPGPFN+KEHVIIT+ ANCGVS GGG
Sbjct  75   AILMQISVLPIGKFMARTLPTREYSLLGR-SFSLNPGPFNMKEHVIITIFANCGVSFGGG  133

Query  454  DAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            DAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLV
Sbjct  134  DAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLV  180



>ref|XP_007026362.1| Oligopeptide transporter isoform 1 [Theobroma cacao]
 gb|EOY28984.1| Oligopeptide transporter isoform 1 [Theobroma cacao]
Length=739

 Score =   280 bits (716),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = +1

Query  94   TAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSIS  273
             A    R PVEEVALVVPETDDPTLPV+TFRAWFLG+TSC++LIFLNTFF YRTQPL+IS
Sbjct  15   NAAEDDRSPVEEVALVVPETDDPTLPVMTFRAWFLGLTSCMLLIFLNTFFTYRTQPLTIS  74

Query  274  AILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGG  453
            AILMQISVLPIGKFMA TLP R+++  GR SF+LNPGPFN+KEHVIIT+ ANCGVS GGG
Sbjct  75   AILMQISVLPIGKFMARTLPTREYSLLGR-SFSLNPGPFNMKEHVIITIFANCGVSFGGG  133

Query  454  DAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            DAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLV
Sbjct  134  DAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLV  180



>ref|XP_009380132.1| PREDICTED: oligopeptide transporter 3-like [Musa acuminata subsp. 
malaccensis]
Length=740

 Score =   280 bits (716),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 153/182 (84%), Gaps = 3/182 (2%)
 Frame = +1

Query  58   MSGLNPATAGEKTAPSGG---RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIF  228
            M+       G  TA  G    RCPVEEVALVVPETDDP+LPV+TFRAWFLG+TSC +LIF
Sbjct  1    MASKGENKGGSSTAEEGEEVERCPVEEVALVVPETDDPSLPVMTFRAWFLGLTSCSLLIF  60

Query  229  LNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHV  408
            LNTFF YRTQPL+ISAILMQI+VLP G+FMA+ LP+R+   F  W F LNPGPFNIKEHV
Sbjct  61   LNTFFTYRTQPLTISAILMQIAVLPAGRFMASVLPDREVKVFRNWGFHLNPGPFNIKEHV  120

Query  409  IITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRY  588
            IIT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC LIIVLTTQ++GYGWAG++RRY
Sbjct  121  IITIFANCGVSIGGGDAYSIGAITVMKAYYKQSLSFLCALIIVLTTQILGYGWAGMMRRY  180

Query  589  LV  594
            LV
Sbjct  181  LV  182



>ref|XP_007154044.1| hypothetical protein PHAVU_003G086500g [Phaseolus vulgaris]
 gb|ESW26038.1| hypothetical protein PHAVU_003G086500g [Phaseolus vulgaris]
Length=741

 Score =   280 bits (715),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 157/183 (86%), Gaps = 5/183 (3%)
 Frame = +1

Query  58   MSGLNPATAGEKTAPSG----GRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILI  225
            M+     T   + A +G     RCPVEEVALVVPETDDP+LPV+TFRAWFLG+ SC++LI
Sbjct  1    MAAAKTTTKDSEKAENGESPPDRCPVEEVALVVPETDDPSLPVMTFRAWFLGLASCVVLI  60

Query  226  FLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEH  405
            FLNTFF +RTQPL+ISAILMQI+VLPIG+FMAATLP ++++  G W FTLNPGPFN+KEH
Sbjct  61   FLNTFFTFRTQPLTISAILMQIAVLPIGRFMAATLPTKEYSFLG-WRFTLNPGPFNMKEH  119

Query  406  VIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRR  585
            VIIT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L IVLTTQ++GYGWAG+LRR
Sbjct  120  VIITIFANCGVSFGGGDAYSIGAITVMKAYYKQSLSFLCALFIVLTTQMLGYGWAGILRR  179

Query  586  YLV  594
            YLV
Sbjct  180  YLV  182



>ref|XP_010907563.1| PREDICTED: oligopeptide transporter 3-like [Elaeis guineensis]
Length=735

 Score =   279 bits (714),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = +1

Query  82   AGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQP  261
            A  +  P   RCPVEEVALVVPETDDP+LPV+TFRAWFLG+ SCIILIFLNTFF YRTQP
Sbjct  7    ARPQAQPPEERCPVEEVALVVPETDDPSLPVMTFRAWFLGLASCIILIFLNTFFTYRTQP  66

Query  262  LSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVS  441
            L+ISAILMQI+ LP+G+FMA+ LP ++    G WSF LNPGPFNIKEHVIIT+ ANCGVS
Sbjct  67   LTISAILMQIAALPLGQFMASVLPNKEVRLPGNWSFNLNPGPFNIKEHVIITIFANCGVS  126

Query  442  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             GGGDAYSIGAIT+MKAYYKQ+LSFLC LIIVLTTQ++GYGWAG+LRRYLV
Sbjct  127  IGGGDAYSIGAITVMKAYYKQSLSFLCALIIVLTTQILGYGWAGMLRRYLV  177



>gb|KJB67417.1| hypothetical protein B456_010G190300 [Gossypium raimondii]
Length=741

 Score =   279 bits (714),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 155/175 (89%), Gaps = 3/175 (2%)
 Frame = +1

Query  70   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  249
             P  AG  TA + G  PVEEVALVVPETDDPTLPVLTFRAWFLG+ SC++LIFLNTFF Y
Sbjct  11   KPNAAG--TAENEGMSPVEEVALVVPETDDPTLPVLTFRAWFLGLVSCVLLIFLNTFFTY  68

Query  250  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  429
            RTQPL+ISAILMQISVLPIGKFMA TLP  +++  G W F+LNPGPFNIKEHVIIT+ AN
Sbjct  69   RTQPLTISAILMQISVLPIGKFMARTLPTTQYSLLG-WHFSLNPGPFNIKEHVIITIFAN  127

Query  430  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            CGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCG++IVLTTQ++GYGWAG+LRRYLV
Sbjct  128  CGVSFGGGDAYSIGAITVMKAYYKQSLNFLCGVLIVLTTQILGYGWAGMLRRYLV  182



>ref|XP_006283198.1| hypothetical protein CARUB_v10004230mg [Capsella rubella]
 gb|EOA16096.1| hypothetical protein CARUB_v10004230mg [Capsella rubella]
Length=737

 Score =   277 bits (709),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 155/180 (86%), Gaps = 5/180 (3%)
 Frame = +1

Query  67   LNPATAGEKT----APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  234
            ++   AG+K     +    RCPVEEVALVVPETDDP++PV+TFRAWFLG+TSC++LIFLN
Sbjct  1    MDAEKAGDKNNAHLSSDHERCPVEEVALVVPETDDPSIPVMTFRAWFLGLTSCVLLIFLN  60

Query  235  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  414
            TFF YRTQPL+ISAILMQI+VLPIGKFMA TLP       G W+F+LNPGPFNIKEHVII
Sbjct  61   TFFTYRTQPLTISAILMQIAVLPIGKFMARTLPTTSHNLLG-WNFSLNPGPFNIKEHVII  119

Query  415  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            T+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  120  TIFANCGVSYGGGDAYSIGAITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLV  179



>ref|XP_009773627.1| PREDICTED: oligopeptide transporter 3 [Nicotiana sylvestris]
Length=751

 Score =   277 bits (709),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
            RCPVEEVALVVPETDDPTLPV+TFRAWFLG+TSC +LIFLNTFFIYRTQPL+ISAILMQI
Sbjct  32   RCPVEEVALVVPETDDPTLPVMTFRAWFLGLTSCTLLIFLNTFFIYRTQPLTISAILMQI  91

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +VLPIGKFMAATLP++ +  FGRW F+LNPGPFNIKEHVIITVMANCGVS GGGDAYSIG
Sbjct  92   AVLPIGKFMAATLPKKSYTLFGRWGFSLNPGPFNIKEHVIITVMANCGVSIGGGDAYSIG  151

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AIT+MKAYYKQ+L+FLC L++VLTTQL+GYGWAG+LRRYLV
Sbjct  152  AITVMKAYYKQSLNFLCALLLVLTTQLVGYGWAGMLRRYLV  192



>gb|KHG20373.1| Oligopeptide transporter 3 -like protein [Gossypium arboreum]
Length=741

 Score =   277 bits (708),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 152/170 (89%), Gaps = 1/170 (1%)
 Frame = +1

Query  85   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  264
             E TA +    PVEEVALVVPETDDPTLPVLTFRAWFLG+ SC++LIFLNTFF YRTQPL
Sbjct  14   AEGTAENEDTSPVEEVALVVPETDDPTLPVLTFRAWFLGLVSCVLLIFLNTFFTYRTQPL  73

Query  265  SISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSP  444
            +ISAILMQISVLPIGKFMA TLP  +++  G W F+LNPGPFNIKEHVIIT+ ANCGVS 
Sbjct  74   TISAILMQISVLPIGKFMARTLPTTQYSLLG-WHFSLNPGPFNIKEHVIITIFANCGVSF  132

Query  445  GGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            GGGDAYSIGAIT+MKAYYKQ+L+FLCG++IVLTTQ++GYGWAG+LRRYLV
Sbjct  133  GGGDAYSIGAITVMKAYYKQSLNFLCGVLIVLTTQILGYGWAGMLRRYLV  182



>sp|O23482.3|OPT3_ARATH RecName: Full=Oligopeptide transporter 3; Short=AtOPT3 [Arabidopsis 
thaliana]
 gb|AAN72034.1| isp4 like protein [Arabidopsis thaliana]
Length=737

 Score =   277 bits (708),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 155/180 (86%), Gaps = 5/180 (3%)
 Frame = +1

Query  67   LNPATAGEKT----APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  234
            ++   A +KT    +    RCPVEEVALVVPETDDP+LPV+TFRAWFLG+TSC++LIFLN
Sbjct  1    MDAEKATDKTNVHLSSDHERCPVEEVALVVPETDDPSLPVMTFRAWFLGLTSCVLLIFLN  60

Query  235  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  414
            TFF YRTQPL+ISAILMQI+VLPIGKFMA TLP       G WSF+LNPGPFNIKEHVII
Sbjct  61   TFFTYRTQPLTISAILMQIAVLPIGKFMARTLPTTSHNLLG-WSFSLNPGPFNIKEHVII  119

Query  415  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            T+ ANCGV+ GGGDAYSIGAIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  120  TIFANCGVAYGGGDAYSIGAITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLV  179



>ref|XP_008780991.1| PREDICTED: oligopeptide transporter 3-like [Phoenix dactylifera]
Length=735

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  100  PSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAI  279
            P   RCPVEEVALVVPETDDP+LPV+TFRAWFLG+ SC ILIFLNTFF YRTQPL ISAI
Sbjct  13   PPEERCPVEEVALVVPETDDPSLPVMTFRAWFLGLASCTILIFLNTFFTYRTQPLIISAI  72

Query  280  LMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDA  459
            LMQI+ LP+G+FMA+ LP ++    G WSF LNPGPFNIKEHVIIT+ ANCGVS GGGDA
Sbjct  73   LMQIAALPMGQFMASVLPNKEVRVLGNWSFNLNPGPFNIKEHVIITIFANCGVSIGGGDA  132

Query  460  YSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            YSIGAIT+MKAYYKQ+LSFLC LIIVLTTQ++GYGWAG+LRRYLV
Sbjct  133  YSIGAITVMKAYYKQSLSFLCALIIVLTTQILGYGWAGMLRRYLV  177



>ref|NP_567493.5| oligopeptide transporter [Arabidopsis thaliana]
 gb|AEE83738.1| oligopeptide transporter [Arabidopsis thaliana]
Length=737

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 155/180 (86%), Gaps = 5/180 (3%)
 Frame = +1

Query  67   LNPATAGEKT----APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  234
            ++   A +KT    +    RCPVEEVALVVPETDDP+LPV+TFRAWFLG+TSC++LIFLN
Sbjct  1    MDAEKATDKTNVHLSSDHERCPVEEVALVVPETDDPSLPVMTFRAWFLGLTSCVLLIFLN  60

Query  235  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  414
            TFF YRTQPL+ISAILMQI+VLPIGKFMA TLP       G WSF+LNPGPFNIKEHVII
Sbjct  61   TFFTYRTQPLTISAILMQIAVLPIGKFMARTLPTTSHNLLG-WSFSLNPGPFNIKEHVII  119

Query  415  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            T+ ANCGV+ GGGDAYSIGAIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  120  TIFANCGVAYGGGDAYSIGAITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLV  179



>ref|XP_003529676.1| PREDICTED: oligopeptide transporter 3-like [Glycine max]
Length=742

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 153/176 (87%), Gaps = 4/176 (2%)
 Frame = +1

Query  76   ATAGEKTAPSGG---RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  246
            +T  EK A       RCPVEEVALVVPETDDP+LPV+TFRAWFLGI SC++LIFLNTFF 
Sbjct  9    STDAEKAANGESPPERCPVEEVALVVPETDDPSLPVMTFRAWFLGIASCVLLIFLNTFFT  68

Query  247  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  426
            +RTQPL+ISAILMQI+VLPIG+FMAATLP +++   G W FT NPGPFN+KEHVIIT+ A
Sbjct  69   FRTQPLTISAILMQIAVLPIGRFMAATLPTKEYGFLG-WRFTFNPGPFNMKEHVIITIFA  127

Query  427  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            NCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L IVLTTQ++GYGWAG+LRRYLV
Sbjct  128  NCGVSFGGGDAYSIGAITVMKAYYKQSLSFLCALFIVLTTQMLGYGWAGILRRYLV  183



>ref|XP_006414361.1| hypothetical protein EUTSA_v10024512mg [Eutrema salsugineum]
 gb|ESQ55814.1| hypothetical protein EUTSA_v10024512mg [Eutrema salsugineum]
Length=736

 Score =   276 bits (706),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = +1

Query  58   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  237
            M     A           RCPVEEVALVVPETDDPTLPV+TFRAWFLG+TSC++LIFLNT
Sbjct  1    MDAEKAANNDNNGHLDHERCPVEEVALVVPETDDPTLPVMTFRAWFLGLTSCVLLIFLNT  60

Query  238  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  417
            FF YRTQPL+ISAILMQI+VLPIGKFMA TLP       G W F+LNPGPFNIKEHVIIT
Sbjct  61   FFTYRTQPLTISAILMQIAVLPIGKFMARTLPTTSHKLMG-WEFSLNPGPFNIKEHVIIT  119

Query  418  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            + ANCGV+ GGGDAYSIGAIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  120  IFANCGVAYGGGDAYSIGAITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLV  178



>gb|KDO78542.1| hypothetical protein CISIN_1g004659mg [Citrus sinensis]
Length=739

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 153/175 (87%), Gaps = 4/175 (2%)
 Frame = +1

Query  70   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  249
            N    G+ T     RCP+EEVAL+VPETDDPT+PV+TFRAWFLG+TSC +LIFLNTFF +
Sbjct  10   NENPNGDSTEE---RCPIEEVALIVPETDDPTMPVMTFRAWFLGLTSCTLLIFLNTFFTF  66

Query  250  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  429
            RTQPL+ISAILMQI+VLPIGKFMA  LP ++F   G W F+LNPGPFNIKEHVIIT+ AN
Sbjct  67   RTQPLTISAILMQIAVLPIGKFMARILPNKEFQVLG-WRFSLNPGPFNIKEHVIITIFAN  125

Query  430  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            CGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLV
Sbjct  126  CGVSFGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLV  180



>ref|XP_006449924.1| hypothetical protein CICLE_v10014396mg [Citrus clementina]
 gb|ESR63164.1| hypothetical protein CICLE_v10014396mg [Citrus clementina]
Length=739

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 149/161 (93%), Gaps = 1/161 (1%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
            RCP+EEVAL+VPETDDPT+PV+TFRAWFLG+TSC +LIFLNTFF +RTQPL+ISAILMQI
Sbjct  21   RCPIEEVALIVPETDDPTMPVMTFRAWFLGLTSCTLLIFLNTFFTFRTQPLTISAILMQI  80

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +VLPIGKFMA  LP ++F   G W F+LNPGPFNIKEHVIIT+ ANCGVS GGGDAYSIG
Sbjct  81   AVLPIGKFMARILPNKEFQVLG-WRFSLNPGPFNIKEHVIITIFANCGVSFGGGDAYSIG  139

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLV
Sbjct  140  AITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLV  180



>ref|XP_006467278.1| PREDICTED: oligopeptide transporter 3-like [Citrus sinensis]
Length=739

 Score =   276 bits (705),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 153/175 (87%), Gaps = 4/175 (2%)
 Frame = +1

Query  70   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  249
            N    G+ T     RCP+EEVAL+VPETDDPT+PV+TFRAWFLG+TSC +LIFLNTFF +
Sbjct  10   NENPNGDSTEE---RCPIEEVALIVPETDDPTMPVMTFRAWFLGLTSCTLLIFLNTFFTF  66

Query  250  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  429
            RTQPL+ISAILMQI+VLPIGKFMA  LP ++F   G W F+LNPGPFNIKEHVIIT+ AN
Sbjct  67   RTQPLTISAILMQIAVLPIGKFMARILPNKEFQVLG-WRFSLNPGPFNIKEHVIITIFAN  125

Query  430  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            CGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLV
Sbjct  126  CGVSFGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLV  180



>ref|XP_002868139.1| hypothetical protein ARALYDRAFT_355122 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44398.1| hypothetical protein ARALYDRAFT_355122 [Arabidopsis lyrata subsp. 
lyrata]
Length=737

 Score =   275 bits (704),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 148/161 (92%), Gaps = 1/161 (1%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
            RCPVEEVALVVPETDDP++PV+TFRAWFLG+TSC++LIFLNTFF YRTQPL+ISAILMQI
Sbjct  20   RCPVEEVALVVPETDDPSIPVMTFRAWFLGLTSCVLLIFLNTFFTYRTQPLTISAILMQI  79

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +VLPIGKFMA TLP       G W+F+LNPGPFNIKEHVIIT+ ANCGVS GGGDAYSIG
Sbjct  80   AVLPIGKFMARTLPTTSHNLLG-WNFSLNPGPFNIKEHVIITIFANCGVSYGGGDAYSIG  138

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  139  AITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLV  179



>ref|XP_010449801.1| PREDICTED: oligopeptide transporter 3 [Camelina sativa]
Length=737

 Score =   275 bits (703),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 147/161 (91%), Gaps = 1/161 (1%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
            RCPVEEVALVVPETDDP++PV+TFRAWFLG+TSC++LIFLNTFF YRTQPL+ISAILMQI
Sbjct  20   RCPVEEVALVVPETDDPSIPVMTFRAWFLGLTSCVLLIFLNTFFTYRTQPLTISAILMQI  79

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +VLPIGKFMA TLP       G W F+LNPGPFNIKEHVIIT+ ANCGVS GGGDAYSIG
Sbjct  80   AVLPIGKFMARTLPTTSRNLLG-WKFSLNPGPFNIKEHVIITIFANCGVSYGGGDAYSIG  138

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AIT+MKAYYKQ+LSF+CGL IVLTTQ+IGYGWAG+LRRYLV
Sbjct  139  AITVMKAYYKQSLSFICGLFIVLTTQIIGYGWAGILRRYLV  179



>ref|XP_003549274.1| PREDICTED: oligopeptide transporter 3-like [Glycine max]
Length=741

 Score =   275 bits (704),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 155/181 (86%), Gaps = 2/181 (1%)
 Frame = +1

Query  52   VEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  231
            V+ S ++   A    +P   RCPVEEVALVVPETDDP+LPV+TFRAWFLGI SC++LIFL
Sbjct  4    VKSSSMDAEKAANGESPPE-RCPVEEVALVVPETDDPSLPVMTFRAWFLGIASCVLLIFL  62

Query  232  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVI  411
            NTFF +RTQPL+ISAILMQI+VLPIG+FMAATLP +++   G   FT NPGPFN+KEHVI
Sbjct  63   NTFFTFRTQPLTISAILMQIAVLPIGRFMAATLPTKEYGFLGS-RFTFNPGPFNMKEHVI  121

Query  412  ITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYL  591
            IT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L IVLTTQ++GYGWAG+LRRYL
Sbjct  122  ITIFANCGVSFGGGDAYSIGAITVMKAYYKQSLSFLCALFIVLTTQMMGYGWAGILRRYL  181

Query  592  V  594
            V
Sbjct  182  V  182



>gb|AAK96781.1| Unknown protein [Arabidopsis thaliana]
Length=737

 Score =   275 bits (703),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 154/180 (86%), Gaps = 5/180 (3%)
 Frame = +1

Query  67   LNPATAGEKT----APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  234
            ++   A +KT    +    RCPVEEVALVVPETDDP+LPV+TFR WFLG+TSC++LIFLN
Sbjct  1    MDAEKATDKTNVHLSSDHERCPVEEVALVVPETDDPSLPVMTFRTWFLGLTSCVLLIFLN  60

Query  235  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  414
            TFF YRTQPL+ISAILMQI+VLPIGKFMA TLP       G WSF+LNPGPFNIKEHVII
Sbjct  61   TFFTYRTQPLTISAILMQIAVLPIGKFMARTLPTTSHNLLG-WSFSLNPGPFNIKEHVII  119

Query  415  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            T+ ANCGV+ GGGDAYSIGAIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  120  TIFANCGVAYGGGDAYSIGAITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLV  179



>ref|XP_010440168.1| PREDICTED: oligopeptide transporter 3-like [Camelina sativa]
Length=737

 Score =   275 bits (703),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 147/161 (91%), Gaps = 1/161 (1%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
            RCPVEEVALVVPETDDP++PV+TFRAWFLG+TSC++LIFLNTFF YRTQPL+ISAILMQI
Sbjct  20   RCPVEEVALVVPETDDPSIPVMTFRAWFLGLTSCVLLIFLNTFFTYRTQPLTISAILMQI  79

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +VLPIGKFMA TLP       G W FTLNPGPFNIKEHVIIT+ ANCGVS GGGDAYSIG
Sbjct  80   AVLPIGKFMARTLPTTSRNLLG-WKFTLNPGPFNIKEHVIITIFANCGVSYGGGDAYSIG  138

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AIT+MKAYYKQ+L+F+CGL IVLTTQ+IGYGWAG+LRRYLV
Sbjct  139  AITVMKAYYKQSLTFICGLFIVLTTQIIGYGWAGILRRYLV  179



>gb|KFK26550.1| hypothetical protein AALP_AA8G263100 [Arabis alpina]
Length=734

 Score =   275 bits (703),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 151/173 (87%), Gaps = 5/173 (3%)
 Frame = +1

Query  88   EKTAPSGG----RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  255
            EK A + G    RCPVEEVALVVPETDDPTLPV+TFRAW LG+TSC++LIFLNTFF YRT
Sbjct  4    EKAAATNGVDHERCPVEEVALVVPETDDPTLPVMTFRAWSLGLTSCVLLIFLNTFFTYRT  63

Query  256  QPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCG  435
            QPL+ISAILMQI+VLPIGKFMA TLP   +   GR  F+LNPGPFNIKEHVIIT+ ANCG
Sbjct  64   QPLTISAILMQIAVLPIGKFMARTLPTTSYHLLGR-EFSLNPGPFNIKEHVIITIFANCG  122

Query  436  VSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            VS GGGDAYSIGAIT+MKAYYKQ+LSF+C L IVLTTQ++GYGWAG+LRRYLV
Sbjct  123  VSFGGGDAYSIGAITVMKAYYKQSLSFICALFIVLTTQILGYGWAGILRRYLV  175



>ref|XP_010087657.1| Oligopeptide transporter 3 [Morus notabilis]
 gb|EXB29550.1| Oligopeptide transporter 3 [Morus notabilis]
Length=724

 Score =   274 bits (700),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 154/180 (86%), Gaps = 1/180 (1%)
 Frame = +1

Query  55   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  234
            + +G    T       S  RC VEEVALVVPETDDP+LPVLTFRAW LG+ SC++LIFLN
Sbjct  4    KTNGQGTETEKPNVESSEERCSVEEVALVVPETDDPSLPVLTFRAWVLGLGSCVLLIFLN  63

Query  235  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  414
            TFF YRTQPL+ISAILMQISVLPIGKFMAATLP ++++  GR  F+LNPGPFN+KEHVII
Sbjct  64   TFFTYRTQPLTISAILMQISVLPIGKFMAATLPTKEYSLLGR-RFSLNPGPFNMKEHVII  122

Query  415  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            T+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+++FLC L+IVLTTQ++GYGWAG+LRRYLV
Sbjct  123  TIFANCGVSFGGGDAYSIGAITVMKAYYKQSVNFLCALLIVLTTQILGYGWAGMLRRYLV  182



>ref|XP_008224626.1| PREDICTED: oligopeptide transporter 3 [Prunus mume]
Length=739

 Score =   273 bits (699),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 156/178 (88%), Gaps = 1/178 (1%)
 Frame = +1

Query  61   SGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTF  240
            + ++P  A   ++    RC +EEVALVVPETDDP++PV+TFRAWFLG+T+CIILIFLNTF
Sbjct  5    NHMDPEKAANGSSEDHERCAIEEVALVVPETDDPSMPVMTFRAWFLGLTTCIILIFLNTF  64

Query  241  FIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITV  420
            F +RTQPLSISAILMQI+ LPIGK MA+TLP+R+++  G W F+LNPGPFN+KEHVIIT+
Sbjct  65   FTFRTQPLSISAILMQIASLPIGKLMASTLPKREYSLLG-WRFSLNPGPFNMKEHVIITI  123

Query  421  MANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             ANCG+S GGGDAYSIGAITIMKAYYKQ+LSFL  LIIVLT+Q++GYGWAG+LRR+LV
Sbjct  124  FANCGISYGGGDAYSIGAITIMKAYYKQSLSFLLALIIVLTSQILGYGWAGILRRFLV  181



>ref|XP_009124517.1| PREDICTED: oligopeptide transporter 3 [Brassica rapa]
 emb|CDY22769.1| BnaA08g05990D [Brassica napus]
Length=735

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 147/161 (91%), Gaps = 1/161 (1%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
            RCPVEEVALVVPETDDPTLPV+TFRAWFLG++SC++LIFLNTFF YRTQPL+ISAILMQI
Sbjct  18   RCPVEEVALVVPETDDPTLPVMTFRAWFLGLSSCVLLIFLNTFFTYRTQPLTISAILMQI  77

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +VLPIGKFMA TLP       G W ++LNPGPFNIKEHVIIT+ ANCGV+ GGGDAYSIG
Sbjct  78   AVLPIGKFMARTLPTTSHRLMG-WEWSLNPGPFNIKEHVIITIFANCGVAYGGGDAYSIG  136

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  137  AITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLV  177



>ref|XP_010270227.1| PREDICTED: oligopeptide transporter 3 [Nelumbo nucifera]
Length=746

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 153/183 (84%), Gaps = 4/183 (2%)
 Frame = +1

Query  55   EMSGLNP---ATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILI  225
            E  G N     T      P   RCPVEEV LVVPETDDP+LPV+TFRAWFLGI SC +LI
Sbjct  6    ETKGQNKKFTTTQKLDDEPPEERCPVEEVRLVVPETDDPSLPVMTFRAWFLGIISCTLLI  65

Query  226  FLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEH  405
            FLNTFFIYRTQPL+ISAILMQI+VLPIGKFMA+TLP ++    G  SF LNPGPFN+KEH
Sbjct  66   FLNTFFIYRTQPLTISAILMQIAVLPIGKFMASTLPNKEIKVLGM-SFNLNPGPFNMKEH  124

Query  406  VIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRR  585
            VIIT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+L+F+CGL+IVLTTQ++GYGWAG+LRR
Sbjct  125  VIITIFANCGVSYGGGDAYSIGAITVMKAYYKQSLNFVCGLLIVLTTQILGYGWAGMLRR  184

Query  586  YLV  594
            YLV
Sbjct  185  YLV  187



>ref|XP_007211357.1| hypothetical protein PRUPE_ppa001984mg [Prunus persica]
 gb|EMJ12556.1| hypothetical protein PRUPE_ppa001984mg [Prunus persica]
Length=733

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 154/175 (88%), Gaps = 1/175 (1%)
 Frame = +1

Query  70   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  249
            +P  A   ++    RC +EEVALVVPETDDP++PV+TFRAWFLG+T+CIILIFLNTFF +
Sbjct  8    DPEKAANGSSEDHERCAIEEVALVVPETDDPSMPVMTFRAWFLGLTTCIILIFLNTFFTF  67

Query  250  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  429
            RTQPLSISAILMQI+ LPIGK MA+TLP+R+++  G W F+LNPGPFN+KEHVIIT+ AN
Sbjct  68   RTQPLSISAILMQIAALPIGKLMASTLPKREYSLLG-WRFSLNPGPFNMKEHVIITIFAN  126

Query  430  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            CG+S GGGDAYSIGAITIMKAYYKQ+LSFL  LIIVLT+Q++GYGWAG+LRR+LV
Sbjct  127  CGISYGGGDAYSIGAITIMKAYYKQSLSFLLALIIVLTSQILGYGWAGILRRFLV  181



>ref|XP_010436532.1| PREDICTED: oligopeptide transporter 3 [Camelina sativa]
Length=726

 Score =   273 bits (697),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 147/161 (91%), Gaps = 1/161 (1%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
            RCPVEEVALVVPETDDP++PV+TFRAWFLG++SC++LIFLNTFF YRTQPL+ISAILMQI
Sbjct  20   RCPVEEVALVVPETDDPSIPVMTFRAWFLGLSSCVLLIFLNTFFTYRTQPLTISAILMQI  79

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +VLPIGKFMA TLP       G W F+LNPGPFNIKEHVIIT+ ANCGV+ GGGDAYSIG
Sbjct  80   AVLPIGKFMARTLPTTSRNLLG-WKFSLNPGPFNIKEHVIITIFANCGVAYGGGDAYSIG  138

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AIT+MKAYYKQ+LSF+CGL IVLTTQ+IGYGWAG+LRRYLV
Sbjct  139  AITVMKAYYKQSLSFICGLFIVLTTQIIGYGWAGILRRYLV  179



>gb|ABF70152.1| oligopeptide transporter OPT family protein [Musa acuminata]
Length=748

 Score =   273 bits (697),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            PVEEVALVVPETDDP+LPV+TFRAWF+G+ SCIILIFLNTFF YRTQPL+ISAIL QI+ 
Sbjct  32   PVEEVALVVPETDDPSLPVMTFRAWFIGLASCIILIFLNTFFTYRTQPLTISAILAQITA  91

Query  298  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  477
            LP+G+FMA+ LP R+   F  W F LNPGPFNIKEHVIIT+ ANCGVS GGGDAYSIGAI
Sbjct  92   LPVGRFMASVLPNREIRVFRNWGFNLNPGPFNIKEHVIITIFANCGVSIGGGDAYSIGAI  151

Query  478  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            T+MKAYYKQ+LSFLCGLIIVLTTQ++GYGWAG+LRRYLV
Sbjct  152  TVMKAYYKQSLSFLCGLIIVLTTQILGYGWAGMLRRYLV  190



>ref|XP_008464311.1| PREDICTED: oligopeptide transporter 3 [Cucumis melo]
Length=745

 Score =   271 bits (693),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 149/170 (88%), Gaps = 1/170 (1%)
 Frame = +1

Query  85   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  264
            G    PS  RCPVEEVALVVPETDDP+LPV+TFR+W LG+ SC +LIFLNTFF YR+QPL
Sbjct  19   GGGELPSEDRCPVEEVALVVPETDDPSLPVMTFRSWVLGLASCCLLIFLNTFFTYRSQPL  78

Query  265  SISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSP  444
            +ISAILMQI+VLPIG+FMA+TLP R F  F RW F+LNPGPFN+KEHVIIT+ ANCG+S 
Sbjct  79   AISAILMQIAVLPIGRFMASTLPNRDFH-FLRWKFSLNPGPFNMKEHVIITIFANCGISY  137

Query  445  GGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            GGGDAYSIGAIT+MKAYYKQ+L+F   L+IVLTTQ++GYGWAG+LRRYLV
Sbjct  138  GGGDAYSIGAITVMKAYYKQSLNFFLALLIVLTTQVLGYGWAGMLRRYLV  187



>ref|XP_009397220.1| PREDICTED: oligopeptide transporter 3-like [Musa acuminata subsp. 
malaccensis]
Length=748

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            PVEEVALVVPETDDP+LPV+TFRAWF+G+ SC ILIFLNTFF YRTQPL+ISAIL QI+ 
Sbjct  32   PVEEVALVVPETDDPSLPVMTFRAWFIGLASCTILIFLNTFFTYRTQPLTISAILAQITA  91

Query  298  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  477
            LP+G+FMA+ LP R+   F  W F LNPGPFNIKEHVIIT+ ANCGVS GGGDAYSIGAI
Sbjct  92   LPVGRFMASVLPNREIRVFRNWGFNLNPGPFNIKEHVIITIFANCGVSIGGGDAYSIGAI  151

Query  478  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            T+MKAYYKQ+LSFLCGLIIVLTTQ++GYGWAG+LRRYLV
Sbjct  152  TVMKAYYKQSLSFLCGLIIVLTTQILGYGWAGMLRRYLV  190



>ref|XP_004139520.1| PREDICTED: oligopeptide transporter 3-like [Cucumis sativus]
 ref|XP_004162504.1| PREDICTED: oligopeptide transporter 3-like [Cucumis sativus]
 gb|KGN65011.1| hypothetical protein Csa_1G180750 [Cucumis sativus]
Length=745

 Score =   269 bits (688),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 148/170 (87%), Gaps = 1/170 (1%)
 Frame = +1

Query  85   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  264
            G    PS  RC VEEVALVVPETDDPTLPV+TFR+W LG+ SC +LIFLNTFF YR+QPL
Sbjct  19   GGGELPSEDRCSVEEVALVVPETDDPTLPVMTFRSWVLGLASCCLLIFLNTFFTYRSQPL  78

Query  265  SISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSP  444
            +ISAILMQI+VLPIG+FMA+TLP R F  F RW F+LNPGPFN+KEHVIIT+ ANCG+S 
Sbjct  79   AISAILMQIAVLPIGRFMASTLPNRDFH-FLRWKFSLNPGPFNMKEHVIITIFANCGISY  137

Query  445  GGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            GGGDAYSIGAIT+MKAYYKQ+L+F   L+IVLTTQ++GYGWAG+LRRYLV
Sbjct  138  GGGDAYSIGAITVMKAYYKQSLNFFLALLIVLTTQVLGYGWAGMLRRYLV  187



>emb|CDY42539.1| BnaC08g10640D [Brassica napus]
Length=735

 Score =   269 bits (688),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 146/162 (90%), Gaps = 3/162 (2%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
            RCPVEEVALVVPETDDPTLPV+TFRAWFLG++SC++LIFLNTFF YRTQPL+ISAILMQI
Sbjct  18   RCPVEEVALVVPETDDPTLPVMTFRAWFLGLSSCVLLIFLNTFFTYRTQPLTISAILMQI  77

Query  292  SVLPIGKFMAATLPERKFAPFG-RWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSI  468
            +VLPIGKFMA TLP       G  WS  LNPGPFNIKEHVIIT+ ANCGV+ GGGDAYSI
Sbjct  78   AVLPIGKFMARTLPTTSHRLMGCEWS--LNPGPFNIKEHVIITIFANCGVAYGGGDAYSI  135

Query  469  GAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            GAIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAGVLRRYLV
Sbjct  136  GAITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGVLRRYLV  177



>gb|ADW09325.1| oligopeptide transporter 3 [Noccaea caerulescens]
Length=736

 Score =   269 bits (688),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 145/161 (90%), Gaps = 1/161 (1%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
            RCPVEEVALVVPETDDPTLPV+TFRAWFLG+ SC++LIFLNTFF YRTQPL+ISAILMQI
Sbjct  19   RCPVEEVALVVPETDDPTLPVMTFRAWFLGLASCVLLIFLNTFFTYRTQPLTISAILMQI  78

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +VLPIGKFMA  LP       G+  F+LNPGPFNIKEHVIIT+ ANCGV+ GGGDAYSIG
Sbjct  79   AVLPIGKFMARILPTTSHKLMGK-EFSLNPGPFNIKEHVIITIFANCGVAYGGGDAYSIG  137

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AIT+MKAYYKQ+L+F+CGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  138  AITVMKAYYKQSLTFICGLFIVLTTQILGYGWAGILRRYLV  178



>ref|XP_010686627.1| PREDICTED: oligopeptide transporter 3 [Beta vulgaris subsp. vulgaris]
Length=741

 Score =   269 bits (687),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 146/161 (91%), Gaps = 1/161 (1%)
 Frame = +1

Query  115  CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQIS  294
            CPVEEVALVVPETDDPTLPVLTFRAWFLG+ SC++LIFLNTFFI+RTQPL+ISAILMQI+
Sbjct  23   CPVEEVALVVPETDDPTLPVLTFRAWFLGMVSCVLLIFLNTFFIFRTQPLTISAILMQIA  82

Query  295  VLPIGKFMAATLPERKFAPFG-RWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            VLP+GKFMA  +P R +  FG RW F+LNPGPFNIKEHVII+++ANCGVS GGGDAYS G
Sbjct  83   VLPMGKFMARVMPTRTYRLFGGRWEFSLNPGPFNIKEHVIISILANCGVSYGGGDAYSTG  142

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AI +MKAYYKQ++ FLC + IVLTTQ++GYGWAG+LRRYLV
Sbjct  143  AIVVMKAYYKQSIGFLCAVFIVLTTQILGYGWAGMLRRYLV  183



>ref|XP_008345787.1| PREDICTED: oligopeptide transporter 3-like [Malus domestica]
Length=753

 Score =   269 bits (687),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 145/160 (91%), Gaps = 1/160 (1%)
 Frame = +1

Query  115  CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQIS  294
            C +EEVALVVPETDDPT+PV+TFRAWFLGITSC ILIFLNTFF YRTQPL+ISAILMQI+
Sbjct  37   CKIEEVALVVPETDDPTMPVMTFRAWFLGITSCTILIFLNTFFTYRTQPLAISAILMQIT  96

Query  295  VLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGA  474
             LPIGKFMA+ LP R+ +  G W F+LNPGPFNIKEHVIIT+ ANCG+S GGGDAYSIGA
Sbjct  97   TLPIGKFMASALPRREHSLLG-WRFSLNPGPFNIKEHVIITIFANCGISYGGGDAYSIGA  155

Query  475  ITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            ITIMKAYYKQ+LSF+  L+IVLTTQ+IGYGWAG+LRRYLV
Sbjct  156  ITIMKAYYKQSLSFILSLVIVLTTQVIGYGWAGILRRYLV  195



>ref|XP_010039442.1| PREDICTED: oligopeptide transporter 3-like [Eucalyptus grandis]
 gb|KCW45989.1| hypothetical protein EUGRSUZ_L00157 [Eucalyptus grandis]
Length=745

 Score =   269 bits (687),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 147/161 (91%), Gaps = 1/161 (1%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
            RCPVEEVALVVPETDDP+LPV+TFR W LG+ SCIILIFLNTFF +RTQPL+ISAILMQI
Sbjct  27   RCPVEEVALVVPETDDPSLPVMTFRVWTLGLASCIILIFLNTFFTFRTQPLTISAILMQI  86

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +VLPIG+FMA TLP R++   G + F+LNPGPFN+KEHVIIT+ ANCGVS GGGDAYSIG
Sbjct  87   AVLPIGRFMAKTLPSREYKVLG-YGFSLNPGPFNMKEHVIITIFANCGVSIGGGDAYSIG  145

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AIT+MKAYYKQ LSFLCGL+IVLTTQ++GYGWAG+LR+YLV
Sbjct  146  AITVMKAYYKQNLSFLCGLVIVLTTQILGYGWAGLLRKYLV  186



>gb|KDP35505.1| hypothetical protein JCGZ_08943 [Jatropha curcas]
Length=743

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 148/177 (84%), Gaps = 1/177 (1%)
 Frame = +1

Query  64   GLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFF  243
            G     A    +    RC +EEVALVVPETDDPTLPV+TFRAWFLG+ SC +LIFLNTFF
Sbjct  9    GTESEKAANGDSTEHERCSIEEVALVVPETDDPTLPVMTFRAWFLGLASCSLLIFLNTFF  68

Query  244  IYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVM  423
             YRTQPL+ISAILMQI VLPIGKFMA TLP +++  FG + FTLNPGPFNIKEHVIIT+ 
Sbjct  69   TYRTQPLTISAILMQIGVLPIGKFMARTLPSKEYKIFG-YGFTLNPGPFNIKEHVIITIF  127

Query  424  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            ANCGVS GGGDAYSIGAIT+MKAYYKQ L+FL  LIIVLT+Q++GYGWAG+LRRYLV
Sbjct  128  ANCGVSYGGGDAYSIGAITVMKAYYKQGLNFLLALIIVLTSQILGYGWAGMLRRYLV  184



>ref|XP_009404107.1| PREDICTED: oligopeptide transporter 3-like [Musa acuminata subsp. 
malaccensis]
Length=738

 Score =   267 bits (682),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
            RCPVEEV LVVPETDDP+LPV+TFRAWFLG+TSC +LIFLNTFF YRTQPL+ISAILMQI
Sbjct  20   RCPVEEVKLVVPETDDPSLPVMTFRAWFLGLTSCSLLIFLNTFFTYRTQPLTISAILMQI  79

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +VLPIG+ MA+ LP+R+      W F LNPGPFNIKEHVIIT+ A+CGVS GGGDAYSIG
Sbjct  80   AVLPIGRLMASVLPDREVNLLPGWGFNLNPGPFNIKEHVIITIFASCGVSYGGGDAYSIG  139

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AIT+MKAYYKQ LSFLC L+IVL+TQ++GYGWAG++RRYLV
Sbjct  140  AITVMKAYYKQNLSFLCALLIVLSTQILGYGWAGMMRRYLV  180



>ref|XP_003559475.2| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 3, partial 
[Brachypodium distachyon]
Length=494

 Score =   261 bits (667),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 150/186 (81%), Gaps = 7/186 (4%)
 Frame = +1

Query  58   MSGLNPATAGE-----KTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIIL  222
            MS L    A E     K    G R PVEEVALVVPETDDP+ PV+TFRAW LG++SC++L
Sbjct  1    MSSLKSPVAAEEAMRGKQQGEGERYPVEEVALVVPETDDPSTPVMTFRAWTLGLSSCVVL  60

Query  223  IFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNI  396
            IFLNTFF YRTQPL+IS IL QI VLP+G+FMA+ LP+R+    G    SF LNPGPFN+
Sbjct  61   IFLNTFFTYRTQPLTISGILAQILVLPVGRFMASVLPDREVRLLGGRLGSFNLNPGPFNV  120

Query  397  KEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGV  576
            KEHVIIT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L+IVL+TQ++GYGWAG+
Sbjct  121  KEHVIITIFANCGVSYGGGDAYSIGAITVMKAYYKQSLSFLCALLIVLSTQILGYGWAGM  180

Query  577  LRRYLV  594
            LRRYLV
Sbjct  181  LRRYLV  186



>ref|XP_010057794.1| PREDICTED: oligopeptide transporter 3-like [Eucalyptus grandis]
 gb|KCW75109.1| hypothetical protein EUGRSUZ_E03859 [Eucalyptus grandis]
Length=744

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = +1

Query  97   APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISA  276
            APS  RC VEEVALVVPETDDPT+PV+TFR W LG+TSC+ILIFLNTFF YRTQPL ISA
Sbjct  21   APSDERCSVEEVALVVPETDDPTIPVMTFRTWTLGLTSCVILIFLNTFFTYRTQPLVISA  80

Query  277  ILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGD  456
            ILMQI+VLPIG+FMA  LP  +++  GR  F LNPGPFNIKEHV+IT+ ANCGVS GGGD
Sbjct  81   ILMQIAVLPIGRFMARVLPTTEYSLLGR-RFRLNPGPFNIKEHVVITIFANCGVSTGGGD  139

Query  457  AYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AYSIGA+T+MK YYKQ LSFLC  +IVLTTQ++GYGWAG+LRRYLV
Sbjct  140  AYSIGAVTVMKTYYKQNLSFLCAFLIVLTTQILGYGWAGMLRRYLV  185



>ref|XP_009374520.1| PREDICTED: oligopeptide transporter 3 [Pyrus x bretschneideri]
Length=749

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 144/160 (90%), Gaps = 1/160 (1%)
 Frame = +1

Query  115  CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQIS  294
            C +EEVALVVPETDDPT+PV+TFRAWFLG+TSC ILIFLNTFF YRTQPL+ISAILMQI+
Sbjct  33   CKIEEVALVVPETDDPTMPVMTFRAWFLGLTSCTILIFLNTFFTYRTQPLAISAILMQIT  92

Query  295  VLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGA  474
             LPIGKFMA+ LP  + +  G W F+LNPGPFNIKEHVIIT+ ANCG+S GGGDAYSIGA
Sbjct  93   TLPIGKFMASALPRHEHSLLG-WGFSLNPGPFNIKEHVIITIFANCGISYGGGDAYSIGA  151

Query  475  ITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            ITIMKAYYKQ+LSF+  L++VLTTQ+IGYGWAG+LRRYLV
Sbjct  152  ITIMKAYYKQSLSFILSLVLVLTTQIIGYGWAGILRRYLV  191



>ref|XP_010542186.1| PREDICTED: oligopeptide transporter 3 [Tarenaya hassleriana]
Length=727

 Score =   261 bits (668),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 141/155 (91%), Gaps = 1/155 (1%)
 Frame = +1

Query  130  VALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIG  309
            VALVVPETDDP+LPV+TFRAWFLG+TSC++LIFLNTFF YRTQPL+ISAILMQISVLPIG
Sbjct  21   VALVVPETDDPSLPVMTFRAWFLGLTSCVLLIFLNTFFTYRTQPLTISAILMQISVLPIG  80

Query  310  KFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMK  489
            KFMA TLP   +  FGR  F+LNPGPFNIKEHVIIT+ ANCGVS GGGDAYSIGAIT+MK
Sbjct  81   KFMARTLPTTPYELFGR-KFSLNPGPFNIKEHVIITIFANCGVSFGGGDAYSIGAITVMK  139

Query  490  AYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AYYKQ LSFLC + IVLTTQ++GYGWAG+LRRYLV
Sbjct  140  AYYKQTLSFLCAIFIVLTTQILGYGWAGILRRYLV  174



>gb|AAO32313.1| putative oligopeptide transporter protein [Oryza sativa Japonica 
Group]
Length=726

 Score =   261 bits (668),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 142/166 (86%), Gaps = 2/166 (1%)
 Frame = +1

Query  103  SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAIL  282
             G RCPVEEVALVVPETDDPT PV+TFRAW LG+ SC++LIFLNTFF YRTQPL+IS IL
Sbjct  25   EGERCPVEEVALVVPETDDPTTPVMTFRAWTLGLASCVVLIFLNTFFTYRTQPLTISGIL  84

Query  283  MQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMANCGVSPGGGD  456
             QI VLP G+FMAA LP R+    G    SF LNPGPFNIKEHVIIT+ ANCGVS GGGD
Sbjct  85   AQILVLPAGQFMAAVLPSREVRLLGGRLGSFNLNPGPFNIKEHVIITIFANCGVSYGGGD  144

Query  457  AYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AYSIGAIT+MKAYYKQ+LSFLC L+IVLTTQ++GYGWAG+LRRYLV
Sbjct  145  AYSIGAITVMKAYYKQSLSFLCALLIVLTTQILGYGWAGMLRRYLV  190



>ref|XP_004295330.1| PREDICTED: oligopeptide transporter 3 [Fragaria vesca subsp. 
vesca]
Length=736

 Score =   261 bits (667),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = +1

Query  115  CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQIS  294
            C +EEVALVVPETDDP+LPV+TFR WFLGITSC ILIFLNTFF YRTQPL ISAILMQI+
Sbjct  20   CEIEEVALVVPETDDPSLPVMTFRTWFLGITSCTILIFLNTFFSYRTQPLIISAILMQIA  79

Query  295  VLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGA  474
            VLPIGKFMA TLP + F   G + F LNP PFN+KEHV+IT+ ANCGVS GGGDAYS GA
Sbjct  80   VLPIGKFMAKTLPNKDFNLMG-FKFNLNPAPFNMKEHVVITIFANCGVSAGGGDAYSTGA  138

Query  475  ITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            IT+MKAYY Q+LSFLCGL IVLT+Q+IGYGWAG+LRRYLV
Sbjct  139  ITVMKAYYHQSLSFLCGLFIVLTSQMIGYGWAGLLRRYLV  178



>ref|NP_001051290.1| Os03g0751100 [Oryza sativa Japonica Group]
 gb|AAR87263.1| putative oligopeptide transporter protein [Oryza sativa Japonica 
Group]
 gb|ABF98905.1| oligopeptide transporter 3, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13204.1| Os03g0751100 [Oryza sativa Japonica Group]
 gb|EEC76189.1| hypothetical protein OsI_13528 [Oryza sativa Indica Group]
 gb|EEE59939.1| hypothetical protein OsJ_12589 [Oryza sativa Japonica Group]
Length=757

 Score =   261 bits (668),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 142/166 (86%), Gaps = 2/166 (1%)
 Frame = +1

Query  103  SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAIL  282
             G RCPVEEVALVVPETDDPT PV+TFRAW LG+ SC++LIFLNTFF YRTQPL+IS IL
Sbjct  25   EGERCPVEEVALVVPETDDPTTPVMTFRAWTLGLASCVVLIFLNTFFTYRTQPLTISGIL  84

Query  283  MQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMANCGVSPGGGD  456
             QI VLP G+FMAA LP R+    G    SF LNPGPFNIKEHVIIT+ ANCGVS GGGD
Sbjct  85   AQILVLPAGQFMAAVLPSREVRLLGGRLGSFNLNPGPFNIKEHVIITIFANCGVSYGGGD  144

Query  457  AYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AYSIGAIT+MKAYYKQ+LSFLC L+IVLTTQ++GYGWAG+LRRYLV
Sbjct  145  AYSIGAITVMKAYYKQSLSFLCALLIVLTTQILGYGWAGMLRRYLV  190



>dbj|BAK07444.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=745

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = +1

Query  73   PATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  252
            PA  G+     G R PVEEVALVVPETDDP  PV+TFRAW LG+TSC++LIFLNTFF YR
Sbjct  8    PAAGGKGAQGEGERYPVEEVALVVPETDDPATPVMTFRAWTLGLTSCVVLIFLNTFFTYR  67

Query  253  TQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMA  426
            TQPL+IS IL QI VLP+G+FMA+ LP+R+    G    SF LNPGPFNIKEHVIIT+ A
Sbjct  68   TQPLTISGILAQILVLPVGRFMASVLPDREVRLLGGRLGSFNLNPGPFNIKEHVIITIFA  127

Query  427  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            NCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L+IVL+TQ++GYGWAG+LRR+LV
Sbjct  128  NCGVSYGGGDAYSIGAITVMKAYYKQSLSFLCALLIVLSTQILGYGWAGMLRRFLV  183



>ref|XP_008349335.1| PREDICTED: oligopeptide transporter 3-like [Malus domestica]
Length=756

 Score =   259 bits (663),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
            RC +EEVALVVPETDDPTLPV+TFRAWFLG+TSC +LIFLNTFF +RTQPL+ISAILMQI
Sbjct  39   RCKIEEVALVVPETDDPTLPVMTFRAWFLGLTSCTLLIFLNTFFSFRTQPLAISAILMQI  98

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
              LPIGKFMA+ LP R+ +  G W F+ N GPFNIKEHVIIT+ ANCG+S GGGDAYSIG
Sbjct  99   ITLPIGKFMASALPRREHSLRG-WRFSXNXGPFNIKEHVIITIFANCGISYGGGDAYSIG  157

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AITIMKAYYKQ+LSF+  L+IVLTTQ+IGYGWAG+LRRYLV
Sbjct  158  AITIMKAYYKQSLSFILSLVIVLTTQIIGYGWAGILRRYLV  198



>ref|XP_009374859.1| PREDICTED: oligopeptide transporter 3-like [Pyrus x bretschneideri]
Length=753

 Score =   259 bits (662),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 147/174 (84%), Gaps = 7/174 (4%)
 Frame = +1

Query  73   PATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  252
            P + G K      RC +EEVALVVPETDDPT+PV+TFRA FLG+TSC +LIFLNTFF +R
Sbjct  29   PESDGHK------RCKIEEVALVVPETDDPTMPVMTFRALFLGLTSCTLLIFLNTFFSFR  82

Query  253  TQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANC  432
            TQPL+ISAILMQI  LPIGKFMA+ LP R+ +  G W F+LNPGPFNIKEHVI+T+ ANC
Sbjct  83   TQPLAISAILMQIITLPIGKFMASALPSRQHSLRG-WRFSLNPGPFNIKEHVIVTIFANC  141

Query  433  GVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            G+S GGGDAYSIGAITIMKAYYKQ+LSF+  L+IVLTTQ+IGYGWAG+ RRYLV
Sbjct  142  GISYGGGDAYSIGAITIMKAYYKQSLSFILSLVIVLTTQIIGYGWAGIFRRYLV  195



>ref|XP_006651827.1| PREDICTED: oligopeptide transporter 3-like [Oryza brachyantha]
Length=742

 Score =   259 bits (661),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 143/168 (85%), Gaps = 2/168 (1%)
 Frame = +1

Query  97   APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISA  276
            A  G RCPVEEVALVVPETDDPT PV+TFRAW LG+TSC++LIFLNTFF YRTQPL+IS 
Sbjct  7    ALQGERCPVEEVALVVPETDDPTTPVMTFRAWTLGLTSCVVLIFLNTFFTYRTQPLTISG  66

Query  277  ILMQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMANCGVSPGG  450
            IL QI VLP G+FMAA LP R+    G    SF LNPGPFNIKEHVIIT+ ANCGVS GG
Sbjct  67   ILAQILVLPAGQFMAAVLPNREGRLLGGRLGSFNLNPGPFNIKEHVIITIFANCGVSYGG  126

Query  451  GDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            GDAYSIGAIT+MKAYYKQ+L F+C L+IVLTTQ++GYGWAG+LRRYLV
Sbjct  127  GDAYSIGAITVMKAYYKQSLGFVCALLIVLTTQILGYGWAGMLRRYLV  174



>gb|KCW45990.1| hypothetical protein EUGRSUZ_L00158 [Eucalyptus grandis]
Length=745

 Score =   257 bits (656),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
            +C VEEVALVVPETDDP LPV+TFR W LG+TSC++LIFLNTFF++RTQPL+IS+ILMQI
Sbjct  28   KCAVEEVALVVPETDDPLLPVMTFRVWVLGLTSCVVLIFLNTFFMFRTQPLTISSILMQI  87

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            ++LPIGKFMA TLP +++  FG +SFTLNPGPFN+KEHV+IT+ ANCGV+ GG DAYSIG
Sbjct  88   TMLPIGKFMARTLPAKRYQVFG-YSFTLNPGPFNVKEHVLITIFANCGVATGGVDAYSIG  146

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             IT+MK YYKQ LSFLC LIIVLTTQL GYGWAG+ R+YLV
Sbjct  147  PITVMKTYYKQNLSFLCALIIVLTTQLAGYGWAGMFRKYLV  187



>ref|XP_002463867.1| hypothetical protein SORBIDRAFT_01g007880 [Sorghum bicolor]
 gb|EER90865.1| hypothetical protein SORBIDRAFT_01g007880 [Sorghum bicolor]
Length=747

 Score =   256 bits (654),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 145/180 (81%), Gaps = 5/180 (3%)
 Frame = +1

Query  70   NPATAGEKTA---PSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTF  240
            +P  A E+       G RC VEEVALVVPETDDP+LPV+TFRAW LG+ SC++LIFLNTF
Sbjct  7    SPVVAEERAGMEEGKGERCAVEEVALVVPETDDPSLPVMTFRAWTLGLGSCVVLIFLNTF  66

Query  241  FIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVII  414
            F YRTQPL+IS IL QI VLP G+FMAA LP R+    G    SF LNPGPFN+KEHVII
Sbjct  67   FTYRTQPLTISGILAQILVLPAGRFMAAVLPNREVRLLGGRLGSFNLNPGPFNVKEHVII  126

Query  415  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            T+ ANCGVS GGGDAYSIGAIT+MKAYYKQ LSF C L+IVLTTQ++GYGWAG+LRRYLV
Sbjct  127  TIFANCGVSYGGGDAYSIGAITVMKAYYKQTLSFACALLIVLTTQILGYGWAGMLRRYLV  186



>gb|ACL82964.1| glutathione transporter [Zea mays]
Length=746

 Score =   256 bits (654),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 146/180 (81%), Gaps = 5/180 (3%)
 Frame = +1

Query  70   NPATAGEKTAP---SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTF  240
            +P  A E+       G RC VEEVALVVPETDDP+LPV+TFRAW LG+ SC++LIFLNTF
Sbjct  6    SPVAAEERAGTGEGKGERCAVEEVALVVPETDDPSLPVMTFRAWALGLGSCVVLIFLNTF  65

Query  241  FIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVII  414
            F YRTQPL+IS IL QI VLP G+F+AA LP+R+    G    SF LNPGPFN+KEHVII
Sbjct  66   FTYRTQPLTISGILAQILVLPAGRFLAAVLPDREVRILGGRLGSFNLNPGPFNVKEHVII  125

Query  415  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            T+ ANCGVS GGGDAYSIGAIT+MKAYYKQ LSF C L+IVLTTQ++GYGWAG+LRRYLV
Sbjct  126  TIFANCGVSYGGGDAYSIGAITVMKAYYKQTLSFACALLIVLTTQILGYGWAGLLRRYLV  185



>gb|EMS48793.1| Oligopeptide transporter 3 [Triticum urartu]
Length=561

 Score =   252 bits (643),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 140/163 (86%), Gaps = 2/163 (1%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
            R PVEEVAL VPETDDP  PV+TFRAW LG+ SC++LIFLNTFF YRTQPL+IS IL QI
Sbjct  27   RYPVEEVALGVPETDDPATPVMTFRAWTLGLASCVVLIFLNTFFTYRTQPLTISGILAQI  86

Query  292  SVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYS  465
             VLP+G+FMA+ LP+RK    G    SF LNPGPFNIKEHVIIT+ ANCGVS GGGDAYS
Sbjct  87   LVLPVGRFMASVLPDRKVRLLGGRLGSFNLNPGPFNIKEHVIITIFANCGVSYGGGDAYS  146

Query  466  IGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            IGAIT+MKAYYKQ+LSFLC L+IVL+TQ++GYGWAG+LRR+LV
Sbjct  147  IGAITVMKAYYKQSLSFLCALLIVLSTQILGYGWAGMLRRFLV  189



>ref|XP_006856263.1| hypothetical protein AMTR_s00047p00062520 [Amborella trichopoda]
 gb|ERN17730.1| hypothetical protein AMTR_s00047p00062520 [Amborella trichopoda]
Length=738

 Score =   255 bits (652),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 144/161 (89%), Gaps = 1/161 (1%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
            + P+EEVALVVP TDDP LPV+TFRAWFLGIT C+ L+F+NTFF YRTQPL+ISAIL QI
Sbjct  21   QSPIEEVALVVPVTDDPNLPVMTFRAWFLGITFCVFLMFVNTFFTYRTQPLTISAILAQI  80

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            + LP+G+FMAATLP+++    G +SF+LNPGPFNIKEHVIIT+ ANCGV+ GGGDAYSIG
Sbjct  81   AALPMGRFMAATLPKKEMRVLG-YSFSLNPGPFNIKEHVIITIFANCGVAYGGGDAYSIG  139

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AIT+MK YYKQ+LSFLCGL IVLTTQ++GYGWAG++RRYLV
Sbjct  140  AITVMKVYYKQSLSFLCGLFIVLTTQVLGYGWAGMMRRYLV  180



>gb|EMT33592.1| Oligopeptide transporter 3 [Aegilops tauschii]
Length=750

 Score =   255 bits (652),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 148/182 (81%), Gaps = 5/182 (3%)
 Frame = +1

Query  55   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  234
            + +G   A  GE     G R PVEEVALVVPETDDP  PV+TFRAW LG+ SC++LIFLN
Sbjct  10   DATGGKAAAQGEG---EGERYPVEEVALVVPETDDPATPVMTFRAWTLGLASCVVLIFLN  66

Query  235  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHV  408
            TFF YRTQPL+IS IL QI VLP+G+FMA+ LP+R+    G    SF LNPGPFNIKEHV
Sbjct  67   TFFTYRTQPLTISGILAQILVLPVGRFMASVLPDREVRLLGGRLGSFNLNPGPFNIKEHV  126

Query  409  IITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRY  588
            IIT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L+IVL+TQ++GYGWAG+LRR+
Sbjct  127  IITIFANCGVSYGGGDAYSIGAITVMKAYYKQSLSFLCALLIVLSTQILGYGWAGMLRRF  186

Query  589  LV  594
            LV
Sbjct  187  LV  188



>ref|XP_004981750.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 3-like 
[Setaria italica]
Length=750

 Score =   255 bits (652),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 141/163 (87%), Gaps = 2/163 (1%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
            RCPVEEVALVVPETDDP+LPV+TFRAW LG+ SC++LIFLNTFF YRTQPL+IS IL QI
Sbjct  28   RCPVEEVALVVPETDDPSLPVMTFRAWTLGLASCVVLIFLNTFFTYRTQPLTISGILAQI  87

Query  292  SVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYS  465
             VLP G+FMAA LP+R+    G    SF LNPGPFN+KEHVIIT+ ANCGVS GGGDAYS
Sbjct  88   LVLPAGRFMAAVLPDREVRLLGGRLGSFNLNPGPFNVKEHVIITIFANCGVSYGGGDAYS  147

Query  466  IGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            IGAIT+MKAYYKQ LSF+  L+IVLTTQ++GYGWAG+LRRYLV
Sbjct  148  IGAITVMKAYYKQTLSFVLALLIVLTTQILGYGWAGMLRRYLV  190



>ref|XP_002522882.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF39482.1| Oligopeptide transporter, putative [Ricinus communis]
Length=734

 Score =   254 bits (649),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 139/166 (84%), Gaps = 1/166 (1%)
 Frame = +1

Query  52   VEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  231
            ++ +G  P       A    RC VEEVALVVPETDDPTLPV+TFRAWFLG+TSC++LIFL
Sbjct  7    IQDNGFKPNGEHSSAAEEHERCSVEEVALVVPETDDPTLPVMTFRAWFLGLTSCVLLIFL  66

Query  232  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVI  411
            NTFF YRTQPL+ISAILMQI VLPIGKFMA  LP +++  FG W F+LNPGPFNIKEHVI
Sbjct  67   NTFFTYRTQPLTISAILMQIGVLPIGKFMAKALPTKQYKIFG-WGFSLNPGPFNIKEHVI  125

Query  412  ITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQ  549
            IT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+L+FLC L+IVLTTQ
Sbjct  126  ITIFANCGVSFGGGDAYSIGAITVMKAYYKQSLNFLCALLIVLTTQ  171



>ref|XP_010039444.1| PREDICTED: oligopeptide transporter 3-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010039445.1| PREDICTED: oligopeptide transporter 3-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW45991.1| hypothetical protein EUGRSUZ_L00159 [Eucalyptus grandis]
Length=765

 Score =   254 bits (649),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 148/186 (80%), Gaps = 5/186 (3%)
 Frame = +1

Query  37   SEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCI  216
             E   VE   L    AGE       RC VEEVALVV ETDD +LPV+TFR W LG+TSC+
Sbjct  26   EERCAVEEVAL---IAGEDQEQEE-RCAVEEVALVVLETDDRSLPVMTFRVWVLGLTSCV  81

Query  217  ILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNI  396
            +LIFLNTFF+YRTQPL+IS+ILMQI+VLPIGKFMA  LP +++  FG +SFTLNPGPFNI
Sbjct  82   VLIFLNTFFMYRTQPLTISSILMQITVLPIGKFMARALPAKRYRFFG-YSFTLNPGPFNI  140

Query  397  KEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGV  576
            KEHV+IT+ ANCGV+ GG DAYSIG IT+MK YYKQ LSFLC LIIVLTTQL GYGWAG+
Sbjct  141  KEHVLITIFANCGVATGGVDAYSIGPITVMKTYYKQNLSFLCALIIVLTTQLAGYGWAGM  200

Query  577  LRRYLV  594
             R+YLV
Sbjct  201  FRKYLV  206



>ref|XP_008665425.1| PREDICTED: oligopeptide transporter 3 [Zea mays]
 tpg|DAA51401.1| TPA: glutathione transporter [Zea mays]
Length=748

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 140/163 (86%), Gaps = 2/163 (1%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
            RC VEEVALVVPETDDP++PV+TFRAW LG+ SC++LIFLNTFF YRTQPL+IS IL QI
Sbjct  25   RCAVEEVALVVPETDDPSMPVMTFRAWALGLGSCVVLIFLNTFFTYRTQPLTISGILAQI  84

Query  292  SVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYS  465
             VLP G+F+AA LP+R+    G    SF LNPGPFN+KEHVIIT+ ANCGVS GGGDAYS
Sbjct  85   LVLPAGRFLAAVLPDREVRILGGRLGSFNLNPGPFNVKEHVIITIFANCGVSYGGGDAYS  144

Query  466  IGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            IGAIT+MKAYYKQ LSF C L+IVLTTQ++GYGWAG+LRRYLV
Sbjct  145  IGAITVMKAYYKQTLSFACALLIVLTTQILGYGWAGLLRRYLV  187



>gb|ABB55328.1| small oligopeptide transporter, OPT family [Asparagus officinalis]
Length=755

 Score =   251 bits (640),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 147/218 (67%), Gaps = 49/218 (22%)
 Frame = +1

Query  88   EKTAP-SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  264
            +K  P    RCP+EEVALVVPETDDP LPVLTFRAWFLG+TSC +LIFLNTFF YRTQPL
Sbjct  10   QKPVPVESDRCPIEEVALVVPETDDPNLPVLTFRAWFLGLTSCSVLIFLNTFFTYRTQPL  69

Query  265  SISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSP  444
            +ISAIL QI+VLPIG+FMA+ LP+++    G W F LNPGPF+IKEHVIIT+ ANCGVS 
Sbjct  70   TISAILTQIAVLPIGRFMASALPDKEVRVLGGWGFNLNPGPFSIKEHVIITIFANCGVST  129

Query  445  GGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQ-------------------------  549
            GGGDAYSIGAIT+MKAYYKQ L FLC LIIVLTTQ                         
Sbjct  130  GGGDAYSIGAITVMKAYYKQGLGFLCALIIVLTTQAVLSHYLLMGFKSSSSSSSSSHRKV  189

Query  550  -----------------------LIGYGWAGVLRRYLV  594
                                   +IGYGWAGVLRR+LV
Sbjct  190  TVGFIAELTVTSTFAAVRAPDFNVIGYGWAGVLRRFLV  227



>gb|AAQ91200.1| putative glutathione transporter [Zea mays]
Length=721

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 138/160 (86%), Gaps = 2/160 (1%)
 Frame = +1

Query  121  VEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVL  300
            VEEVALVVPETDDP++PV+TFRAW LG+ SC++LIFLNTFF YRTQPL+IS IL QI VL
Sbjct  1    VEEVALVVPETDDPSMPVMTFRAWALGLGSCVVLIFLNTFFTYRTQPLTISGILAQILVL  60

Query  301  PIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGA  474
            P G+F+AA LP+R+    G    SF LNPGPFN+KEHVIIT+ ANCGVS GGGDAYSIGA
Sbjct  61   PAGRFLAAVLPDREVRILGGRLGSFNLNPGPFNVKEHVIITIFANCGVSYGGGDAYSIGA  120

Query  475  ITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            IT+MKAYYKQ LSF C L+IVLTTQ++GYGWAG+LRRYLV
Sbjct  121  ITVMKAYYKQTLSFACALLIVLTTQILGYGWAGLLRRYLV  160



>gb|ADW66457.1| oligopeptide transporter [Phytolacca americana]
Length=733

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 133/159 (84%), Gaps = 2/159 (1%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            PVEEV L VP TDDP+LPVLTFR WFLG+ SCI+L FLN FF YRTQPL+ISAI  QI+V
Sbjct  19   PVEEVRLTVPITDDPSLPVLTFRMWFLGLCSCILLSFLNDFFWYRTQPLTISAI-SQIAV  77

Query  298  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  477
            LP+G FMA  LP   F P   WS++LNPGPFN+KEHVI+T+ ANCGVS GGGDAYSIGAI
Sbjct  78   LPLGGFMARILPTTPF-PGRGWSYSLNPGPFNLKEHVIVTIFANCGVSQGGGDAYSIGAI  136

Query  478  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            T+MKAYYKQ+L FLC + IVLTTQ +GYGWAG+LRRYLV
Sbjct  137  TVMKAYYKQSLGFLCAIFIVLTTQALGYGWAGMLRRYLV  175



>gb|KHN42268.1| Oligopeptide transporter 3 [Glycine soja]
Length=698

 Score =   232 bits (592),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 127/140 (91%), Gaps = 1/140 (1%)
 Frame = +1

Query  175  LTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPF  354
            +TFRAWFLGI SC++LIFLNTFF +RTQPL+ISAILMQI+VLPIG+FMAATLP +++   
Sbjct  1    MTFRAWFLGIASCVLLIFLNTFFTFRTQPLTISAILMQIAVLPIGRFMAATLPTKEYGFL  60

Query  355  GRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLII  534
            G W FT NPGPFN+KEHVIIT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L I
Sbjct  61   G-WRFTFNPGPFNMKEHVIITIFANCGVSFGGGDAYSIGAITVMKAYYKQSLSFLCALFI  119

Query  535  VLTTQLIGYGWAGVLRRYLV  594
            VLTTQ++GYGWAG+LRRYLV
Sbjct  120  VLTTQMLGYGWAGILRRYLV  139



>ref|XP_010039443.1| PREDICTED: oligopeptide transporter 3-like [Eucalyptus grandis]
Length=697

 Score =   219 bits (557),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 124/140 (89%), Gaps = 1/140 (1%)
 Frame = +1

Query  175  LTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPF  354
            +TFR W LG+TSC++LIFLNTFF++RTQPL+IS+ILMQI++LPIGKFMA TLP +++  F
Sbjct  1    MTFRVWVLGLTSCVVLIFLNTFFMFRTQPLTISSILMQITMLPIGKFMARTLPAKRYQVF  60

Query  355  GRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLII  534
            G +SFTLNPGPFN+KEHV+IT+ ANCGV+ GG DAYSIG IT+MK YYKQ LSFLC LII
Sbjct  61   G-YSFTLNPGPFNVKEHVLITIFANCGVATGGVDAYSIGPITVMKTYYKQNLSFLCALII  119

Query  535  VLTTQLIGYGWAGVLRRYLV  594
            VLTTQL GYGWAG+ R+YLV
Sbjct  120  VLTTQLAGYGWAGMFRKYLV  139



>ref|XP_008374100.1| PREDICTED: oligopeptide transporter 7-like isoform X1 [Malus 
domestica]
Length=307

 Score =   199 bits (506),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 120/161 (75%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              PVE+VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PLSI+AI  QI
Sbjct  46   NSPVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQI  105

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +V+P+G+ MA+ +  R F    RW F LNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  106  AVVPLGQLMASKITNRVFFKGSRWEFNLNPGPFNVKEHVLITIFANS----GAGTVYAIH  161

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +T++K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV
Sbjct  162  IVTVVKVFYKRHITFFVSLLVILTTQVLGFGWAGIFRRYLV  202



>gb|KJB32170.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=754

 Score =   207 bits (527),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 131/178 (74%), Gaps = 3/178 (2%)
 Frame = +1

Query  70   NPATAGEKTAPSGGR-CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  246
            N A  GE  A       P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF 
Sbjct  19   NHAIKGENAAADDDELSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCALLSFLNQFFA  78

Query  247  YRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITV  420
            YRT+PL I+ I +Q++ LPIG+FMAA LP R+F     G   F+LNPGPFN+KEHV+I++
Sbjct  79   YRTEPLIITQITVQVATLPIGQFMAAVLPRRQFKLPGVGSRKFSLNPGPFNMKEHVLISI  138

Query  421  MANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             AN G + G G AY++G +TI+KA+Y++ +SFL G ++++TTQ++GYGWAG+LR+Y+V
Sbjct  139  FANAGSAFGSGSAYAVGIVTIIKAFYQRKISFLAGWLLIITTQVLGYGWAGLLRKYVV  196



>ref|XP_010090590.1| Oligopeptide transporter 7 [Morus notabilis]
 gb|EXB39949.1| Oligopeptide transporter 7 [Morus notabilis]
Length=707

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 127/173 (73%), Gaps = 8/173 (5%)
 Frame = +1

Query  76   ATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  255
            A A EK   S    PVE+VAL VP TDDP+LPVLTFR WFLGI SC++L FLN FF YR 
Sbjct  39   AEAAEKEENS----PVEQVALTVPITDDPSLPVLTFRMWFLGILSCVLLSFLNQFFWYRK  94

Query  256  QPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCG  435
            +PLSI+AI  QI+V+P+G+ MAA +P   F    RW F+LNPGPFN+KEHV+IT+ AN  
Sbjct  95   EPLSITAISAQIAVVPLGQLMAAKIPNHVFFRGTRWEFSLNPGPFNVKEHVLITIFANS-  153

Query  436  VSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
               G G  Y+I  +T++K +YKQ ++F   LI+VLTTQ++G+GWAG+ RRYLV
Sbjct  154  ---GAGTVYAIHVVTVVKIFYKQHMTFFVSLIVVLTTQVLGFGWAGIFRRYLV  203



>emb|CAB10414.1| isp4 like protein [Arabidopsis thaliana]
 emb|CAB78679.1| isp4 like protein [Arabidopsis thaliana]
Length=691

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 129/180 (72%), Gaps = 27/180 (15%)
 Frame = +1

Query  67   LNPATAGEKT----APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  234
            ++   A +KT    +    RCPVEEVALVVPETDDP+LPV+TFRA       C       
Sbjct  1    MDAEKATDKTNVHLSSDHERCPVEEVALVVPETDDPSLPVMTFRA-------CH------  47

Query  235  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  414
                  +QP      LMQI+ LPIGKFMA TLP       G WSF+LNPGPFNIKEHVII
Sbjct  48   ----SPSQP-----SLMQIAGLPIGKFMARTLPTTSHNLLG-WSFSLNPGPFNIKEHVII  97

Query  415  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            T+ ANCGV+ GGGDAYSIGAIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  98   TIFANCGVAYGGGDAYSIGAITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLV  157



>gb|AEJ88342.1| putative oligopeptide transporter [Tamarix hispida]
Length=516

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 122/164 (74%), Gaps = 4/164 (2%)
 Frame = +1

Query  103  SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAIL  282
            S    PV++VAL VP TDDPTLPVLT R W LG  SCI+L FLN FF YR +PL+I+AI 
Sbjct  51   SEENSPVKQVALTVPTTDDPTLPVLTCRMWILGALSCILLSFLNQFFWYREEPLTITAIS  110

Query  283  MQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAY  462
             QI+V+PIG++MA+ LP R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y
Sbjct  111  AQIAVVPIGRYMASRLPTRIFFKGTRWEFTLNPGPFNVKEHVLITIFANA----GAGTVY  166

Query  463  SIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            +I  +T++K +YK+ ++F   LI+VLTTQ++G+GWAG+ RRYLV
Sbjct  167  AIHVVTVVKVFYKKQITFFVSLIVVLTTQVLGFGWAGIFRRYLV  210



>ref|XP_008361590.1| PREDICTED: oligopeptide transporter 2-like, partial [Malus domestica]
Length=564

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 127/176 (72%), Gaps = 5/176 (3%)
 Frame = +1

Query  67   LNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  246
            + PAT  ++   S    PVEEV L V   DDPTLPV TFR W LG+ SC +L FLNTFF 
Sbjct  7    IEPATKHDENDVS----PVEEVRLTVSNDDDPTLPVWTFRMWTLGLASCALLSFLNTFFS  62

Query  247  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  426
            YRT+PL IS I +Q++ LPIG+FMA  LP+RKF   G   F+LNPGPFN+KEHV+I++ A
Sbjct  63   YRTEPLXISXISVQVATLPIGRFMARXLPKRKFQ-IGXKEFSLNPGPFNMKEHVLISIFA  121

Query  427  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            N G   G G AY+I  + I+KA+Y + +SFL   I+V+TTQ++GYGWAG+LRRY+V
Sbjct  122  NAGSGFGSGTAYAISIVDIIKAFYHRKISFLASWILVITTQVLGYGWAGILRRYVV  177



>ref|XP_002283680.1| PREDICTED: oligopeptide transporter 4 [Vitis vinifera]
Length=757

 Score =   204 bits (519),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 133/185 (72%), Gaps = 4/185 (2%)
 Frame = +1

Query  52   VEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  231
            VE+      T  ++        P+EEV L VP  DDP+LPV TFR WFLG+ SC +L FL
Sbjct  4    VEIEAPIIKTRTDEDVKEDELSPIEEVRLTVPNDDDPSLPVWTFRMWFLGLISCALLSFL  63

Query  232  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAP----FGRWSFTLNPGPFNIK  399
            N FF YR +PL IS I +Q++ LPIG+FMA+ LP+ KF      FG+   +LNPGPFN+K
Sbjct  64   NQFFSYRKEPLVISQITVQVATLPIGRFMASVLPDIKFHVHIPFFGKKELSLNPGPFNMK  123

Query  400  EHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVL  579
            EHV+I++ AN G + GGG AY++G +TI+KA+YK+ +S+L G I+++TTQ++GYGWAG+L
Sbjct  124  EHVLISIFANAGSAFGGGSAYAVGIVTIIKAFYKRNISYLAGWILIITTQVLGYGWAGLL  183

Query  580  RRYLV  594
            R+Y+V
Sbjct  184  RKYVV  188



>ref|XP_010553673.1| PREDICTED: oligopeptide transporter 2 [Tarenaya hassleriana]
Length=734

 Score =   204 bits (519),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 125/169 (74%), Gaps = 1/169 (1%)
 Frame = +1

Query  88   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  267
            ++        PVEEV L VP  DDP+LPV TFR WFLG+ SC++L FLNTFF YRTQPL 
Sbjct  12   DEEEGDNDESPVEEVRLTVPNHDDPSLPVWTFRMWFLGLFSCVLLSFLNTFFGYRTQPLM  71

Query  268  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  447
            IS I +Q+  LPIGK MA  LP++KF   G + F+LNPGPFN+KEHV+I++ AN G   G
Sbjct  72   ISMISIQVVTLPIGKMMARVLPDKKFR-VGSFEFSLNPGPFNVKEHVLISMFANAGAGYG  130

Query  448  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             G AY++G + I+KA+YK+ +SFL   ++V+TTQ++GYGWAG++RR LV
Sbjct  131  SGTAYAVGIVDIIKAFYKRNISFLASWLLVITTQVLGYGWAGIMRRLLV  179



>ref|XP_011070370.1| PREDICTED: oligopeptide transporter 7 [Sesamum indicum]
Length=753

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 123/163 (75%), Gaps = 4/163 (2%)
 Frame = +1

Query  106  GGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILM  285
            G   P+++VAL VP TDDPTLPVLTFR WFLG  SC++L FLN FF YRT+PLSI+AI  
Sbjct  39   GENSPIKQVALTVPTTDDPTLPVLTFRMWFLGTLSCVLLSFLNQFFWYRTEPLSITAISA  98

Query  286  QISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYS  465
            QI+V+P+G+ MAA + +R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+
Sbjct  99   QIAVVPLGQLMAAKITDRVFFRGTRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYA  154

Query  466  IGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            I  +T +K +YKQ +SF   LI+V+TTQ++G+GWAG+ RRYLV
Sbjct  155  IHVVTAVKVFYKQHISFFVSLIVVITTQVLGFGWAGIYRRYLV  197



>ref|XP_011078507.1| PREDICTED: oligopeptide transporter 4-like [Sesamum indicum]
Length=754

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 130/177 (73%), Gaps = 7/177 (4%)
 Frame = +1

Query  70   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  249
             PA   E+        PVE+V L VP  DDPTLPV TFR WFLG+ SC++L FLNTFF Y
Sbjct  28   EPAVDDEEEV-----SPVEQVRLTVPNEDDPTLPVWTFRMWFLGLFSCMLLSFLNTFFSY  82

Query  250  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  423
            R++PL I+ I +Q++ LPIG+FMA  LP  KF    FG   F+LNPGPFN+KEHV+I++ 
Sbjct  83   RSEPLIITMISVQVATLPIGRFMANVLPTTKFRLPGFGSREFSLNPGPFNMKEHVLISIF  142

Query  424  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AN G + GGG AY++G + I+KA+YK+ +SFL   I+V+TTQ++GYGWAG+LR+Y+V
Sbjct  143  ANAGSAFGGGSAYAVGIVDIIKAFYKRNISFLASWILVITTQVLGYGWAGILRKYVV  199



>gb|KJB32172.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=493

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 126/177 (71%), Gaps = 2/177 (1%)
 Frame = +1

Query  70   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  249
            +  + G          P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  19   DATSGGNHDVEDDEISPIEQVRLTVTNTDDPTLPVWTFRMWFLGLFSCALLSFLNQFFSY  78

Query  250  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  423
            RT+PL I+ I +Q+S LPIG FMA+ LP+ +F    FG   F+LNPGPFN+KEHV+I + 
Sbjct  79   RTEPLIITQITVQVSTLPIGHFMASVLPKTQFGIPGFGSKRFSLNPGPFNMKEHVLICIF  138

Query  424  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AN G + G G AY+IG + I+KA+Y + +SFL G ++++TTQ++GYGWAG+LR+Y+V
Sbjct  139  ANAGSAFGNGSAYAIGIVNIIKAFYGRNISFLAGWLLIITTQVLGYGWAGLLRKYVV  195



>emb|CBI19304.3| unnamed protein product [Vitis vinifera]
Length=749

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 127/163 (78%), Gaps = 4/163 (2%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+EEV L VP  DDP+LPV TFR WFLG+ SC +L FLN FF YR +PL IS I +Q++ 
Sbjct  28   PIEEVRLTVPNDDDPSLPVWTFRMWFLGLISCALLSFLNQFFSYRKEPLVISQITVQVAT  87

Query  298  LPIGKFMAATLPERKFAP----FGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYS  465
            LPIG+FMA+ LP+ KF      FG+   +LNPGPFN+KEHV+I++ AN G + GGG AY+
Sbjct  88   LPIGRFMASVLPDIKFHVHIPFFGKKELSLNPGPFNMKEHVLISIFANAGSAFGGGSAYA  147

Query  466  IGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            +G +TI+KA+YK+ +S+L G I+++TTQ++GYGWAG+LR+Y+V
Sbjct  148  VGIVTIIKAFYKRNISYLAGWILIITTQVLGYGWAGLLRKYVV  190



>gb|EYU33488.1| hypothetical protein MIMGU_mgv1a0023121mg, partial [Erythranthe 
guttata]
Length=548

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 122/164 (74%), Gaps = 4/164 (2%)
 Frame = +1

Query  103  SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAIL  282
            +G   P+E+VAL V   DDP+LPVLTFR WFLG  SC++L FLN FF YRT+PLSI+AI 
Sbjct  35   NGENSPIEQVALTVSTADDPSLPVLTFRMWFLGTLSCVLLSFLNQFFWYRTEPLSITAIS  94

Query  283  MQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAY  462
             QI+V+P+G+ MAA + +R F    R+ FTLNPGPFN+KEHV+IT+ AN     G G  Y
Sbjct  95   AQIAVVPLGQLMAARITDRSFFRGSRFEFTLNPGPFNVKEHVLITIFANS----GAGTVY  150

Query  463  SIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            +I  +T +K +YKQ +SF   LI+V+TTQ++G+GWAG+ RRYLV
Sbjct  151  AIHVVTAVKIFYKQHISFFVSLIVVITTQVLGFGWAGIYRRYLV  194



>gb|KDP41518.1| hypothetical protein JCGZ_15925 [Jatropha curcas]
Length=730

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 125/166 (75%), Gaps = 2/166 (1%)
 Frame = +1

Query  103  SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAIL  282
            S    P+EEV L V   DDPTLPV TFR WFLGI SC++L FLNTFF YRT+PL+IS I 
Sbjct  10   SDDVSPIEEVRLTVSNHDDPTLPVWTFRMWFLGIVSCVLLSFLNTFFAYRTEPLTISMIS  69

Query  283  MQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGD  456
            +Q++ LPIG+FMA TLP  KFA   FG   F+LNPGPFN+KEHV+I++ AN G + G G 
Sbjct  70   VQVATLPIGRFMAKTLPTTKFAIPGFGNKKFSLNPGPFNVKEHVLISIFANVGSNAGSGA  129

Query  457  AYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AY+I  I I+ A+Y + +SFL   I+V+TTQ++GYGWAG++R+++V
Sbjct  130  AYAISIIDIIVAFYHRKISFLASWILVITTQVLGYGWAGIMRKFVV  175



>ref|XP_004136415.1| PREDICTED: oligopeptide transporter 2-like [Cucumis sativus]
 ref|XP_004164895.1| PREDICTED: oligopeptide transporter 2-like [Cucumis sativus]
 gb|KGN60282.1| hypothetical protein Csa_3G893320 [Cucumis sativus]
Length=742

 Score =   202 bits (515),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 129/177 (73%), Gaps = 2/177 (1%)
 Frame = +1

Query  70   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  249
            +  T  +K  P     P+E+V L V   DDP++PV TFR WFLG+ SCIIL FLNTFF Y
Sbjct  11   DSTTTTQKPIPDDEISPIEQVRLTVSNEDDPSIPVWTFRMWFLGLLSCIILSFLNTFFGY  70

Query  250  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  423
            RT+PL IS I +Q++ LPIG+FMA  LP + F    FG  +F+LNPGPFNIKEHV+I++ 
Sbjct  71   RTEPLVISMISVQVATLPIGRFMANVLPTKTFRIPGFGDRNFSLNPGPFNIKEHVLISIF  130

Query  424  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AN G + G G AY+IG + I+ A+Y + +SFL G I+V+TTQ++GYGWAG+LR+Y+V
Sbjct  131  ANAGSAFGNGAAYAIGIVDIVMAFYHRKISFLTGWILVITTQVMGYGWAGILRKYVV  187



>ref|XP_011087976.1| PREDICTED: oligopeptide transporter 4 [Sesamum indicum]
Length=744

 Score =   202 bits (515),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 126/161 (78%), Gaps = 1/161 (1%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q+
Sbjct  30   ESPIEEVRLTVTNTDDPTLPVWTFRMWFLGLLSCALLSFLNQFFAYRTEPLLITQITVQV  89

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            + LPIG F+AA LPE KF  FG   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  90   ATLPIGHFLAAVLPETKFR-FGGRVFSLNPGPFNMKEHVLISIFANAGSAFGNGSAYAVG  148

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +TI+KA+Y++ +SFL G ++++TTQ++GYGWAG+LR+Y++
Sbjct  149  IVTIVKAFYRRNISFLAGWLLIITTQVLGYGWAGLLRKYVI  189



>gb|EMT01286.1| Oligopeptide transporter 4 [Aegilops tauschii]
Length=730

 Score =   202 bits (514),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 131/171 (77%), Gaps = 5/171 (3%)
 Frame = +1

Query  82   AGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQP  261
            AG++   S    PVE+V L VP TDDP+LPV TFR W +G  SC +L FLN FF YR +P
Sbjct  9    AGDEDDAS----PVEQVRLTVPVTDDPSLPVWTFRMWTMGFLSCALLSFLNQFFAYRAEP  64

Query  262  LSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVS  441
            + IS I +Q++ LPIG F+A  LPE+KF  FGR   ++NPGPFN+KEHV+I++ AN G S
Sbjct  65   IIISQITIQVAALPIGHFLARVLPEKKFRVFGR-ECSVNPGPFNVKEHVLISIFANAGAS  123

Query  442  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             GGG+AY+IG +TI+KA+YK+ +SF+  L++V+TTQ++GYGWAG++R+Y+V
Sbjct  124  FGGGNAYAIGIVTIIKAFYKRNISFVTSLLLVITTQVLGYGWAGLMRKYVV  174



>ref|XP_002963418.1| hypothetical protein SELMODRAFT_166204 [Selaginella moellendorffii]
 gb|EFJ35289.1| hypothetical protein SELMODRAFT_166204 [Selaginella moellendorffii]
Length=743

 Score =   202 bits (513),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 126/176 (72%), Gaps = 1/176 (1%)
 Frame = +1

Query  70   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  249
             P  A +  A    + PVEEVAL V   DDPTLPV TFR WFLG+ SCI+L FLN FF Y
Sbjct  11   EPLVAPQVEAEGDDQSPVEEVALTVDTRDDPTLPVGTFRMWFLGLLSCILLSFLNQFFSY  70

Query  250  RTQPLSISAILMQISVLPIGKFMAATLPERKF-APFGRWSFTLNPGPFNIKEHVIITVMA  426
            RT+P  I  I +QI  LP G+FMA  LPER F  PF   SF+LNPGPFN+KEHV+IT+ A
Sbjct  71   RTEPFIIGLISVQIVALPFGRFMANVLPERSFRVPFTSSSFSLNPGPFNVKEHVLITIFA  130

Query  427  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            N G   G G AY++G + I +A+YK+++ F  GL++V+TTQ++GYGWAG+++++LV
Sbjct  131  NAGSGFGNGGAYAMGIVNITRAFYKRSMGFTAGLLLVMTTQVLGYGWAGLMKKHLV  186



>ref|XP_009775420.1| PREDICTED: oligopeptide transporter 2-like [Nicotiana sylvestris]
Length=733

 Score =   202 bits (513),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 122/159 (77%), Gaps = 5/159 (3%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+EEV L V   DDP+LPV TFR WFLGI SC IL FLNTFF YRTQPLSIS I +QI+ 
Sbjct  26   PIEEVRLTVSNEDDPSLPVWTFRMWFLGILSCGILAFLNTFFSYRTQPLSISMITVQIAA  85

Query  298  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  477
            LP+GK MA  LP RKF   G W F+ NPGPFN+KEHV+I++ ANC    G G AY++  +
Sbjct  86   LPLGKIMARVLPTRKFK-IGSWEFSFNPGPFNMKEHVLISIFANC----GSGTAYAVSIV  140

Query  478  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            TI+KA+Y + +SF+ G I+V+TTQ++GYGWAG++R+Y+V
Sbjct  141  TIIKAFYLRNISFVAGWILVVTTQVLGYGWAGIMRKYVV  179



>emb|CDY06509.1| BnaC06g11350D [Brassica napus]
Length=227

 Score =   191 bits (484),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 118/159 (74%), Gaps = 4/159 (3%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+ EVAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YR +PLSISAI  QI+V
Sbjct  55   PIREVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRREPLSISAISAQIAV  114

Query  298  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  477
            +P+G+ MAA + +R F    +  FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  115  VPLGRLMAAKISDRVFLQGSKCEFTLNPGPFNVKEHVLITIFANA----GAGSVYAIHVV  170

Query  478  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            T++KA+Y + ++F    ++++TTQ++G+GWAG+ R+YLV
Sbjct  171  TVVKAFYMKNITFFVSFVVIVTTQVLGFGWAGIFRKYLV  209



>ref|XP_002313213.2| hypothetical protein POPTR_0009s08290g [Populus trichocarpa]
 gb|EEE87168.2| hypothetical protein POPTR_0009s08290g [Populus trichocarpa]
Length=752

 Score =   202 bits (513),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 126/161 (78%), Gaps = 2/161 (1%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL IS I +QI+ 
Sbjct  33   PIEEVRLTVANTDDPTLPVWTFRMWFLGLISCSLLAFLNQFFSYRTEPLIISQITVQIAS  92

Query  298  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            LPIG+ MAA LP+ KF    FG  +F+LNPGPFNIKEHV+I++ AN G + G G AY++G
Sbjct  93   LPIGRSMAAVLPKTKFKIPGFGSRTFSLNPGPFNIKEHVLISIFANAGSAFGSGSAYAVG  152

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +TI+KA+Y +++SFL G +++ TTQ++GYGWAG+LR+Y+V
Sbjct  153  IVTIIKAFYGRSISFLAGWLLITTTQVLGYGWAGLLRKYVV  193



>ref|XP_008338986.1| PREDICTED: oligopeptide transporter 2-like [Malus domestica]
Length=733

 Score =   201 bits (512),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 127/176 (72%), Gaps = 5/176 (3%)
 Frame = +1

Query  67   LNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  246
            + PAT  ++   S    PVEEV L V   DDPTLPV TFR W LG+ SC +L FLNTFF 
Sbjct  7    IEPATKHDENDVS----PVEEVRLTVSNDDDPTLPVWTFRMWTLGLASCALLSFLNTFFS  62

Query  247  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  426
            YRT+PL IS I +Q++ LPIG+FMA  LP+RKF   G   F+LNPGPFN+KEHV+I++ A
Sbjct  63   YRTEPLXISXISVQVATLPIGRFMARXLPKRKFQ-IGXKEFSLNPGPFNMKEHVLISIFA  121

Query  427  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            N G   G G AY+I  + I+KA+Y + +SFL   I+V+TTQ++GYGWAG+LRRY+V
Sbjct  122  NAGSGFGSGTAYAISIVDIIKAFYHRKISFLASWILVITTQVLGYGWAGILRRYVV  177



>ref|XP_006851884.1| hypothetical protein AMTR_s00041p00121000 [Amborella trichopoda]
 gb|ERN13351.1| hypothetical protein AMTR_s00041p00121000 [Amborella trichopoda]
Length=734

 Score =   201 bits (512),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 126/175 (72%), Gaps = 4/175 (2%)
 Frame = +1

Query  70   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  249
            + +T  E+   S    P+E+VAL VP TDDP+LPVLTFR WFLG  SC++L FLN FF Y
Sbjct  6    SSSTTIEEPNTSPENSPIEQVALTVPVTDDPSLPVLTFRMWFLGGLSCVVLSFLNQFFWY  65

Query  250  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  429
            RT+PLSI+++  QI+V+P+G  MAA LP R F    RW FTLNPGPFN+KEHV+IT+ AN
Sbjct  66   RTEPLSITSVSAQIAVVPLGHLMAAVLPTRPFFKGKRWEFTLNPGPFNVKEHVLITIFAN  125

Query  430  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
                 G G  Y+I  ++ +K +YK+ LSF    ++V+TTQ++G+GWAG+ R+YLV
Sbjct  126  S----GAGSVYAIHIVSAVKIFYKETLSFFVAFLVVITTQVLGFGWAGIFRKYLV  176



>ref|XP_002981747.1| hypothetical protein SELMODRAFT_179057 [Selaginella moellendorffii]
 gb|EFJ17229.1| hypothetical protein SELMODRAFT_179057 [Selaginella moellendorffii]
Length=771

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 122/161 (76%), Gaps = 5/161 (3%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
            + P+EEVAL V  +DDP+LPV TFR W LG+ SC++L F N FF YRT+PL I+AI  QI
Sbjct  55   QSPIEEVALTVDTSDDPSLPVYTFRMWTLGVVSCVLLAFFNQFFAYRTEPLIITAISAQI  114

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
              LP+GK MAATLP RKF+ FGR  F+LNPG FN KEHV+IT+ AN     G G AY++G
Sbjct  115  VTLPLGKLMAATLPTRKFSIFGR-EFSLNPGAFNKKEHVLITIFANT----GAGSAYAVG  169

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +TI+KA+YK+ + F  GL+I +TTQ+IGYGWAG+ R+YLV
Sbjct  170  IVTIVKAFYKRRMDFGVGLLITITTQIIGYGWAGIFRKYLV  210



>ref|XP_009366376.1| PREDICTED: oligopeptide transporter 2-like [Pyrus x bretschneideri]
Length=734

 Score =   201 bits (511),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 127/176 (72%), Gaps = 5/176 (3%)
 Frame = +1

Query  67   LNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  246
            + PAT  ++   S    PVEEV L V   DDPTLPV TFR W LG+ SC +L FLNTFF 
Sbjct  8    IEPATKHDENDVS----PVEEVRLTVSNDDDPTLPVWTFRMWTLGLASCALLSFLNTFFS  63

Query  247  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  426
            YRT+PL IS I +Q++ LPIG+FMA  LP+RKF   G   F+LNPGPFN+KEHV+I++ A
Sbjct  64   YRTEPLIISMISVQVATLPIGRFMARALPKRKFQ-IGSKEFSLNPGPFNMKEHVLISIFA  122

Query  427  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            N G   G G AY+I  + I+KA+Y + +SFL   I+V+TTQ++GYGWAG+LRRY+V
Sbjct  123  NAGSGFGSGTAYAISIVDIIKAFYHRKISFLASWILVITTQVLGYGWAGILRRYVV  178



>ref|XP_011016978.1| PREDICTED: oligopeptide transporter 2 [Populus euphratica]
Length=738

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 130/187 (70%), Gaps = 7/187 (4%)
 Frame = +1

Query  40   EHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCII  219
            + + +E    NP    E      G  P+EEV L VP  DD TLPV TFR WFLGI SCII
Sbjct  2    DSLEIEGKPQNP-NMNENIEEDDGVSPIEEVRLTVPTRDDHTLPVWTFRMWFLGIASCII  60

Query  220  LIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFN  393
            L FLNTFF YRT+PL+IS I +Q+  LP+G+FMA TLP  KF    FG   F+LNPGPFN
Sbjct  61   LSFLNTFFSYRTEPLTISMISVQVVTLPVGRFMAKTLPTTKFRVPGFGGREFSLNPGPFN  120

Query  394  IKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAG  573
            +KEHV+I++ AN G S     AY++G I I+ A+YK+ +SFL   I+VLTTQ++GYGWAG
Sbjct  121  VKEHVLISIFANVGSS----TAYAVGIIDIIMAFYKRKISFLASWILVLTTQMLGYGWAG  176

Query  574  VLRRYLV  594
            ++R+Y+V
Sbjct  177  IMRKYVV  183



>ref|XP_009619170.1| PREDICTED: oligopeptide transporter 2-like [Nicotiana tomentosiformis]
Length=733

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 122/159 (77%), Gaps = 5/159 (3%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+E+V L V   DDP+LPV TFR WFLGI SC IL FLNTFF YRTQPLSIS I +QI+ 
Sbjct  26   PIEQVRLTVSNQDDPSLPVWTFRMWFLGILSCGILAFLNTFFSYRTQPLSISMITVQIAA  85

Query  298  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  477
            LP+GK MA  LP RKF   G W F+ NPGPFN+KEHV+I++ ANC    G G AY++  +
Sbjct  86   LPLGKIMARVLPTRKFK-IGSWEFSFNPGPFNMKEHVLISIFANC----GSGTAYAVSIV  140

Query  478  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            TI+KA+Y + +SF+ G I+V+TTQ++GYGWAG++R+Y+V
Sbjct  141  TIIKAFYLRNISFVAGWILVVTTQVLGYGWAGIMRKYVV  179



>ref|XP_002967597.1| hypothetical protein SELMODRAFT_88962 [Selaginella moellendorffii]
 gb|EFJ30944.1| hypothetical protein SELMODRAFT_88962 [Selaginella moellendorffii]
Length=771

 Score =   201 bits (511),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 122/161 (76%), Gaps = 5/161 (3%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
            + P+EEVAL V  +DDP+LPV TFR W LG+ SC++L F N FF YRT+PL I+AI  QI
Sbjct  55   QSPIEEVALTVDTSDDPSLPVYTFRMWTLGVVSCVLLAFFNQFFAYRTEPLIITAISAQI  114

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
              LP+GK MAATLP RKF+ FGR  F+LNPG FN KEHV+IT+ AN     G G AY++G
Sbjct  115  VTLPLGKLMAATLPTRKFSIFGR-EFSLNPGAFNKKEHVLITIFANT----GAGSAYAVG  169

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +TI+KA+YK+ + F  GL+I +TTQ+IGYGWAG+ R+YLV
Sbjct  170  IVTIVKAFYKRRMEFGVGLLITITTQIIGYGWAGIFRKYLV  210



>ref|XP_008466130.1| PREDICTED: oligopeptide transporter 2 [Cucumis melo]
Length=741

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 131/183 (72%), Gaps = 2/183 (1%)
 Frame = +1

Query  52   VEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  231
            +E+     +T  +K  P     P+E+V L V   DDP++PV TFR WFLG+ SC+IL FL
Sbjct  4    LEIELEQDSTTTQKPIPDDEISPIEQVRLTVSNEDDPSIPVWTFRMWFLGLLSCMILSFL  63

Query  232  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEH  405
            NTFF YRT+PL IS I +Q++ LPIG+FMA  LP   F    FG  +F+LNPGPFNIKEH
Sbjct  64   NTFFGYRTEPLVISMISVQVATLPIGRFMANVLPTTTFRIPGFGDRNFSLNPGPFNIKEH  123

Query  406  VIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRR  585
            V+I++ AN G + G G AY+IG + I+ A+Y + +SFL G I+V+TTQ++GYGWAG+LR+
Sbjct  124  VLISIFANAGSAFGNGAAYAIGIVDIVMAFYHRKISFLAGWILVITTQVMGYGWAGILRK  183

Query  586  YLV  594
            Y+V
Sbjct  184  YVV  186



>gb|EMS68344.1| Oligopeptide transporter 4 [Triticum urartu]
Length=727

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 128/169 (76%), Gaps = 1/169 (1%)
 Frame = +1

Query  88   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  267
            E+        PVE+V L VP TDD +LPV TFR W +G  SC +L FLN FF YR +P+ 
Sbjct  4    ERAGDEDDASPVEQVRLTVPVTDDHSLPVWTFRMWTMGFLSCALLSFLNQFFAYRAEPII  63

Query  268  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  447
            IS I +Q++ LPIG+F++  LPE+KF  FGR   ++NPGPFN+KEHV+I++ AN G S G
Sbjct  64   ISQITIQVAALPIGRFLSRVLPEKKFRVFGR-ECSVNPGPFNVKEHVLISIFANAGASFG  122

Query  448  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            GG+AY+IG +TI+KA+YK+ +SF+  L++V+TTQ++GYGWAG++R+Y+V
Sbjct  123  GGNAYAIGIVTIIKAFYKRNISFVTSLLLVITTQVLGYGWAGLMRKYVV  171



>ref|XP_009790410.1| PREDICTED: oligopeptide transporter 4 [Nicotiana sylvestris]
Length=738

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 129/176 (73%), Gaps = 6/176 (3%)
 Frame = +1

Query  73   PATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  252
            PA A +    S    P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YR
Sbjct  12   PAGAADDDDES----PIEEVRLTVTNTDDPTLPVWTFRMWFLGLFSCCLLSFLNQFFSYR  67

Query  253  TQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMA  426
            T+PL I+ I +Q++ LPIG F+A  LP  KF    FG  SF+LNPGPFN+KEHV+I++ A
Sbjct  68   TEPLVITQITVQVATLPIGHFLATVLPTTKFRLPGFGSRSFSLNPGPFNMKEHVLISIFA  127

Query  427  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            N G + G G AY++G +TI+KA+Y + +SFL G ++++TTQ++GYGWAG+LR+Y+V
Sbjct  128  NAGSAFGNGSAYAVGIVTIIKAFYHRNISFLAGWLLIITTQVLGYGWAGLLRKYVV  183



>gb|EPS66512.1| hypothetical protein M569_08265, partial [Genlisea aurea]
Length=162

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 118/162 (73%), Gaps = 3/162 (2%)
 Frame = +1

Query  76   ATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  255
            A+    +    G  P+E+V L V  TDDPTLPV TFR WFLGI SC +L FLN FF YRT
Sbjct  1    ASGSYFSDEDDGESPIEQVRLTVRNTDDPTLPVWTFRMWFLGIVSCGLLSFLNQFFSYRT  60

Query  256  QPLSISAILMQISVLPIGKFMAATLPERKFAPFG---RWSFTLNPGPFNIKEHVIITVMA  426
            QPL I+ I +QI+VLPIG+FMAA LPER+F   G    WSFTLNPGPFNIKEHV+I++ A
Sbjct  61   QPLVITQITVQIAVLPIGRFMAAALPERRFGLPGLGPAWSFTLNPGPFNIKEHVLISIFA  120

Query  427  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQL  552
            N G + G G AY++G + I+KA Y +++SFL G ++++TTQ+
Sbjct  121  NAGSAFGNGPAYAVGIVDIVKALYGRSISFLAGWLLIITTQV  162



>ref|XP_010676880.1| PREDICTED: oligopeptide transporter 7-like [Beta vulgaris subsp. 
vulgaris]
Length=763

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 120/161 (75%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              PV++VA+ VP  DDP LPVLTFR W LG  SC++L FLN FF YRT+PLSI+AI  QI
Sbjct  49   NSPVKQVAMTVPTIDDPELPVLTFRMWALGTLSCVVLSFLNQFFWYRTEPLSITAISAQI  108

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +V+P+G+ MAA LP R F    RW FTLNPGPFNIKEHV+IT+ AN     G G  Y+I 
Sbjct  109  AVVPLGQLMAAKLPSRPFLRGTRWEFTLNPGPFNIKEHVLITIFANA----GAGSVYAIH  164

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +T++K +YK+ ++F   LI+VLTTQ++G+GWAG+ RRYLV
Sbjct  165  VVTVVKIFYKKQITFFVSLIVVLTTQVLGFGWAGIFRRYLV  205



>gb|KDO67986.1| hypothetical protein CISIN_1g029091mg [Citrus sinensis]
Length=199

 Score =   188 bits (478),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 127/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query  58   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  237
            M+  N  +A           PVEEV L V  +DDP+LPV TFR WFLG+ SC +L FLN 
Sbjct  1    MAPTNVTSATAADIDGDELSPVEEVRLTVLNSDDPSLPVWTFRMWFLGLLSCALLSFLNQ  60

Query  238  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWS--FTLNPGPFNIKEHVI  411
            FF YRT+PL I+ I +Q++ LPIG+F+AATLPE +F   G  S  F+LN GPFN+KEHV+
Sbjct  61   FFAYRTEPLIITQITVQVATLPIGRFLAATLPETRFRIPGCGSRLFSLNSGPFNVKEHVL  120

Query  412  ITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYL  591
            I++ AN G + G G  +++  + I+KA+Y + +SFL   ++++TTQ++GYGWAG+LR+Y+
Sbjct  121  ISIFANAGSAFGAGSTFAVSIVNIIKAFYHRKISFLASWLLIITTQVLGYGWAGLLRKYV  180

Query  592  V  594
            V
Sbjct  181  V  181



>ref|XP_002301110.1| oligopeptide transporter OPT family protein [Populus trichocarpa]
 gb|EEE80383.1| oligopeptide transporter OPT family protein [Populus trichocarpa]
Length=724

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 124/172 (72%), Gaps = 6/172 (3%)
 Frame = +1

Query  85   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  264
             E      G  P+EEV L VP  DD TLPV TFR WFLGI SCIIL FLNTFF YRT+PL
Sbjct  2    NENIEEDDGVSPIEEVRLTVPTRDDHTLPVWTFRMWFLGIASCIILSFLNTFFSYRTEPL  61

Query  265  SISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGV  438
            +IS I +Q+  LPIG+FMA TLP  KF    FG   F+LNPGPFN+KEHV+I++ AN G 
Sbjct  62   TISMISVQVVTLPIGRFMAKTLPTAKFRVPGFGGREFSLNPGPFNVKEHVLISIFANVGS  121

Query  439  SPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            S     AY++G I I+ A+YK+ +SFL   I+VLTTQ++GYGWAG++R+Y+V
Sbjct  122  S----TAYAVGIIDIIMAFYKRKISFLASWILVLTTQMLGYGWAGIMRKYVV  169



>emb|CAN79818.1| hypothetical protein VITISV_040328 [Vitis vinifera]
Length=701

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 134/194 (69%), Gaps = 15/194 (8%)
 Frame = +1

Query  16   TVPAQ*LSEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWF  195
            T P     +H+ +E      AT  E+       CP+E+V L VP TDDPT PVLTFR W 
Sbjct  9    TQPKPQEQQHLDIE------ATGDEEV----NDCPIEQVRLTVPITDDPTEPVLTFRTWV  58

Query  196  LGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA-PFGRWSFT  372
            LG+ SC+IL F+N FF YR+  LSIS++  QI  LP+GKFMAATLPE+    P  +WSF+
Sbjct  59   LGVASCVILSFVNQFFGYRSNQLSISSVSAQIVTLPLGKFMAATLPEKPIKVPCTKWSFS  118

Query  373  LNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQL  552
            LNPGPFNIKEHV+IT+ AN     G G  Y++G +TI+KA+YK++LS   G ++V TTQL
Sbjct  119  LNPGPFNIKEHVLITMFANS----GSGGVYAVGILTIVKAFYKRSLSPGAGYLLVQTTQL  174

Query  553  IGYGWAGVLRRYLV  594
            +GYGWAG+ R+YLV
Sbjct  175  LGYGWAGLFRKYLV  188



>gb|KJB24153.1| hypothetical protein B456_004G130200 [Gossypium raimondii]
Length=759

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 121/161 (75%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              PV +VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PL+I+AI  QI
Sbjct  46   NSPVRQVALTVPTTDDPSLPVLTFRMWVLGTISCVLLSFLNQFFWYRTEPLTITAISAQI  105

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +V+P+G+ MAA + +R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  106  AVVPLGQLMAAKITKRVFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGSVYAIH  161

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +T++K +YKQ ++F   LI++LTTQ++G+GWAG+ RRYLV
Sbjct  162  VVTVVKVFYKQHITFFVSLIVILTTQVLGFGWAGIFRRYLV  202



>ref|XP_010254620.1| PREDICTED: oligopeptide transporter 4-like [Nelumbo nucifera]
Length=738

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 125/161 (78%), Gaps = 2/161 (1%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  23   PIEQVRLTVTNTDDPTLPVWTFRMWFLGLISCALLSFLNQFFAYRTEPLIITQITVQVAT  82

Query  298  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            LPIG+FMA+ LP  KF    FG   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  83   LPIGRFMASVLPRTKFRLPGFGSTEFSLNPGPFNMKEHVLISIFANAGSAFGSGYAYAVG  142

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             + I+KA+Y++ +SFL G I+V+TTQ++GYGWAG+LR+Y+V
Sbjct  143  IVNIIKAFYRKNISFLAGWILVITTQVLGYGWAGLLRKYVV  183



>ref|XP_002263530.1| PREDICTED: oligopeptide transporter 4 [Vitis vinifera]
Length=744

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 132/175 (75%), Gaps = 6/175 (3%)
 Frame = +1

Query  76   ATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  255
            AT G++   S    P+EEV L V  TDDP+LPV TFR WF+G+ SC +L FL+ FF YRT
Sbjct  19   ATDGDEDELS----PIEEVRLTVTNTDDPSLPVWTFRMWFMGLFSCALLSFLDQFFAYRT  74

Query  256  QPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMAN  429
            +PL I+ I +Q++ LPIG FMAA LP  +F    FG  SF+LNPGPFN+KEHV+I++ AN
Sbjct  75   EPLIITQITVQVATLPIGHFMAAVLPTTRFRIPGFGSRSFSLNPGPFNMKEHVLISIFAN  134

Query  430  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             G + G G AY++G +TI+KA+Y++ +SFL G ++++TTQ++GYGWAG+LR+Y+V
Sbjct  135  AGSAFGSGSAYAVGIVTIIKAFYQRKISFLSGWLLIITTQVLGYGWAGLLRKYVV  189



>ref|XP_002971556.1| hypothetical protein SELMODRAFT_172313 [Selaginella moellendorffii]
 gb|EFJ27305.1| hypothetical protein SELMODRAFT_172313 [Selaginella moellendorffii]
Length=743

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 124/176 (70%), Gaps = 1/176 (1%)
 Frame = +1

Query  70   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  249
             P    E       + PVEEVAL V   DDPTLPV TFR WFLG+ SCI+L FLN FF Y
Sbjct  11   EPLVTREVEPEGDDQSPVEEVALTVDTRDDPTLPVGTFRMWFLGLLSCILLSFLNQFFSY  70

Query  250  RTQPLSISAILMQISVLPIGKFMAATLPERKF-APFGRWSFTLNPGPFNIKEHVIITVMA  426
            RT+P  I  I +QI  LP G+FMA  LPER F  PF   SF+LNPGPFN+KEHV+IT+ A
Sbjct  71   RTEPFIIGLISVQIVALPFGRFMANVLPERSFRVPFTSSSFSLNPGPFNVKEHVLITIFA  130

Query  427  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            N G   G G AY++G + I +A+YK+++ F  GL++V+TTQ++GYGWAG+++++LV
Sbjct  131  NAGSGFGNGGAYAMGIVNITRAFYKRSMGFTAGLLLVMTTQVLGYGWAGLMKKHLV  186



>ref|XP_004163578.1| PREDICTED: oligopeptide transporter 7-like [Cucumis sativus]
Length=835

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 124/168 (74%), Gaps = 4/168 (2%)
 Frame = +1

Query  91   KTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSI  270
            + + S    P+ +VAL VP TDDP+LPVLTFR WFLG  SC++L FLN FF YR +PLSI
Sbjct  117  EISESDENSPIPQVALTVPTTDDPSLPVLTFRMWFLGTLSCVLLSFLNQFFWYRKEPLSI  176

Query  271  SAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGG  450
            +AI  QI+V+P+G+ MA+ + +R F    RW F+LNPGPFN+KEHV+IT+ AN     G 
Sbjct  177  TAISAQIAVVPLGRLMASKITDRVFFKGKRWEFSLNPGPFNVKEHVLITIFANS----GA  232

Query  451  GDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            G  Y+I  +T++K +YKQ L+F   LI+V+TTQ++G+GWAG+ R+YLV
Sbjct  233  GSVYAIHVVTVVKTFYKQHLTFFVSLIVVVTTQVLGFGWAGIFRKYLV  280



>ref|XP_011003045.1| PREDICTED: oligopeptide transporter 4 [Populus euphratica]
Length=749

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 125/161 (78%), Gaps = 2/161 (1%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+EEV L V  TDDPTLP+ TFR WFLG+ SC +L FLN FF YRT+PL IS I +Q++ 
Sbjct  33   PIEEVRLTVANTDDPTLPIWTFRMWFLGLISCSLLAFLNQFFSYRTEPLIISQITVQVAS  92

Query  298  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            LPIG+ MAA LP+ KF    FG  +F+LNPGPFNIKEHV+I++ AN G + G G AY++G
Sbjct  93   LPIGRSMAAVLPKTKFKIPGFGSRTFSLNPGPFNIKEHVLISIFANAGSAFGSGSAYAVG  152

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +TI+KA+Y + +SFL G +++ TTQ++GYGWAG+LR+Y+V
Sbjct  153  IVTIIKAFYGRRISFLAGWLLITTTQVLGYGWAGLLRKYVV  193



>ref|XP_004143945.1| PREDICTED: oligopeptide transporter 7-like [Cucumis sativus]
 gb|KGN49990.1| hypothetical protein Csa_5G148610 [Cucumis sativus]
Length=757

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 124/168 (74%), Gaps = 4/168 (2%)
 Frame = +1

Query  91   KTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSI  270
            + + S    P+ +VAL VP TDDP+LPVLTFR WFLG  SC++L FLN FF YR +PLSI
Sbjct  39   EISESDENSPIPQVALTVPTTDDPSLPVLTFRMWFLGTLSCVLLSFLNQFFWYRKEPLSI  98

Query  271  SAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGG  450
            +AI  QI+V+P+G+ MA+ + +R F    RW F+LNPGPFN+KEHV+IT+ AN     G 
Sbjct  99   TAISAQIAVVPLGRLMASKITDRVFFKGKRWEFSLNPGPFNVKEHVLITIFANS----GA  154

Query  451  GDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            G  Y+I  +T++K +YKQ L+F   LI+V+TTQ++G+GWAG+ R+YLV
Sbjct  155  GSVYAIHVVTVVKTFYKQHLTFFVSLIVVVTTQVLGFGWAGIFRKYLV  202



>ref|XP_004238028.1| PREDICTED: oligopeptide transporter 4-like [Solanum lycopersicum]
Length=755

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 125/171 (73%), Gaps = 2/171 (1%)
 Frame = +1

Query  88   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  267
            E+        P+EEV L VP TDDPTLPV TFR W LG+ SC++L FLN FF YR +PL 
Sbjct  17   EEEINEDELSPIEEVRLTVPNTDDPTLPVWTFRMWILGVFSCVLLSFLNQFFSYRKEPLI  76

Query  268  ISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVS  441
            I+ I +Q++ LPIG+FMAA LP  KF    FG   F+LNPGPFN+KEHV+IT+ AN G +
Sbjct  77   ITQITVQVATLPIGRFMAAVLPTTKFRILGFGSREFSLNPGPFNMKEHVLITIFANAGFA  136

Query  442  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             G G AY++G + I+KA+Y++ +SF    ++++TTQ++GYGWAG+LR+Y+V
Sbjct  137  FGNGSAYAVGIVNIIKAFYRRNISFAASWLLIITTQVLGYGWAGLLRKYVV  187



>dbj|BAJ97716.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 121/175 (69%), Gaps = 4/175 (2%)
 Frame = +1

Query  70   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  249
            +P    +    S    P+E+VAL VP  DDP  PVLTFR W LG+ SC +L FLN FF Y
Sbjct  45   SPEHQNDDGNLSSENSPIEQVALTVPVGDDPDTPVLTFRMWVLGMASCAVLSFLNQFFWY  104

Query  250  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  429
            R +PL+I+AI  QI+V+P+G+ MAA LPER F    RW FTLNPGPFN+KEHV+IT+ AN
Sbjct  105  RKEPLTITAISAQIAVVPLGRLMAAALPERVFLRGSRWEFTLNPGPFNVKEHVLITIFAN  164

Query  430  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
                 G G  Y+I  +T ++ +Y + L+F   L++VLTTQ++G+GWAG+ RRYLV
Sbjct  165  A----GAGTVYAIHVVTAVRVFYGKNLTFFVSLLVVLTTQVLGFGWAGIFRRYLV  215



>ref|XP_006364982.1| PREDICTED: oligopeptide transporter 4-like [Solanum tuberosum]
Length=755

 Score =   199 bits (507),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 125/171 (73%), Gaps = 2/171 (1%)
 Frame = +1

Query  88   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  267
            E+        P+EEV L VP TDDPTLPV TFR W LG+ SC++L FLN FF YR +PL 
Sbjct  17   EEEINEDELSPIEEVRLTVPNTDDPTLPVWTFRMWILGVFSCVLLSFLNQFFSYRKEPLI  76

Query  268  ISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVS  441
            I+ I +Q++ LPIG+FMAA LP  KF    FG   F+LNPGPFN+KEHV+IT+ AN G +
Sbjct  77   ITQITVQVATLPIGRFMAAVLPTTKFRILGFGSREFSLNPGPFNMKEHVLITIFANAGFA  136

Query  442  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             G G AY++G + I+KA+Y + +SF+   ++++TTQ++GYGWAG+LR+Y+V
Sbjct  137  FGNGSAYAVGIVNIIKAFYHRNISFVASWLLIITTQVLGYGWAGLLRKYVV  187



>ref|XP_004252726.1| PREDICTED: oligopeptide transporter 2-like [Solanum lycopersicum]
Length=731

 Score =   199 bits (507),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 122/159 (77%), Gaps = 5/159 (3%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+E+V L V   DD +LPV TFR WFLG+ SC IL FLNTFF YRTQPLSIS I +QI+ 
Sbjct  22   PIEQVRLTVSNQDDTSLPVWTFRMWFLGLLSCSILAFLNTFFSYRTQPLSISMITVQIAA  81

Query  298  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  477
            LP+GK MA  LP RKF   G W F+LNPGPFN+KEHV+I++ ANC    G G AY++  +
Sbjct  82   LPVGKLMAKVLPTRKFK-IGSWEFSLNPGPFNMKEHVLISIFANC----GAGTAYAVSIV  136

Query  478  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            TI+KA+Y + +SF+ G ++V+TTQ++GYGWAG++R+Y+V
Sbjct  137  TIIKAFYLRNISFVAGWVLVVTTQVLGYGWAGIMRKYVV  175



>ref|XP_002267184.1| PREDICTED: oligopeptide transporter 1-like [Vitis vinifera]
Length=753

 Score =   199 bits (507),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 134/194 (69%), Gaps = 15/194 (8%)
 Frame = +1

Query  16   TVPAQ*LSEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWF  195
            T P     +H+ +E      AT  E+       CP+E+V L VP TDDPT PVLTFR W 
Sbjct  9    TQPKPQEQQHLDIE------ATGDEEV----NDCPIEQVRLTVPITDDPTEPVLTFRTWV  58

Query  196  LGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA-PFGRWSFT  372
            LG+ SC+IL F+N FF YR+  LSIS++  QI  LP+GKFMAATLPE+    P  +WSF+
Sbjct  59   LGVASCVILSFVNQFFGYRSNQLSISSVSAQIVTLPLGKFMAATLPEKPIKVPCTKWSFS  118

Query  373  LNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQL  552
            LNPGPFNIKEHV+IT+ AN     G G  Y++G +TI+KA+YK++LS   G ++V TTQL
Sbjct  119  LNPGPFNIKEHVLITMFANS----GSGGVYAVGILTIVKAFYKRSLSPGAGYLLVQTTQL  174

Query  553  IGYGWAGVLRRYLV  594
            +GYGWAG+ R+YLV
Sbjct  175  LGYGWAGLFRKYLV  188



>ref|XP_007200086.1| hypothetical protein PRUPE_ppa021086mg [Prunus persica]
 gb|EMJ01285.1| hypothetical protein PRUPE_ppa021086mg [Prunus persica]
Length=743

 Score =   199 bits (506),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 124/171 (73%), Gaps = 2/171 (1%)
 Frame = +1

Query  88   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  267
            +  A      P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL 
Sbjct  19   DSDAEDDDVSPIEQVRLTVTNTDDPTLPVWTFRMWFLGLLSCALLSFLNQFFSYRTEPLI  78

Query  268  ISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVS  441
            I+ I +Q+S LPIG FMA  LP  KF    FG  SF+LNPGPFNIKEHV+IT+ AN G +
Sbjct  79   ITQITVQVSTLPIGNFMAKVLPTNKFHIPGFGSRSFSLNPGPFNIKEHVLITIFANAGSA  138

Query  442  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             G G AY++G + I+KA+Y++ +S L   ++++TTQ++GYGWAG+LR+Y+V
Sbjct  139  FGLGSAYAVGIVNIIKAFYRRKISLLASWLLIITTQVLGYGWAGLLRKYVV  189



>gb|KHG17687.1| Oligopeptide transporter 7 [Gossypium arboreum]
Length=759

 Score =   199 bits (506),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 120/161 (75%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              PV +VAL VP TDDP+LPVLTFR W LG  SC +L FLN FF YRT+PL+I+AI  QI
Sbjct  46   NSPVRQVALTVPTTDDPSLPVLTFRMWVLGTISCFLLSFLNQFFWYRTEPLTITAISAQI  105

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +V+P+G+ MAA + +R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  106  AVVPLGQLMAAKITKRVFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGSVYAIH  161

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +T++K +YKQ ++F   LI++LTTQ++G+GWAG+ RRYLV
Sbjct  162  VVTVVKVFYKQHITFFVSLIVILTTQVLGFGWAGIFRRYLV  202



>ref|XP_002272972.2| PREDICTED: oligopeptide transporter 7 [Vitis vinifera]
Length=749

 Score =   199 bits (506),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 123/168 (73%), Gaps = 4/168 (2%)
 Frame = +1

Query  91   KTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSI  270
            K  P     P+++VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PL+I
Sbjct  29   KPDPDEENSPIKQVALTVPTTDDPSLPVLTFRMWVLGTVSCVLLSFLNQFFWYRTEPLTI  88

Query  271  SAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGG  450
            +AI  QI+V+P+G+ MAA + +R F     W FTLNPGPFN+KEHV+IT+ AN     G 
Sbjct  89   TAISAQIAVVPLGRLMAAKITDRVFFKGTPWEFTLNPGPFNVKEHVLITIFANS----GA  144

Query  451  GDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            G  Y+I  +T++K +YK+ +SF   LI+V+TTQ++G+GWAG+ RRYLV
Sbjct  145  GTVYAIHVVTVVKVFYKKHISFFVSLIVVITTQVLGFGWAGIFRRYLV  192



>gb|KHG17686.1| Oligopeptide transporter 7 [Gossypium arboreum]
Length=783

 Score =   199 bits (506),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 120/161 (75%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              PV +VAL VP TDDP+LPVLTFR W LG  SC +L FLN FF YRT+PL+I+AI  QI
Sbjct  70   NSPVRQVALTVPTTDDPSLPVLTFRMWVLGTISCFLLSFLNQFFWYRTEPLTITAISAQI  129

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +V+P+G+ MAA + +R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  130  AVVPLGQLMAAKITKRVFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGSVYAIH  185

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +T++K +YKQ ++F   LI++LTTQ++G+GWAG+ RRYLV
Sbjct  186  VVTVVKVFYKQHITFFVSLIVILTTQVLGFGWAGIFRRYLV  226



>ref|XP_002283674.1| PREDICTED: oligopeptide transporter 4-like [Vitis vinifera]
Length=754

 Score =   199 bits (506),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 127/183 (69%), Gaps = 2/183 (1%)
 Frame = +1

Query  52   VEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  231
            VE+      T            P+EEV L VP  DD +L V TFR WFLG+ SC +L FL
Sbjct  4    VEIEAPRVNTLENGNINEDEESPIEEVRLTVPNDDDSSLSVWTFRMWFLGVLSCTLLSFL  63

Query  232  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEH  405
            N FF YR +PL I+ I +Q++ LPIG+FMAA LPE KF    FG+  F+ NPGPFN+KEH
Sbjct  64   NQFFSYRREPLVITQITVQVATLPIGRFMAAVLPETKFHIPGFGKREFSFNPGPFNMKEH  123

Query  406  VIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRR  585
            V+I++ AN G + G G AY++G +TI+KA+Y  ++SFL G ++++TTQ++GYGWAG+LR+
Sbjct  124  VLISIFANAGSAFGNGSAYAVGIVTIIKAFYNSSISFLAGWLLIVTTQVLGYGWAGLLRK  183

Query  586  YLV  594
            Y+V
Sbjct  184  YVV  186



>ref|XP_010691453.1| PREDICTED: oligopeptide transporter 4 [Beta vulgaris subsp. vulgaris]
Length=746

 Score =   199 bits (505),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 128/174 (74%), Gaps = 5/174 (3%)
 Frame = +1

Query  88   EKTAPSGGR---CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQ  258
            EK+ P        P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+
Sbjct  15   EKSKPDIDEDDISPIEEVRLTVTNTDDPTLPVWTFRMWFLGLVSCGMLSFLNQFFSYRTE  74

Query  259  PLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANC  432
            PL I+ I +Q++ LP+G F+A  LPE KF    FG  +F+LNPGPFN+KEHV+IT+ AN 
Sbjct  75   PLIITQITVQVATLPLGHFLARILPETKFRIPGFGPRTFSLNPGPFNVKEHVLITIFANA  134

Query  433  GVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            G + G G AY++G + I+KA+YK+ +SFL   I+++TTQ++GYGWAG++R+Y+V
Sbjct  135  GSAFGNGSAYAVGIVNIIKAFYKRNISFLAAWILIITTQVLGYGWAGLMRKYVV  188



>emb|CDP12213.1| unnamed protein product [Coffea canephora]
Length=763

 Score =   199 bits (505),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 122/161 (76%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              P+ +VAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YRT+PL+I+AI  Q+
Sbjct  50   NSPIPQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTITAISAQV  109

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +V+P+G+ MAA LP+  F    RW F+LNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  110  AVVPLGQLMAAKLPKGAFFKGSRWEFSLNPGPFNVKEHVLITIFANS----GAGTVYAIH  165

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +T++KA+YK+ ++F   LI+VLTTQ++G+GWAG+ RRYLV
Sbjct  166  IVTVVKAFYKRHITFFVSLIVVLTTQVLGFGWAGIFRRYLV  206



>emb|CAN81605.1| hypothetical protein VITISV_025060 [Vitis vinifera]
Length=739

 Score =   198 bits (504),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 123/163 (75%), Gaps = 2/163 (1%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              P+EEV L VP  DD +L V TFR WFLG+ SC +L FLN FF YR +PL I+ I +Q+
Sbjct  9    ESPIEEVRLTVPNDDDSSLSVWTFRMWFLGVLSCTLLSFLNQFFSYRREPLVITQITVQV  68

Query  292  SVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYS  465
            + LPIG+FMAA LPE KF    FG+  F+ NPGPFN+KEHV+I++ AN G + G G AY+
Sbjct  69   ATLPIGRFMAAVLPETKFHIPGFGKREFSFNPGPFNMKEHVLISIFANAGSAFGNGSAYA  128

Query  466  IGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            +G +TI+KA+Y  ++SFL G ++++TTQ++GYGWAG+LR+Y+V
Sbjct  129  VGIVTIIKAFYNSSISFLAGWLLIVTTQVLGYGWAGLLRKYVV  171



>ref|XP_006417516.1| hypothetical protein EUTSA_v10009349mg [Eutrema salsugineum]
 gb|ESQ35869.1| hypothetical protein EUTSA_v10009349mg [Eutrema salsugineum]
Length=731

 Score =   198 bits (504),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              PVEEV L V   DDP+LPV TFR WFLG+ SC++L FLNTFF YRTQPL IS I +Q+
Sbjct  16   ESPVEEVRLTVSNDDDPSLPVWTFRMWFLGLISCVMLSFLNTFFGYRTQPLMISMISVQV  75

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
              LPIGK MA  LPE K+   G W F+ NPGPFN+KEHV+I++ AN G   G G AY++G
Sbjct  76   VTLPIGKLMARVLPETKYR-IGSWEFSFNPGPFNVKEHVLISMFANAGAGFGSGTAYAVG  134

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             + I+ A+YK+ +SFL   I+V+TTQ++GYGWAG++R+ +V
Sbjct  135  IVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVV  175



>ref|XP_009359568.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 7-like 
[Pyrus x bretschneideri]
Length=757

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 121/159 (76%), Gaps = 4/159 (3%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            PVE+VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PLSI+AI  QI+V
Sbjct  48   PVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQIAV  107

Query  298  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  477
            +P+G+ MA+ +  R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  108  VPLGQLMASKITNRVFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIHIV  163

Query  478  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            T++K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV
Sbjct  164  TVVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLV  202



>gb|EPS60835.1| hypothetical protein M569_13965 [Genlisea aurea]
Length=743

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 124/175 (71%), Gaps = 6/175 (3%)
 Frame = +1

Query  73   PATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  252
            P +A +   P     P+EEV L VP TDDP+LP LTFR WFLGI SC  L +LN FF YR
Sbjct  12   PESAAKNDEPLND-SPIEEVRLTVPTTDDPSLPCLTFRTWFLGIISCAALSYLNQFFSYR  70

Query  253  TQPLSISAILMQISVLPIGKFMAATLPERKFA-PFGRWSFTLNPGPFNIKEHVIITVMAN  429
              PLSI+++  QI VLP+GKFMAATLPER+F  P   WSF+LNPGPFN+KEH +IT+ AN
Sbjct  71   RNPLSITSVSAQILVLPVGKFMAATLPERRFRFPGTNWSFSLNPGPFNMKEHCLITIFAN  130

Query  430  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             G S      Y+IG +TI+KA+Y + L  L  +I+  +TQL+GYGWAG+ R++LV
Sbjct  131  AGAS----GVYAIGIVTIVKAFYHRKLHPLAAMILTHSTQLLGYGWAGIFRKFLV  181



>emb|CDO97358.1| unnamed protein product [Coffea canephora]
Length=309

 Score =   190 bits (482),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 130/187 (70%), Gaps = 6/187 (3%)
 Frame = +1

Query  52   VEMSGLNPATAG----EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCII  219
            +E+  LN  T       +        P+EEV L V   DDPTLPV TFR W LG+ SC +
Sbjct  4    LEVESLNTTTTATNDHHQKYEDEDDSPIEEVRLTVSNYDDPTLPVWTFRMWLLGLLSCAL  63

Query  220  LIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFN  393
            L FLN FF YRT+PL IS I +Q++ LPIG FMAA LPE+KF    FG+  F+ NPGPFN
Sbjct  64   LSFLNQFFSYRTEPLIISQITVQVASLPIGHFMAAVLPEKKFRLPGFGQRLFSFNPGPFN  123

Query  394  IKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAG  573
            +KEHV+IT+ AN G + G G AY++G I I+ A+YK+ +SFL G ++++TTQ++GYGWAG
Sbjct  124  MKEHVLITIFANAGAAFGNGSAYAVGIINIIIAFYKRKISFLAGWLLIITTQVLGYGWAG  183

Query  574  VLRRYLV  594
            +LR+Y+V
Sbjct  184  LLRKYVV  190



>ref|XP_006351838.1| PREDICTED: oligopeptide transporter 4-like [Solanum tuberosum]
Length=738

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 125/161 (78%), Gaps = 2/161 (1%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  23   PIEEVRLTVTNTDDPTLPVWTFRMWFLGLFSCCLLSFLNQFFSYRTEPLVITQITVQVAT  82

Query  298  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            LPIG F+A  LP+ KF    FG   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  83   LPIGHFLATILPKTKFRLPGFGPRLFSLNPGPFNMKEHVLISIFANAGSAFGNGSAYAVG  142

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +TI+KA+Y++ +SFL G I+++TTQ++GYGWAG+LR+Y+V
Sbjct  143  IVTIIKAFYRRNISFLAGWILIITTQVLGYGWAGLLRKYVV  183



>emb|CDP19589.1| unnamed protein product [Coffea canephora]
Length=750

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 131/191 (69%), Gaps = 6/191 (3%)
 Frame = +1

Query  37   SEHIVVEMSGLN-PATAGEKTAPSG----GRCPVEEVALVVPETDDPTLPVLTFRAWFLG  201
            S  I V+ S +N P T G      G       P+E+V L V   DDP+LPV TFR WFLG
Sbjct  3    SFEINVDDSTMNAPKTKGHGYEAEGIDPEEESPIEQVRLTVLNHDDPSLPVWTFRMWFLG  62

Query  202  ITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNP  381
            + SC +L FLNTFF YR++PL I+ I  Q++ LP+G FMA  LP +KF   G W F+LNP
Sbjct  63   LLSCGVLSFLNTFFSYRSEPLVITMISAQVATLPMGHFMAKVLPTKKFQ-IGSWEFSLNP  121

Query  382  GPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGY  561
            GPFNIKEH +I++ AN G + GGG AY+I  + I+KA+Y + +SFL   I+V+TTQ++GY
Sbjct  122  GPFNIKEHALISIFANTGSAFGGGTAYAISIVDIVKAFYHRKISFLASWILVVTTQVLGY  181

Query  562  GWAGVLRRYLV  594
            GWAG++R+Y++
Sbjct  182  GWAGIMRKYVI  192



>ref|XP_010501399.1| PREDICTED: oligopeptide transporter 2 [Camelina sativa]
Length=735

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 127/180 (71%), Gaps = 2/180 (1%)
 Frame = +1

Query  58   MSGLNPATAGEKTAPSG-GRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  234
            M+ ++ +   E  A       PVEEV L V   DDP+LPV TFR WFLG+ SC++L FLN
Sbjct  1    MAAIDESRKPEIIADDDEDESPVEEVRLTVSNHDDPSLPVWTFRMWFLGLLSCVLLSFLN  60

Query  235  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  414
            TFF YRTQPL I+ I +Q+  LP+GK MA  LPE K+   G W F+LNPGPFN+KEHV+I
Sbjct  61   TFFGYRTQPLMITMISVQVVTLPLGKLMARVLPETKYK-IGSWEFSLNPGPFNVKEHVLI  119

Query  415  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            ++ AN G   G G AY++G + I+ A+YK+ +SFL   I+V+TTQ++GYGWAG++R+ +V
Sbjct  120  SMFANAGAGFGSGTAYAVGIVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVV  179



>gb|KDP25233.1| hypothetical protein JCGZ_20389 [Jatropha curcas]
Length=756

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 124/169 (73%), Gaps = 4/169 (2%)
 Frame = +1

Query  88   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  267
             K   +    PV++VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PLS
Sbjct  35   NKLQETEENSPVKQVALTVPTTDDPSLPVLTFRMWVLGTISCVLLSFLNQFFWYRTEPLS  94

Query  268  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  447
            I+AI  QI+V+P+G+ MAA + +R F    RW FTLNPGPFN+KEHV+IT+ AN     G
Sbjct  95   ITAISAQIAVVPLGQLMAAKITDRVFLKGTRWEFTLNPGPFNVKEHVLITIFANS----G  150

Query  448  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             G  Y+I  +T++K +YK+ ++F   LI+++TTQ++G+GWAG+ R+YLV
Sbjct  151  AGSVYAIHIVTVVKMFYKKHITFFVSLIVIITTQVLGFGWAGIFRKYLV  199



>ref|XP_010475851.1| PREDICTED: oligopeptide transporter 2-like [Camelina sativa]
Length=735

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 120/161 (75%), Gaps = 1/161 (1%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              PVEEV L V   DDP+LPV TFR WFLG+ SC++L FLNTFF YRTQPL I+ I +Q+
Sbjct  20   ESPVEEVRLTVSNHDDPSLPVWTFRMWFLGLLSCVLLSFLNTFFGYRTQPLMITMISVQV  79

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
              LP+GK MA  LPE K+   G W F+LNPGPFN+KEHV+I++ AN G   G G AY++G
Sbjct  80   VTLPLGKLMARVLPETKYK-IGSWEFSLNPGPFNVKEHVLISMFANAGAGFGSGTAYAVG  138

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             + I+ A+YK+ +SFL   I+V+TTQ++GYGWAG++R+ +V
Sbjct  139  IVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVV  179



>gb|KJB32169.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=753

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 126/177 (71%), Gaps = 2/177 (1%)
 Frame = +1

Query  70   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  249
            +  + G          P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  19   DATSGGNHDVEDDEISPIEQVRLTVTNTDDPTLPVWTFRMWFLGLFSCALLSFLNQFFSY  78

Query  250  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  423
            RT+PL I+ I +Q+S LPIG FMA+ LP+ +F    FG   F+LNPGPFN+KEHV+I + 
Sbjct  79   RTEPLIITQITVQVSTLPIGHFMASVLPKTQFGIPGFGSKRFSLNPGPFNMKEHVLICIF  138

Query  424  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AN G + G G AY+IG + I+KA+Y + +SFL G ++++TTQ++GYGWAG+LR+Y+V
Sbjct  139  ANAGSAFGNGSAYAIGIVNIIKAFYGRNISFLAGWLLIITTQVLGYGWAGLLRKYVV  195



>ref|XP_006343795.1| PREDICTED: oligopeptide transporter 7-like [Solanum tuberosum]
Length=749

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 122/161 (76%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              P+E+VAL VP TDDP+LPVLTFR WFLG  SC++L FLN FF YRT+PL+I+AI  QI
Sbjct  36   NSPIEQVALTVPTTDDPSLPVLTFRMWFLGTLSCVLLSFLNQFFWYRTEPLTITAISAQI  95

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +V+P+G+ MAA + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  96   AVVPLGQLMAAKITKRVFLQGSKWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  151

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +T +K +YK+ ++F   LI+++TTQ++G+GWAG+ R+YLV
Sbjct  152  VVTAVKVFYKKDITFFVSLIVIITTQVLGFGWAGIFRKYLV  192



>ref|XP_006376658.1| hypothetical protein POPTR_0012s02660g [Populus trichocarpa]
 gb|ERP54455.1| hypothetical protein POPTR_0012s02660g [Populus trichocarpa]
Length=381

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 123/179 (69%), Gaps = 6/179 (3%)
 Frame = +1

Query  58   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  237
            M+G N   A E        CPV++V L V +TDDPTLPVLTFR W LG+ SC++L F+N 
Sbjct  1    MAGANEVQAME--IEDEEECPVKQVDLTVLKTDDPTLPVLTFRMWVLGLGSCVLLSFVNQ  58

Query  238  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  417
            FF YRTQP+ IS+I  QI+V+P+G  MA  L  RKF     W FT+NPGPFNIKEHV+IT
Sbjct  59   FFWYRTQPMFISSISAQIAVVPLGHLMAKKLTTRKFFEGTSWEFTMNPGPFNIKEHVLIT  118

Query  418  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            + AN     G G  Y+   +T +K YYK+ L+F+  L +++TTQ++G+GWAG+ R+YLV
Sbjct  119  IFANS----GAGTVYATHILTAVKLYYKRKLTFVPALFVMITTQVLGFGWAGLFRKYLV  173



>ref|XP_009801973.1| PREDICTED: oligopeptide transporter 6-like [Nicotiana sylvestris]
Length=732

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 126/176 (72%), Gaps = 7/176 (4%)
 Frame = +1

Query  67   LNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  246
            +N A A E        CP++EV + VP+TDDPT PVLTFR WFLGITSC++L F+N FF 
Sbjct  6    VNMAAANEADE---DLCPIKEVDMTVPKTDDPTTPVLTFRMWFLGITSCVLLSFVNQFFW  62

Query  247  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  426
            YRT+PL+IS+  +QI+V+PIG  MA T+ +R F    RW FTLNPGPFNIKEHV+IT+ A
Sbjct  63   YRTEPLTISSTAVQIAVVPIGHLMAKTITKRLFFEGTRWEFTLNPGPFNIKEHVLITIFA  122

Query  427  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            N     G G  Y+   ++ +K YYK+ LSF   L+I+ TTQ++G+GWAG+ R++LV
Sbjct  123  NA----GAGSVYATHILSAVKLYYKRPLSFFPALLIMATTQMLGFGWAGIFRKHLV  174



>gb|KHG09371.1| Oligopeptide transporter 4 -like protein [Gossypium arboreum]
Length=753

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 126/177 (71%), Gaps = 2/177 (1%)
 Frame = +1

Query  70   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  249
            +  + G          P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  19   DATSGGNHDVEDDEISPIEQVRLTVTNTDDPTLPVWTFRMWFLGLFSCALLSFLNQFFSY  78

Query  250  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  423
            RT+PL I+ I +Q+S LPIG FMA+ LP+ +F    FG   F+LNPGPFN+KEHV+I + 
Sbjct  79   RTEPLIITQITVQVSTLPIGHFMASVLPKTQFGIPGFGSKRFSLNPGPFNMKEHVLICIF  138

Query  424  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AN G + G G AY++G + I+KA+Y + +SFL G ++++TTQ++GYGWAG+LR+Y+V
Sbjct  139  ANAGSAFGNGSAYAVGIVNIIKAFYGRNISFLAGWLLIITTQVLGYGWAGLLRKYVV  195



>emb|CBI39770.3| unnamed protein product [Vitis vinifera]
Length=749

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 130/181 (72%), Gaps = 8/181 (4%)
 Frame = +1

Query  55   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  234
            E++  N    G++       CP+E+V L VP TDDPT PVLTFR W LG+ +C+IL F+N
Sbjct  7    EVTQKNFKVDGDEEE---NDCPIEQVRLTVPITDDPTEPVLTFRTWVLGVAACVILSFVN  63

Query  235  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA-PFGRWSFTLNPGPFNIKEHVI  411
             FF YR+  LSIS++  QI  LP+GKFMAATLPE+    P  +WSF+LNPGPFNIKEHV+
Sbjct  64   QFFGYRSNQLSISSVSAQIVTLPLGKFMAATLPEKPIKVPCTKWSFSLNPGPFNIKEHVL  123

Query  412  ITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYL  591
            IT+ AN     G G  Y++G +TI+KA+YK++LS   G ++V TTQL+GYGWAG+ R+YL
Sbjct  124  ITMFANS----GSGGVYAVGILTIVKAFYKRSLSPGAGYLLVQTTQLLGYGWAGLFRKYL  179

Query  592  V  594
            V
Sbjct  180  V  180



>ref|XP_004245468.1| PREDICTED: oligopeptide transporter 7-like [Solanum lycopersicum]
Length=749

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 122/161 (76%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              PVE+VAL VP TDDP+LPVLTFR WFLG  SC++L FLN FF YRT+PL+I+AI  QI
Sbjct  36   NSPVEQVALTVPTTDDPSLPVLTFRMWFLGTVSCVLLSFLNQFFWYRTEPLTITAISAQI  95

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +V+P+G+ MAA + +R F    +W F+LNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  96   AVVPLGQLMAAKITKRVFLQGSKWEFSLNPGPFNVKEHVLITIFANS----GAGTVYAIH  151

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +T +K +YK+ ++F   LI+++TTQ++G+GWAG+ R+YLV
Sbjct  152  VVTAVKVFYKKDITFFVSLIVIITTQVLGFGWAGIFRKYLV  192



>ref|XP_009368318.1| PREDICTED: oligopeptide transporter 4 [Pyrus x bretschneideri]
Length=750

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 124/177 (70%), Gaps = 2/177 (1%)
 Frame = +1

Query  70   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  249
             P  + E         P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  20   KPTHSLEPDTEDDDVSPIEQVRLTVTNTDDPTLPVWTFRMWFLGLVSCALLSFLNQFFSY  79

Query  250  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  423
            RT+PL I+ I +Q+S LPIG FMA  LP + F    FG  +F+LNPGPFNIKEHV+IT+ 
Sbjct  80   RTEPLIITQITVQVSTLPIGYFMAKVLPTKTFHIPGFGSRTFSLNPGPFNIKEHVLITIF  139

Query  424  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AN G + G G AY++G + I+KA+Y + +S L   ++++TTQ++GYGWAG+LR+Y+V
Sbjct  140  ANAGSAFGAGSAYAVGIVNIIKAFYHRKISLLASWLLIITTQVLGYGWAGLLRKYVV  196



>ref|XP_004231372.1| PREDICTED: oligopeptide transporter 4 [Solanum lycopersicum]
Length=735

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 125/166 (75%), Gaps = 2/166 (1%)
 Frame = +1

Query  103  SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAIL  282
            S    P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I 
Sbjct  15   SDDVSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLFSCCLLSFLNQFFSYRTEPLVITQIT  74

Query  283  MQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGD  456
            +Q++ LPIG F+A  LP  KF    FG   F+LNPGPFN+KEHV+I++ AN G + G G 
Sbjct  75   VQVATLPIGHFLATILPATKFRLPGFGPRLFSLNPGPFNMKEHVLISIFANAGSAFGNGS  134

Query  457  AYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AY++G +TI+KA+Y++ +SFL G I+++TTQ++GYGWAG+LR+Y+V
Sbjct  135  AYAVGIVTIIKAFYRRNISFLAGWILIITTQVLGYGWAGLLRKYVV  180



>ref|XP_010644607.1| PREDICTED: oligopeptide transporter 1-like [Vitis vinifera]
Length=745

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 130/181 (72%), Gaps = 8/181 (4%)
 Frame = +1

Query  55   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  234
            E++  N    G++       CP+E+V L VP TDDPT PVLTFR W LG+ +C+IL F+N
Sbjct  7    EVTQKNFKVDGDEEE---NDCPIEQVRLTVPITDDPTEPVLTFRTWVLGVAACVILSFVN  63

Query  235  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA-PFGRWSFTLNPGPFNIKEHVI  411
             FF YR+  LSIS++  QI  LP+GKFMAATLPE+    P  +WSF+LNPGPFNIKEHV+
Sbjct  64   QFFGYRSNQLSISSVSAQIVTLPLGKFMAATLPEKPIKVPCTKWSFSLNPGPFNIKEHVL  123

Query  412  ITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYL  591
            IT+ AN     G G  Y++G +TI+KA+YK++LS   G ++V TTQL+GYGWAG+ R+YL
Sbjct  124  ITMFANS----GSGGVYAVGILTIVKAFYKRSLSPGAGYLLVQTTQLLGYGWAGLFRKYL  179

Query  592  V  594
            V
Sbjct  180  V  180



>ref|XP_008239235.1| PREDICTED: oligopeptide transporter 7-like [Prunus mume]
Length=759

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 120/161 (75%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              PVE+VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PLSI+AI  QI
Sbjct  48   NSPVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQI  107

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +V+P+G+ MA+ +    F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  108  AVVPLGQLMASKITTHAFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  163

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +T++K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV
Sbjct  164  VVTVVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLV  204



>ref|XP_006851891.1| hypothetical protein AMTR_s00041p00133990 [Amborella trichopoda]
 gb|ERN13358.1| hypothetical protein AMTR_s00041p00133990 [Amborella trichopoda]
Length=800

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 127/179 (71%), Gaps = 4/179 (2%)
 Frame = +1

Query  58   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  237
            M   + +T  E+   S    P+E+VAL VP TDDP+LPV+TFR WFLG  SC+I+ FLN 
Sbjct  68   MDKPSSSTTTEEPNTSPENSPIEQVALTVPVTDDPSLPVITFRMWFLGCLSCVIISFLNQ  127

Query  238  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  417
            FF +RT+PL+I+++  QI+V+P+G  MAA LP R F    RW FTLNPGPFN+KEHV+IT
Sbjct  128  FFWFRTEPLTITSVSAQIAVVPLGHLMAAVLPTRPFFKGKRWEFTLNPGPFNVKEHVLIT  187

Query  418  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            + AN     G G  ++I  ++ +K +YK+ LSF    ++V+TTQ++G+GWAG+ R+YLV
Sbjct  188  IFANS----GAGSVFAIHIVSSVKVFYKETLSFFVAFLVVITTQVMGFGWAGMFRKYLV  242



>ref|XP_003581597.1| PREDICTED: oligopeptide transporter 4-like [Brachypodium distachyon]
Length=736

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 125/175 (71%), Gaps = 5/175 (3%)
 Frame = +1

Query  70   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  249
            +PA   E    S    PVE+V L VP TDDPTLP+ TFR W +G  SC +L F N FF Y
Sbjct  11   HPAAVDEDDDVS----PVEQVRLTVPVTDDPTLPLWTFRMWTIGFVSCALLSFFNQFFAY  66

Query  250  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  429
            RT+P+ IS I +Q++ LPIG FMA  LPERK   FG    +LNPGPFN+KEHV+I++ AN
Sbjct  67   RTEPIIISQITIQVAALPIGHFMARVLPERKLRVFGH-ECSLNPGPFNVKEHVLISIFAN  125

Query  430  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             G + G G AY++G + I+KA+YK+ +SF   L++++TTQ++GYGWAG+LR+Y+V
Sbjct  126  AGAAFGSGSAYAVGIVNIVKAFYKRNISFFTSLLLIITTQVLGYGWAGLLRKYVV  180



>gb|KJB32171.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=951

 Score =   198 bits (504),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 126/177 (71%), Gaps = 2/177 (1%)
 Frame = +1

Query  70   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  249
            +  + G          P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  217  DATSGGNHDVEDDEISPIEQVRLTVTNTDDPTLPVWTFRMWFLGLFSCALLSFLNQFFSY  276

Query  250  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  423
            RT+PL I+ I +Q+S LPIG FMA+ LP+ +F    FG   F+LNPGPFN+KEHV+I + 
Sbjct  277  RTEPLIITQITVQVSTLPIGHFMASVLPKTQFGIPGFGSKRFSLNPGPFNMKEHVLICIF  336

Query  424  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AN G + G G AY+IG + I+KA+Y + +SFL G ++++TTQ++GYGWAG+LR+Y+V
Sbjct  337  ANAGSAFGNGSAYAIGIVNIIKAFYGRNISFLAGWLLIITTQVLGYGWAGLLRKYVV  393


 Score =   184 bits (466),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 117/164 (71%), Gaps = 3/164 (2%)
 Frame = +1

Query  70   NPATAGEKTAPSGGR-CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  246
            N A  GE  A       P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF 
Sbjct  19   NHAIKGENAAADDDELSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCALLSFLNQFFA  78

Query  247  YRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITV  420
            YRT+PL I+ I +Q++ LPIG+FMAA LP R+F     G   F+LNPGPFN+KEHV+I++
Sbjct  79   YRTEPLIITQITVQVATLPIGQFMAAVLPRRQFKLPGVGSRKFSLNPGPFNMKEHVLISI  138

Query  421  MANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQL  552
             AN G + G G AY++G +TI+KA+Y++ +SFL G ++++TTQL
Sbjct  139  FANAGSAFGSGSAYAVGIVTIIKAFYQRKISFLAGWLLIITTQL  182



>ref|XP_002892535.1| ATOPT2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68794.1| ATOPT2 [Arabidopsis lyrata subsp. lyrata]
Length=734

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              PVEEV L V   DDP+LPV TFR WFLG+ SCI+L FLNTFF YRTQPL I+ I +Q+
Sbjct  19   ESPVEEVRLTVSNHDDPSLPVWTFRMWFLGLLSCILLSFLNTFFGYRTQPLMITMISVQV  78

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
              LP+GK MA  LPE K+   G W F+ NPGPFN+KEHV+I++ AN G   G G AY++G
Sbjct  79   VTLPLGKLMARVLPETKYK-IGSWEFSFNPGPFNVKEHVLISMFANAGAGFGSGTAYAVG  137

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             + I+ A+YK+ +SFL   I+V+TTQ++GYGWAG++R+ +V
Sbjct  138  IVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVV  178



>ref|XP_008390300.1| PREDICTED: oligopeptide transporter 7 isoform X2 [Malus domestica]
Length=706

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 121/159 (76%), Gaps = 4/159 (3%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            PV++VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PLSI+AI  QI+V
Sbjct  48   PVKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQIAV  107

Query  298  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  477
            +P+G+ MA+ +  R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  108  VPLGQLMASKITNRVFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIHIV  163

Query  478  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            T++K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV
Sbjct  164  TVVKVFYKRHITFFVSLLVILTTQVLGFGWAGIFRRYLV  202



>ref|XP_010065750.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
 gb|KCW63397.1| hypothetical protein EUGRSUZ_G01043 [Eucalyptus grandis]
Length=752

 Score =   197 bits (500),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 126/177 (71%), Gaps = 2/177 (1%)
 Frame = +1

Query  70   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  249
             PA   +         P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  21   KPAAPNDVDDAEDDLSPIEEVRLTVTNTDDPTLPVWTFRMWFLGVLSCALLSFLNQFFAY  80

Query  250  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  423
            RT+PL I+ I +Q++ LPIG+FMAA LP  KF     G  +F+LNPGPFN+KEHV+I++ 
Sbjct  81   RTEPLVITQITVQVATLPIGRFMAAVLPTAKFRIPGLGPRTFSLNPGPFNMKEHVLISIF  140

Query  424  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AN G + G G AY++  + I+KA+Y +++SF  G ++++TTQ++GYGWAG+LR+Y+V
Sbjct  141  ANAGSAFGSGSAYAVSIVNIIKAFYVRSISFFAGWLLIITTQVLGYGWAGLLRKYVV  197



>ref|XP_010458316.1| PREDICTED: oligopeptide transporter 2-like [Camelina sativa]
Length=736

 Score =   197 bits (500),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            PVEEV L V   DDP+LPV TFR WFLG+ SC++L FLNTFF YRTQPL I+ I +Q+  
Sbjct  23   PVEEVRLTVSNHDDPSLPVWTFRMWFLGLLSCVLLSFLNTFFGYRTQPLMITMISVQVVT  82

Query  298  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  477
            LP+GK MA  LPE K+   G W F+LNPGPFN+KEHV+I++ AN G   G G AY++G +
Sbjct  83   LPLGKLMARVLPETKYK-IGSWEFSLNPGPFNVKEHVLISMFANAGAGFGSGTAYAVGIV  141

Query  478  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             I+ A+YK+ +SFL   I+V+TTQ++GYGWAG++R+ +V
Sbjct  142  DIIVAFYKRKISFLASWILVITTQILGYGWAGIMRKLVV  180



>ref|XP_006364985.1| PREDICTED: oligopeptide transporter 2-like isoform X2 [Solanum 
tuberosum]
Length=726

 Score =   196 bits (499),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 122/169 (72%), Gaps = 1/169 (1%)
 Frame = +1

Query  88   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  267
            +         P+E+V L V   DDP+LPV TFR WFLG+ SC +L FLNTFF YR +PL 
Sbjct  3    QNLKEEDDESPIEQVRLTVSNDDDPSLPVWTFRMWFLGLLSCALLSFLNTFFSYRAEPLV  62

Query  268  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  447
            IS I +Q++ LPIG+ MA  LP+RKF     W F+LNPGPFN+KEHV+I++ AN G + G
Sbjct  63   ISMITVQVATLPIGRLMAKVLPKRKFT-IKSWEFSLNPGPFNVKEHVLISIFANAGSAFG  121

Query  448  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             G AY++G + I+KA+Y + ++FL G I+V+ TQ++GYGWAG++R+Y+V
Sbjct  122  NGPAYAVGIVDIIKAFYFRNITFLAGWILVVATQVLGYGWAGIMRKYVV  170



>ref|XP_006394156.1| hypothetical protein EUTSA_v10003716mg [Eutrema salsugineum]
 gb|ESQ31442.1| hypothetical protein EUTSA_v10003716mg [Eutrema salsugineum]
Length=729

 Score =   196 bits (499),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 124/161 (77%), Gaps = 2/161 (1%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+EEV L V  TDDPTLPV TFR WFLGI SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  14   PIEEVRLTVTNTDDPTLPVWTFRMWFLGIISCSLLSFLNQFFSYRTEPLVITQITVQVAT  73

Query  298  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            LPIG F+A  LP+ +F     G   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  74   LPIGHFLAKVLPKTRFGLPGLGSTRFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  133

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +TI+KA+Y++ +SF+ G ++++TTQ++GYGWAG+LR+Y+V
Sbjct  134  IVTIIKAFYRRNISFVAGWLLIITTQVLGYGWAGLLRKYVV  174



>ref|XP_009612437.1| PREDICTED: oligopeptide transporter 4 [Nicotiana tomentosiformis]
Length=737

 Score =   196 bits (499),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 123/163 (75%), Gaps = 2/163 (1%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q+
Sbjct  20   ESPIEEVRLTVTNTDDPTLPVWTFRMWFLGLFSCCLLSFLNQFFSYRTEPLVITQITVQV  79

Query  292  SVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYS  465
            + LPIG F+A  LP  KF    FG   F+LNPGPFN+KEHV+I++ AN G + G G AY+
Sbjct  80   ATLPIGHFLATVLPTTKFRLPGFGSRLFSLNPGPFNMKEHVLISIFANAGSAFGNGSAYA  139

Query  466  IGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            +G +TI+KA+Y + +SFL G ++++TTQ++GYGWAG+LR+Y+V
Sbjct  140  VGIVTIIKAFYHRNISFLAGWLLIITTQVLGYGWAGLLRKYVV  182



>ref|XP_008390299.1| PREDICTED: oligopeptide transporter 7 isoform X1 [Malus domestica]
Length=757

 Score =   196 bits (499),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 121/159 (76%), Gaps = 4/159 (3%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            PV++VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PLSI+AI  QI+V
Sbjct  48   PVKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQIAV  107

Query  298  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  477
            +P+G+ MA+ +  R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  108  VPLGQLMASKITNRVFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIHIV  163

Query  478  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            T++K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV
Sbjct  164  TVVKVFYKRHITFFVSLLVILTTQVLGFGWAGIFRRYLV  202



>gb|EMS65129.1| Oligopeptide transporter 7 [Triticum urartu]
Length=798

 Score =   197 bits (500),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 121/175 (69%), Gaps = 4/175 (2%)
 Frame = +1

Query  70   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  249
            +P    +    S    P+E+VAL VP  DDP  PVLTFR W LG+ SC +L FLN FF Y
Sbjct  103  SPERHDDGHGRSSENSPIEQVALTVPVGDDPDTPVLTFRMWVLGMASCAVLSFLNQFFWY  162

Query  250  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  429
            R +PL+I+AI  QI+V+P+G+ MAA LPER F    RW FTLNPGPFN+KEHV+IT+ AN
Sbjct  163  RKEPLTITAISAQIAVVPLGRLMAAALPERAFLRGSRWEFTLNPGPFNVKEHVLITIFAN  222

Query  430  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
                 G G  Y+I  +T ++ +Y + L+F   L++VLTTQ++G+GWAG+ RRYLV
Sbjct  223  A----GAGTVYAIHVVTAVRVFYGKNLTFFVSLLVVLTTQVLGFGWAGIFRRYLV  273



>ref|XP_009358688.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 7-like 
[Pyrus x bretschneideri]
Length=749

 Score =   196 bits (499),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 120/161 (75%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              PVE+VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PL+I+AI  QI
Sbjct  38   NSPVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQI  97

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +V+P+G+ MA+ +  R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  98   AVVPLGQLMASKITNRVFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  153

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +T +K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV
Sbjct  154  IVTAVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLV  194



>ref|XP_006304646.1| hypothetical protein CARUB_v10011782mg [Capsella rubella]
 gb|EOA37544.1| hypothetical protein CARUB_v10011782mg [Capsella rubella]
Length=735

 Score =   196 bits (498),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              PVEEV L V   DDP+LPV TFR WFLG+ SC++L FLNTFF YRTQPL I+ I +Q+
Sbjct  20   ESPVEEVRLTVSNHDDPSLPVWTFRMWFLGLLSCVLLSFLNTFFGYRTQPLMITMISVQV  79

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
              LP+GK MA  LPE K+   G W F+ NPGPFN+KEHV+I++ AN G   G G AY++G
Sbjct  80   VTLPLGKLMARVLPETKYK-IGSWEFSFNPGPFNVKEHVLISMFANAGAGFGSGTAYAVG  138

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             + I+ A+YK+ +SFL   I+V+TTQ++GYGWAG++R+ +V
Sbjct  139  IVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVV  179



>ref|XP_007039426.1| Oligopeptide transporter 7 isoform 1 [Theobroma cacao]
 gb|EOY23927.1| Oligopeptide transporter 7 isoform 1 [Theobroma cacao]
Length=762

 Score =   196 bits (499),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 121/161 (75%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              PV +VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PL+I+AI  QI
Sbjct  49   NSPVRQVALTVPTTDDPSLPVLTFRMWVLGTISCVLLSFLNQFFWYRTEPLTITAISAQI  108

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +V+P+G+ MAA + +R F    RW F+LNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  109  AVVPLGQLMAAKITDRVFFKGTRWEFSLNPGPFNVKEHVLITIFANS----GAGSVYAIH  164

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +T++K +YK+ ++F   LI+++TTQ++G+GWAG+ RRYLV
Sbjct  165  VVTVVKVFYKKHITFFVSLIVIITTQVLGFGWAGIFRRYLV  205



>ref|XP_004309115.1| PREDICTED: oligopeptide transporter 6-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011470202.1| PREDICTED: oligopeptide transporter 6-like [Fragaria vesca subsp. 
vesca]
Length=728

 Score =   196 bits (498),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 120/164 (73%), Gaps = 4/164 (2%)
 Frame = +1

Query  103  SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAIL  282
               RC +E+V L VP+TDDPTLPVLTFR W LG+ SCI+L F+N FF YRTQPL+ISAI 
Sbjct  14   EDDRCLIEQVELTVPKTDDPTLPVLTFRMWVLGLVSCILLSFVNQFFWYRTQPLTISAIS  73

Query  283  MQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAY  462
             QI+V+P+G FMA  LP R F    +  FT+NPGPFN+KEHV+IT+ ANC    G G  Y
Sbjct  74   AQIAVVPLGHFMARVLPTRSFFQGTQLEFTMNPGPFNVKEHVLITIFANC----GAGTVY  129

Query  463  SIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            +   +T +K  YK+ L+FL   I++LTTQ++G+GWAG+ R+YLV
Sbjct  130  ASHILTAVKLLYKRKLTFLPAFIVMLTTQVLGFGWAGIFRKYLV  173



>ref|XP_004309550.1| PREDICTED: oligopeptide transporter 7 [Fragaria vesca subsp. 
vesca]
Length=749

 Score =   196 bits (498),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 120/161 (75%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              PV++VAL VP  DDP+LPVLTFR W LG  SC++L FLN FF YRT+PLSI+AI  QI
Sbjct  38   NSPVKQVALTVPTGDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQI  97

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +V+P+G+ MAA +  R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  98   AVVPLGQLMAANITTRVFFKGTRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  153

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +T++K +YKQ ++F   L+++LTTQ++G+GWAG+ RRYLV
Sbjct  154  IVTVVKVFYKQHITFFVSLLVILTTQVLGFGWAGIFRRYLV  194



>ref|XP_008437437.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 7 [Cucumis 
melo]
Length=752

 Score =   196 bits (498),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 124/168 (74%), Gaps = 5/168 (3%)
 Frame = +1

Query  91   KTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSI  270
            + + S    P+ +VAL VP +DDP+LPVLTFR WFLG  SC++L FLN FF YR +PLSI
Sbjct  35   EISESDENSPIPQVALTVPTSDDPSLPVLTFRMWFLGTLSCVLLSFLNQFFWYRKEPLSI  94

Query  271  SAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGG  450
            +AI  QI+V+P+G+ MA+ + +R F    RW F+LNPGPFN+KEHV+IT+ AN     G 
Sbjct  95   TAISAQIAVVPLGRLMASKITDRVFKG-KRWEFSLNPGPFNVKEHVLITIFANS----GA  149

Query  451  GDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            G  Y+I  +T++K +YKQ L+F   LI+V+TTQ++G+GWAG+ R+YLV
Sbjct  150  GSVYAIHVVTVVKTFYKQHLTFFVSLIVVVTTQVLGFGWAGIFRKYLV  197



>ref|XP_010538850.1| PREDICTED: oligopeptide transporter 7 [Tarenaya hassleriana]
Length=757

 Score =   196 bits (498),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 121/161 (75%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              P+ +VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PL+ISAI  QI
Sbjct  44   NSPIRQVALTVPTTDDPSLPVLTFRMWVLGTVSCVVLSFLNQFFWYRTEPLTISAISAQI  103

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +V+P+G+ MAA L ++ F    +W F+LNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  104  AVVPLGRLMAAKLSDKVFLRGSKWEFSLNPGPFNVKEHVLITIFANA----GAGSVYAIH  159

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +T++KA+Y + ++F   LI+++TTQ++G+GWAG+ RRYLV
Sbjct  160  VVTVVKAFYMKNITFFVSLIVIITTQVLGFGWAGIFRRYLV  200



>ref|XP_010029951.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
 gb|KCW56909.1| hypothetical protein EUGRSUZ_I02585 [Eucalyptus grandis]
Length=746

 Score =   196 bits (498),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 123/171 (72%), Gaps = 2/171 (1%)
 Frame = +1

Query  88   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  267
            + T       P+EEV L V   DDP+LPV TFR WFLG+ SC +L FLN FF YRT+PL 
Sbjct  21   DGTVDKDDLSPIEEVRLTVSNADDPSLPVWTFRMWFLGLLSCALLSFLNQFFAYRTEPLV  80

Query  268  ISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVS  441
            I+ I +Q++ LPIG+FMAA LPE KF     G   F+LNPGPFN+KEHV+I++ AN G +
Sbjct  81   ITQITVQVATLPIGRFMAAALPEAKFQIPGLGPRLFSLNPGPFNMKEHVLISIFANAGSA  140

Query  442  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             G G AY +G + I+KA+Y + +SF  G ++++TTQ++GYGWAG+LR+Y+V
Sbjct  141  FGSGSAYGVGIVNIIKAFYHRGISFFAGWLLIITTQVLGYGWAGLLRKYVV  191



>ref|XP_009765351.1| PREDICTED: oligopeptide transporter 7-like [Nicotiana sylvestris]
Length=757

 Score =   196 bits (498),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 124/169 (73%), Gaps = 4/169 (2%)
 Frame = +1

Query  88   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  267
            ++        P+++VAL VP TDDP+LPVLTFR WFLG  SC++L FLN FF YRT+PL+
Sbjct  36   KQEEDEEENSPIKQVALTVPITDDPSLPVLTFRMWFLGTVSCVLLSFLNQFFWYRTEPLT  95

Query  268  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  447
            I+AI  QI+V+P+G+ MAA + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G
Sbjct  96   ITAISAQIAVVPLGQLMAAKITKRVFFQGSKWEFTLNPGPFNVKEHVLITIFANS----G  151

Query  448  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             G  Y+I  +T +K +Y++ ++F   LI+V+TTQ++G+GWAG+ RRYLV
Sbjct  152  AGTVYAIHVVTAVKVFYQKNITFFVSLIVVITTQVLGFGWAGIFRRYLV  200



>ref|XP_008237085.1| PREDICTED: oligopeptide transporter 4-like [Prunus mume]
Length=747

 Score =   196 bits (498),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 122/168 (73%), Gaps = 2/168 (1%)
 Frame = +1

Query  97   APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISA  276
            A      P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ 
Sbjct  26   AEDDDVSPIEQVRLTVTNTDDPTLPVWTFRMWFLGLLSCALLSFLNQFFSYRTEPLIITQ  85

Query  277  ILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGG  450
            I +Q+S LPIG FMA  LP  KF    FG  SF+LNPGPFNIKEHV++T+ AN G + G 
Sbjct  86   ITVQVSALPIGHFMAKVLPTNKFHIPGFGSRSFSLNPGPFNIKEHVLVTIFANAGSAFGV  145

Query  451  GDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            G AY++G +TI+K +Y + +S L   ++++TTQ++GYGWAG+LR+Y+V
Sbjct  146  GSAYAVGIVTIIKVFYGRKISLLASWLLIITTQVLGYGWAGLLRKYVV  193



>ref|XP_008349603.1| PREDICTED: oligopeptide transporter 5-like [Malus domestica]
Length=400

 Score =   190 bits (483),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 116/161 (72%), Gaps = 5/161 (3%)
 Frame = +1

Query  115  CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQIS  294
             P+EEV L VP TDDP+ P LTFR W LGI SC+IL F+N FF +RT  LS+S++  QI 
Sbjct  35   SPIEEVWLTVPITDDPSQPTLTFRTWVLGILSCVILSFVNEFFGFRTNQLSVSSVSAQIV  94

Query  295  VLPIGKFMAATLPERKF-APFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            VLP+GK MAATLP RKF  PF +WSFT+NPGPFN+KEHV+IT+ AN     G G  Y++ 
Sbjct  95   VLPLGKLMAATLPTRKFRVPFTKWSFTMNPGPFNLKEHVLITIFANS----GAGGVYAVH  150

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             ITI+KA+Y +        ++  TTQ++GYGWAG+ R+YLV
Sbjct  151  IITIVKAFYHRKQHPAAAFLLAQTTQMLGYGWAGLFRKYLV  191



>ref|XP_002283691.1| PREDICTED: oligopeptide transporter 2 [Vitis vinifera]
Length=740

 Score =   196 bits (497),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 124/161 (77%), Gaps = 2/161 (1%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+EEV L VP TDDP+LPV TFR WFLG+ SC++L FLNTFF YRT+PL I+ I +Q++ 
Sbjct  25   PIEEVRLTVPTTDDPSLPVWTFRMWFLGLISCVLLSFLNTFFGYRTEPLVITMISVQVAT  84

Query  298  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            LP+G+FMA  LP+ KF    FG   ++LNPGPFN+KEHV+I++ AN G + G G AY+I 
Sbjct  85   LPVGRFMAKVLPKTKFRVPGFGSREYSLNPGPFNVKEHVLISIFANAGAAFGSGTAYAIS  144

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             + I+KA+Y + +SF    I+V+TTQ++GYGWAG+LR+++V
Sbjct  145  IVDIIKAFYHREISFSACWILVITTQVLGYGWAGILRKFVV  185



>gb|ABE65610.1| oligopeptide transporter OPT family protein [Arabidopsis thaliana]
Length=734

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 119/164 (73%), Gaps = 1/164 (1%)
 Frame = +1

Query  103  SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAIL  282
                 PVE+V L V   DDP+LPV TFR WFLG+ SCI+L FLNTFF YRTQPL I+ I 
Sbjct  16   DDDESPVEQVRLTVSNHDDPSLPVWTFRMWFLGLLSCILLSFLNTFFGYRTQPLMITMIS  75

Query  283  MQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAY  462
            +Q+  LP+GK MA  LPE K+   G W F+ NPGPFN+KEHV+I++ AN G   G G AY
Sbjct  76   VQVVTLPLGKLMARVLPETKYK-IGSWEFSFNPGPFNVKEHVLISMFANAGAGFGSGTAY  134

Query  463  SIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            ++G + I+ A+YK+ +SFL   I+V+TTQ++GYGWAG++R+ +V
Sbjct  135  AVGIVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVV  178



>ref|XP_006364984.1| PREDICTED: oligopeptide transporter 2-like isoform X1 [Solanum 
tuberosum]
Length=737

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 121/159 (76%), Gaps = 1/159 (1%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+E+V L V   DDP+LPV TFR WFLG+ SC +L FLNTFF YR +PL IS I +Q++ 
Sbjct  24   PIEQVRLTVSNDDDPSLPVWTFRMWFLGLLSCALLSFLNTFFSYRAEPLVISMITVQVAT  83

Query  298  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  477
            LPIG+ MA  LP+RKF     W F+LNPGPFN+KEHV+I++ AN G + G G AY++G +
Sbjct  84   LPIGRLMAKVLPKRKFT-IKSWEFSLNPGPFNVKEHVLISIFANAGSAFGNGPAYAVGIV  142

Query  478  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             I+KA+Y + ++FL G I+V+ TQ++GYGWAG++R+Y+V
Sbjct  143  DIIKAFYFRNITFLAGWILVVATQVLGYGWAGIMRKYVV  181



>ref|XP_010676881.1| PREDICTED: oligopeptide transporter 7 [Beta vulgaris subsp. vulgaris]
Length=754

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 125/186 (67%), Gaps = 4/186 (2%)
 Frame = +1

Query  37   SEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCI  216
             EH   E +  +       +  S    PV++VAL VP TDDP LPVLTFR W LG+ SCI
Sbjct  16   DEHHQDEKNEESQRLISSSSTKSTENSPVKQVALTVPITDDPELPVLTFRTWVLGMVSCI  75

Query  217  ILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNI  396
            +L FLN FF YRT+PLS++ I  QI+V+P+G +MA+ LP        RW F++NPGPFN+
Sbjct  76   VLSFLNQFFWYRTEPLSVTGIAAQIAVVPLGHWMASNLPNGSLFRGTRWEFSMNPGPFNV  135

Query  397  KEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGV  576
            KEHV+IT+ AN     G G  Y+I  +T +K +YK+ ++F   L++VLTTQ++G+GWAGV
Sbjct  136  KEHVLITIFANA----GAGTVYAIHVVTAVKIFYKKNITFFVSLLVVLTTQVLGFGWAGV  191

Query  577  LRRYLV  594
             RRYLV
Sbjct  192  FRRYLV  197



>ref|NP_172464.1| oligopeptide transporter 2 [Arabidopsis thaliana]
 sp|O04514.2|OPT2_ARATH RecName: Full=Oligopeptide transporter 2; Short=AtOPT2 [Arabidopsis 
thaliana]
 gb|AEE28515.1| oligopeptide transporter 2 [Arabidopsis thaliana]
Length=734

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              PVE+V L V   DDP+LPV TFR WFLG+ SCI+L FLNTFF YRTQPL I+ I +Q+
Sbjct  19   ESPVEQVRLTVSNHDDPSLPVWTFRMWFLGLLSCILLSFLNTFFGYRTQPLMITMISVQV  78

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
              LP+GK MA  LPE K+   G W F+ NPGPFN+KEHV+I++ AN G   G G AY++G
Sbjct  79   VTLPLGKLMARVLPETKYK-IGSWEFSFNPGPFNVKEHVLISMFANAGAGFGSGTAYAVG  137

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             + I+ A+YK+ +SFL   I+V+TTQ++GYGWAG++R+ +V
Sbjct  138  IVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVV  178



>ref|XP_009615073.1| PREDICTED: oligopeptide transporter 4-like [Nicotiana tomentosiformis]
Length=753

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 124/171 (73%), Gaps = 2/171 (1%)
 Frame = +1

Query  88   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  267
            E+         +EEV L VP TDDPTLPV TFR W LG+ SCI+L FLN FF YR +PL 
Sbjct  15   EEDVNEDELSSIEEVRLTVPNTDDPTLPVWTFRMWILGLLSCILLSFLNQFFSYRKEPLI  74

Query  268  ISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVS  441
            I+ I +Q++ LPIG+FMAA LP  KF    FG   F+LNPGPFN+KEHV+IT+ AN G +
Sbjct  75   ITQITVQVATLPIGRFMAAVLPTTKFRILGFGSKEFSLNPGPFNMKEHVLITIFANAGSA  134

Query  442  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             G G AY++G + I+KA+Y +++SF    ++++TTQ++GYGWAG+LR+Y+V
Sbjct  135  FGNGSAYAVGIVNIIKAFYGRSISFGASWLLIITTQVLGYGWAGLLRKYVV  185



>ref|XP_002437735.1| hypothetical protein SORBIDRAFT_10g001530 [Sorghum bicolor]
 gb|EER89102.1| hypothetical protein SORBIDRAFT_10g001530 [Sorghum bicolor]
Length=785

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 122/171 (71%), Gaps = 4/171 (2%)
 Frame = +1

Query  82   AGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQP  261
            + + ++  G   P+E+VAL VP  DDPT PVLTFR W LG  SC +L FLN FF YR +P
Sbjct  60   SDDLSSSEGENSPIEQVALTVPVGDDPTTPVLTFRMWVLGTASCALLSFLNQFFWYRKEP  119

Query  262  LSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVS  441
            L+I+AI  QI+V+P+G+ MAA LPER F    RW F+LNPGPFN+KEHV+IT+ AN    
Sbjct  120  LTITAISAQIAVVPLGRLMAAALPERAFLRGTRWEFSLNPGPFNVKEHVLITIFANS---  176

Query  442  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             G G  Y+I  IT ++ +Y + ++F   L++VLTTQ++G+GWAG+ RRYLV
Sbjct  177  -GAGTVYAIHVITAVRVFYGKNITFFVSLLVVLTTQVLGFGWAGIFRRYLV  226



>ref|XP_004288878.1| PREDICTED: oligopeptide transporter 2-like [Fragaria vesca subsp. 
vesca]
Length=746

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+E+V L V   DDP+LPV TFR W +G+ SC++L F+NTFF YRT+PL IS I +Q++ 
Sbjct  34   PIEQVRLTVSNDDDPSLPVWTFRMWSIGLLSCVLLSFVNTFFSYRTEPLVISMITIQVAS  93

Query  298  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  477
            LPIGKFMA TLP RKF   G   F+LNPG FNIKEHV+I++ AN G   G G AY+IG +
Sbjct  94   LPIGKFMARTLPTRKFR-IGSKEFSLNPGEFNIKEHVLISIFANTGAGFGSGPAYAIGIV  152

Query  478  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            TI+KA+Y + +SFL   I+V+TTQ++GYGWAG+LR+Y+V
Sbjct  153  TIVKAFYGRRISFLASWILVITTQVLGYGWAGILRKYVV  191



>emb|CBI19303.3| unnamed protein product [Vitis vinifera]
Length=859

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 124/161 (77%), Gaps = 2/161 (1%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+EEV L VP TDDP+LPV TFR WFLG+ SC++L FLNTFF YRT+PL I+ I +Q++ 
Sbjct  144  PIEEVRLTVPTTDDPSLPVWTFRMWFLGLISCVLLSFLNTFFGYRTEPLVITMISVQVAT  203

Query  298  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            LP+G+FMA  LP+ KF    FG   ++LNPGPFN+KEHV+I++ AN G + G G AY+I 
Sbjct  204  LPVGRFMAKVLPKTKFRVPGFGSREYSLNPGPFNVKEHVLISIFANAGAAFGSGTAYAIS  263

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             + I+KA+Y + +SF    I+V+TTQ++GYGWAG+LR+++V
Sbjct  264  IVDIIKAFYHREISFSACWILVITTQVLGYGWAGILRKFVV  304



>emb|CDP00949.1| unnamed protein product [Coffea canephora]
Length=752

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 124/164 (76%), Gaps = 3/164 (2%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              PVE+V L V   DDP+LPV TFR WFLG+ SC++L FLNTFF YR+QPL+I+ I  Q+
Sbjct  33   ESPVEQVRLTVSNHDDPSLPVWTFRMWFLGLLSCVLLSFLNTFFGYRSQPLTITMISAQV  92

Query  292  SVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYS  465
            + LP+G+FMA  LP++KF    FG   F+LNPGPFN+KEH +I+V AN G S GGG AY+
Sbjct  93   ATLPLGRFMAKVLPKKKFRIPGFGSRQFSLNPGPFNMKEHALISVFANAGSSFGGGTAYA  152

Query  466  IGAITIMKAYYKQALSFLCGLIIVLTT-QLIGYGWAGVLRRYLV  594
            I  +TI++A+Y + +SFL   I+V TT Q++GYGWAG++RRY+V
Sbjct  153  IDIVTIVRAFYHRRISFLASWILVTTTQQVLGYGWAGIMRRYVV  196



>gb|KJB58808.1| hypothetical protein B456_009G227000 [Gossypium raimondii]
Length=754

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 132/189 (70%), Gaps = 12/189 (6%)
 Frame = +1

Query  34   LSEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSC  213
            L+E +V E   ++ +             P+E+V L VP+TDDP+LPV TFR WFLG+ SC
Sbjct  12   LAEEVVKEEGEMDESEVS----------PIEQVRLTVPDTDDPSLPVWTFRMWFLGLFSC  61

Query  214  IILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGP  387
             +L FLN FF YRT+PL I+ I +Q++ LPIG+FMA+ LP  KF    FG   F+LNPGP
Sbjct  62   ALLSFLNQFFGYRTEPLVITQITVQVATLPIGRFMASALPATKFRIPGFGSKEFSLNPGP  121

Query  388  FNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGW  567
            FN+KEHV+IT+ AN G   G G  Y++  +TI+KA+Y +++SF    ++++TTQ++GYGW
Sbjct  122  FNMKEHVLITIFANAGSGFGNGTVYAVSIVTIIKAFYGRSISFFSSWLLIMTTQVMGYGW  181

Query  568  AGVLRRYLV  594
            AG+LR+Y+V
Sbjct  182  AGILRKYVV  190



>gb|KJB58807.1| hypothetical protein B456_009G227000 [Gossypium raimondii]
Length=754

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 132/189 (70%), Gaps = 12/189 (6%)
 Frame = +1

Query  34   LSEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSC  213
            L+E +V E   ++ +             P+E+V L VP+TDDP+LPV TFR WFLG+ SC
Sbjct  12   LAEEVVKEEGEMDESEVS----------PIEQVRLTVPDTDDPSLPVWTFRMWFLGLFSC  61

Query  214  IILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGP  387
             +L FLN FF YRT+PL I+ I +Q++ LPIG+FMA+ LP  KF    FG   F+LNPGP
Sbjct  62   ALLSFLNQFFGYRTEPLVITQITVQVATLPIGRFMASALPATKFRIPGFGSKEFSLNPGP  121

Query  388  FNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGW  567
            FN+KEHV+IT+ AN G   G G  Y++  +TI+KA+Y +++SF    ++++TTQ++GYGW
Sbjct  122  FNMKEHVLITIFANAGSGFGNGTVYAVSIVTIIKAFYGRSISFFSSWLLIMTTQVMGYGW  181

Query  568  AGVLRRYLV  594
            AG+LR+Y+V
Sbjct  182  AGILRKYVV  190



>emb|CDY31321.1| BnaA02g34200D [Brassica napus]
Length=729

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 124/161 (77%), Gaps = 2/161 (1%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+EEV L V  TDD TLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  14   PIEEVRLTVTNTDDHTLPVWTFRMWFLGLISCALLSFLNQFFSYRTEPLVITQITVQVAT  73

Query  298  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            LPIG F+A  LP+ +F    FG   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  74   LPIGHFLAKVLPKTQFGIPGFGSTRFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  133

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +TI+KA+Y++ +SF+ G ++++TTQ++GYGWAG+LR+Y+V
Sbjct  134  IVTIIKAFYRKNISFIAGWLLIITTQVLGYGWAGLLRKYVV  174



>ref|XP_009608843.1| PREDICTED: oligopeptide transporter 7-like [Nicotiana tomentosiformis]
Length=757

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 124/169 (73%), Gaps = 4/169 (2%)
 Frame = +1

Query  88   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  267
            ++        P+++VAL VP TDDP+LPVLTFR WFLG  SC++L FLN FF YRT+PL+
Sbjct  36   KQEEDEEENSPIKQVALTVPITDDPSLPVLTFRMWFLGTLSCVLLSFLNQFFWYRTEPLT  95

Query  268  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  447
            I+AI  QI+V+P+G+ MAA + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G
Sbjct  96   ITAISAQIAVVPLGQLMAAKITKRVFFQGSKWEFTLNPGPFNVKEHVLITIFANS----G  151

Query  448  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             G  Y+I  +T +K +Y++ ++F   LI+V+TTQ++G+GWAG+ RRYLV
Sbjct  152  AGTVYAIHVVTAVKVFYQKNITFFVSLIVVITTQVLGFGWAGIFRRYLV  200



>ref|XP_009130453.1| PREDICTED: oligopeptide transporter 4 [Brassica rapa]
Length=729

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 124/161 (77%), Gaps = 2/161 (1%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+EEV L V  TDD TLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  14   PIEEVRLTVTNTDDHTLPVWTFRMWFLGLISCALLSFLNQFFSYRTEPLVITQITVQVAT  73

Query  298  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            LPIG F+A  LP+ +F    FG   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  74   LPIGHFLAKVLPKTQFGIPGFGSTRFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  133

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +TI+KA+Y++ +SF+ G ++++TTQ++GYGWAG+LR+Y+V
Sbjct  134  IVTIIKAFYRKNISFIAGWLLIITTQVLGYGWAGLLRKYVV  174



>ref|XP_010267481.1| PREDICTED: oligopeptide transporter 7-like [Nelumbo nucifera]
Length=734

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 128/179 (72%), Gaps = 4/179 (2%)
 Frame = +1

Query  58   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  237
            M+G   ++  E  +P  G   +++VAL VP TDD ++PVLTFR W LG+ SC++L FLN 
Sbjct  1    MTGNPLSSEMEMESPESGNSTIKQVALTVPTTDDSSIPVLTFRMWVLGLVSCVLLSFLNQ  60

Query  238  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  417
            FF YRT+P+SI+A+  QI+V+P+G  MA+T+ +R F    RW FT+NPGPFN+KEHV+IT
Sbjct  61   FFWYRTEPISITALSAQIAVVPLGHLMASTITKRVFFKGSRWEFTMNPGPFNVKEHVLIT  120

Query  418  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            + AN     G G  Y+   ++ +K YYK+ L+F   L+I+LTTQ++G+GWAG+ RRYLV
Sbjct  121  IFANA----GAGTVYATHILSAIKLYYKRKLTFFPALLIILTTQILGFGWAGMFRRYLV  175



>emb|CDY46800.1| BnaC02g43080D [Brassica napus]
Length=729

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 124/161 (77%), Gaps = 2/161 (1%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+EEV L V  TDD TLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  14   PIEEVRLTVTNTDDHTLPVWTFRMWFLGLISCALLSFLNQFFSYRTEPLVITQITVQVAT  73

Query  298  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            LPIG F+A  LP+ +F    FG   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  74   LPIGHFLAKVLPKTQFGIPGFGSTRFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  133

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +TI+KA+Y++ +SF+ G ++++TTQ++GYGWAG+LR+Y+V
Sbjct  134  IVTIIKAFYRKNISFIAGWLLIITTQVLGYGWAGLLRKYVV  174



>ref|XP_007210345.1| hypothetical protein PRUPE_ppa001827mg [Prunus persica]
 gb|EMJ11544.1| hypothetical protein PRUPE_ppa001827mg [Prunus persica]
Length=760

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 119/161 (74%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              PVE+VAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YR +PLSI+AI  QI
Sbjct  49   NSPVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRKEPLSITAISAQI  108

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +V+P+G+ MA+ +    F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  109  AVVPLGQLMASKITTHAFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  164

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +T++K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV
Sbjct  165  IVTVVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLV  205



>gb|EMT31419.1| Oligopeptide transporter 7 [Aegilops tauschii]
Length=218

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 123/182 (68%), Gaps = 7/182 (4%)
 Frame = +1

Query  58   MSGLNPATAGEKTAPSGG---RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIF  228
            M+ ++P      T+P        P+E+VAL VP  DDP  P+LTFR W LG+ S  +L F
Sbjct  1    MATVSPRRTLPSTSPDEEEEENSPIEQVALTVPVGDDPDTPLLTFRMWVLGMASRAVLSF  60

Query  229  LNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHV  408
            LN FF YR +PL+I+AI  QI+V+P+G+ MAA LPER F     + FTLNPGPFN+KEHV
Sbjct  61   LNQFFWYRKEPLTITAISAQIAVVPLGRLMAAALPERAFFRGRPYEFTLNPGPFNVKEHV  120

Query  409  IITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRY  588
            +IT+ AN     G G  Y+I  +T ++ +Y + L+F   L++VLTTQ++G+GWAG+ RRY
Sbjct  121  LITIFANA----GAGTVYAIHVVTAVRVFYGKNLTFFASLLVVLTTQVLGFGWAGIFRRY  176

Query  589  LV  594
            LV
Sbjct  177  LV  178



>ref|XP_010065749.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
Length=756

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 127/177 (72%), Gaps = 2/177 (1%)
 Frame = +1

Query  70   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  249
             P    +         P+E+V L+V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  25   KPVAPNDVDDAEDDLSPIEQVRLIVTNTDDPTLPVWTFRMWFLGVLSCALLSFLNQFFAY  84

Query  250  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFG--RWSFTLNPGPFNIKEHVIITVM  423
            RT+PL I+ I +Q++ LPIG+FMAA LP  +F   G  R +F+LNPGPFN+KEHV+I++ 
Sbjct  85   RTEPLVITQITVQVATLPIGRFMAAVLPTAEFRIPGLRRRTFSLNPGPFNMKEHVLISIF  144

Query  424  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            AN G + G G AY++G + I+KA+Y +++SF  G ++++TTQ++GYGWAG+LR+Y V
Sbjct  145  ANAGSAFGSGPAYAVGIVNIIKAFYLRSISFFAGWLLIITTQVLGYGWAGLLRKYAV  201



>ref|XP_008803573.1| PREDICTED: oligopeptide transporter 4-like isoform X3 [Phoenix 
dactylifera]
Length=600

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 131/185 (71%), Gaps = 8/185 (4%)
 Frame = +1

Query  58   MSGLNPATAGEKTAPSGGR----CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILI  225
            M+    A   EKTA  GG      P+E+V L VP TD+PTLPV TFR WF+GI SC ++ 
Sbjct  26   MTATVSAMDVEKTA--GGDEEEVSPIEQVRLTVPTTDNPTLPVWTFRMWFIGILSCSLMS  83

Query  226  FLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIK  399
            FLN FF YRT+PL I+ I +Q++ LP+G F+A  LP  KF    FG   F+LNPGPFN+K
Sbjct  84   FLNQFFSYRTEPLIITQISIQVASLPVGHFLARVLPAAKFRLPGFGDRQFSLNPGPFNMK  143

Query  400  EHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVL  579
            EHV+I++ AN G + G G AY +G + I++A+YK+ +SF  G I+++TTQ++GYGWAG++
Sbjct  144  EHVLISIFANAGYAFGNGPAYGVGIVNIIRAFYKRTISFTAGWILIITTQVLGYGWAGLM  203

Query  580  RRYLV  594
            R+Y+V
Sbjct  204  RKYVV  208



>gb|AAM64614.1| Isp4-like protein [Arabidopsis thaliana]
Length=729

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 129/175 (74%), Gaps = 4/175 (2%)
 Frame = +1

Query  76   ATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  255
            ATA E +       P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT
Sbjct  2    ATADEFSDED--TSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRT  59

Query  256  QPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMAN  429
            +PL I+ I +Q++ LPIG F+A  LP+ +F     G   F+LNPGPFN+KEHV+I++ AN
Sbjct  60   EPLVITQITVQVATLPIGHFLAKVLPKTRFGLPGCGSARFSLNPGPFNMKEHVLISIFAN  119

Query  430  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             G + G G AY++G ITI+KA+Y +++SF+ G ++++TTQ++GYGWAG+LR+Y+V
Sbjct  120  AGSAFGSGSAYAVGIITIIKAFYGRSISFIAGWLLIITTQVLGYGWAGLLRKYVV  174



>ref|NP_201246.1| oligopeptide transporter 4 [Arabidopsis thaliana]
 sp|Q9FME8.1|OPT4_ARATH RecName: Full=Oligopeptide transporter 4; Short=AtOPT4 [Arabidopsis 
thaliana]
 dbj|BAB09872.1| Isp4-like protein [Arabidopsis thaliana]
 gb|AAM20694.1| Isp4-like protein [Arabidopsis thaliana]
 gb|AAN15658.1| Isp4-like protein [Arabidopsis thaliana]
 dbj|BAE99084.1| Isp4-like protein [Arabidopsis thaliana]
 gb|AED97890.1| oligopeptide transporter 4 [Arabidopsis thaliana]
Length=729

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 129/175 (74%), Gaps = 4/175 (2%)
 Frame = +1

Query  76   ATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  255
            ATA E +       P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT
Sbjct  2    ATADEFSDED--TSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRT  59

Query  256  QPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMAN  429
            +PL I+ I +Q++ LPIG F+A  LP+ +F     G   F+LNPGPFN+KEHV+I++ AN
Sbjct  60   EPLVITQITVQVATLPIGHFLAKVLPKTRFGLPGCGSARFSLNPGPFNMKEHVLISIFAN  119

Query  430  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             G + G G AY++G ITI+KA+Y +++SF+ G ++++TTQ++GYGWAG+LR+Y+V
Sbjct  120  AGSAFGSGSAYAVGIITIIKAFYGRSISFIAGWLLIITTQVLGYGWAGLLRKYVV  174



>ref|XP_008803572.1| PREDICTED: oligopeptide transporter 4-like isoform X2 [Phoenix 
dactylifera]
Length=606

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 131/185 (71%), Gaps = 8/185 (4%)
 Frame = +1

Query  58   MSGLNPATAGEKTAPSGGR----CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILI  225
            M+    A   EKTA  GG      P+E+V L VP TD+PTLPV TFR WF+GI SC ++ 
Sbjct  26   MTATVSAMDVEKTA--GGDEEEVSPIEQVRLTVPTTDNPTLPVWTFRMWFIGILSCSLMS  83

Query  226  FLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIK  399
            FLN FF YRT+PL I+ I +Q++ LP+G F+A  LP  KF    FG   F+LNPGPFN+K
Sbjct  84   FLNQFFSYRTEPLIITQISIQVASLPVGHFLARVLPAAKFRLPGFGDRQFSLNPGPFNMK  143

Query  400  EHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVL  579
            EHV+I++ AN G + G G AY +G + I++A+YK+ +SF  G I+++TTQ++GYGWAG++
Sbjct  144  EHVLISIFANAGYAFGNGPAYGVGIVNIIRAFYKRTISFTAGWILIITTQVLGYGWAGLM  203

Query  580  RRYLV  594
            R+Y+V
Sbjct  204  RKYVV  208



>ref|XP_006397011.1| hypothetical protein EUTSA_v10028453mg [Eutrema salsugineum]
 gb|ESQ38464.1| hypothetical protein EUTSA_v10028453mg [Eutrema salsugineum]
Length=764

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 127/180 (71%), Gaps = 5/180 (3%)
 Frame = +1

Query  55   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  234
            E  GL    +G+ +       P+ +VAL VP TDDP+LPVLTFR W LG  SCI+L FLN
Sbjct  34   ETEGLCLPISGD-SGEDEENSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLN  92

Query  235  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  414
             FF YRT+PL+ISAI  QI+V+P+G+ MAA + +R F    +W FTLNPGPFN+KEHV+I
Sbjct  93   QFFWYRTEPLTISAISAQIAVVPLGRLMAAKISDRVFLQGSKWEFTLNPGPFNVKEHVLI  152

Query  415  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            T+ AN     G G  Y+I  +T+++A+Y + L+F    I+++TTQ++G+GWAG+ R+YLV
Sbjct  153  TIFANA----GAGSVYAIHIVTVVRAFYMKNLTFFVSFIVIVTTQVLGFGWAGIFRKYLV  208



>gb|EEE68909.1| hypothetical protein OsJ_27765 [Oryza sativa Japonica Group]
Length=702

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 123/181 (68%), Gaps = 5/181 (3%)
 Frame = +1

Query  55   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  234
              S  NP +  EKT      CP+EEV L VP TDDP LP LTFR W LG+ SC +L F N
Sbjct  14   HRSSENPESRDEKTEEEVDDCPIEEVRLTVPITDDPALPALTFRTWLLGLISCAMLAFSN  73

Query  235  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGR-WSFTLNPGPFNIKEHVI  411
             FF YR  PL IS++ +QI VLP+GK MAA LP++ F   G  WSF+LNPGPFN+KEHV+
Sbjct  74   QFFGYRQNPLYISSLSVQIVVLPLGKLMAACLPKKVFRVKGTAWSFSLNPGPFNLKEHVL  133

Query  412  ITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYL  591
            IT+ AN     G    Y++G ITI+KA+Y++ +  L  +++  TTQL+GYGWAG+ R++L
Sbjct  134  ITIFANT----GSNSVYAVGIITIVKAFYRREIHPLAAMLLTQTTQLMGYGWAGLFRKFL  189

Query  592  V  594
            V
Sbjct  190  V  190



>gb|KHG27446.1| Oligopeptide transporter 4 -like protein [Gossypium arboreum]
Length=755

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 135/199 (68%), Gaps = 14/199 (7%)
 Frame = +1

Query  4    KLSQTVPAQ*LSEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTF  183
            ++  TVP   L+E +V E   ++               P+E+V L VP TDDP+LPV TF
Sbjct  5    EIEATVPK--LAEEVVKEEGEMDEIEV----------SPIEQVRLTVPNTDDPSLPVWTF  52

Query  184  RAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFG  357
            R WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ LPIG+FMA+ LP  KF    FG
Sbjct  53   RMWFLGLFSCALLSFLNQFFGYRTEPLVITQITVQVATLPIGRFMASALPATKFRIPGFG  112

Query  358  RWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIV  537
               F+LNPGPFN+KEHV+IT+ AN G   G G  Y++  +TI+KA+Y +++SF    +++
Sbjct  113  SKEFSLNPGPFNMKEHVLITIFANAGSGFGNGTVYAVSIVTIIKAFYGRSISFFSSWLLI  172

Query  538  LTTQLIGYGWAGVLRRYLV  594
            +TTQ++GYGWAG+LR+Y+V
Sbjct  173  MTTQVMGYGWAGILRKYVV  191



>gb|KCW63396.1| hypothetical protein EUGRSUZ_G01042, partial [Eucalyptus grandis]
Length=720

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 125/161 (78%), Gaps = 2/161 (1%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+E+V L+V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  5    PIEQVRLIVTNTDDPTLPVWTFRMWFLGVLSCALLSFLNQFFAYRTEPLVITQITVQVAT  64

Query  298  LPIGKFMAATLPERKFAPFG--RWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            LPIG+FMAA LP  +F   G  R +F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  65   LPIGRFMAAVLPTAEFRIPGLRRRTFSLNPGPFNMKEHVLISIFANAGSAFGSGPAYAVG  124

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             + I+KA+Y +++SF  G ++++TTQ++GYGWAG+LR+Y V
Sbjct  125  IVNIIKAFYLRSISFFAGWLLIITTQVLGYGWAGLLRKYAV  165



>ref|XP_010461766.1| PREDICTED: oligopeptide transporter 4-like [Camelina sativa]
Length=729

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 124/161 (77%), Gaps = 2/161 (1%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  14   PIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRTEPLVITQITVQVAT  73

Query  298  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            LPIG F+A  LP+ +F     G   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  74   LPIGHFLAKVLPKTRFGLPGCGSTRFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  133

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             ITI+KA+Y++ +SF+ G ++++TTQ++GYGWAG+LR+Y+V
Sbjct  134  IITIIKAFYRRNISFVAGWLLIITTQVLGYGWAGLLRKYVV  174



>ref|XP_010444374.1| PREDICTED: oligopeptide transporter 4-like [Camelina sativa]
Length=729

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 124/161 (77%), Gaps = 2/161 (1%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  14   PIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRTEPLVITQITVQVAT  73

Query  298  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            LPIG F+A  LP+ +F     G   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  74   LPIGHFLAKVLPKTRFGLPGCGSTRFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  133

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             ITI+KA+Y++ +SF+ G ++++TTQ++GYGWAG+LR+Y+V
Sbjct  134  IITIIKAFYRRNISFVAGWLLIITTQVLGYGWAGLLRKYVV  174



>ref|XP_004147543.1| PREDICTED: oligopeptide transporter 4-like [Cucumis sativus]
 ref|XP_004170983.1| PREDICTED: oligopeptide transporter 4-like [Cucumis sativus]
Length=738

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 127/176 (72%), Gaps = 2/176 (1%)
 Frame = +1

Query  73   PATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  252
            P +  +  A      P+E+V L V  +DDPTLPV TFR W LG+ SC +L FLN FF YR
Sbjct  8    PLSGSDPAADDDDISPIEQVRLTVTNSDDPTLPVWTFRMWTLGLLSCALLSFLNQFFYYR  67

Query  253  TQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMA  426
            T+PL I+ I +Q++ LPIG+FMAA LP  +F    FG   F+LNPGPFN+KEHV+I++ A
Sbjct  68   TEPLIITQITVQVATLPIGQFMAAVLPASRFRLPGFGSRRFSLNPGPFNMKEHVLISIFA  127

Query  427  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            N G + GGG AY++G + I+KA+Y + +SF+   ++++TTQ++GYGWAG+LR+Y+V
Sbjct  128  NAGTAFGGGSAYAVGIVNIIKAFYGRNISFVAAWLLIVTTQVLGYGWAGLLRKYVV  183



>ref|XP_009601745.1| PREDICTED: oligopeptide transporter 7-like [Nicotiana tomentosiformis]
 ref|XP_009601746.1| PREDICTED: oligopeptide transporter 7-like [Nicotiana tomentosiformis]
Length=732

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 125/176 (71%), Gaps = 7/176 (4%)
 Frame = +1

Query  67   LNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  246
            +N A A E        CP++EV + VP+TDDPT PV+TFR WFLGITSC++L F+N FF 
Sbjct  6    VNMAAANEADE---DLCPIKEVDMTVPKTDDPTTPVVTFRMWFLGITSCVLLSFVNQFFW  62

Query  247  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  426
            YRT+PL+IS+  +QI+V+PIG  MA T+ +R F    RW FTLNPGPFNIKEHV+IT+ A
Sbjct  63   YRTEPLTISSTAVQIAVVPIGHLMAKTITKRVFFEGTRWEFTLNPGPFNIKEHVLITIFA  122

Query  427  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            N     G G  Y+   ++ +K YYK+ LSF   L+I+ TTQ++G+GWAG+ R+ LV
Sbjct  123  NA----GAGSVYATHILSAVKLYYKRPLSFFPALLIMATTQMLGFGWAGIFRKQLV  174



>ref|XP_010484229.1| PREDICTED: oligopeptide transporter 4 [Camelina sativa]
Length=729

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 124/161 (77%), Gaps = 2/161 (1%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  14   PIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRTEPLVITQITVQVAT  73

Query  298  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            LPIG F+A  LP+ +F     G   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  74   LPIGHFLAKVLPKTRFGLPGCGSTRFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  133

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             ITI+KA+Y++ +SF+ G ++++TTQ++GYGWAG+LR+Y+V
Sbjct  134  IITIIKAFYRRDISFVAGWLLIITTQVLGYGWAGLLRKYVV  174



>ref|XP_009132469.1| PREDICTED: oligopeptide transporter 9-like [Brassica rapa]
Length=746

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 126/184 (68%), Gaps = 7/184 (4%)
 Frame = +1

Query  52   VEMSGLNPATAG---EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIIL  222
            V+ S + P+TA    E+      RC VEEV L VP+TDDPTLPVLTFR W LG+ +CIIL
Sbjct  5    VKGSTVKPSTAAMEIEEGVDELDRCAVEEVELTVPKTDDPTLPVLTFRMWVLGLGACIIL  64

Query  223  IFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKE  402
             F+N FF YR  PLSI+ I  QI+V+P+G  MA  LP +K+    RW F +NPGPFN+KE
Sbjct  65   SFINQFFWYRRMPLSITGISAQIAVVPLGHLMARVLPNKKYLEGSRWEFNMNPGPFNVKE  124

Query  403  HVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLR  582
            HV+IT+ AN     G G  Y+   ++ +K YYK++L FL   +I++TTQ +G+GWAG+ R
Sbjct  125  HVMITIFANS----GAGTVYATHILSAIKLYYKRSLPFLPAFLIMITTQFLGFGWAGLFR  180

Query  583  RYLV  594
            ++LV
Sbjct  181  KHLV  184



>gb|KGN53886.1| hypothetical protein Csa_4G179700 [Cucumis sativus]
Length=738

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 127/176 (72%), Gaps = 2/176 (1%)
 Frame = +1

Query  73   PATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  252
            P +  +  A      P+E+V L V  +DDPTLPV TFR W LG+ SC +L FLN FF YR
Sbjct  8    PLSGSDPAADDDDISPIEQVRLTVTNSDDPTLPVWTFRMWTLGLLSCALLSFLNQFFYYR  67

Query  253  TQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMA  426
            T+PL I+ I +Q++ LPIG+FMAA LP  +F    FG   F+LNPGPFN+KEHV+I++ A
Sbjct  68   TEPLIITQITVQVATLPIGQFMAAVLPASRFRLPGFGSRRFSLNPGPFNMKEHVLISIFA  127

Query  427  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            N G + GGG AY++G + I+KA+Y + +SF+   ++++TTQ++GYGWAG+LR+Y+V
Sbjct  128  NAGTAFGGGSAYAVGIVNIIKAFYGRNISFVAAWLLIVTTQVLGYGWAGLLRKYVV  183



>ref|XP_009108224.1| PREDICTED: oligopeptide transporter 7 [Brassica rapa]
Length=765

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 119/159 (75%), Gaps = 4/159 (3%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+ EVAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YR +PLSISAI  QI+V
Sbjct  55   PIREVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRREPLSISAISAQIAV  114

Query  298  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  477
            +P+G+ MAA + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  115  VPLGRLMAAKISDRVFLQGSKWEFTLNPGPFNVKEHVLITIFANA----GAGSVYAIHVV  170

Query  478  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            T++KA+Y + ++F    ++++TTQ++G+GWAG+ R+YLV
Sbjct  171  TVVKAFYMKNITFFVSFVVIVTTQVLGFGWAGIFRKYLV  209



>ref|XP_006280078.1| hypothetical protein CARUB_v10025959mg [Capsella rubella]
 gb|EOA12976.1| hypothetical protein CARUB_v10025959mg [Capsella rubella]
Length=729

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 124/161 (77%), Gaps = 2/161 (1%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  14   PIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRTEPLVITQITVQVAT  73

Query  298  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            LPIG F+A  LP+ +F     G   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  74   LPIGHFLAKVLPKTRFGLPGCGSARFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  133

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             ITI+KA+Y++ +SF+ G ++++TTQ++GYGWAG+LR+Y++
Sbjct  134  IITIIKAFYRRNISFIAGWLLIITTQVLGYGWAGLLRKYVI  174



>emb|CDX86844.1| BnaA09g22340D [Brassica napus]
Length=765

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 119/159 (75%), Gaps = 4/159 (3%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+ EVAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YR +PLSISAI  QI+V
Sbjct  55   PIREVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRREPLSISAISAQIAV  114

Query  298  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  477
            +P+G+ MAA + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  115  VPLGRLMAAKISDRVFLQGSKWEFTLNPGPFNVKEHVLITIFANA----GAGSVYAIHVV  170

Query  478  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            T++KA+Y + ++F    ++++TTQ++G+GWAG+ R+YLV
Sbjct  171  TVVKAFYMKNITFFVSFVVIVTTQVLGFGWAGIFRKYLV  209



>ref|XP_008239237.1| PREDICTED: oligopeptide transporter 7 [Prunus mume]
Length=760

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 119/161 (74%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              PVE+VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YR +PLSI+AI  QI
Sbjct  49   NSPVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRKEPLSITAISAQI  108

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +V+P+G+ MA+ +    F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  109  AVVPLGQLMASKITTHAFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  164

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +T++K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV
Sbjct  165  IVTVVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLV  205



>emb|CDP19590.1| unnamed protein product [Coffea canephora]
Length=751

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 120/161 (75%), Gaps = 2/161 (1%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            PVE+V L VP  DDP++PV TFR WFLGI SC +L FLNTFF YRT+PL I+ I  Q++ 
Sbjct  35   PVEQVRLTVPTHDDPSIPVWTFRMWFLGILSCGLLAFLNTFFGYRTEPLIITMISAQVAT  94

Query  298  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            LP+GKFMA  LPE+KF    FG   F+LNPGPFNIKEH +I++ AN G   G G AY+I 
Sbjct  95   LPVGKFMAKVLPEKKFKIPGFGSREFSLNPGPFNIKEHALISIFANTGSGFGSGAAYAIS  154

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             + I+K +Y + +SFL   I+V+TTQ++GYGWAG++R+Y+V
Sbjct  155  IVDIVKVFYHRKISFLASWILVVTTQVLGYGWAGIIRKYVV  195



>ref|XP_002303684.2| hypothetical protein POPTR_0003s14540g [Populus trichocarpa]
 gb|EEE78663.2| hypothetical protein POPTR_0003s14540g [Populus trichocarpa]
Length=800

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 125/178 (70%), Gaps = 4/178 (2%)
 Frame = +1

Query  61   SGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTF  240
            S     T+    A      PV++VAL VP TDDP+LPVLTFR W LG  SC++L FLN F
Sbjct  70   SSSKSQTSEINQAHDEENSPVKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQF  129

Query  241  FIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITV  420
            F YRT+PLSI+AI  QI+V+P+G+ MAA + +R F    R  FTLNPGPFN+KEHV+IT+
Sbjct  130  FWYRTEPLSITAISAQIAVVPLGQLMAAKITDRVFFKGTRCEFTLNPGPFNVKEHVLITI  189

Query  421  MANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             AN     G G  Y+I  +T++KA+YK+ ++F    I+++TTQ++G+GWAG+ RRYLV
Sbjct  190  FANS----GAGSVYAIHIVTVVKAFYKKNITFFVSFIVIITTQVLGFGWAGIFRRYLV  243



>ref|XP_006289826.1| hypothetical protein CARUB_v10003431mg [Capsella rubella]
 gb|EOA22724.1| hypothetical protein CARUB_v10003431mg [Capsella rubella]
Length=766

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 120/161 (75%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              P+ +VAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YRT+PL+ISAI  QI
Sbjct  54   NSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTISAISAQI  113

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +V+P+G+ MAA + ER +    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  114  AVVPLGRLMAAKISERVYFQGSKWQFTLNPGPFNVKEHVLITIFANA----GAGSVYAIH  169

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +T++KA+Y + ++F    I+++TTQ++G+GWAG+ R+YLV
Sbjct  170  VVTVVKAFYMKNITFFVSFIVIVTTQVLGFGWAGIFRKYLV  210



>ref|XP_002447030.1| hypothetical protein SORBIDRAFT_06g027230 [Sorghum bicolor]
 gb|EES11358.1| hypothetical protein SORBIDRAFT_06g027230 [Sorghum bicolor]
Length=736

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 126/173 (73%), Gaps = 2/173 (1%)
 Frame = +1

Query  76   ATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  255
            A  GE+    G    VE+V L VP TDDPTLPV TFR W +GI SC +L F N FF YRT
Sbjct  12   AAVGEEE-DDGDVALVEQVRLTVPTTDDPTLPVWTFRMWTIGIVSCALLSFFNQFFAYRT  70

Query  256  QPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCG  435
            +P+ IS I +Q++ LP+G FMA  LPE K +  GR  +T+NPGPFN+KEHV+I + AN G
Sbjct  71   EPIIISQITVQVAALPVGHFMARVLPETKRSALGR-EWTMNPGPFNVKEHVLICIFANAG  129

Query  436  VSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             + G G AY++  I I+KA+YK+ +SF+ GL++++TTQ++GYGWAG+LR+Y+V
Sbjct  130  TAFGNGGAYAVLIIDIIKAFYKRNISFVVGLLLIITTQVLGYGWAGLLRKYVV  182



>ref|XP_002866614.1| hypothetical protein ARALYDRAFT_496649 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42873.1| hypothetical protein ARALYDRAFT_496649 [Arabidopsis lyrata subsp. 
lyrata]
Length=729

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 128/175 (73%), Gaps = 4/175 (2%)
 Frame = +1

Query  76   ATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  255
            ATA E +       P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT
Sbjct  2    ATADEFSDED--TSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRT  59

Query  256  QPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMAN  429
            +PL I+ I +Q++ LPIG F+A  LP+ +F     G   F+LNPGPFN+KEHV+I++ AN
Sbjct  60   EPLVITQITVQVATLPIGHFLAKVLPKTRFGLPGCGSARFSLNPGPFNMKEHVLISIFAN  119

Query  430  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             G + G G AY++G ITI+KA+Y + +SF+ G ++++TTQ++GYGWAG+LR+Y+V
Sbjct  120  AGSAFGSGSAYAVGIITIIKAFYGRNISFIAGWLLIITTQVLGYGWAGLLRKYVV  174



>gb|KFK31865.1| hypothetical protein AALP_AA6G168500 [Arabis alpina]
Length=755

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 120/161 (75%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              P+ +VAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YRT+PL+ISAI  QI
Sbjct  43   NSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTISAISAQI  102

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +V+P+G+ MAA + +R F     W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  103  AVVPLGRLMAAKISDRVFLQGSYWEFTLNPGPFNVKEHVLITIFANA----GAGSVYAIH  158

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +T++KA+Y + ++F   LI+++TTQ++G+GWAG+ R+YLV
Sbjct  159  VVTVVKAFYMKNITFFVSLIVIVTTQVLGFGWAGIFRKYLV  199



>ref|XP_010455470.1| PREDICTED: oligopeptide transporter 7-like [Camelina sativa]
Length=767

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 120/161 (75%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              P+ +VAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YRT+PL+ISAI  QI
Sbjct  55   NSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTISAISAQI  114

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +V+P+G+ MAA + ER +    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  115  AVVPLGRLMAAKISERVYFQGSKWQFTLNPGPFNVKEHVLITIFANA----GAGSVYAIH  170

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +T++KA+Y + ++F    I+++TTQ++G+GWAG+ R+YLV
Sbjct  171  VVTVVKAFYMKNITFFVSFIVIVTTQVLGFGWAGIFRKYLV  211



>ref|NP_001062118.1| Os08g0492000 [Oryza sativa Japonica Group]
 dbj|BAD09683.1| putative glutathione transporter [Oryza sativa Japonica Group]
 dbj|BAD10005.1| putative glutathione transporter [Oryza sativa Japonica Group]
 dbj|BAF24032.1| Os08g0492000 [Oryza sativa Japonica Group]
 gb|EEC83792.1| hypothetical protein OsI_29707 [Oryza sativa Indica Group]
Length=752

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 123/181 (68%), Gaps = 5/181 (3%)
 Frame = +1

Query  55   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  234
              S  NP +  EKT      CP+EEV L VP TDDP LP LTFR W LG+ SC +L F N
Sbjct  14   HRSSENPESRDEKTEEEVDDCPIEEVRLTVPITDDPALPALTFRTWLLGLISCAMLAFSN  73

Query  235  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGR-WSFTLNPGPFNIKEHVI  411
             FF YR  PL IS++ +QI VLP+GK MAA LP++ F   G  WSF+LNPGPFN+KEHV+
Sbjct  74   QFFGYRQNPLYISSLSVQIVVLPLGKLMAACLPKKVFRVKGTAWSFSLNPGPFNLKEHVL  133

Query  412  ITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYL  591
            IT+ AN     G    Y++G ITI+KA+Y++ +  L  +++  TTQL+GYGWAG+ R++L
Sbjct  134  ITIFANT----GSNSVYAVGIITIVKAFYRREIHPLAAMLLTQTTQLMGYGWAGLFRKFL  189

Query  592  V  594
            V
Sbjct  190  V  190



>ref|XP_003555686.1| PREDICTED: oligopeptide transporter 7 [Glycine max]
Length=749

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 120/161 (75%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              P+++VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YR QPL+I+AI  QI
Sbjct  38   NSPIKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRIQPLTITAISAQI  97

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +V+P+G+ MAAT+ +R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  98   AVVPLGQLMAATITKRVFFRGTRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  153

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +T +K +Y + +SF   L++V+TTQ++G+GWAG+ RRYLV
Sbjct  154  VVTAVKIFYHKHISFFVSLLVVITTQVLGFGWAGIFRRYLV  194



>ref|XP_009616769.1| PREDICTED: oligopeptide transporter 2-like [Nicotiana tomentosiformis]
Length=738

 Score =   193 bits (491),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              P+E+V L V   DDP+LPV TFR WFLG+ SC +L FLNTFF YR +PL I+ I +Q+
Sbjct  26   ESPIEQVRLTVSNDDDPSLPVWTFRMWFLGLLSCALLSFLNTFFSYRAEPLVITMITVQV  85

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            + LP+G+ MA  LP RKF     W FTLNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  86   ATLPLGRIMARVLPTRKFK-IRSWEFTLNPGPFNMKEHVLISIFANAGSAFGNGPAYAVG  144

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             + I KA+Y + +SFL G I+V+ TQ++GYGWAG++R+Y+V
Sbjct  145  IVDITKAFYFRNISFLAGWILVIATQVLGYGWAGIMRKYVV  185



>ref|XP_010422002.1| PREDICTED: oligopeptide transporter 7 [Camelina sativa]
Length=769

 Score =   194 bits (492),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 120/161 (75%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              P+ +VAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YRT+PL+ISAI  QI
Sbjct  57   NSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTISAISAQI  116

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +V+P+G+ MAA + ER +    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  117  AVVPLGRLMAAKISERVYFQGSKWQFTLNPGPFNVKEHVLITIFANA----GAGSVYAIH  172

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +T++KA+Y + ++F    ++++TTQ++G+GWAG+ R+YLV
Sbjct  173  VVTVVKAFYMKNITFFVSFLVIVTTQVLGFGWAGIFRKYLV  213



>ref|NP_192815.1| oligopeptide transporter 7 [Arabidopsis thaliana]
 sp|O82485.1|OPT7_ARATH RecName: Full=Oligopeptide transporter 7; Short=AtOPT7 [Arabidopsis 
thaliana]
 gb|AAC35527.1| similar to Schizosaccharomyces pombe isp4 protein (GB:D14061) 
[Arabidopsis thaliana]
 emb|CAB81178.1| putative oligopeptide transporter [Arabidopsis thaliana]
 gb|AAK74026.1| AT4g10770/T12H20_7 [Arabidopsis thaliana]
 gb|AAO42765.1| At4g10770/T12H20_7 [Arabidopsis thaliana]
 gb|AEE82927.1| oligopeptide transporter 7 [Arabidopsis thaliana]
Length=766

 Score =   193 bits (491),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 120/159 (75%), Gaps = 4/159 (3%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+ +VAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YRT+PL+ISAI  QI+V
Sbjct  56   PIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTISAISAQIAV  115

Query  298  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  477
            +P+G+ MAA + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  116  VPLGRLMAAKITDRVFFQGSKWQFTLNPGPFNVKEHVLITIFANA----GAGSVYAIHVV  171

Query  478  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            T++KA+Y + ++F    I+++TTQ++G+GWAG+ R+YLV
Sbjct  172  TVVKAFYMKNITFFVSFIVIVTTQVLGFGWAGIFRKYLV  210



>ref|XP_006376659.1| hypothetical protein POPTR_0012s02660g [Populus trichocarpa]
 gb|ERP54456.1| hypothetical protein POPTR_0012s02660g [Populus trichocarpa]
Length=532

 Score =   191 bits (484),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 123/179 (69%), Gaps = 6/179 (3%)
 Frame = +1

Query  58   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  237
            M+G N   A E        CPV++V L V +TDDPTLPVLTFR W LG+ SC++L F+N 
Sbjct  1    MAGANEVQAME--IEDEEECPVKQVDLTVLKTDDPTLPVLTFRMWVLGLGSCVLLSFVNQ  58

Query  238  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  417
            FF YRTQP+ IS+I  QI+V+P+G  MA  L  RKF     W FT+NPGPFNIKEHV+IT
Sbjct  59   FFWYRTQPMFISSISAQIAVVPLGHLMAKKLTTRKFFEGTSWEFTMNPGPFNIKEHVLIT  118

Query  418  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            + AN     G G  Y+   +T +K YYK+ L+F+  L +++TTQ++G+GWAG+ R+YLV
Sbjct  119  IFANS----GAGTVYATHILTAVKLYYKRKLTFVPALFVMITTQVLGFGWAGLFRKYLV  173



>ref|XP_009128701.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 7-like 
[Brassica rapa]
Length=760

 Score =   193 bits (491),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 118/159 (74%), Gaps = 4/159 (3%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+ EVAL VP TDD +LPVLTFR WFLG  SCI+L FLN FF YR +PL ISAI  QI+V
Sbjct  52   PIREVALTVPTTDDHSLPVLTFRMWFLGSISCILLSFLNQFFWYRREPLVISAISAQIAV  111

Query  298  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  477
            +P+G+ MAA + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  I
Sbjct  112  VPLGRLMAAKITDRVFLQGSKWEFTLNPGPFNVKEHVLITIFANA----GAGSVYAIHII  167

Query  478  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            T++KAYY + ++F    I+++TTQ++G+GWAG+ R+YLV
Sbjct  168  TVVKAYYMKNMTFFVSFIVIVTTQVLGFGWAGIFRKYLV  206



>ref|XP_010436760.1| PREDICTED: oligopeptide transporter 7-like [Camelina sativa]
Length=766

 Score =   193 bits (491),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 125/171 (73%), Gaps = 7/171 (4%)
 Frame = +1

Query  82   AGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQP  261
            +GE+   +    P+ +VAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YRT+P
Sbjct  47   SGEEEEENS---PIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEP  103

Query  262  LSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVS  441
            L+ISAI  QI+V+P+G+ MAA + ER +    +W FTLNPGPFN+KEHV+IT+ AN    
Sbjct  104  LTISAISAQIAVVPLGRLMAAKISERVYFQGSKWQFTLNPGPFNVKEHVLITIFANA---  160

Query  442  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             G G  Y+I  +T++KA+Y + ++F    ++++TTQ++G+GWAG+ R+YLV
Sbjct  161  -GAGSVYAIHVVTVVKAFYMKNITFFVSFLVIVTTQVLGFGWAGIFRKYLV  210



>ref|XP_010104574.1| Oligopeptide transporter 4 [Morus notabilis]
 gb|EXC01175.1| Oligopeptide transporter 4 [Morus notabilis]
Length=754

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 125/174 (72%), Gaps = 2/174 (1%)
 Frame = +1

Query  79   TAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQ  258
            T+ E         PVEEV L VP TDD +LPV TFR WFLG+ SC +L FLN FF YR +
Sbjct  20   TSDEPIVDEDELSPVEEVRLTVPNTDDKSLPVWTFRMWFLGLLSCALLSFLNQFFSYRKE  79

Query  259  PLSISAILMQISVLPIGKFMAATLPERKFAPFGRWS--FTLNPGPFNIKEHVIITVMANC  432
            PL ++ I + ++ LP+G+FMAA LPE KF   G  S  F+LNPGPFN+KEHV+I++ AN 
Sbjct  80   PLVVTQITVLVATLPVGRFMAAVLPETKFRVPGLKSREFSLNPGPFNVKEHVLISIFANA  139

Query  433  GVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            G + G G AY++  + I+KA+Y + +SFL G I+++TTQ++GYGWAG+LR+Y+V
Sbjct  140  GSAFGNGSAYAVMIVDIIKAFYGRKISFLSGWILIITTQVLGYGWAGLLRKYVV  193



>ref|XP_010267482.1| PREDICTED: oligopeptide transporter 7-like [Nelumbo nucifera]
Length=766

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 119/159 (75%), Gaps = 4/159 (3%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+++VAL VP TDD TLPVLTFR W LG  SCI+L FLN FF YRT+PL+I+AI  QI+V
Sbjct  53   PIKQVALTVPTTDDHTLPVLTFRMWVLGTVSCILLSFLNQFFWYRTEPLTITAISAQIAV  112

Query  298  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  477
            +P+G+ MA+ +  R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  113  VPLGRLMASMITNRVFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIHIV  168

Query  478  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            T +K +YK+ ++F   LI+V+TTQ++G+GWAG+ RRYLV
Sbjct  169  TAVKIFYKKNITFFVSLIVVITTQVLGFGWAGIFRRYLV  207



>ref|XP_010246854.1| PREDICTED: oligopeptide transporter 7-like [Nelumbo nucifera]
Length=757

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 121/159 (76%), Gaps = 4/159 (3%)
 Frame = +1

Query  118  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  297
            P+E+VAL VP TDDPTLP+LTFR W LG  +C +L FLN FF YR +PLSI++I  QI+V
Sbjct  45   PIEQVALTVPITDDPTLPILTFRMWVLGTLACALLSFLNQFFWYRKEPLSITSISAQIAV  104

Query  298  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  477
            +P+G  MA+T+ +R F    RW FTLNPGPFNIKEHV+IT+ AN     G G+ Y+I  +
Sbjct  105  VPLGHLMASTITDRVFFKKSRWEFTLNPGPFNIKEHVLITIFANS----GAGNVYAIHIV  160

Query  478  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            + +K +YK+ L+FL  L++V+T+Q++G+GWAG+ RRYLV
Sbjct  161  SAVKLFYKKNLTFLVSLLVVITSQVLGFGWAGLFRRYLV  199



>ref|XP_008663549.1| PREDICTED: oligopeptide transporter 4-like [Zea mays]
 gb|AFW59311.1| hypothetical protein ZEAMMB73_934591 [Zea mays]
Length=737

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +1

Query  124  EEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVLP  303
            E+V L VP TDDPTLPV TFR W +GI SC +L F N FF YRT+P+ IS I +Q++ LP
Sbjct  27   EQVRLTVPTTDDPTLPVWTFRMWTIGIVSCALLSFFNQFFAYRTEPIIISQITVQVAALP  86

Query  304  IGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITI  483
            +G FMA  LP+ K + FGR  +T+NPGPFN+KEHV+I + AN G + G G AY+I  ITI
Sbjct  87   VGHFMARVLPKTKLSAFGR-EWTMNPGPFNVKEHVLICIFANAGTAFGNGGAYAISIITI  145

Query  484  MKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
            +KA+YK+ +SF+  L++++TTQ++GYGWAG++R+++V
Sbjct  146  IKAFYKRNISFVVSLLLIMTTQVLGYGWAGLMRKHVV  182



>ref|XP_010520948.1| PREDICTED: oligopeptide transporter 6 [Tarenaya hassleriana]
Length=739

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 119/161 (74%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
            RC VE+V L VP+TDDPTLPVLTFR W LGI +CI+L F+N FF YRT PLSI+ I  QI
Sbjct  20   RCVVEQVELTVPKTDDPTLPVLTFRMWVLGIGACIVLSFVNQFFWYRTMPLSITGISAQI  79

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +V+P+G  MA  LP RK+    RW F++NPGPFN+KEHV+IT+ AN     G G  Y+  
Sbjct  80   AVVPLGHLMARILPTRKYFEGTRWEFSMNPGPFNVKEHVLITIFANS----GAGSVYATH  135

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             ++ +K YYK+AL FL   ++++TTQ++G+GWAG+ R++LV
Sbjct  136  ILSAIKLYYKRALPFLPAFLVMITTQVLGFGWAGLFRKHLV  176



>ref|XP_009407958.1| PREDICTED: oligopeptide transporter 7-like [Musa acuminata subsp. 
malaccensis]
Length=759

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 118/161 (73%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              P+E+VAL VP  DDPT+PVLTFR W LG  SC++L FLN FF YR +PLSI++I  QI
Sbjct  45   NSPIEQVALTVPVEDDPTMPVLTFRMWVLGTASCVLLSFLNQFFWYRKEPLSITSISAQI  104

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +V+P+G  MA+T+ +R F    RW FTLNPGPFNIKEHV+IT+ AN     G G  Y+I 
Sbjct  105  AVVPLGHLMASTITDRVFFKGSRWEFTLNPGPFNIKEHVLITIFANS----GAGSVYAIH  160

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +T +K +Y + ++F   L++V+TTQ++G+GWAG+ RRYLV
Sbjct  161  VVTAVKIFYGKHITFFVSLLVVITTQVLGFGWAGIFRRYLV  201



>ref|XP_011022429.1| PREDICTED: oligopeptide transporter 7-like [Populus euphratica]
Length=760

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 124/178 (70%), Gaps = 4/178 (2%)
 Frame = +1

Query  61   SGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTF  240
            S     T+    A      PV++VAL VP TDDP+LPVLTFR W LG  SC++L FLN F
Sbjct  30   SSSKSQTSEINQAHDEENSPVKQVALTVPTTDDPSLPVLTFRMWVLGTISCVLLSFLNQF  89

Query  241  FIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITV  420
            F YRT+PLSI+AI  QI+V+P+G+ MAA + +R F    R  FTLNPGPFN+KEHV+IT+
Sbjct  90   FWYRTEPLSITAISAQIAVVPLGQLMAAKITDRVFFKGTRCEFTLNPGPFNVKEHVLITI  149

Query  421  MANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             AN     G G  Y+I  +T++KA+YK+ ++     I+++TTQ++G+GWAG+ RRYLV
Sbjct  150  FANS----GAGSVYAIHIVTVVKAFYKKNITLFVSFIVIITTQVLGFGWAGIFRRYLV  203



>dbj|BAJ87692.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=735

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 124/175 (71%), Gaps = 7/175 (4%)
 Frame = +1

Query  70   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  249
            +P   G++ A +     VE+VAL VP  DDP+ PVLTFR W LG  SC+ L FLNTFF Y
Sbjct  43   SPEEVGDREAENSA---VEQVALTVPVGDDPSTPVLTFRMWVLGAASCVALSFLNTFFWY  99

Query  250  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  429
            R +PL I+AI  Q++V+P+G+ MAA LPER F    RW FTLNPGPF++KEHV+IT+ AN
Sbjct  100  RKEPLEITAISAQVAVVPLGRLMAAALPERAFFRGRRWEFTLNPGPFSVKEHVLITIFAN  159

Query  430  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
                 G G  ++I  +T ++ +Y + +SFL  L++VLT+Q++G+GWAG+ RRYLV
Sbjct  160  A----GAGSVFAINLVTAVRVFYGKPISFLVSLLVVLTSQVVGFGWAGIFRRYLV  210



>ref|XP_008803571.1| PREDICTED: oligopeptide transporter 4-like isoform X1 [Phoenix 
dactylifera]
Length=763

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 129/183 (70%), Gaps = 4/183 (2%)
 Frame = +1

Query  58   MSGLNPATAGEKTAPSGGR--CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  231
            M+    A   EKTA        P+E+V L VP TD+PTLPV TFR WF+GI SC ++ FL
Sbjct  26   MTATVSAMDVEKTAGGDEEEVSPIEQVRLTVPTTDNPTLPVWTFRMWFIGILSCSLMSFL  85

Query  232  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEH  405
            N FF YRT+PL I+ I +Q++ LP+G F+A  LP  KF    FG   F+LNPGPFN+KEH
Sbjct  86   NQFFSYRTEPLIITQISIQVASLPVGHFLARVLPAAKFRLPGFGDRQFSLNPGPFNMKEH  145

Query  406  VIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRR  585
            V+I++ AN G + G G AY +G + I++A+YK+ +SF  G I+++TTQ++GYGWAG++R+
Sbjct  146  VLISIFANAGYAFGNGPAYGVGIVNIIRAFYKRTISFTAGWILIITTQVLGYGWAGLMRK  205

Query  586  YLV  594
            Y+V
Sbjct  206  YVV  208



>ref|XP_010053083.1| PREDICTED: oligopeptide transporter 7 [Eucalyptus grandis]
Length=751

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 120/161 (75%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  291
              PV +VAL V  TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PL+I+AI  QI
Sbjct  41   NSPVPQVALTVQTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQI  100

Query  292  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  471
            +V+P+G+ MAA + +R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  101  AVVPLGRLMAARITDRVFLKGTRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIY  156

Query  472  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             +T++K +YK+ ++F   LI+V+TTQ++G+GWAG+ R+YLV
Sbjct  157  VVTVVKVFYKKQITFFVSLIVVITTQVLGFGWAGIFRKYLV  197



>emb|CDY35662.1| BnaC09g29840D [Brassica napus]
Length=741

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 118/169 (70%), Gaps = 4/169 (2%)
 Frame = +1

Query  88   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  267
            E+      RC VEEV L VP+TDDPTLPVLTFR W LG+ +CIIL F+N FF YR  PL+
Sbjct  15   EEAVDELDRCAVEEVELTVPKTDDPTLPVLTFRMWVLGLAACIILSFVNQFFWYRQMPLT  74

Query  268  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  447
            I+ I  QI+V+P+G  MA  LP +K+    RW F +NPGPFNIKEHV+IT+ AN     G
Sbjct  75   ITGISAQIAVVPLGHLMARVLPNKKYLEGSRWEFNMNPGPFNIKEHVMITIFANS----G  130

Query  448  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             G  Y+   ++ +K YYK++L FL   +I++TTQ +G+GWAG+ R++LV
Sbjct  131  AGTVYATHILSAIKLYYKRSLPFLPAFLIMITTQFLGFGWAGLFRKHLV  179



>emb|CDY14374.1| BnaA10g06810D [Brassica napus]
Length=709

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 118/169 (70%), Gaps = 4/169 (2%)
 Frame = +1

Query  88   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  267
            E+      RC VEEV L VP+TDDPTLPVLTFR W LG+ +CIIL F+N FF YR  PL+
Sbjct  15   EEAVDELDRCAVEEVELTVPKTDDPTLPVLTFRMWVLGLAACIILSFVNQFFWYRQMPLT  74

Query  268  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  447
            I+ I  QI+V+P+G  MA  LP +K+    RW F +NPGPFNIKEHV+IT+ AN     G
Sbjct  75   ITGISAQIAVVPLGHLMARVLPNKKYLEGSRWEFNMNPGPFNIKEHVMITIFANS----G  130

Query  448  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  594
             G  Y+   ++ +K YYK++L FL   +I++TTQ +G+GWAG+ R++LV
Sbjct  131  AGTVYATHILSAIKLYYKRSLPFLPAFLIMITTQFLGFGWAGLFRKHLV  179



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 778590373395