BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF008B07

Length=565
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP11417.1|  unnamed protein product                                233   1e-67   Coffea canephora [robusta coffee]
gb|AIA61439.1|  cellulose synthase                                      228   1e-65   Boehmeria nivea [Chinese silk-plant]
ref|XP_006367803.1|  PREDICTED: cellulose synthase A catalytic su...    227   3e-65   Solanum tuberosum [potatoes]
ref|XP_009599913.1|  PREDICTED: cellulose synthase A catalytic su...    226   3e-65   Nicotiana tomentosiformis
ref|XP_011101270.1|  PREDICTED: cellulose synthase A catalytic su...    226   7e-65   Sesamum indicum [beniseed]
ref|XP_006364140.1|  PREDICTED: cellulose synthase A catalytic su...    226   7e-65   Solanum tuberosum [potatoes]
ref|XP_004252570.1|  PREDICTED: cellulose synthase A catalytic su...    225   1e-64   Solanum lycopersicum
ref|XP_009782822.1|  PREDICTED: cellulose synthase A catalytic su...    225   1e-64   Nicotiana sylvestris
gb|AFY06685.1|  cellulose synthase                                      225   1e-64   Nicotiana tabacum [American tobacco]
ref|XP_009609627.1|  PREDICTED: cellulose synthase A catalytic su...    225   2e-64   Nicotiana tomentosiformis
ref|XP_009765335.1|  PREDICTED: cellulose synthase A catalytic su...    224   2e-64   Nicotiana sylvestris
gb|AEI87569.1|  cellulose synthase catalytic subunit protein            224   2e-64   Nicotiana tabacum [American tobacco]
ref|XP_008381836.1|  PREDICTED: cellulose synthase A catalytic su...    223   6e-64   
ref|XP_008369157.1|  PREDICTED: cellulose synthase A catalytic su...    223   7e-64   
ref|XP_008358296.1|  PREDICTED: cellulose synthase A catalytic su...    223   7e-64   
ref|XP_009339472.1|  PREDICTED: cellulose synthase A catalytic su...    223   9e-64   Pyrus x bretschneideri [bai li]
ref|XP_007199689.1|  hypothetical protein PRUPE_ppa000559mg             223   9e-64   Prunus persica
dbj|BAG06272.1|  cellulose synthase Z632                                223   1e-63   Zinnia elegans [garden zinnia]
gb|AAK49454.1|AF304374_1  cellulose synthase catalytic subunit          222   2e-63   Nicotiana alata [flowering tobacco]
ref|XP_011074751.1|  PREDICTED: cellulose synthase A catalytic su...    221   2e-63   Sesamum indicum [beniseed]
ref|XP_004237809.1|  PREDICTED: cellulose synthase A catalytic su...    221   4e-63   Solanum lycopersicum
ref|XP_002265955.1|  PREDICTED: cellulose synthase A catalytic su...    221   5e-63   Vitis vinifera
ref|XP_010106861.1|  Isoxaben-resistant protein 2                       220   8e-63   
emb|CBI18221.3|  unnamed protein product                                220   8e-63   Vitis vinifera
gb|AFZ78561.1|  cellulose synthase                                      220   1e-62   Populus tomentosa [Chinese white poplar]
ref|XP_002302169.1|  CesA7A-like family protein                         219   2e-62   
ref|XP_010241683.1|  PREDICTED: cellulose synthase A catalytic su...    219   2e-62   Nelumbo nucifera [Indian lotus]
ref|XP_011042869.1|  PREDICTED: cellulose synthase A catalytic su...    219   2e-62   Populus euphratica
ref|XP_009376550.1|  PREDICTED: cellulose synthase A catalytic su...    218   4e-62   Pyrus x bretschneideri [bai li]
gb|AAT09895.1|  cellulose synthase                                      218   5e-62   Populus tremula x Populus tremuloides
ref|XP_011044242.1|  PREDICTED: cellulose synthase A catalytic su...    217   1e-61   Populus euphratica
ref|XP_002306707.1|  CesA7A-like family protein                         217   1e-61   Populus trichocarpa [western balsam poplar]
ref|XP_004138382.1|  PREDICTED: cellulose synthase A catalytic su...    217   1e-61   Cucumis sativus [cucumbers]
ref|XP_008463088.1|  PREDICTED: cellulose synthase A catalytic su...    217   1e-61   Cucumis melo [Oriental melon]
ref|XP_008463087.1|  PREDICTED: cellulose synthase A catalytic su...    217   1e-61   Cucumis melo [Oriental melon]
ref|XP_010520165.1|  PREDICTED: cellulose synthase A catalytic su...    216   2e-61   Tarenaya hassleriana [spider flower]
ref|XP_004290503.1|  PREDICTED: cellulose synthase A catalytic su...    216   3e-61   Fragaria vesca subsp. vesca
ref|XP_007019545.1|  Cellulose synthase 6                               216   3e-61   
gb|KJB14950.1|  hypothetical protein B456_002G150300                    215   4e-61   Gossypium raimondii
gb|AFB18634.1|  CESA5                                                   215   4e-61   Gossypium hirsutum [American cotton]
gb|KHG02518.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...    215   6e-61   Gossypium arboreum [tree cotton]
gb|KDP35302.1|  hypothetical protein JCGZ_09461                         215   6e-61   Jatropha curcas
ref|XP_007048203.1|  Cellulose synthase 6                               215   7e-61   
gb|AFZ78560.1|  cellulose synthase                                      214   7e-61   Populus tomentosa [Chinese white poplar]
gb|AGV22110.1|  cellulose synthase 8                                    214   1e-60   Betula luminifera [liang ye hua]
gb|KJB18370.1|  hypothetical protein B456_003G049300                    214   1e-60   Gossypium raimondii
gb|KJB18373.1|  hypothetical protein B456_003G049300                    214   1e-60   Gossypium raimondii
ref|XP_008232182.1|  PREDICTED: cellulose synthase A catalytic su...    214   2e-60   Prunus mume [ume]
gb|EPS58530.1|  hypothetical protein M569_16283                         203   2e-60   Genlisea aurea
ref|XP_007213713.1|  hypothetical protein PRUPE_ppa000567mg             213   2e-60   Prunus persica
gb|KHG24947.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...    213   3e-60   Gossypium arboreum [tree cotton]
gb|KJB18372.1|  hypothetical protein B456_003G049300                    212   3e-60   Gossypium raimondii
ref|XP_003531396.1|  PREDICTED: cellulose synthase A catalytic su...    213   4e-60   Glycine max [soybeans]
gb|KJB66303.1|  hypothetical protein B456_010G134500                    212   5e-60   Gossypium raimondii
ref|XP_007159799.1|  hypothetical protein PHAVU_002G268200g             212   5e-60   Phaseolus vulgaris [French bean]
gb|EYU17481.1|  hypothetical protein MIMGU_mgv1a000527mg                212   5e-60   Erythranthe guttata [common monkey flower]
gb|KDO83761.1|  hypothetical protein CISIN_1g001373mg                   212   6e-60   Citrus sinensis [apfelsine]
gb|KDO83760.1|  hypothetical protein CISIN_1g001373mg                   212   6e-60   Citrus sinensis [apfelsine]
ref|XP_006473074.1|  PREDICTED: cellulose synthase A catalytic su...    212   6e-60   Citrus sinensis [apfelsine]
ref|XP_006434481.1|  hypothetical protein CICLE_v10000103mg             212   6e-60   Citrus clementina [clementine]
ref|XP_002307145.1|  cellulose synthase family protein                  212   8e-60   Populus trichocarpa [western balsam poplar]
gb|AEE60899.1|  cellulose synthase                                      212   8e-60   Populus tomentosa [Chinese white poplar]
gb|KJB59451.1|  hypothetical protein B456_009G255100                    211   9e-60   Gossypium raimondii
gb|KJB59449.1|  hypothetical protein B456_009G255100                    211   1e-59   Gossypium raimondii
gb|KHG29218.1|  Cellulose synthase A catalytic subunit 6 [UDP-for...    211   1e-59   Gossypium arboreum [tree cotton]
ref|XP_011013552.1|  PREDICTED: cellulose synthase A catalytic su...    211   2e-59   Populus euphratica
ref|XP_011013550.1|  PREDICTED: cellulose synthase A catalytic su...    211   2e-59   Populus euphratica
gb|AAT09898.1|  cellulose synthase                                      211   2e-59   Populus tremula x Populus tremuloides
gb|KJB59452.1|  hypothetical protein B456_009G255100                    210   2e-59   Gossypium raimondii
gb|EYU36833.1|  hypothetical protein MIMGU_mgv1a000540mg                211   2e-59   Erythranthe guttata [common monkey flower]
ref|XP_009758840.1|  PREDICTED: cellulose synthase A catalytic su...    210   3e-59   Nicotiana sylvestris
ref|XP_007213712.1|  hypothetical protein PRUPE_ppa000567mg             208   3e-59   
ref|XP_002524299.1|  Cellulose synthase A catalytic subunit 6 [UD...    210   3e-59   Ricinus communis
gb|KDO83762.1|  hypothetical protein CISIN_1g001373mg                   208   4e-59   Citrus sinensis [apfelsine]
ref|XP_009629755.1|  PREDICTED: cellulose synthase A catalytic su...    209   6e-59   Nicotiana tomentosiformis
gb|KJB59450.1|  hypothetical protein B456_009G255100                    207   6e-59   Gossypium raimondii
gb|AFZ78553.1|  cellulose synthase                                      209   6e-59   Populus tomentosa [Chinese white poplar]
gb|KDP30751.1|  hypothetical protein JCGZ_15180                         209   8e-59   Jatropha curcas
ref|XP_002310629.1|  hypothetical protein POPTR_0007s07120g             208   1e-58   Populus trichocarpa [western balsam poplar]
ref|XP_002310628.1|  cellulose synthase family protein                  208   1e-58   Populus trichocarpa [western balsam poplar]
gb|AFB18639.1|  CESA9                                                   208   1e-58   Gossypium hirsutum [American cotton]
gb|AAO25581.1|  cellulose synthase                                      208   2e-58   Populus tremuloides
ref|XP_011021978.1|  PREDICTED: cellulose synthase A catalytic su...    207   2e-58   Populus euphratica
ref|XP_011021980.1|  PREDICTED: cellulose synthase A catalytic su...    207   2e-58   Populus euphratica
ref|XP_011042923.1|  PREDICTED: cellulose synthase A catalytic su...    206   5e-58   Populus euphratica
ref|XP_003536418.1|  PREDICTED: cellulose synthase A catalytic su...    207   6e-58   Glycine max [soybeans]
emb|CDP12843.1|  unnamed protein product                                206   8e-58   Coffea canephora [robusta coffee]
gb|AHL45027.1|  cellulose synthase 6A                                   206   1e-57   Linum usitatissimum
gb|KHN34038.1|  Cellulose synthase A catalytic subunit 6 [UDP-for...    205   2e-57   Glycine soja [wild soybean]
ref|XP_003525098.1|  PREDICTED: cellulose synthase A catalytic su...    205   2e-57   Glycine max [soybeans]
gb|AHL45028.1|  cellulose synthase 6B                                   205   2e-57   Linum usitatissimum
ref|XP_006411737.1|  hypothetical protein EUTSA_v10024277mg             205   2e-57   Eutrema salsugineum [saltwater cress]
ref|XP_002866842.1|  hypothetical protein ARALYDRAFT_490712             205   2e-57   
ref|XP_008338760.1|  PREDICTED: cellulose synthase A catalytic su...    205   3e-57   
ref|XP_007151999.1|  hypothetical protein PHAVU_004G093300g             204   3e-57   Phaseolus vulgaris [French bean]
gb|AHL45029.1|  cellulose synthase 6C                                   204   3e-57   Linum usitatissimum
gb|AHL45030.1|  cellulose synthase 6D                                   204   3e-57   Linum usitatissimum
ref|XP_010260984.1|  PREDICTED: cellulose synthase A catalytic su...    204   4e-57   Nelumbo nucifera [Indian lotus]
ref|XP_006283042.1|  hypothetical protein CARUB_v10004034mg             204   4e-57   Capsella rubella
gb|KDO57137.1|  hypothetical protein CISIN_1g001369mg                   204   5e-57   Citrus sinensis [apfelsine]
ref|XP_002878571.1|  hypothetical protein ARALYDRAFT_900606             204   5e-57   Arabidopsis lyrata subsp. lyrata
ref|XP_006427904.1|  hypothetical protein CICLE_v10024766mg             204   5e-57   Citrus clementina [clementine]
gb|KHN41284.1|  Cellulose synthase A catalytic subunit 6 [UDP-for...    201   9e-57   Glycine soja [wild soybean]
ref|XP_009350645.1|  PREDICTED: cellulose synthase A catalytic su...    203   1e-56   
ref|XP_009350646.1|  PREDICTED: cellulose synthase A catalytic su...    203   1e-56   Pyrus x bretschneideri [bai li]
ref|XP_010680991.1|  PREDICTED: cellulose synthase A catalytic su...    203   1e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010546378.1|  PREDICTED: cellulose synthase A catalytic su...    203   1e-56   Tarenaya hassleriana [spider flower]
gb|KJB18371.1|  hypothetical protein B456_003G049300                    201   1e-56   Gossypium raimondii
gb|KDO83763.1|  hypothetical protein CISIN_1g001373mg                   201   2e-56   Citrus sinensis [apfelsine]
ref|XP_010431901.1|  PREDICTED: cellulose synthase A catalytic su...    202   2e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010547636.1|  PREDICTED: cellulose synthase A catalytic su...    202   2e-56   Tarenaya hassleriana [spider flower]
ref|XP_008440995.1|  PREDICTED: cellulose synthase A catalytic su...    202   2e-56   Cucumis melo [Oriental melon]
ref|NP_195645.1|  cellulose synthase A catalytic subunit 2 [UDP-f...    202   2e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010027732.1|  PREDICTED: cellulose synthase A catalytic su...    202   2e-56   Eucalyptus grandis [rose gum]
ref|XP_004141979.1|  PREDICTED: probable cellulose synthase A cat...    202   3e-56   Cucumis sativus [cucumbers]
gb|EYU17480.1|  hypothetical protein MIMGU_mgv1a000527mg                200   4e-56   Erythranthe guttata [common monkey flower]
ref|XP_004503981.1|  PREDICTED: cellulose synthase A catalytic su...    201   5e-56   Cicer arietinum [garbanzo]
ref|XP_003630174.1|  Cellulose synthase A catalytic subunit             201   5e-56   Medicago truncatula
ref|XP_007143558.1|  hypothetical protein PHAVU_007G081700g             201   9e-56   Phaseolus vulgaris [French bean]
ref|XP_010437052.1|  PREDICTED: cellulose synthase A catalytic su...    200   9e-56   Camelina sativa [gold-of-pleasure]
gb|AGV22108.1|  cellulose synthase 6                                    200   9e-56   Betula luminifera [liang ye hua]
ref|XP_003548102.1|  PREDICTED: cellulose synthase A catalytic su...    200   9e-56   Glycine max [soybeans]
gb|KHN00756.1|  Cellulose synthase A catalytic subunit 6 [UDP-for...    200   1e-55   Glycine soja [wild soybean]
ref|XP_003518592.1|  PREDICTED: cellulose synthase A catalytic su...    200   1e-55   Glycine max [soybeans]
emb|CDY42621.1|  BnaC01g00330D                                          200   1e-55   Brassica napus [oilseed rape]
ref|XP_010678670.1|  PREDICTED: cellulose synthase A catalytic su...    200   1e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010526630.1|  PREDICTED: cellulose synthase A catalytic su...    199   2e-55   Tarenaya hassleriana [spider flower]
gb|AES62337.2|  cellulose synthase-like protein                         199   2e-55   Medicago truncatula
gb|KEH43649.1|  cellulose synthase-like protein                         199   2e-55   Medicago truncatula
ref|XP_006399471.1|  hypothetical protein EUTSA_v10012521mg             199   4e-55   Eutrema salsugineum [saltwater cress]
gb|KFK25282.1|  hypothetical protein AALP_AA8G091900                    198   4e-55   Arabis alpina [alpine rockcress]
ref|XP_009150553.1|  PREDICTED: cellulose synthase A catalytic su...    198   4e-55   Brassica rapa
emb|CDY08854.1|  BnaA06g23700D                                          198   4e-55   Brassica napus [oilseed rape]
emb|CDY14504.1|  BnaC03g49550D                                          198   4e-55   Brassica napus [oilseed rape]
ref|XP_009115076.1|  PREDICTED: cellulose synthase A catalytic su...    198   5e-55   Brassica rapa
ref|XP_002871389.1|  hypothetical protein ARALYDRAFT_908936             198   5e-55   Arabidopsis lyrata subsp. lyrata
emb|CDY41973.1|  BnaA01g05450D                                          198   5e-55   Brassica napus [oilseed rape]
gb|ACS68191.1|  cellulose synthase 2.1 catalytic subunit                198   5e-55   Brassica napus [oilseed rape]
ref|XP_002864919.1|  hypothetical protein ARALYDRAFT_496689             198   6e-55   
ref|NP_196549.1|  cellulose synthase A catalytic subunit 5 [UDP-f...    198   7e-55   Arabidopsis thaliana [mouse-ear cress]
gb|KHG03006.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...    197   7e-55   Gossypium arboreum [tree cotton]
ref|NP_201279.1|  cellulose synthase A catalytic subunit 6 [UDP-f...    198   8e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279743.1|  hypothetical protein CARUB_v10027598mg             198   8e-55   Capsella rubella
ref|XP_010491630.1|  PREDICTED: cellulose synthase A catalytic su...    197   1e-54   Camelina sativa [gold-of-pleasure]
gb|AEK86669.1|  cellulose synthase 5                                    196   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010444419.1|  PREDICTED: cellulose synthase A catalytic su...    197   1e-54   Camelina sativa [gold-of-pleasure]
emb|CDX81249.1|  BnaC09g06600D                                          197   2e-54   
emb|CDY18696.1|  BnaA09g06990D                                          197   2e-54   Brassica napus [oilseed rape]
ref|XP_010452989.1|  PREDICTED: cellulose synthase A catalytic su...    197   2e-54   Camelina sativa [gold-of-pleasure]
gb|ACS68196.1|  cellulose synthase 6.1 catalytic subunit                197   2e-54   Brassica napus [oilseed rape]
ref|XP_009112155.1|  PREDICTED: cellulose synthase A catalytic su...    196   2e-54   Brassica rapa
ref|XP_010462809.1|  PREDICTED: cellulose synthase A catalytic su...    196   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010088737.1|  Isoxaben-resistant protein 2                       196   4e-54   Morus notabilis
gb|KDO57138.1|  hypothetical protein CISIN_1g001369mg                   193   5e-54   Citrus sinensis [apfelsine]
ref|XP_011090445.1|  PREDICTED: cellulose synthase A catalytic su...    195   8e-54   Sesamum indicum [beniseed]
ref|XP_010484268.1|  PREDICTED: cellulose synthase A catalytic su...    195   1e-53   Camelina sativa [gold-of-pleasure]
gb|EYU31127.1|  hypothetical protein MIMGU_mgv1a000549mg                194   1e-53   Erythranthe guttata [common monkey flower]
ref|XP_006286951.1|  hypothetical protein CARUB_v10000099mg             194   2e-53   Capsella rubella
emb|CDY31305.1|  BnaA02g34360D                                          194   2e-53   Brassica napus [oilseed rape]
ref|XP_006427905.1|  hypothetical protein CICLE_v10024766mg             192   2e-53   
ref|XP_010446473.1|  PREDICTED: cellulose synthase A catalytic su...    193   3e-53   Camelina sativa [gold-of-pleasure]
ref|NP_179768.1|  cellulose synthase A9                                 193   4e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130469.1|  PREDICTED: cellulose synthase A catalytic su...    192   9e-53   Brassica rapa
emb|CDY46820.1|  BnaC02g43280D                                          192   9e-53   Brassica napus [oilseed rape]
gb|AAC29067.1|  cellulose synthase                                      192   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002277635.1|  PREDICTED: cellulose synthase A catalytic su...    191   1e-52   Vitis vinifera
ref|XP_009131129.1|  PREDICTED: cellulose synthase A catalytic su...    191   2e-52   Brassica rapa
emb|CDY56540.1|  BnaA03g55860D                                          191   2e-52   Brassica napus [oilseed rape]
emb|CDX81145.1|  BnaC03g03990D                                          191   2e-52   
gb|ACS68195.1|  cellulose synthase 5.1 catalytic subunit                191   2e-52   Brassica napus [oilseed rape]
emb|CBI21555.3|  unnamed protein product                                190   4e-52   Vitis vinifera
ref|XP_006394118.1|  hypothetical protein EUTSA_v100035740mg            187   7e-52   
ref|XP_003592086.1|  Cellulose synthase                                 189   8e-52   
dbj|BAF01335.1|  cellulose synthase                                     185   3e-51   Arabidopsis thaliana [mouse-ear cress]
gb|EPS71230.1|  hypothetical protein M569_03522                         187   5e-51   Genlisea aurea
ref|XP_006847152.1|  hypothetical protein AMTR_s00017p00239550          186   1e-50   Amborella trichopoda
gb|KHG02517.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...    186   1e-50   Gossypium arboreum [tree cotton]
gb|EPS66740.1|  hypothetical protein M569_08032                         184   5e-50   Genlisea aurea
ref|XP_004502891.1|  PREDICTED: cellulose synthase A catalytic su...    184   7e-50   Cicer arietinum [garbanzo]
ref|XP_006351001.1|  PREDICTED: cellulose synthase A catalytic su...    182   3e-49   Solanum tuberosum [potatoes]
ref|XP_010312466.1|  PREDICTED: cellulose synthase A catalytic su...    181   9e-49   Solanum lycopersicum
ref|XP_010063847.1|  PREDICTED: cellulose synthase A catalytic su...    174   2e-46   Eucalyptus grandis [rose gum]
ref|XP_010063851.1|  PREDICTED: cellulose synthase A catalytic su...    174   2e-46   Eucalyptus grandis [rose gum]
gb|AFD33697.1|  cellulose synthase A                                    172   1e-45   Eucalyptus camaldulensis
ref|XP_010927397.1|  PREDICTED: cellulose synthase A catalytic su...    162   4e-42   Elaeis guineensis
ref|XP_011079381.1|  PREDICTED: cellulose synthase A catalytic su...    160   9e-42   
ref|XP_011079380.1|  PREDICTED: cellulose synthase A catalytic su...    160   1e-41   Sesamum indicum [beniseed]
ref|XP_011079382.1|  PREDICTED: cellulose synthase A catalytic su...    160   1e-41   
ref|XP_009414591.1|  PREDICTED: cellulose synthase A catalytic su...    160   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB49074.1|  hypothetical protein B456_008G100100                    151   2e-41   Gossypium raimondii
ref|XP_009622821.1|  PREDICTED: cellulose synthase A catalytic su...    159   3e-41   Nicotiana tomentosiformis
gb|EYU35355.1|  hypothetical protein MIMGU_mgv1a000638mg                159   3e-41   Erythranthe guttata [common monkey flower]
ref|XP_011083940.1|  PREDICTED: cellulose synthase A catalytic su...    159   3e-41   Sesamum indicum [beniseed]
ref|XP_009777624.1|  PREDICTED: cellulose synthase A catalytic su...    159   3e-41   Nicotiana sylvestris
ref|XP_009622822.1|  PREDICTED: cellulose synthase A catalytic su...    159   3e-41   Nicotiana tomentosiformis
gb|AFW69155.1|  putative cellulose synthase family protein              159   5e-41   
ref|XP_004242614.1|  PREDICTED: cellulose synthase A catalytic su...    159   5e-41   Solanum lycopersicum
ref|XP_004956855.1|  PREDICTED: cellulose synthase A catalytic su...    158   7e-41   Setaria italica
ref|XP_002963550.1|  family 2 glycosyltransferase                       158   8e-41   
ref|XP_006660635.1|  PREDICTED: cellulose synthase A catalytic su...    158   8e-41   Oryza brachyantha
ref|XP_002460229.1|  hypothetical protein SORBIDRAFT_02g025020          158   8e-41   Sorghum bicolor [broomcorn]
ref|XP_006343620.1|  PREDICTED: cellulose synthase A catalytic su...    158   8e-41   Solanum tuberosum [potatoes]
gb|KCW78813.1|  hypothetical protein EUGRSUZ_C00246                     157   1e-40   Eucalyptus grandis [rose gum]
ref|XP_008670200.1|  PREDICTED: cellulose synthase A catalytic su...    157   1e-40   
gb|AFR58756.2|  cellulose synthase 3                                    157   1e-40   Eucalyptus tereticornis [red ironbark]
gb|AGE09566.1|  cellulose synthase-like protein                         157   1e-40   Eucalyptus cladocalyx
ref|NP_001105532.1|  cellulose synthase catalytic subunit 12            157   1e-40   Zea mays [maize]
gb|AEK31217.1|  cellulose synthase A                                    157   1e-40   Eucalyptus camaldulensis
gb|KCW78815.1|  hypothetical protein EUGRSUZ_C00246                     157   1e-40   Eucalyptus grandis [rose gum]
gb|KCW78814.1|  hypothetical protein EUGRSUZ_C00246                     157   1e-40   Eucalyptus grandis [rose gum]
ref|XP_010687624.1|  PREDICTED: cellulose synthase A catalytic su...    157   1e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009417280.1|  PREDICTED: probable cellulose synthase A cat...    157   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGJ71354.1|  cellulose synthase 3                                    157   1e-40   Eucalyptus urophylla
ref|XP_009408434.1|  PREDICTED: probable cellulose synthase A cat...    157   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW78812.1|  hypothetical protein EUGRSUZ_C00246                     157   1e-40   Eucalyptus grandis [rose gum]
ref|NP_001289644.1|  cellulose synthase A catalytic subunit 7           157   1e-40   Eucalyptus grandis [rose gum]
gb|EPS60781.1|  hypothetical protein M569_14019                         157   1e-40   Genlisea aurea
ref|XP_008794369.1|  PREDICTED: cellulose synthase A catalytic su...    157   1e-40   Phoenix dactylifera
ref|XP_010265522.1|  PREDICTED: cellulose synthase A catalytic su...    157   2e-40   Nelumbo nucifera [Indian lotus]
gb|EYU17477.1|  hypothetical protein MIMGU_mgv1a016004mg                145   2e-40   Erythranthe guttata [common monkey flower]
gb|KHG11460.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    157   2e-40   Gossypium arboreum [tree cotton]
ref|XP_008450511.1|  PREDICTED: cellulose synthase A catalytic su...    157   2e-40   Cucumis melo [Oriental melon]
gb|AFB18637.1|  CESA8                                                   157   2e-40   Gossypium hirsutum [American cotton]
gb|KJB53884.1|  hypothetical protein B456_009G009700                    157   2e-40   Gossypium raimondii
ref|XP_010929171.1|  PREDICTED: cellulose synthase A catalytic su...    157   2e-40   Elaeis guineensis
gb|KHG19749.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    157   2e-40   Gossypium arboreum [tree cotton]
gb|AFB18636.1|  CESA7                                                   156   3e-40   Gossypium hirsutum [American cotton]
gb|KJB07761.1|  hypothetical protein B456_001G044700                    156   3e-40   Gossypium raimondii
gb|KJB07762.1|  hypothetical protein B456_001G044700                    156   3e-40   Gossypium raimondii
dbj|BAJ85783.1|  predicted protein                                      156   3e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA61529.1|  TPA: putative cellulose synthase family protein        156   3e-40   
gb|AAM26299.1|  cellulose synthase                                      156   3e-40   Populus tremuloides
ref|XP_009410192.1|  PREDICTED: cellulose synthase A catalytic su...    156   3e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009385959.1|  PREDICTED: probable cellulose synthase A cat...    156   3e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002325122.1|  cellulose synthase family protein                  156   3e-40   
gb|AFZ78551.1|  cellulose synthase                                      156   4e-40   Populus tomentosa [Chinese white poplar]
ref|XP_007013859.1|  Cellulose synthase family protein isoform 1        156   4e-40   
ref|XP_008790154.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    156   4e-40   Phoenix dactylifera
ref|XP_011018058.1|  PREDICTED: cellulose synthase A catalytic su...    155   5e-40   Populus euphratica
ref|XP_011033387.1|  PREDICTED: cellulose synthase A catalytic su...    155   5e-40   Populus euphratica
dbj|BAJ05813.1|  cellulose synthase catalytic subunit                   155   6e-40   Oryza sativa Indica Group [Indian rice]
ref|NP_001063207.1|  Os09g0422500                                       155   6e-40   
gb|ACJ38667.1|  cellulose synthase                                      155   6e-40   Betula luminifera [liang ye hua]
ref|XP_004287144.1|  PREDICTED: cellulose synthase A catalytic su...    155   6e-40   Fragaria vesca subsp. vesca
ref|XP_010250039.1|  PREDICTED: probable cellulose synthase A cat...    155   6e-40   Nelumbo nucifera [Indian lotus]
gb|AEE60897.1|  cellulose synthase                                      155   6e-40   Populus tomentosa [Chinese white poplar]
ref|XP_006842872.1|  hypothetical protein AMTR_s00081p00171100          155   7e-40   Amborella trichopoda
gb|KEH32618.1|  cellulose synthase-like protein                         155   7e-40   Medicago truncatula
ref|XP_004507755.1|  PREDICTED: cellulose synthase A catalytic su...    155   8e-40   Cicer arietinum [garbanzo]
gb|AFR38707.1|  cellulose synthase                                      142   8e-40   Populus trichocarpa [western balsam poplar]
gb|AFR38732.1|  cellulose synthase                                      142   8e-40   Populus fremontii
ref|XP_010273667.1|  PREDICTED: cellulose synthase A catalytic su...    155   8e-40   Nelumbo nucifera [Indian lotus]
ref|XP_003610282.1|  Cellulose synthase catalytic subunit               155   8e-40   Medicago truncatula
emb|CDP02834.1|  unnamed protein product                                155   8e-40   Coffea canephora [robusta coffee]
gb|ACC59196.1|  cellulose synthase                                      155   9e-40   Betula platyphylla [Asian white birch]
gb|ACJ38665.1|  cellulose synthase                                      155   9e-40   Betula luminifera [liang ye hua]
gb|AFR38723.1|  cellulose synthase                                      142   9e-40   Populus alba [abele]
gb|AFR38724.1|  cellulose synthase                                      142   9e-40   Populus alba [abele]
gb|AFR38726.1|  cellulose synthase                                      142   9e-40   Populus alba [abele]
gb|AFR38730.1|  cellulose synthase                                      142   1e-39   Populus fremontii
gb|AII73574.1|  cellulose synthase 7-A                                  155   1e-39   Medicago sativa [alfalfa]
ref|XP_003522926.1|  PREDICTED: cellulose synthase A catalytic su...    155   1e-39   Glycine max [soybeans]
ref|XP_008243020.1|  PREDICTED: cellulose synthase A catalytic su...    155   1e-39   Prunus mume [ume]
ref|XP_007204670.1|  hypothetical protein PRUPE_ppa000618mg             155   1e-39   Prunus persica
ref|XP_004152851.1|  PREDICTED: cellulose synthase A catalytic su...    154   1e-39   Cucumis sativus [cucumbers]
gb|AGX27222.1|  cellulose synthase 7                                    154   1e-39   Populus tomentosa [Chinese white poplar]
ref|XP_010254360.1|  PREDICTED: probable cellulose synthase A cat...    154   1e-39   Nelumbo nucifera [Indian lotus]
gb|AGX27229.1|  cellulose synthase 7                                    154   2e-39   Populus tomentosa [Chinese white poplar]
gb|AGX27219.1|  cellulose synthase 7                                    154   2e-39   Populus tomentosa [Chinese white poplar]
gb|AGX27212.1|  cellulose synthase 7                                    154   2e-39   Populus tomentosa [Chinese white poplar]
gb|AFZ78559.1|  cellulose synthase                                      154   2e-39   Populus tomentosa [Chinese white poplar]
gb|AGX27236.1|  cellulose synthase 7                                    154   2e-39   Populus tomentosa [Chinese white poplar]
gb|AGX27238.1|  cellulose synthase 7                                    154   2e-39   Populus tomentosa [Chinese white poplar]
gb|AGX27235.1|  cellulose synthase 7                                    154   2e-39   Populus tomentosa [Chinese white poplar]
gb|AGX27233.1|  cellulose synthase 7                                    154   2e-39   Populus tomentosa [Chinese white poplar]
gb|AGX27231.1|  cellulose synthase 7                                    154   2e-39   Populus tomentosa [Chinese white poplar]
gb|AGX27223.1|  cellulose synthase 7                                    154   2e-39   Populus tomentosa [Chinese white poplar]
gb|AGX27220.1|  cellulose synthase 7                                    154   2e-39   Populus tomentosa [Chinese white poplar]
gb|AGX27216.1|  cellulose synthase 7                                    154   2e-39   Populus tomentosa [Chinese white poplar]
gb|AGX27215.1|  cellulose synthase 7                                    154   2e-39   
gb|AGX27211.1|  cellulose synthase 7                                    154   2e-39   
gb|AGX27206.1|  cellulose synthase 7                                    154   2e-39   
gb|AGX27205.1|  cellulose synthase 7                                    154   2e-39   
gb|AGX27203.1|  cellulose synthase 7                                    154   2e-39   
gb|AGX27202.1|  cellulose synthase 7                                    154   2e-39   
gb|AGX27201.1|  cellulose synthase 7                                    154   2e-39   
gb|AGX27199.1|  cellulose synthase 7                                    154   2e-39   
gb|AGX27214.1|  cellulose synthase 7                                    154   2e-39   
gb|AFP93559.1|  cellulose synthase A1                                   154   2e-39   
ref|XP_010091161.1|  OsCesA7 protein                                    154   2e-39   
ref|XP_002308412.1|  cellulose synthase family protein                  154   2e-39   
dbj|BAG06269.1|  cellulose synthase Z811                                153   2e-39   
ref|XP_008362868.1|  PREDICTED: cellulose synthase A catalytic su...    154   2e-39   
ref|XP_006381880.1|  hypothetical protein POPTR_0006s19580g             154   2e-39   
emb|CDP13491.1|  unnamed protein product                                154   2e-39   
ref|XP_006826669.1|  hypothetical protein AMTR_s00137p00043990          154   2e-39   
gb|AHH81946.1|  cellulose synthase                                      154   2e-39   
ref|XP_002533228.1|  Cellulose synthase A catalytic subunit 3 [UD...    154   2e-39   
ref|XP_010912005.1|  PREDICTED: cellulose synthase A catalytic su...    154   3e-39   
ref|XP_009358418.1|  PREDICTED: cellulose synthase A catalytic su...    154   3e-39   
gb|KHN17507.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    154   3e-39   
ref|XP_006474028.1|  PREDICTED: cellulose synthase A catalytic su...    153   3e-39   
ref|XP_006474027.1|  PREDICTED: cellulose synthase A catalytic su...    153   3e-39   
gb|KHN14136.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    153   3e-39   
ref|XP_003519160.1|  PREDICTED: cellulose synthase A catalytic su...    153   3e-39   
gb|AFR38984.1|  cellulose synthase                                      140   3e-39   
gb|KDO62270.1|  hypothetical protein CISIN_1g039060mg                   153   4e-39   
ref|XP_006453581.1|  hypothetical protein CICLE_v10007321mg             153   4e-39   
ref|XP_004238519.1|  PREDICTED: probable cellulose synthase A cat...    153   4e-39   
ref|XP_003549532.1|  PREDICTED: cellulose synthase A catalytic su...    153   4e-39   
ref|XP_006849886.1|  hypothetical protein AMTR_s00022p00086120          153   4e-39   
ref|XP_006600535.1|  PREDICTED: cellulose synthase A catalytic su...    153   4e-39   
gb|ACT67415.1|  cellulose synthase                                      153   4e-39   
dbj|BAM05571.1|  cellulose synthase 3                                   145   4e-39   
ref|XP_007138395.1|  hypothetical protein PHAVU_009G205100g             153   4e-39   
gb|KEH32617.1|  cellulose synthase-like protein                         152   4e-39   
gb|KHG22630.1|  Cellulose synthase A catalytic subunit 9 [UDP-for...    145   4e-39   
ref|XP_010925238.1|  PREDICTED: probable cellulose synthase A cat...    153   4e-39   
ref|XP_006354075.1|  PREDICTED: probable cellulose synthase A cat...    153   5e-39   
ref|XP_003527198.1|  PREDICTED: cellulose synthase A catalytic su...    153   5e-39   
ref|XP_010545449.1|  PREDICTED: cellulose synthase A catalytic su...    153   5e-39   
ref|XP_008784981.1|  PREDICTED: probable cellulose synthase A cat...    153   6e-39   
gb|KEH32616.1|  cellulose synthase-like protein                         151   6e-39   
ref|XP_008366693.1|  PREDICTED: cellulose synthase A catalytic su...    152   7e-39   
gb|KHG19971.1|  Cellulose synthase A catalytic subunit 9 [UDP-for...    145   7e-39   
dbj|BAF93202.1|  cellulose synthase catalytic subunit                   152   7e-39   
gb|AEE60896.1|  cellulose synthase                                      152   7e-39   
ref|XP_009366208.1|  PREDICTED: cellulose synthase A catalytic su...    152   7e-39   
ref|XP_008394069.1|  PREDICTED: cellulose synthase A catalytic su...    152   7e-39   
gb|AGX27207.1|  cellulose synthase 7                                    152   8e-39   
gb|AFW81389.1|  cellulose synthase1                                     152   9e-39   
gb|AFW81388.1|  cellulose synthase1                                     152   1e-38   
ref|XP_010905024.1|  PREDICTED: cellulose synthase A catalytic su...    152   1e-38   
ref|XP_008785840.1|  PREDICTED: cellulose synthase A catalytic su...    152   1e-38   
ref|XP_009355721.1|  PREDICTED: cellulose synthase A catalytic su...    152   1e-38   
ref|XP_010932185.1|  PREDICTED: probable cellulose synthase A cat...    152   1e-38   
gb|AGC97433.2|  cellulose synthase                                      152   1e-38   
ref|XP_002277713.1|  PREDICTED: probable cellulose synthase A cat...    152   2e-38   
ref|XP_003568832.2|  PREDICTED: probable cellulose synthase A cat...    151   2e-38   
ref|NP_001104954.1|  cellulose synthase-1                               151   2e-38   
ref|XP_003578137.1|  PREDICTED: cellulose synthase A catalytic su...    151   2e-38   
ref|XP_002319002.2|  cellulose synthase 6 family protein                151   2e-38   
gb|KDP36709.1|  hypothetical protein JCGZ_08000                         151   2e-38   
ref|XP_010914890.1|  PREDICTED: probable cellulose synthase A cat...    151   2e-38   
gb|KCW81421.1|  hypothetical protein EUGRSUZ_C02801                     151   2e-38   
gb|EMT30130.1|  Cellulose synthase A catalytic subunit 9 (UDP-for...    151   2e-38   
gb|AGV22109.1|  cellulose synthase 7                                    151   3e-38   
emb|CAN73700.1|  hypothetical protein VITISV_013112                     150   3e-38   
gb|AFR38735.1|  cellulose synthase                                      138   3e-38   
ref|XP_007018605.1|  Cellulose synthase 6                               150   3e-38   
ref|NP_001289657.1|  cellulose synthase A catalytic subunit 1           150   3e-38   
gb|AEK31219.1|  cellulose synthase A                                    150   3e-38   
ref|XP_007154868.1|  hypothetical protein PHAVU_003G154600g             150   3e-38   
ref|XP_008394301.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    150   4e-38   
ref|XP_006400279.1|  hypothetical protein EUTSA_v10012538mg             150   4e-38   
ref|XP_002440694.1|  hypothetical protein SORBIDRAFT_09g005280          150   4e-38   
ref|XP_008796456.1|  PREDICTED: probable cellulose synthase A cat...    150   4e-38   
ref|XP_010648652.1|  PREDICTED: cellulose synthase A catalytic su...    150   4e-38   
ref|XP_002276890.2|  PREDICTED: cellulose synthase A catalytic su...    150   4e-38   
ref|XP_004291468.1|  PREDICTED: cellulose synthase A catalytic su...    150   4e-38   
ref|XP_011459196.1|  PREDICTED: cellulose synthase A catalytic su...    150   4e-38   
ref|XP_002873827.1|  hypothetical protein ARALYDRAFT_909737             150   5e-38   
gb|AAY43217.1|  cellulose synthase BoCesA1                              150   5e-38   
gb|KCW70399.1|  hypothetical protein EUGRSUZ_F03635                     150   5e-38   
ref|NP_001051830.1|  Os03g0837100                                       150   6e-38   
ref|NP_001289648.1|  probable cellulose synthase A catalytic subu...    150   6e-38   
gb|AFI71895.1|  cellulose synthase 6                                    150   6e-38   
dbj|BAM05574.1|  cellulose synthase 3                                   146   6e-38   
gb|KCW70400.1|  hypothetical protein EUGRSUZ_F03635                     150   6e-38   
gb|AAP40636.1|  cellulose synthase 6                                    150   7e-38   
ref|XP_008796554.1|  PREDICTED: probable cellulose synthase A cat...    150   7e-38   
emb|CBI40805.3|  unnamed protein product                                149   7e-38   
gb|ACS68197.1|  cellulose synthase 7.1 catalytic subunit                149   8e-38   
ref|XP_008792060.1|  PREDICTED: probable cellulose synthase A cat...    149   8e-38   
ref|XP_006286973.1|  hypothetical protein CARUB_v10000119mg             149   8e-38   
ref|XP_011023647.1|  PREDICTED: probable cellulose synthase A cat...    149   8e-38   
ref|XP_010927484.1|  PREDICTED: probable cellulose synthase A cat...    149   8e-38   
ref|XP_009131595.1|  PREDICTED: cellulose synthase A catalytic su...    149   9e-38   
gb|ADV58936.1|  cellulose synthase                                      149   9e-38   
ref|XP_010270654.1|  PREDICTED: probable cellulose synthase A cat...    149   9e-38   
ref|XP_007221583.1|  hypothetical protein PRUPE_ppa000611mg             149   1e-37   
ref|XP_008219478.1|  PREDICTED: cellulose synthase A catalytic su...    149   1e-37   
gb|ADR74043.1|  cellulose synthase                                      149   1e-37   
gb|EYU32338.1|  hypothetical protein MIMGU_mgv1a000544mg                149   1e-37   
ref|NP_001105574.1|  cellulose synthase2                                149   1e-37   
ref|XP_003598145.1|  Cellulose synthase                                 149   1e-37   
gb|KCW81422.1|  hypothetical protein EUGRSUZ_C02801                     149   1e-37   
ref|XP_010453934.1|  PREDICTED: cellulose synthase A catalytic su...    149   1e-37   
gb|ADD71499.1|  cellulose synthase catalytic subunit                    149   1e-37   
gb|AFM37966.1|  cellulose synthase catalytic subunit                    149   1e-37   
ref|XP_004965873.1|  PREDICTED: probable cellulose synthase A cat...    149   2e-37   
ref|XP_010420462.1|  PREDICTED: cellulose synthase A catalytic su...    149   2e-37   
ref|XP_010453933.1|  PREDICTED: cellulose synthase A catalytic su...    149   2e-37   
ref|XP_010420461.1|  PREDICTED: cellulose synthase A catalytic su...    149   2e-37   
ref|XP_010492694.1|  PREDICTED: cellulose synthase A catalytic su...    149   2e-37   
emb|CBI21020.3|  unnamed protein product                                148   2e-37   
gb|AAD32031.1|AF088917_1  cellulose synthase catalytic subunit          148   2e-37   
gb|AFZ78555.1|  cellulose synthase                                      148   2e-37   
ref|NP_197244.1|  cellulose synthase A catalytic subunit 7 [UDP-f...    148   2e-37   
gb|KFK25953.1|  hypothetical protein AALP_AA8G184200                    148   2e-37   
gb|KFK25952.1|  hypothetical protein AALP_AA8G184200                    148   2e-37   
ref|XP_009126184.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    148   2e-37   
gb|AHL45024.1|  cellulose synthase 1B                                   148   3e-37   
emb|CDX85455.1|  BnaA02g03580D                                          147   3e-37   
ref|XP_010270659.1|  PREDICTED: probable cellulose synthase A cat...    147   4e-37   
gb|KDO85323.1|  hypothetical protein CISIN_1g045222mg                   147   4e-37   
ref|XP_006435515.1|  hypothetical protein CICLE_v10000117mg             147   4e-37   
ref|XP_006654097.1|  PREDICTED: probable cellulose synthase A cat...    147   4e-37   
ref|XP_002960719.1|  hypothetical protein SELMODRAFT_73698              147   4e-37   
ref|XP_002983952.1|  family 2 glycosyltransferase                       147   4e-37   
emb|CAN60659.1|  hypothetical protein VITISV_018069                     147   4e-37   
ref|XP_011081578.1|  PREDICTED: cellulose synthase A catalytic su...    147   5e-37   
ref|XP_006651997.1|  PREDICTED: probable cellulose synthase A cat...    147   6e-37   
ref|XP_010525969.1|  PREDICTED: cellulose synthase A catalytic su...    147   6e-37   
ref|XP_011036833.1|  PREDICTED: probable cellulose synthase A cat...    147   6e-37   
ref|XP_006382504.1|  cellulose synthase 6 family protein                147   6e-37   
gb|AFS95066.1|  cellulose synthase                                      147   6e-37   
gb|AFZ78563.1|  cellulose synthase                                      147   6e-37   
ref|XP_011036830.1|  PREDICTED: probable cellulose synthase A cat...    147   6e-37   
gb|KJB07760.1|  hypothetical protein B456_001G044700                    145   6e-37   
ref|XP_009617930.1|  PREDICTED: probable cellulose synthase A cat...    147   8e-37   
ref|XP_009617929.1|  PREDICTED: probable cellulose synthase A cat...    147   8e-37   
ref|XP_007013860.1|  Cellulose synthase family protein isoform 2        145   8e-37   
gb|KHN07088.1|  Cellulose synthase A catalytic subunit 1 [UDP-for...    147   8e-37   
ref|XP_003526416.1|  PREDICTED: cellulose synthase A catalytic su...    147   8e-37   
gb|AHL45023.1|  cellulose synthase 1A                                   147   8e-37   
ref|XP_010266321.1|  PREDICTED: probable cellulose synthase A cat...    147   9e-37   
ref|XP_006494425.1|  PREDICTED: probable cellulose synthase A cat...    146   9e-37   
ref|XP_010110357.1|  Protein radially swollen 1                         146   1e-36   
ref|XP_007137035.1|  hypothetical protein PHAVU_009G094200g             146   1e-36   
gb|KHN08123.1|  Cellulose synthase A catalytic subunit 1 [UDP-for...    146   1e-36   
ref|XP_003522623.1|  PREDICTED: cellulose synthase A catalytic su...    146   1e-36   
ref|XP_004509860.1|  PREDICTED: cellulose synthase A catalytic su...    146   1e-36   
gb|AFR39009.1|  cellulose synthase                                      134   1e-36   
ref|XP_009411928.1|  PREDICTED: cellulose synthase A catalytic su...    146   1e-36   
gb|ABI78958.1|  cellulose synthase 5                                    146   1e-36   
ref|XP_001757887.1|  cellulose synthase 5, glycosyltransferase fa...    146   1e-36   
ref|XP_006664834.1|  PREDICTED: probable cellulose synthase A cat...    146   1e-36   
ref|XP_001757832.1|  predicted protein                                  146   1e-36   
gb|ACQ99194.1|  cellulose synthase                                      145   2e-36   
ref|XP_011071168.1|  PREDICTED: cellulose synthase A catalytic su...    145   2e-36   
gb|AAY43224.2|  cellulose synthase BoCesA7                              145   2e-36   
ref|XP_004981133.1|  PREDICTED: probable cellulose synthase A cat...    145   2e-36   
ref|XP_004956059.1|  PREDICTED: probable cellulose synthase A cat...    145   3e-36   
ref|XP_004956058.1|  PREDICTED: probable cellulose synthase A cat...    145   3e-36   
ref|NP_001059487.1|  Os07g0424400                                       145   3e-36   
ref|XP_006450469.1|  hypothetical protein CICLE_v10007296mg             145   3e-36   
ref|XP_010266322.1|  PREDICTED: probable cellulose synthase A cat...    144   4e-36   
ref|XP_004955913.1|  PREDICTED: probable cellulose synthase A cat...    145   4e-36   
ref|XP_004956060.1|  PREDICTED: probable cellulose synthase A cat...    145   4e-36   
ref|XP_004956061.1|  PREDICTED: probable cellulose synthase A cat...    145   4e-36   
ref|XP_010255732.1|  PREDICTED: probable cellulose synthase A cat...    145   4e-36   
ref|XP_010255731.1|  PREDICTED: probable cellulose synthase A cat...    145   4e-36   
ref|XP_004300066.1|  PREDICTED: probable cellulose synthase A cat...    145   4e-36   
ref|NP_001054788.1|  Os05g0176100                                       145   4e-36   
ref|XP_010238134.1|  PREDICTED: probable cellulose synthase A cat...    144   4e-36   
ref|XP_010238067.1|  PREDICTED: probable cellulose synthase A cat...    144   4e-36   
gb|ACR38558.1|  unknown                                                 142   4e-36   
gb|ACL36367.1|  cellulose synthase CesA9                                137   5e-36   
gb|AAT66940.1|  CesA1                                                   144   5e-36   
ref|XP_010526207.1|  PREDICTED: cellulose synthase A catalytic su...    144   5e-36   
gb|AAC39333.1|  RSW1-like cellulose synthase catalytic subunit          141   6e-36   
ref|XP_011466718.1|  PREDICTED: cellulose synthase A catalytic su...    144   6e-36   
ref|XP_007210416.1|  hypothetical protein PRUPE_ppa000557mg             144   6e-36   
gb|ACL36368.1|  cellulose synthase CesA10                               137   6e-36   
ref|XP_008233413.1|  PREDICTED: probable cellulose synthase A cat...    144   7e-36   
ref|XP_004245031.1|  PREDICTED: cellulose synthase A catalytic su...    144   7e-36   
ref|XP_010048223.1|  PREDICTED: cellulose synthase A catalytic su...    144   8e-36   
gb|KDP33612.1|  hypothetical protein JCGZ_07183                         144   8e-36   
ref|XP_004960821.1|  PREDICTED: probable cellulose synthase A cat...    144   8e-36   
ref|XP_007013842.1|  Cellulose synthase 1                               144   8e-36   
ref|XP_004960820.1|  PREDICTED: probable cellulose synthase A cat...    144   9e-36   
ref|XP_008387657.1|  PREDICTED: cellulose synthase A catalytic su...    142   9e-36   
ref|XP_002515536.1|  Cellulose synthase A catalytic subunit 6 [UD...    144   1e-35   
gb|KGN60109.1|  hypothetical protein Csa_3G878780                       143   1e-35   
ref|XP_003562886.1|  PREDICTED: probable cellulose synthase A cat...    143   1e-35   
ref|XP_004136343.1|  PREDICTED: cellulose synthase A catalytic su...    143   1e-35   
ref|XP_010238033.1|  PREDICTED: probable cellulose synthase A cat...    143   1e-35   
ref|NP_001104957.1|  cellulose synthase7                                143   1e-35   
ref|XP_010645442.1|  PREDICTED: probable cellulose synthase A cat...    143   1e-35   
ref|XP_006361724.1|  PREDICTED: cellulose synthase A catalytic su...    143   1e-35   
ref|XP_002960291.1|  family 2 glycosyltransferase                       143   1e-35   
ref|XP_008648127.1|  PREDICTED: cellulose synthase6 isoform X1          143   2e-35   
ref|XP_002967423.1|  hypothetical protein SELMODRAFT_86720              143   2e-35   
gb|AAR29967.1|  putative cellulose synthase catalytic subunit           143   2e-35   
ref|XP_002466137.1|  hypothetical protein SORBIDRAFT_01g002050          143   2e-35   
ref|XP_010047060.1|  PREDICTED: cellulose synthase A catalytic su...    142   2e-35   
ref|XP_011466721.1|  PREDICTED: cellulose synthase A catalytic su...    142   2e-35   
ref|XP_008337190.1|  PREDICTED: cellulose synthase A catalytic su...    134   2e-35   
gb|AAY43216.1|  cellulose synthase BoCesA8                              142   2e-35   
ref|XP_001767133.1|  cellulose synthase 4, glycosyltransferase fa...    142   2e-35   
ref|XP_010689561.1|  PREDICTED: cellulose synthase A catalytic su...    142   3e-35   
ref|XP_010670651.1|  PREDICTED: cellulose synthase A catalytic su...    142   3e-35   
ref|XP_008466397.1|  PREDICTED: cellulose synthase A catalytic su...    142   3e-35   
ref|NP_001104958.1|  cellulose synthase8                                142   3e-35   
emb|CBI37703.3|  unnamed protein product                                142   3e-35   
ref|XP_009768318.1|  PREDICTED: cellulose synthase A catalytic su...    142   3e-35   
gb|KDO62271.1|  hypothetical protein CISIN_1g039678mg                   142   4e-35   
ref|XP_006474030.1|  PREDICTED: cellulose synthase A catalytic su...    142   4e-35   
ref|XP_006453580.1|  hypothetical protein CICLE_v10010165mg             142   4e-35   



>emb|CDP11417.1| unnamed protein product [Coffea canephora]
Length=1096

 Score =   233 bits (595),  Expect = 1e-67, Method: Composition-based stats.
 Identities = 126/149 (85%), Positives = 132/149 (89%), Gaps = 9/149 (6%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDE+E TVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEIEFTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDE+E+EFDDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEDEDEFDDLEHEFDYNSNER  120

Query  489  --PEHMTEAALAARFNGGLG--VNGSGTT  563
              P+ + EAALAAR N G G  VN SG T
Sbjct  121  RDPQQIAEAALAARLNIGRGGNVNASGIT  149



>gb|AIA61439.1| cellulose synthase [Boehmeria nivea]
Length=1090

 Score =   228 bits (581),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 120/147 (82%), Positives = 130/147 (88%), Gaps = 7/147 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+E+TVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEVTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEEE+ DDL++EF       
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEEDTDDLENEFHIQHGGD  120

Query  489  PEHMTEAALAARFNGGLG--VNGSGTT  563
            P ++T+A LAAR N G G  VNGSG T
Sbjct  121  PHNLTDAMLAARLNVGRGSQVNGSGIT  147



>ref|XP_006367803.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Solanum tuberosum]
Length=1091

 Score =   227 bits (578),  Expect = 3e-65, Method: Composition-based stats.
 Identities = 120/141 (85%), Positives = 128/141 (91%), Gaps = 3/141 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRLIAGSHNRNEFVLINADE+GRVTSVKELSGQICQICGDE+E+TVDGE FVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDEIEVTVDGETFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY---PE  494
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGS RV+GD+EE+EFDDLDHEFDY   P 
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSQRVDGDDEEDEFDDLDHEFDYDGTPR  120

Query  495  HMTEAALAARFNGGLGVNGSG  557
            H++EAALAAR   G   N SG
Sbjct  121  HLSEAALAARLGRGTNYNASG  141



>ref|XP_009599913.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana tomentosiformis]
Length=1084

 Score =   226 bits (577),  Expect = 3e-65, Method: Composition-based stats.
 Identities = 122/140 (87%), Positives = 129/140 (92%), Gaps = 2/140 (1%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRLIAGSHNRNEFVLINADE+GRVTSVKELSGQICQICGDE+EITVD EPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDEIEITVDEEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  503
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGD+EE+EFDDLD+EFD P+   
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDDEEDEFDDLDNEFD-PQQTA  119

Query  504  EAALAARFNGGLG-VNGSGT  560
            EAAL+AR N G G  N SGT
Sbjct  120  EAALSARLNFGRGHPNASGT  139



>ref|XP_011101270.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Sesamum indicum]
Length=1084

 Score =   226 bits (575),  Expect = 7e-65, Method: Composition-based stats.
 Identities = 116/140 (83%), Positives = 129/140 (92%), Gaps = 1/140 (1%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDE+E TVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEIEFTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-PEHM  500
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GDE+E+EFDDL++EFDY  +H+
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDEDEDEFDDLENEFDYNAQHI  120

Query  501  TEAALAARFNGGLGVNGSGT  560
             EA+L++R N G   +G  T
Sbjct  121  AEASLSSRLNIGRSASGIST  140



>ref|XP_006364140.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Solanum tuberosum]
Length=1084

 Score =   226 bits (575),  Expect = 7e-65, Method: Composition-based stats.
 Identities = 122/139 (88%), Positives = 128/139 (92%), Gaps = 2/139 (1%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRLIAGSHNRNEFVLINADE+GRVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDELEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  503
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGD+EE+EFDDLD+EFD P    
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDDEEDEFDDLDNEFD-PHQTA  119

Query  504  EAALAARFNGGLG-VNGSG  557
            EAAL+AR N G G  N SG
Sbjct  120  EAALSARLNVGRGNPNASG  138



>ref|XP_004252570.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Solanum lycopersicum]
Length=1083

 Score =   225 bits (573),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 122/139 (88%), Positives = 128/139 (92%), Gaps = 2/139 (1%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRLIAGSHNRNEFVLINADE+GRVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDELEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  503
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGD+EE+EFDDLD+EFD P    
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDDEEDEFDDLDNEFD-PHQTA  119

Query  504  EAALAARFNGGLG-VNGSG  557
            EAAL+AR N G G  N SG
Sbjct  120  EAALSARLNVGRGNPNASG  138



>ref|XP_009782822.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana sylvestris]
Length=1091

 Score =   225 bits (573),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 115/143 (80%), Positives = 130/143 (91%), Gaps = 3/143 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFV+INADE+GRVTSVKELSGQICQICGDE+E+TVDGEPF+ACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVVINADEVGRVTSVKELSGQICQICGDEIEVTVDGEPFIACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY---PE  494
            CAFPVCR CYEYERREGNQACPQCKTR+KRIKGSPRV+GD+E++EFDDLDHEFDY   P 
Sbjct  61   CAFPVCRQCYEYERREGNQACPQCKTRFKRIKGSPRVDGDDEDDEFDDLDHEFDYHGNPR  120

Query  495  HMTEAALAARFNGGLGVNGSGTT  563
            +M+EAAL++R   G   N SG T
Sbjct  121  YMSEAALSSRLGRGTNHNASGLT  143



>gb|AFY06685.1| cellulose synthase [Nicotiana tabacum]
Length=1091

 Score =   225 bits (573),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 115/143 (80%), Positives = 130/143 (91%), Gaps = 3/143 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFV+INADE+GRVTSVKELSGQICQICGDE+E+TVDGEPF+ACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVVINADEVGRVTSVKELSGQICQICGDEIEVTVDGEPFIACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY---PE  494
            CAFPVCR CYEYERREGNQACPQCKTR+KRIKGSPRV+GD+E++EFDDLDHEFDY   P 
Sbjct  61   CAFPVCRQCYEYERREGNQACPQCKTRFKRIKGSPRVDGDDEDDEFDDLDHEFDYHGNPR  120

Query  495  HMTEAALAARFNGGLGVNGSGTT  563
            +M+EAAL++R   G   N SG T
Sbjct  121  YMSEAALSSRLGRGTNHNASGLT  143



>ref|XP_009609627.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana tomentosiformis]
Length=1087

 Score =   225 bits (573),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 115/143 (80%), Positives = 130/143 (91%), Gaps = 3/143 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFV+INADE+GRVTSVKELSGQICQICGDE+E+TVDGEPF+ACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVVINADEVGRVTSVKELSGQICQICGDEIEVTVDGEPFIACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY---PE  494
            CAFPVCR CYEYERREGNQACPQCKTR+KRIKGSPRV+GD+E++EFDDLDHEFDY   P 
Sbjct  61   CAFPVCRQCYEYERREGNQACPQCKTRFKRIKGSPRVDGDDEDDEFDDLDHEFDYHGNPR  120

Query  495  HMTEAALAARFNGGLGVNGSGTT  563
            +M+EAAL++R   G   N SG T
Sbjct  121  YMSEAALSSRLGRGTNHNASGLT  143



>ref|XP_009765335.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana sylvestris]
Length=1084

 Score =   224 bits (572),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 121/140 (86%), Positives = 129/140 (92%), Gaps = 2/140 (1%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRLIAGSHNRNEFVLINADE+GRVTSVKELSGQICQICGDE+EITVD EPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDEIEITVDEEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  503
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGD+EE+EFDDLD+EFD P+   
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDDEEDEFDDLDNEFD-PQQTA  119

Query  504  EAALAARFNGGLG-VNGSGT  560
            EAAL+AR + G G  N SGT
Sbjct  120  EAALSARLSIGRGHPNASGT  139



>gb|AEI87569.1| cellulose synthase catalytic subunit protein [Nicotiana tabacum]
Length=1091

 Score =   224 bits (572),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 115/143 (80%), Positives = 130/143 (91%), Gaps = 3/143 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFV+INADE+GRVTSVKELSGQICQICGDE+E+TVDGEPF+ACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVVINADEVGRVTSVKELSGQICQICGDEIEVTVDGEPFIACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY---PE  494
            CAFPVCR CYEYERREGNQACPQCKTR+KRIKGSPRV+GD+E++EFDDLDHEFDY   P 
Sbjct  61   CAFPVCRQCYEYERREGNQACPQCKTRFKRIKGSPRVDGDDEDDEFDDLDHEFDYHGNPR  120

Query  495  HMTEAALAARFNGGLGVNGSGTT  563
            +M+EAAL++R   G   N SG T
Sbjct  121  YMSEAALSSRLGRGTNHNASGLT  143



>ref|XP_008381836.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
Length=1095

 Score =   223 bits (569),  Expect = 6e-64, Method: Composition-based stats.
 Identities = 117/149 (79%), Positives = 123/149 (83%), Gaps = 9/149 (6%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefdd-------ldhef  482
            CAFPVCR CYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DD          E 
Sbjct  61   CAFPVCRSCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDLENEFDIASSER  120

Query  483  dYPEHMTEAALAARFNGGLG--VNGSGTT  563
              P  + EA LAAR N G G  VNGSG +
Sbjct  121  RDPHSIAEAVLAARLNIGRGSHVNGSGIS  149



>ref|XP_008369157.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
 ref|XP_008369158.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
 ref|XP_008369159.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
Length=1095

 Score =   223 bits (568),  Expect = 7e-64, Method: Composition-based stats.
 Identities = 117/149 (79%), Positives = 124/149 (83%), Gaps = 9/149 (6%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefdd-------ldhef  482
            CAFPVCR CYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DD         +E 
Sbjct  61   CAFPVCRSCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDLENEFDIASNER  120

Query  483  dYPEHMTEAALAARFNGGLG--VNGSGTT  563
              P  + EA LAAR N G G  VNGSG +
Sbjct  121  RDPHSIAEAVLAARLNIGRGSHVNGSGIS  149



>ref|XP_008358296.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
Length=1095

 Score =   223 bits (568),  Expect = 7e-64, Method: Composition-based stats.
 Identities = 117/149 (79%), Positives = 123/149 (83%), Gaps = 9/149 (6%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefdd-------ldhef  482
            CAFPVCR CYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DD          E 
Sbjct  61   CAFPVCRSCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDLENEFDIASXER  120

Query  483  dYPEHMTEAALAARFNGGLG--VNGSGTT  563
              P  + EA LAAR N G G  VNGSG +
Sbjct  121  RDPHSIAEAVLAARLNIGRGSHVNGSGIS  149



>ref|XP_009339472.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Pyrus x bretschneideri]
Length=1095

 Score =   223 bits (567),  Expect = 9e-64, Method: Composition-based stats.
 Identities = 116/149 (78%), Positives = 124/149 (83%), Gaps = 9/149 (6%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefdd-------ldhef  482
            CAFPVCR CYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DD         +E 
Sbjct  61   CAFPVCRSCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDLENEFDIASNEK  120

Query  483  dYPEHMTEAALAARFNGGLG--VNGSGTT  563
              P  + EA LAAR N G G  +NGSG +
Sbjct  121  RDPHSIAEAVLAARLNIGRGSHINGSGIS  149



>ref|XP_007199689.1| hypothetical protein PRUPE_ppa000559mg [Prunus persica]
 ref|XP_008237530.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Prunus mume]
 gb|EMJ00888.1| hypothetical protein PRUPE_ppa000559mg [Prunus persica]
Length=1096

 Score =   223 bits (567),  Expect = 9e-64, Method: Composition-based stats.
 Identities = 114/149 (77%), Positives = 125/149 (84%), Gaps = 9/149 (6%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefdd-------ldhef  482
            CAFPVCR CYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DD         ++ 
Sbjct  61   CAFPVCRSCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLENEFDISSNDR  120

Query  483  dYPEHMTEAALAARFNGGLG--VNGSGTT  563
              P H+ EA LAAR N G G  V+GSG +
Sbjct  121  RDPHHIAEAVLAARLNIGRGSHVHGSGIS  149



>dbj|BAG06272.1| cellulose synthase Z632 [Zinnia elegans]
Length=1090

 Score =   223 bits (567),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 115/139 (83%), Positives = 127/139 (91%), Gaps = 1/139 (1%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFVLINADE+GRVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  503
            CAFP+CRPCYEYERREGNQACPQCKTR+KRIKGSPRV+GDE+E+ FDDLDHEFD    ++
Sbjct  61   CAFPICRPCYEYERREGNQACPQCKTRFKRIKGSPRVDGDEDEDGFDDLDHEFDLANGVS  120

Query  504  EAALAARFNGGLGV-NGSG  557
            EA L++R N G G  N SG
Sbjct  121  EAGLSSRLNIGRGTSNASG  139



>gb|AAK49454.1|AF304374_1 cellulose synthase catalytic subunit [Nicotiana alata]
Length=1091

 Score =   222 bits (565),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 113/143 (79%), Positives = 129/143 (90%), Gaps = 3/143 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFV+INAD++GRVTSVKELSGQICQICGDE+E+TVDGEPF+ACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVVINADDVGRVTSVKELSGQICQICGDEIEVTVDGEPFIACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY---PE  494
            CAFPVCR CYEYERREGNQACPQCKTR+KRIKGSPRV+GD+E++EFDDLDHEFDY   P 
Sbjct  61   CAFPVCRQCYEYERREGNQACPQCKTRFKRIKGSPRVDGDDEDDEFDDLDHEFDYHGNPR  120

Query  495  HMTEAALAARFNGGLGVNGSGTT  563
            +M+EAA ++R   G   N SG T
Sbjct  121  YMSEAAFSSRLGRGTNHNASGLT  143



>ref|XP_011074751.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Sesamum indicum]
Length=1092

 Score =   221 bits (564),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 116/147 (79%), Positives = 128/147 (87%), Gaps = 9/147 (6%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFVLINADEIGRVTSVKEL+GQICQICGDE+E TVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEIGRVTSVKELTGQICQICGDEIEFTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYP----  491
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GDE+E+EFDDL++EFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDEDEDEFDDLENEFDYNGNER  120

Query  492  ---EHMTEAALAARFNGGLGVNGSGTT  563
               +H+ E AL+ R N  +G   SG T
Sbjct  121  RDHQHIAEGALSGRLN--IGRTASGIT  145



>ref|XP_004237809.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Solanum lycopersicum]
Length=1090

 Score =   221 bits (562),  Expect = 4e-63, Method: Composition-based stats.
 Identities = 119/141 (84%), Positives = 127/141 (90%), Gaps = 4/141 (3%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRLIAGSHNRNEFVLINADE+GRVTSVKELSGQICQICGDE+E+TVDGE FVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDEIEVTVDGETFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY---PE  494
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGS RV+GD+EE+EFDDLDHEFDY   P 
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSQRVDGDDEEDEFDDLDHEFDYDGTPR  120

Query  495  HMTEAALAARFNGGLGVNGSG  557
            H++EAAL AR   G   N SG
Sbjct  121  HLSEAAL-ARLGRGTNYNASG  140



>ref|XP_002265955.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Vitis vinifera]
Length=1096

 Score =   221 bits (562),  Expect = 5e-63, Method: Composition-based stats.
 Identities = 116/147 (79%), Positives = 127/147 (86%), Gaps = 7/147 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDL++EFD+     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDLENEFDFRSNYS  120

Query  489  --PEHMTEAALAARFNGGLGVNGSGTT  563
              P  + EA L+A  N G   + SG +
Sbjct  121  RDPHQVAEAMLSAHLNIGSHAHTSGIS  147



>ref|XP_010106861.1| Isoxaben-resistant protein 2 [Morus notabilis]
 gb|EXC12321.1| Isoxaben-resistant protein 2 [Morus notabilis]
Length=1121

 Score =   220 bits (561),  Expect = 8e-63, Method: Composition-based stats.
 Identities = 114/147 (78%), Positives = 127/147 (86%), Gaps = 7/147 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFV+INADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVVINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GDE+E++ DDL++EF       
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDEDEDDIDDLENEFHIANGGD  120

Query  489  PEHMTEAALAARFNGGLG--VNGSGTT  563
            P ++ EA LAAR N G    +NG G T
Sbjct  121  PNNIAEAMLAARLNVGRSSQINGFGIT  147



>emb|CBI18221.3| unnamed protein product [Vitis vinifera]
Length=1067

 Score =   220 bits (560),  Expect = 8e-63, Method: Composition-based stats.
 Identities = 116/147 (79%), Positives = 127/147 (86%), Gaps = 7/147 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDL++EFD+     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDLENEFDFRSNYS  120

Query  489  --PEHMTEAALAARFNGGLGVNGSGTT  563
              P  + EA L+A  N G   + SG +
Sbjct  121  RDPHQVAEAMLSAHLNIGSHAHTSGIS  147



>gb|AFZ78561.1| cellulose synthase [Populus tomentosa]
Length=1097

 Score =   220 bits (560),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 115/140 (82%), Positives = 124/140 (89%), Gaps = 7/140 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQIC+ICGDE+EITVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQC+TRYKRIKGSPRV+GDEEEE+ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCRTRYKRIKGSPRVDGDEEEEDTDDLENEFDIGINDR  120

Query  489  --PEHMTEAALAARFNGGLG  542
              P  +TEA LAAR N G G
Sbjct  121  RDPHQVTEALLAARLNTGRG  140



>ref|XP_002302169.1| CesA7A-like family protein [Populus trichocarpa]
 gb|EEE81442.1| CesA7A-like family protein [Populus trichocarpa]
Length=1093

 Score =   219 bits (558),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 113/140 (81%), Positives = 124/140 (89%), Gaps = 7/140 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQIC+ICGDE+E+TVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEVTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQC+TRYKRIKGSPRV+GDEEEE+ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCRTRYKRIKGSPRVDGDEEEEDTDDLENEFDIGVNDR  120

Query  489  --PEHMTEAALAARFNGGLG  542
              P H+ EA L+AR N G G
Sbjct  121  RDPRHVAEALLSARLNTGRG  140



>ref|XP_010241683.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nelumbo nucifera]
Length=1095

 Score =   219 bits (557),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 115/146 (79%), Positives = 125/146 (86%), Gaps = 6/146 (4%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT GRL+AGSHNRNEFVLINADEIGRV SV+ELSGQICQICGDEVEIT DGEPFVACNE
Sbjct  1    MDTGGRLVAGSHNRNEFVLINADEIGRVKSVRELSGQICQICGDEVEITEDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  491
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GDEEE+  DDL++EFD+     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDEEEDGIDDLENEFDFRSRDT  120

Query  492  EHMTEAALAARFNGGLG--VNGSGTT  563
            +H  EA L++R N G G   N SG T
Sbjct  121  QHTAEAILSSRLNVGRGPNANASGVT  146



>ref|XP_011042869.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Populus euphratica]
Length=1093

 Score =   219 bits (557),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 113/140 (81%), Positives = 124/140 (89%), Gaps = 7/140 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQIC+ICGDE+E+TVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEVTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQC+TRYKRIKGSPRV+GDEEEE+ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCRTRYKRIKGSPRVDGDEEEEDTDDLENEFDIGVNDR  120

Query  489  --PEHMTEAALAARFNGGLG  542
              P H+ EA L+AR N G G
Sbjct  121  KDPRHVAEALLSARLNTGRG  140



>ref|XP_009376550.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Pyrus x bretschneideri]
Length=1095

 Score =   218 bits (556),  Expect = 4e-62, Method: Composition-based stats.
 Identities = 115/149 (77%), Positives = 123/149 (83%), Gaps = 9/149 (6%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefdd-------ldhef  482
            CAFPVCR CYEYERREGNQACPQCKTRYKRIKGS RVEGDEEE++ DD         +E 
Sbjct  61   CAFPVCRSCYEYERREGNQACPQCKTRYKRIKGSQRVEGDEEEDDIDDLENEFDIASNER  120

Query  483  dYPEHMTEAALAARFNGGLG--VNGSGTT  563
              P  + EA LAAR N G G  +NGSG +
Sbjct  121  RDPHSIAEAVLAARLNIGRGSHLNGSGIS  149



>gb|AAT09895.1| cellulose synthase [Populus tremula x Populus tremuloides]
Length=1095

 Score =   218 bits (555),  Expect = 5e-62, Method: Composition-based stats.
 Identities = 111/140 (79%), Positives = 124/140 (89%), Gaps = 7/140 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQIC+ICGDE+E+TVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEVTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQC+TRYKRIKGSP+V+GDEEEE+ DDL++EF+      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCRTRYKRIKGSPKVDGDEEEEDTDDLENEFEIGVNDR  120

Query  489  --PEHMTEAALAARFNGGLG  542
              P H+ EA L+AR N G G
Sbjct  121  RDPRHVAEALLSARLNTGRG  140



>ref|XP_011044242.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Populus euphratica]
Length=1095

 Score =   217 bits (552),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 113/140 (81%), Positives = 123/140 (88%), Gaps = 7/140 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+TKGRL+AGSHNRNEFVLINADEI RVTSVKELSGQIC+ICGDE+EITVDGEPFVACNE
Sbjct  1    METKGRLVAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQC+TRYKRIKGSPRV+GDEEEE+ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCRTRYKRIKGSPRVDGDEEEEDTDDLENEFDMGINDR  120

Query  489  --PEHMTEAALAARFNGGLG  542
              P  + EA LAAR N G G
Sbjct  121  RDPHQVAEALLAARLNTGRG  140



>ref|XP_002306707.1| CesA7A-like family protein [Populus trichocarpa]
 gb|EEE93703.1| CesA7A-like family protein [Populus trichocarpa]
Length=1095

 Score =   217 bits (552),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 114/140 (81%), Positives = 123/140 (88%), Gaps = 7/140 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQIC+ICGDE+EITVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQC+TRYKRIKGSPRV+GDEEEE+ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCRTRYKRIKGSPRVDGDEEEEDTDDLENEFDIGINDR  120

Query  489  --PEHMTEAALAARFNGGLG  542
              P  + EA LAAR N G G
Sbjct  121  RDPHQVAEALLAARLNTGRG  140



>ref|XP_004138382.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Cucumis sativus]
 ref|XP_004160741.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Cucumis sativus]
Length=1090

 Score =   217 bits (552),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 93/97 (96%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>ref|XP_008463088.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X2 [Cucumis melo]
Length=1090

 Score =   217 bits (552),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 93/97 (96%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>ref|XP_008463087.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X1 [Cucumis melo]
Length=1091

 Score =   217 bits (552),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 93/97 (96%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>ref|XP_010520165.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming] 
[Tarenaya hassleriana]
Length=1066

 Score =   216 bits (549),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 107/132 (81%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADENARIRSVQELSGQICQICGDEIELTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  503
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE+  DDLD+EFDYP+H++
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDGIDDLDNEFDYPDHVS  120

Query  504  EAALAARFNGGL  539
            E  L++R + G+
Sbjct  121  EGMLSSRHHSGI  132



>ref|XP_004290503.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Fragaria vesca subsp. vesca]
Length=1093

 Score =   216 bits (549),  Expect = 3e-61, Method: Composition-based stats.
 Identities = 112/149 (75%), Positives = 123/149 (83%), Gaps = 9/149 (6%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefdd-------ldhef  482
            CAFPVCR CYEYERREGNQ+CPQCKTRYKR+KGSPRVEGDEEEE+ DD         ++ 
Sbjct  61   CAFPVCRSCYEYERREGNQSCPQCKTRYKRVKGSPRVEGDEEEEDIDDLENEFDIASNDR  120

Query  483  dYPEHMTEAALAARFNGGLG--VNGSGTT  563
              P  +  A LAAR N G G  V+GSG +
Sbjct  121  RDPHQIAAAVLAARLNIGRGSQVHGSGIS  149



>ref|XP_007019545.1| Cellulose synthase 6 [Theobroma cacao]
 gb|EOY16770.1| Cellulose synthase 6 [Theobroma cacao]
Length=1091

 Score =   216 bits (549),  Expect = 3e-61, Method: Composition-based stats.
 Identities = 111/136 (82%), Positives = 119/136 (88%), Gaps = 7/136 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFVLINADEI RVTSVKELSGQICQICGDE+EI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEIARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKG PRVEGDEEE+  DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGCPRVEGDEEEDGADDLENEFDIANHDR  120

Query  489  --PEHMTEAALAARFN  530
              P H+  A L+AR N
Sbjct  121  RDPHHIAAAMLSARLN  136



>gb|KJB14950.1| hypothetical protein B456_002G150300 [Gossypium raimondii]
 gb|KJB14951.1| hypothetical protein B456_002G150300 [Gossypium raimondii]
Length=1095

 Score =   215 bits (548),  Expect = 4e-61, Method: Composition-based stats.
 Identities = 115/144 (80%), Positives = 122/144 (85%), Gaps = 6/144 (4%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  491
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDLD+EFDY    P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDLDNEFDYDALDP  120

Query  492  EHMTEAALAARFNGGLGV--NGSG  557
            + + EA L    N G G   NGSG
Sbjct  121  QQVAEAMLGGHLNTGRGFHPNGSG  144



>gb|AFB18634.1| CESA5 [Gossypium hirsutum]
Length=1095

 Score =   215 bits (548),  Expect = 4e-61, Method: Composition-based stats.
 Identities = 115/144 (80%), Positives = 122/144 (85%), Gaps = 6/144 (4%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  491
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDLD+EFDY    P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDLDNEFDYDALDP  120

Query  492  EHMTEAALAARFNGGLGV--NGSG  557
            + + EA L    N G G   NGSG
Sbjct  121  QQVAEAMLGGHLNTGRGFHPNGSG  144



>gb|KHG02518.1| Cellulose synthase A catalytic subunit 2 [UDP-forming] [Gossypium 
arboreum]
Length=1095

 Score =   215 bits (547),  Expect = 6e-61, Method: Composition-based stats.
 Identities = 115/144 (80%), Positives = 122/144 (85%), Gaps = 6/144 (4%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  491
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDLD+EFDY    P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDLDNEFDYDALDP  120

Query  492  EHMTEAALAARFNGGLGV--NGSG  557
            + + EA L    N G G   NGSG
Sbjct  121  QQVAEAMLGGHLNTGRGFHPNGSG  144



>gb|KDP35302.1| hypothetical protein JCGZ_09461 [Jatropha curcas]
Length=1097

 Score =   215 bits (547),  Expect = 6e-61, Method: Composition-based stats.
 Identities = 110/138 (80%), Positives = 122/138 (88%), Gaps = 7/138 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRL+AGSHNRNEFVLINADE GR+ SV+ELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADESGRIKSVQELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDEEEDDIDDLEHEFDYGNFDG  120

Query  489  --PEHMTEAALAARFNGG  536
              PE + EA L+AR N G
Sbjct  121  MGPEQVAEAMLSARLNTG  138



>ref|XP_007048203.1| Cellulose synthase 6 [Theobroma cacao]
 gb|EOX92360.1| Cellulose synthase 6 [Theobroma cacao]
Length=1096

 Score =   215 bits (547),  Expect = 7e-61, Method: Composition-based stats.
 Identities = 113/137 (82%), Positives = 120/137 (88%), Gaps = 4/137 (3%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT GRLIAGSHNRNEFVLINADE GR+ SV+ELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENGRIKSVQELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  491
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDLD+EFDY    P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDLDNEFDYDALDP  120

Query  492  EHMTEAALAARFNGGLG  542
              + EA L AR N G G
Sbjct  121  HQVAEAMLTARLNTGRG  137



>gb|AFZ78560.1| cellulose synthase [Populus tomentosa]
Length=1093

 Score =   214 bits (546),  Expect = 7e-61, Method: Composition-based stats.
 Identities = 111/140 (79%), Positives = 122/140 (87%), Gaps = 7/140 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+TKGRLIAGSHNRNEFVLINADEI RVT  KELSGQIC+ICGDE+E+TVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTPFKELSGQICKICGDEIEVTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQC+TRYKRIKGSPRV+GDEEEE+ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCRTRYKRIKGSPRVDGDEEEEDTDDLENEFDIGVNDR  120

Query  489  --PEHMTEAALAARFNGGLG  542
              P H+ EA L+AR N G G
Sbjct  121  RDPRHVAEALLSARLNTGRG  140



>gb|AGV22110.1| cellulose synthase 8 [Betula luminifera]
Length=1091

 Score =   214 bits (545),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 111/143 (78%), Positives = 123/143 (86%), Gaps = 3/143 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRLIAGSHNRNEF+LINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFILINADEVARVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhe---fdYPE  494
            CAFPVCRPCYEYERREGNQACPQCKTR+KRIKG PRVEGDEEEE+ DDL++E        
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRFKRIKGCPRVEGDEEEEDTDDLENEFDIGSNSH  120

Query  495  HMTEAALAARFNGGLGVNGSGTT  563
            ++ EA L+AR N G G + +  T
Sbjct  121  NIAEAMLSARLNVGRGSHATIAT  143



>gb|KJB18370.1| hypothetical protein B456_003G049300 [Gossypium raimondii]
Length=1096

 Score =   214 bits (545),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 115/144 (80%), Positives = 122/144 (85%), Gaps = 6/144 (4%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  491
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE+  DDLD+EFDY    P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDGIDDLDNEFDYDASDP  120

Query  492  EHMTEAALAARFNGGLGV--NGSG  557
            + + EA L AR N G G   N SG
Sbjct  121  QQVAEAMLNARLNTGRGTHQNASG  144



>gb|KJB18373.1| hypothetical protein B456_003G049300 [Gossypium raimondii]
Length=1082

 Score =   214 bits (544),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 115/144 (80%), Positives = 122/144 (85%), Gaps = 6/144 (4%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  491
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE+  DDLD+EFDY    P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDGIDDLDNEFDYDASDP  120

Query  492  EHMTEAALAARFNGGLGV--NGSG  557
            + + EA L AR N G G   N SG
Sbjct  121  QQVAEAMLNARLNTGRGTHQNASG  144



>ref|XP_008232182.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Prunus mume]
Length=1095

 Score =   214 bits (544),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 109/140 (78%), Positives = 122/140 (87%), Gaps = 7/140 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT+GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTRGRLVAGSHNRNEFVLINADENARIKSVQELSGQICQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGD+EE++ DDLD+EF+Y     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDDEEDDIDDLDNEFNYGNLDT  120

Query  489  --PEHMTEAALAARFNGGLG  542
              P  + EA L++R N G G
Sbjct  121  MGPHQVAEAVLSSRLNIGRG  140



>gb|EPS58530.1| hypothetical protein M569_16283, partial [Genlisea aurea]
Length=343

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 125/142 (88%), Gaps = 4/142 (3%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MD  GRL+AGSHNRNEFVLINADEIG+VTSVKELSGQICQICGDE+E  +DGEPFVACNE
Sbjct  1    MDATGRLVAGSHNRNEFVLINADEIGKVTSVKELSGQICQICGDEIEFKIDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYP--EH  497
            CAFPVCRPCYEYERREGNQ+CPQCKTRYKRIKGSPRV+GDE+EEEFDDL+HEFDY   E 
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCKTRYKRIKGSPRVDGDEDEEEFDDLEHEFDYDGNEQ  120

Query  498  MTEAALAARFNGGLGVNGSGTT  563
            + E AL++RFN  +    SG T
Sbjct  121  IAEPALSSRFN--ISRTASGIT  140



>ref|XP_007213713.1| hypothetical protein PRUPE_ppa000567mg [Prunus persica]
 gb|EMJ14912.1| hypothetical protein PRUPE_ppa000567mg [Prunus persica]
Length=1095

 Score =   213 bits (543),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 109/140 (78%), Positives = 122/140 (87%), Gaps = 7/140 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT+GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTRGRLVAGSHNRNEFVLINADENARIKSVQELSGQICQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGD+EE++ DDLD+EF+Y     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDDEEDDIDDLDNEFNYGNLDT  120

Query  489  --PEHMTEAALAARFNGGLG  542
              P  + EA L++R N G G
Sbjct  121  MGPHQVAEAVLSSRLNIGRG  140



>gb|KHG24947.1| Cellulose synthase A catalytic subunit 2 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1071

 Score =   213 bits (542),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 112/139 (81%), Positives = 121/139 (87%), Gaps = 4/139 (3%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  491
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDLD+EFDY    P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDLDNEFDYDASDP  120

Query  492  EHMTEAALAARFNGGLGVN  548
            + + EA L AR N G G +
Sbjct  121  QQVAEAMLNARLNTGRGTH  139



>gb|KJB18372.1| hypothetical protein B456_003G049300 [Gossypium raimondii]
Length=1008

 Score =   212 bits (540),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 115/144 (80%), Positives = 122/144 (85%), Gaps = 6/144 (4%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  491
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE+  DDLD+EFDY    P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDGIDDLDNEFDYDASDP  120

Query  492  EHMTEAALAARFNGGLGV--NGSG  557
            + + EA L AR N G G   N SG
Sbjct  121  QQVAEAMLNARLNTGRGTHQNASG  144



>ref|XP_003531396.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Glycine max]
 gb|KHN29142.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine 
soja]
Length=1097

 Score =   213 bits (541),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 114/146 (78%), Positives = 125/146 (86%), Gaps = 8/146 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M T GRL+AGSHNRNEFVLINADE GR+ SV+ELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MHTGGRLVAGSHNRNEFVLINADENGRIKSVRELSGQICQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDLD+EFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDTDDLDNEFDYGDIDA  120

Query  489  --PEHMTEAALAARFNGGLGV-NGSG  557
              P+ M+E+  + R N G G  NGSG
Sbjct  121  LGPQPMSESLYSGRPNTGRGANNGSG  146



>gb|KJB66303.1| hypothetical protein B456_010G134500 [Gossypium raimondii]
Length=1090

 Score =   212 bits (540),  Expect = 5e-60, Method: Composition-based stats.
 Identities = 91/97 (94%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFVLINADEI RVTSVKELSGQICQICGDE+EI++DGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEIARVTSVKELSGQICQICGDEIEISLDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKG PRV
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGCPRV  97



>ref|XP_007159799.1| hypothetical protein PHAVU_002G268200g [Phaseolus vulgaris]
 gb|ESW31793.1| hypothetical protein PHAVU_002G268200g [Phaseolus vulgaris]
Length=1097

 Score =   212 bits (540),  Expect = 5e-60, Method: Composition-based stats.
 Identities = 110/144 (76%), Positives = 122/144 (85%), Gaps = 7/144 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M T GRL+AGSHNRNEFVLINADE GR+ SV+ELSGQICQICGDE+E+TVDGEPFVACNE
Sbjct  1    MHTGGRLVAGSHNRNEFVLINADENGRIKSVRELSGQICQICGDEIEVTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDE+EE  DDLD+EFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEDEEGSDDLDNEFDYGDFDA  120

Query  489  --PEHMTEAALAARFNGGLGVNGS  554
               + M+E+  + R N G G NG+
Sbjct  121  MGTQPMSESLFSGRLNTGRGANGA  144



>gb|EYU17481.1| hypothetical protein MIMGU_mgv1a000527mg [Erythranthe guttata]
Length=1093

 Score =   212 bits (540),  Expect = 5e-60, Method: Composition-based stats.
 Identities = 91/97 (94%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT GRL+AGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVE TVDGEPFVACNE
Sbjct  1    MDTNGRLVAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEFTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFP+CRPCYEYERREGNQ+CPQCKTR+KRIKGSPRV
Sbjct  61   CAFPICRPCYEYERREGNQSCPQCKTRFKRIKGSPRV  97



>gb|KDO83761.1| hypothetical protein CISIN_1g001373mg [Citrus sinensis]
Length=1089

 Score =   212 bits (540),  Expect = 6e-60, Method: Composition-based stats.
 Identities = 109/138 (79%), Positives = 121/138 (88%), Gaps = 5/138 (4%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M T GRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EIT +GEPFVACNE
Sbjct  1    MATNGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITDNGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GDEEE++ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDEEEDDTDDLENEFDINDRKD  120

Query  489  PEHMTEAALAARFNGGLG  542
            P H+ EA L++R N G G
Sbjct  121  PHHIAEAMLSSRLNIGRG  138



>gb|KDO83760.1| hypothetical protein CISIN_1g001373mg [Citrus sinensis]
Length=1091

 Score =   212 bits (540),  Expect = 6e-60, Method: Composition-based stats.
 Identities = 109/138 (79%), Positives = 121/138 (88%), Gaps = 5/138 (4%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M T GRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EIT +GEPFVACNE
Sbjct  1    MATNGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITDNGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GDEEE++ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDEEEDDTDDLENEFDINDRKD  120

Query  489  PEHMTEAALAARFNGGLG  542
            P H+ EA L++R N G G
Sbjct  121  PHHIAEAMLSSRLNIGRG  138



>ref|XP_006473074.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Citrus sinensis]
Length=1091

 Score =   212 bits (540),  Expect = 6e-60, Method: Composition-based stats.
 Identities = 109/138 (79%), Positives = 121/138 (88%), Gaps = 5/138 (4%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M T GRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EIT +GEPFVACNE
Sbjct  1    MATNGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITDNGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GDEEE++ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDEEEDDTDDLENEFDINDRKD  120

Query  489  PEHMTEAALAARFNGGLG  542
            P H+ EA L++R N G G
Sbjct  121  PHHIAEAMLSSRLNIGRG  138



>ref|XP_006434481.1| hypothetical protein CICLE_v10000103mg [Citrus clementina]
 gb|ESR47721.1| hypothetical protein CICLE_v10000103mg [Citrus clementina]
Length=1091

 Score =   212 bits (540),  Expect = 6e-60, Method: Composition-based stats.
 Identities = 109/138 (79%), Positives = 121/138 (88%), Gaps = 5/138 (4%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M T GRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EIT +GEPFVACNE
Sbjct  1    MATNGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITDNGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GDEEE++ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDEEEDDTDDLENEFDINDRKD  120

Query  489  PEHMTEAALAARFNGGLG  542
            P H+ EA L++R N G G
Sbjct  121  PHHIAEAMLSSRLNIGRG  138



>ref|XP_002307145.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE94141.1| cellulose synthase family protein [Populus trichocarpa]
Length=1096

 Score =   212 bits (539),  Expect = 8e-60, Method: Composition-based stats.
 Identities = 110/138 (80%), Positives = 121/138 (88%), Gaps = 7/138 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDTDDLEHEFDYGNLDG  120

Query  489  --PEHMTEAALAARFNGG  536
              PE + EA L++R N G
Sbjct  121  LSPEQVAEAMLSSRINTG  138



>gb|AEE60899.1| cellulose synthase [Populus tomentosa]
Length=1100

 Score =   212 bits (539),  Expect = 8e-60, Method: Composition-based stats.
 Identities = 114/145 (79%), Positives = 123/145 (85%), Gaps = 12/145 (8%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGR-----VTSVKELSGQICQICGDEVEITVDGEPF  308
            M+TKGRLIAGSHNRNEFVLINADEI R     VTSVKELSGQIC+ICGDE+EITVDGEPF
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARLLSIPVTSVKELSGQICKICGDEIEITVDGEPF  60

Query  309  VACNECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY  488
            VACNECAFPVCRPCYEYERREGNQACPQC+TRYKRIKGSPRV+GDEEEE+ DDL++EFD 
Sbjct  61   VACNECAFPVCRPCYEYERREGNQACPQCRTRYKRIKGSPRVDGDEEEEDTDDLENEFDI  120

Query  489  -------PEHMTEAALAARFNGGLG  542
                   P  + EA LAAR N G G
Sbjct  121  GINDRRDPHQVAEALLAARLNTGRG  145



>gb|KJB59451.1| hypothetical protein B456_009G255100 [Gossypium raimondii]
Length=1064

 Score =   211 bits (538),  Expect = 9e-60, Method: Composition-based stats.
 Identities = 108/136 (79%), Positives = 118/136 (87%), Gaps = 7/136 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCR CYEYERREGNQACPQCKTRYKRIKG PRVEGDEEE+  DDL++EFD      
Sbjct  61   CAFPVCRACYEYERREGNQACPQCKTRYKRIKGCPRVEGDEEEDGADDLENEFDIASHDR  120

Query  489  --PEHMTEAALAARFN  530
              P H+  A L+ R+N
Sbjct  121  RDPHHIAAAMLSGRYN  136



>gb|KJB59449.1| hypothetical protein B456_009G255100 [Gossypium raimondii]
Length=1090

 Score =   211 bits (538),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 108/136 (79%), Positives = 118/136 (87%), Gaps = 7/136 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCR CYEYERREGNQACPQCKTRYKRIKG PRVEGDEEE+  DDL++EFD      
Sbjct  61   CAFPVCRACYEYERREGNQACPQCKTRYKRIKGCPRVEGDEEEDGADDLENEFDIASHDR  120

Query  489  --PEHMTEAALAARFN  530
              P H+  A L+ R+N
Sbjct  121  RDPHHIAAAMLSGRYN  136



>gb|KHG29218.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1090

 Score =   211 bits (538),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 108/136 (79%), Positives = 118/136 (87%), Gaps = 7/136 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCR CYEYERREGNQACPQCKTRYKRIKG PRVEGDEEE+  DDL++EFD      
Sbjct  61   CAFPVCRACYEYERREGNQACPQCKTRYKRIKGCPRVEGDEEEDGADDLENEFDIASHDR  120

Query  489  --PEHMTEAALAARFN  530
              P H+  A L+ R+N
Sbjct  121  RDPHHIAAAMLSGRYN  136



>ref|XP_011013552.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X3 [Populus euphratica]
Length=1096

 Score =   211 bits (537),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 110/138 (80%), Positives = 121/138 (88%), Gaps = 7/138 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLEHEFDYGNFDG  120

Query  489  --PEHMTEAALAARFNGG  536
              PE + EA L++R N G
Sbjct  121  LSPEQVAEAMLSSRMNTG  138



>ref|XP_011013550.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X1 [Populus euphratica]
 ref|XP_011013551.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X2 [Populus euphratica]
Length=1097

 Score =   211 bits (537),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 110/138 (80%), Positives = 121/138 (88%), Gaps = 7/138 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLEHEFDYGNFDG  120

Query  489  --PEHMTEAALAARFNGG  536
              PE + EA L++R N G
Sbjct  121  LSPEQVAEAMLSSRMNTG  138



>gb|AAT09898.1| cellulose synthase [Populus tremula x Populus tremuloides]
Length=1096

 Score =   211 bits (536),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 110/138 (80%), Positives = 121/138 (88%), Gaps = 7/138 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLEHEFDYGNLEG  120

Query  489  --PEHMTEAALAARFNGG  536
              PE + EA L++R N G
Sbjct  121  LSPEQVAEAMLSSRINTG  138



>gb|KJB59452.1| hypothetical protein B456_009G255100 [Gossypium raimondii]
Length=1035

 Score =   210 bits (535),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 108/136 (79%), Positives = 118/136 (87%), Gaps = 7/136 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCR CYEYERREGNQACPQCKTRYKRIKG PRVEGDEEE+  DDL++EFD      
Sbjct  61   CAFPVCRACYEYERREGNQACPQCKTRYKRIKGCPRVEGDEEEDGADDLENEFDIASHDR  120

Query  489  --PEHMTEAALAARFN  530
              P H+  A L+ R+N
Sbjct  121  RDPHHIAAAMLSGRYN  136



>gb|EYU36833.1| hypothetical protein MIMGU_mgv1a000540mg [Erythranthe guttata]
Length=1087

 Score =   211 bits (536),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 88/97 (91%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT GRL+AGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDE+E + DGEPFVACNE
Sbjct  1    MDTNGRLVAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEIEFSADGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFP+CRPCYEYERREGNQ+CPQCKTR+KRIKGSPRV
Sbjct  61   CAFPICRPCYEYERREGNQSCPQCKTRFKRIKGSPRV  97



>ref|XP_009758840.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana sylvestris]
Length=1094

 Score =   210 bits (535),  Expect = 3e-59, Method: Composition-based stats.
 Identities = 90/97 (93%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADEIGR+ SV+ELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  3    MNTGGRLIAGSHNRNEFVLINADEIGRIKSVRELSGQVCQICGDEIEITVDGEPFVACNE  62

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV
Sbjct  63   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  99



>ref|XP_007213712.1| hypothetical protein PRUPE_ppa000567mg [Prunus persica]
 gb|EMJ14911.1| hypothetical protein PRUPE_ppa000567mg [Prunus persica]
Length=853

 Score =   208 bits (530),  Expect = 3e-59, Method: Composition-based stats.
 Identities = 109/140 (78%), Positives = 122/140 (87%), Gaps = 7/140 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT+GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTRGRLVAGSHNRNEFVLINADENARIKSVQELSGQICQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGD+EE++ DDLD+EF+Y     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDDEEDDIDDLDNEFNYGNLDT  120

Query  489  --PEHMTEAALAARFNGGLG  542
              P  + EA L++R N G G
Sbjct  121  MGPHQVAEAVLSSRLNIGRG  140



>ref|XP_002524299.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
 gb|EEF38039.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
Length=1095

 Score =   210 bits (535),  Expect = 3e-59, Method: Composition-based stats.
 Identities = 92/97 (95%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGN+ACPQCKT YKRIKGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNRACPQCKTIYKRIKGSPRV  97



>gb|KDO83762.1| hypothetical protein CISIN_1g001373mg [Citrus sinensis]
Length=917

 Score =   208 bits (530),  Expect = 4e-59, Method: Composition-based stats.
 Identities = 109/138 (79%), Positives = 121/138 (88%), Gaps = 5/138 (4%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M T GRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EIT +GEPFVACNE
Sbjct  1    MATNGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITDNGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GDEEE++ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDEEEDDTDDLENEFDINDRKD  120

Query  489  PEHMTEAALAARFNGGLG  542
            P H+ EA L++R N G G
Sbjct  121  PHHIAEAMLSSRLNIGRG  138



>ref|XP_009629755.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana tomentosiformis]
Length=1094

 Score =   209 bits (533),  Expect = 6e-59, Method: Composition-based stats.
 Identities = 89/97 (92%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADEIGR+ SV+ELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  3    MNTGGRLIAGSHNRNEFVLINADEIGRIKSVRELSGQVCQICGDEIEITVDGEPFVACNE  62

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFP+CRPCYEYERREGNQACPQCKTRYKRIKGSPRV
Sbjct  63   CAFPICRPCYEYERREGNQACPQCKTRYKRIKGSPRV  99



>gb|KJB59450.1| hypothetical protein B456_009G255100 [Gossypium raimondii]
Length=902

 Score =   207 bits (528),  Expect = 6e-59, Method: Composition-based stats.
 Identities = 105/136 (77%), Positives = 114/136 (84%), Gaps = 7/136 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefdd-------ldhef  482
            CAFPVCR CYEYERREGNQACPQCKTRYKRIKG PRVEGDEEE+  DD         H+ 
Sbjct  61   CAFPVCRACYEYERREGNQACPQCKTRYKRIKGCPRVEGDEEEDGADDLENEFDIASHDR  120

Query  483  dYPEHMTEAALAARFN  530
              P H+  A L+ R+N
Sbjct  121  RDPHHIAAAMLSGRYN  136



>gb|AFZ78553.1| cellulose synthase [Populus tomentosa]
Length=1096

 Score =   209 bits (532),  Expect = 6e-59, Method: Composition-based stats.
 Identities = 109/138 (79%), Positives = 120/138 (87%), Gaps = 7/138 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQ CPQCKTRYKR+KGSPRVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQVCPQCKTRYKRLKGSPRVEGDEEEDDTDDLEHEFDYGNLDG  120

Query  489  --PEHMTEAALAARFNGG  536
              PE + EA L++R N G
Sbjct  121  LSPEQVAEAMLSSRINTG  138



>gb|KDP30751.1| hypothetical protein JCGZ_15180 [Jatropha curcas]
Length=1092

 Score =   209 bits (532),  Expect = 8e-59, Method: Composition-based stats.
 Identities = 108/138 (78%), Positives = 116/138 (84%), Gaps = 7/138 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+TKGRLIAGSHNRNEFVLINADEI RVTSV+ELSGQICQICGDE+E T DGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEISRVTSVEELSGQICQICGDEIEFTRDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefdd-------ldhef  482
            CAFPVCR CYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEE+ DD         H+ 
Sbjct  61   CAFPVCRHCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEEDIDDLENEFDISAHDR  120

Query  483  dYPEHMTEAALAARFNGG  536
              P+H+ EA L+A  N G
Sbjct  121  RDPQHIAEAMLSAHLNIG  138



>ref|XP_002310629.1| hypothetical protein POPTR_0007s07120g [Populus trichocarpa]
 gb|EEE91079.1| hypothetical protein POPTR_0007s07120g [Populus trichocarpa]
Length=1095

 Score =   208 bits (530),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 108/138 (78%), Positives = 120/138 (87%), Gaps = 7/138 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+C ICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQVCHICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLEHEFDYGNFDG  120

Query  489  --PEHMTEAALAARFNGG  536
              PE + EA L++R N G
Sbjct  121  LSPEQVAEAMLSSRMNTG  138



>ref|XP_002310628.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE91078.1| cellulose synthase family protein [Populus trichocarpa]
Length=1096

 Score =   208 bits (530),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 108/138 (78%), Positives = 120/138 (87%), Gaps = 7/138 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+C ICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQVCHICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLEHEFDYGNFDG  120

Query  489  --PEHMTEAALAARFNGG  536
              PE + EA L++R N G
Sbjct  121  LSPEQVAEAMLSSRMNTG  138



>gb|AFB18639.1| CESA9 [Gossypium hirsutum]
Length=1090

 Score =   208 bits (530),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 107/136 (79%), Positives = 117/136 (86%), Gaps = 7/136 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AG HNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGPHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCR CYEYERREGNQACPQCKTRYKRIKG PRVEGDEEE+  DDL++EFD      
Sbjct  61   CAFPVCRACYEYERREGNQACPQCKTRYKRIKGCPRVEGDEEEDGADDLENEFDIASHDR  120

Query  489  --PEHMTEAALAARFN  530
              P H+  A L+ R+N
Sbjct  121  RDPHHIAAAMLSGRYN  136



>gb|AAO25581.1| cellulose synthase [Populus tremuloides]
Length=1096

 Score =   208 bits (529),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 109/138 (79%), Positives = 120/138 (87%), Gaps = 7/138 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDTDDLEHEFDYGNLDG  120

Query  489  --PEHMTEAALAARFNGG  536
              PE + EA L++R   G
Sbjct  121  LSPEQVAEAMLSSRITLG  138



>ref|XP_011021978.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
isoform X1 [Populus euphratica]
 ref|XP_011021979.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
isoform X2 [Populus euphratica]
Length=1097

 Score =   207 bits (528),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 109/138 (79%), Positives = 120/138 (87%), Gaps = 7/138 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLEHEFDYGNLDG  120

Query  489  --PEHMTEAALAARFNGG  536
              PE + EA L++  N G
Sbjct  121  LSPEQVAEAMLSSGMNTG  138



>ref|XP_011021980.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
isoform X3 [Populus euphratica]
Length=1096

 Score =   207 bits (528),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 109/138 (79%), Positives = 120/138 (87%), Gaps = 7/138 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLEHEFDYGNLDG  120

Query  489  --PEHMTEAALAARFNGG  536
              PE + EA L++  N G
Sbjct  121  LSPEQVAEAMLSSGMNTG  138



>ref|XP_011042923.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Populus euphratica]
Length=943

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 124/140 (89%), Gaps = 7/140 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQIC+ICGDE+E+TVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEVTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQC+TRYKR+KGSPRV+GDEEEE+ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCRTRYKRVKGSPRVDGDEEEEDTDDLENEFDIGVNDR  120

Query  489  --PEHMTEAALAARFNGGLG  542
              P H+ EA L+AR N G G
Sbjct  121  KDPRHVAEALLSARLNTGRG  140



>ref|XP_003536418.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Glycine max]
 gb|KHN17022.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine 
soja]
Length=1095

 Score =   207 bits (526),  Expect = 6e-58, Method: Composition-based stats.
 Identities = 110/149 (74%), Positives = 122/149 (82%), Gaps = 9/149 (6%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFVLINADE  RV +V ELSGQICQICGDE+E+TVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADETARVNAVTELSGQICQICGDEIEVTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGN+ CPQCKT YKR+KGSPRVEGDEEEE+ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNKICPQCKTIYKRLKGSPRVEGDEEEEDIDDLENEFDIGSNIR  120

Query  489  --PEHMTEAALAARFNGGLG--VNGSGTT  563
              P H+ EA L+AR N   G  +N  G T
Sbjct  121  HDPHHVAEALLSARLNAARGSQMNAPGIT  149



>emb|CDP12843.1| unnamed protein product [Coffea canephora]
Length=1093

 Score =   206 bits (524),  Expect = 8e-58, Method: Composition-based stats.
 Identities = 89/97 (92%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT GRLIAGSHNRNEFVLINAD+IG++ SV+ELSGQICQICGDEVEITVDGE FVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADDIGKIKSVQELSGQICQICGDEVEITVDGELFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKG PRV
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGDPRV  97



>gb|AHL45027.1| cellulose synthase 6A [Linum usitatissimum]
Length=1096

 Score =   206 bits (523),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 112/148 (76%), Positives = 124/148 (84%), Gaps = 9/148 (6%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE GR+ SV+ELSGQ+CQICGDE+EIT DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESGRIQSVRELSGQVCQICGDEIEITADGELFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREG QACPQC+TR+KR+KGS RVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGTQACPQCRTRFKRLKGSARVEGDEEEDDIDDLEHEFDYGNLES  120

Query  489  --PEHMTEAALAARFNGGLG--VNGSGT  560
              PE +TE  LAAR N G G  VNG GT
Sbjct  121  LTPEQVTELMLAARLNTGRGSQVNGFGT  148



>gb|KHN34038.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine 
soja]
Length=1097

 Score =   205 bits (522),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 111/146 (76%), Positives = 123/146 (84%), Gaps = 8/146 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M T GRL+AGSHNRNEFVLINAD+ GR+ SV+ELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MHTGGRLVAGSHNRNEFVLINADDNGRIKSVRELSGQICQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREG QACPQC TRYKRIKGSPRVEGDEEE++ DDLD+EFDY     
Sbjct  61   CAFPVCRPCYEYERREGIQACPQCNTRYKRIKGSPRVEGDEEEDDTDDLDNEFDYGDVDA  120

Query  489  --PEHMTEAALAARFNGGLGV-NGSG  557
              P+ M+E+  + R N G G  NGSG
Sbjct  121  LGPQPMSESLYSGRPNTGRGANNGSG  146



>ref|XP_003525098.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Glycine max]
Length=1097

 Score =   205 bits (522),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 111/146 (76%), Positives = 123/146 (84%), Gaps = 8/146 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M T GRL+AGSHNRNEFVLINAD+ GR+ SV+ELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MHTGGRLVAGSHNRNEFVLINADDNGRIKSVRELSGQICQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREG QACPQC TRYKRIKGSPRVEGDEEE++ DDLD+EFDY     
Sbjct  61   CAFPVCRPCYEYERREGIQACPQCNTRYKRIKGSPRVEGDEEEDDTDDLDNEFDYGDVDA  120

Query  489  --PEHMTEAALAARFNGGLGV-NGSG  557
              P+ M+E+  + R N G G  NGSG
Sbjct  121  LGPQPMSESLYSGRPNTGRGANNGSG  146



>gb|AHL45028.1| cellulose synthase 6B [Linum usitatissimum]
Length=1096

 Score =   205 bits (522),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 112/148 (76%), Positives = 124/148 (84%), Gaps = 9/148 (6%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE GR+ SV+ELSGQ+CQICGDE+EIT DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESGRIRSVRELSGQVCQICGDEIEITADGELFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREG QACPQC+TR+KR+KGS RVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGTQACPQCRTRFKRLKGSARVEGDEEEDDIDDLEHEFDYGNLEG  120

Query  489  --PEHMTEAALAARFNGGLG--VNGSGT  560
              PE +TE  LAAR N G G  VNG GT
Sbjct  121  LTPEQVTELMLAARLNTGRGSQVNGFGT  148



>ref|XP_006411737.1| hypothetical protein EUTSA_v10024277mg [Eutrema salsugineum]
 gb|ESQ53190.1| hypothetical protein EUTSA_v10024277mg [Eutrema salsugineum]
Length=1084

 Score =   205 bits (522),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 104/142 (73%), Positives = 116/142 (82%), Gaps = 4/142 (3%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E+TV+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICGDEIELTVNGELFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhef----dYP  491
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGD+EEE+  D           P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDDEEEDDIDDLEYEFDHGMDP  120

Query  492  EHMTEAALAARFNGGLGVNGSG  557
            EH+ EAAL++R N G G + S 
Sbjct  121  EHVAEAALSSRLNTGRGGSDSA  142



>ref|XP_002866842.1| hypothetical protein ARALYDRAFT_490712 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43101.1| hypothetical protein ARALYDRAFT_490712 [Arabidopsis lyrata subsp. 
lyrata]
Length=1084

 Score =   205 bits (521),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 102/137 (74%), Positives = 113/137 (82%), Gaps = 4/137 (3%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E+TV+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSGQTCQICGDEIELTVNGELFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  491
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GD++EEE  D           P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDDDEEEDIDDLEYEFNHGMDP  120

Query  492  EHMTEAALAARFNGGLG  542
            EH  EAAL++R N G G
Sbjct  121  EHAAEAALSSRLNTGRG  137



>ref|XP_008338760.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
Length=1097

 Score =   205 bits (521),  Expect = 3e-57, Method: Composition-based stats.
 Identities = 105/142 (74%), Positives = 118/142 (83%), Gaps = 7/142 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT+GRL+AGSHNRNEFVLINADE  R+  V+ELSGQICQICGDE+E+TVDGEPFVACNE
Sbjct  1    MDTRGRLVAGSHNRNEFVLINADENSRIQPVQELSGQICQICGDEIELTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhe-------f  482
            CAFPVCRPCYEYERREGNQACP CKTRYKRI+GSPRVEGDEEE++ DDLD+E        
Sbjct  61   CAFPVCRPCYEYERREGNQACPHCKTRYKRIRGSPRVEGDEEEDDIDDLDNEFNCGNLDA  120

Query  483  dYPEHMTEAALAARFNGGLGVN  548
              P  + E+ L+AR N G G N
Sbjct  121  LGPHQVAESVLSARLNVGRGSN  142



>ref|XP_007151999.1| hypothetical protein PHAVU_004G093300g [Phaseolus vulgaris]
 gb|ESW23993.1| hypothetical protein PHAVU_004G093300g [Phaseolus vulgaris]
Length=1089

 Score =   204 bits (520),  Expect = 3e-57, Method: Composition-based stats.
 Identities = 110/144 (76%), Positives = 117/144 (81%), Gaps = 8/144 (6%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT GRLIAGSHNRNEFVLINADE  RVT+V ELSGQICQICGDE+E+TV GEPFVACNE
Sbjct  1    MDTNGRLIAGSHNRNEFVLINADETARVTAVTELSGQICQICGDELEVTVIGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYP----  491
            CAFPVCRPCYEYERREGNQ CPQCKTRYKRIKGS RVEGDEEE+  DDL+ EFD+     
Sbjct  61   CAFPVCRPCYEYERREGNQVCPQCKTRYKRIKGSARVEGDEEEDNTDDLESEFDFGGNLR  120

Query  492  ---EHMTEAALAARFNGGLGVNGS  554
                HM EA  + R N G  VNGS
Sbjct  121  RDHHHMAEAMFSTRLNYG-SVNGS  143



>gb|AHL45029.1| cellulose synthase 6C [Linum usitatissimum]
Length=1097

 Score =   204 bits (520),  Expect = 3e-57, Method: Composition-based stats.
 Identities = 112/147 (76%), Positives = 123/147 (84%), Gaps = 9/147 (6%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE GR+ SV+ELSGQ+CQICGDE+EITVDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESGRIRSVQELSGQVCQICGDEIEITVDGELFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREG QACPQC+TRYKR+KG PRVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGTQACPQCRTRYKRLKGCPRVEGDEEEDDIDDLEHEFDYGNLEG  120

Query  489  --PEHMTEAALAARFNGGLG--VNGSG  557
               E + E  LAAR N G G  VNGSG
Sbjct  121  LTSEQVAELMLAARLNTGRGSQVNGSG  147



>gb|AHL45030.1| cellulose synthase 6D [Linum usitatissimum]
Length=1097

 Score =   204 bits (520),  Expect = 3e-57, Method: Composition-based stats.
 Identities = 112/147 (76%), Positives = 123/147 (84%), Gaps = 9/147 (6%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE GR+ SV+ELSGQ+CQICGDE+EITVDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENGRIRSVQELSGQVCQICGDEIEITVDGELFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREG QACPQC+TRYKR+KG PRVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGTQACPQCRTRYKRLKGCPRVEGDEEEDDIDDLEHEFDYGNLEG  120

Query  489  --PEHMTEAALAARFNGGLG--VNGSG  557
               E + E  LAAR N G G  VNGSG
Sbjct  121  LTSEQVAELMLAARLNTGRGSQVNGSG  147



>ref|XP_010260984.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nelumbo nucifera]
Length=1093

 Score =   204 bits (520),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 108/139 (78%), Positives = 117/139 (84%), Gaps = 6/139 (4%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M T GRL+AGSHNRNEFV+INADEIGRV SVKELSGQICQICGDEVEIT DGEPFVACNE
Sbjct  1    MYTGGRLVAGSHNRNEFVVINADEIGRVKSVKELSGQICQICGDEVEITDDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEH--  497
            CAFPVCRPCYEYERREGNQ CPQCKTRYKRIKGS RV+GDEEE+  DDL++EFD+  H  
Sbjct  61   CAFPVCRPCYEYERREGNQICPQCKTRYKRIKGSARVDGDEEEDGVDDLENEFDFGSHEM  120

Query  498  ----MTEAALAARFNGGLG  542
                  EA L++R N G G
Sbjct  121  DSHQTAEAILSSRLNVGRG  139



>ref|XP_006283042.1| hypothetical protein CARUB_v10004034mg [Capsella rubella]
 gb|EOA15940.1| hypothetical protein CARUB_v10004034mg [Capsella rubella]
Length=1084

 Score =   204 bits (519),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 100/137 (73%), Positives = 112/137 (82%), Gaps = 4/137 (3%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E+TV  E FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSGQTCQICGDEIELTVTSELFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhef----dYP  491
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GD++EE+  D          +P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDDDEEDDIDDLEYEFDHGMHP  120

Query  492  EHMTEAALAARFNGGLG  542
            EH  EAAL++R N G G
Sbjct  121  EHAVEAALSSRLNTGRG  137



>gb|KDO57137.1| hypothetical protein CISIN_1g001369mg [Citrus sinensis]
Length=1091

 Score =   204 bits (519),  Expect = 5e-57, Method: Composition-based stats.
 Identities = 108/137 (79%), Positives = 119/137 (87%), Gaps = 7/137 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQIC DE+EIT +GEPFVACNE
Sbjct  1    MATGGRLIAGSHNRNEFVLINADETARIKSVKELSGQTCQICEDEIEITDNGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDLDHEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLDHEFDYGNLDG  120

Query  489  --PEHMTEAALAARFNG  533
              P+H+++AAL+AR N 
Sbjct  121  FGPQHVSDAALSARLNA  137



>ref|XP_002878571.1| hypothetical protein ARALYDRAFT_900606 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54830.1| hypothetical protein ARALYDRAFT_900606 [Arabidopsis lyrata subsp. 
lyrata]
Length=1089

 Score =   204 bits (519),  Expect = 5e-57, Method: Composition-based stats.
 Identities = 101/137 (74%), Positives = 118/137 (86%), Gaps = 2/137 (1%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ C+IC DE+E+T +GEPF+ACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADETARIRSVQELSGQTCKICRDEIELTENGEPFIACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhe--fdYPEH  497
            CAFPVCRPCYEYER+EGNQACPQC+TRYKRIKGSPRVEGDEE+++ DDL++E     PEH
Sbjct  61   CAFPVCRPCYEYERKEGNQACPQCRTRYKRIKGSPRVEGDEEDDDIDDLEYEFYGMDPEH  120

Query  498  MTEAALAARFNGGLGVN  548
            + EAAL+ R N G G N
Sbjct  121  VAEAALSMRLNTGRGTN  137



>ref|XP_006427904.1| hypothetical protein CICLE_v10024766mg [Citrus clementina]
 ref|XP_006464533.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Citrus sinensis]
 gb|ESR41144.1| hypothetical protein CICLE_v10024766mg [Citrus clementina]
Length=1091

 Score =   204 bits (518),  Expect = 5e-57, Method: Composition-based stats.
 Identities = 108/137 (79%), Positives = 119/137 (87%), Gaps = 7/137 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQIC DE+EIT +GEPFVACNE
Sbjct  1    MATGGRLIAGSHNRNEFVLINADETARIKSVKELSGQTCQICEDEIEITDNGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDLDHEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLDHEFDYGNLDG  120

Query  489  --PEHMTEAALAARFNG  533
              P+H+++AAL+AR N 
Sbjct  121  FGPQHVSDAALSARLNA  137



>gb|KHN41284.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine 
soja]
Length=847

 Score =   201 bits (512),  Expect = 9e-57, Method: Composition-based stats.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 1/97 (1%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFVLINADE  RV +V ELSGQICQICGDE+E+TV+GEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADETARV-AVTELSGQICQICGDELEVTVNGEPFVACNE  59

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQ CPQCKTRYKRIKGSPRV
Sbjct  60   CAFPVCRPCYEYERREGNQVCPQCKTRYKRIKGSPRV  96



>ref|XP_009350645.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X1 [Pyrus x bretschneideri]
Length=1099

 Score =   203 bits (516),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 86/97 (89%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT+GRL+AGSHNRNEFVLINADE  R+  V+ELSGQICQICGDE+E+TVDGEPFVACNE
Sbjct  1    MDTRGRLVAGSHNRNEFVLINADENSRIQPVQELSGQICQICGDEIELTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQACP CKTRYKRIKGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQACPHCKTRYKRIKGSPRV  97



>ref|XP_009350646.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X2 [Pyrus x bretschneideri]
Length=1097

 Score =   203 bits (516),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 86/97 (89%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT+GRL+AGSHNRNEFVLINADE  R+  V+ELSGQICQICGDE+E+TVDGEPFVACNE
Sbjct  1    MDTRGRLVAGSHNRNEFVLINADENSRIQPVQELSGQICQICGDEIELTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQACP CKTRYKRIKGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQACPHCKTRYKRIKGSPRV  97



>ref|XP_010680991.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Beta vulgaris subsp. vulgaris]
Length=1102

 Score =   203 bits (516),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 103/147 (70%), Positives = 121/147 (82%), Gaps = 7/147 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFVLINAD+IGRVTSVKELSGQ+CQICGDE+E T + EPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADDIGRVTSVKELSGQLCQICGDEIENTKNDEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCY+YER EGNQACPQCKTRYKRIKG  RVEGDE+E++ DD+++E  Y     
Sbjct  61   CAFPVCRPCYDYERGEGNQACPQCKTRYKRIKGCARVEGDEDEDDLDDIENELKYVSEDR  120

Query  489  -PEHMTEAALAARFNGGLG-VNGSGTT  563
             P+H+ E+  ++R N G    N SG +
Sbjct  121  DPQHIAESVFSSRLNVGRAPSNASGLS  147



>ref|XP_010546378.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming] 
[Tarenaya hassleriana]
Length=1075

 Score =   203 bits (516),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 105/137 (77%), Positives = 120/137 (88%), Gaps = 5/137 (4%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+E+TVDG+ FVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADESARIRSVQELSGQICQICGDEIELTVDGDSFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDLD+EFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDTDDLDNEFDYRNGVG  120

Query  489  PEHMTEAALAARFNGGL  539
            P+ ++E  L +R N G+
Sbjct  121  PDQVSEGMLFSRRNSGI  137



>gb|KJB18371.1| hypothetical protein B456_003G049300 [Gossypium raimondii]
Length=925

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 122/144 (85%), Gaps = 6/144 (4%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  491
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE+  DDLD+EFDY    P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDGIDDLDNEFDYDASDP  120

Query  492  EHMTEAALAARFNGGLGV--NGSG  557
            + + EA L AR N G G   N SG
Sbjct  121  QQVAEAMLNARLNTGRGTHQNASG  144



>gb|KDO83763.1| hypothetical protein CISIN_1g001373mg [Citrus sinensis]
 gb|KDO83764.1| hypothetical protein CISIN_1g001373mg [Citrus sinensis]
Length=786

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 124/147 (84%), Gaps = 7/147 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M T GRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EIT +GEPFVACNE
Sbjct  1    MATNGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITDNGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GDEEE++ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDEEEDDTDDLENEFDINDRKD  120

Query  489  PEHMTEAALAARFNGGLGVNG--SGTT  563
            P H+ EA L++R N G G     SG T
Sbjct  121  PHHIAEAMLSSRLNIGRGSQAYVSGIT  147



>ref|XP_010431901.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Camelina sativa]
Length=1074

 Score =   202 bits (515),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 99/137 (72%), Positives = 112/137 (82%), Gaps = 4/137 (3%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ C IC DE+E+TV+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSGQTCHICRDEIELTVNGELFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhef----dYP  491
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GD++EE+  D          +P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDDDEEDDIDDLENEFDHGMHP  120

Query  492  EHMTEAALAARFNGGLG  542
            EH  EAAL++R N G G
Sbjct  121  EHAVEAALSSRLNTGRG  137



>ref|XP_010547636.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Tarenaya hassleriana]
Length=1068

 Score =   202 bits (514),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 86/97 (89%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+E+TVDG+PFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQICQICGDEIELTVDGDPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPC+EYERREGNQACPQCKTRYKRIKGSPRV
Sbjct  61   CAFPVCRPCFEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|XP_008440995.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Cucumis melo]
Length=1091

 Score =   202 bits (514),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 106/140 (76%), Positives = 115/140 (82%), Gaps = 7/140 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQICGDEVE+T +GE FVACNE
Sbjct  1    MDTAGRLIAGSHNRNEFVLINADETARIKSVKELSGQTCQICGDEVELTAEGELFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDE+E++ DDLD+EFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEDEDDIDDLDNEFDYGNLDD  120

Query  489  --PEHMTEAALAARFNGGLG  542
              P H  E +  +  N G G
Sbjct  121  FGPHHAAEGSYGSHLNSGRG  140



>ref|NP_195645.1| cellulose synthase A catalytic subunit 2 [UDP-forming] [Arabidopsis 
thaliana]
 sp|O48947.1|CESA2_ARATH RecName: Full=Cellulose synthase A catalytic subunit 2 [UDP-forming]; 
Short=AtCesA2; Short=Ath-A [Arabidopsis thaliana]
 gb|AAC39335.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
 emb|CAB43650.1| cellulose synthase catalytic subunit (Ath-A) [Arabidopsis thaliana]
 emb|CAB80598.1| cellulose synthase catalytic subunit (Ath-A) [Arabidopsis thaliana]
 gb|AEE87059.1| cellulose synthase A catalytic subunit 2 [UDP-forming] [Arabidopsis 
thaliana]
 gb|AHL38978.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1084

 Score =   202 bits (514),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 102/137 (74%), Positives = 111/137 (81%), Gaps = 4/137 (3%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E+TV  E FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSGQTCQICGDEIELTVSSELFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhef----dYP  491
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GD+EEEE  D           P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDDEEEEDIDDLEYEFDHGMDP  120

Query  492  EHMTEAALAARFNGGLG  542
            EH  EAAL++R N G G
Sbjct  121  EHAAEAALSSRLNTGRG  137



>ref|XP_010027732.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Eucalyptus grandis]
 gb|KCW54322.1| hypothetical protein EUGRSUZ_I00286 [Eucalyptus grandis]
Length=1092

 Score =   202 bits (514),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 111/144 (77%), Positives = 121/144 (84%), Gaps = 7/144 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQICQICGDEVEI  DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESSRIKSVKELSGQICQICGDEVEIA-DGELFVACNE  59

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  491
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDLD+EFDY    P
Sbjct  60   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLDNEFDYDPSDP  119

Query  492  EHMTEAALAARFNGGLGV--NGSG  557
            +H+ E   ++R N G G   N SG
Sbjct  120  QHVAEKTFSSRLNYGRGAHRNASG  143



>ref|XP_004141979.1| PREDICTED: probable cellulose synthase A catalytic subunit 9 
[UDP-forming]-like [Cucumis sativus]
 ref|XP_004160480.1| PREDICTED: probable cellulose synthase A catalytic subunit 9 
[UDP-forming]-like [Cucumis sativus]
 gb|KGN48397.1| hypothetical protein Csa_6G486700 [Cucumis sativus]
Length=1090

 Score =   202 bits (513),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 106/140 (76%), Positives = 115/140 (82%), Gaps = 7/140 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQICGDEVE+T +GE FVACNE
Sbjct  1    MDTAGRLIAGSHNRNEFVLINADETARIKSVKELSGQTCQICGDEVELTAEGELFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDE+E++ DDLD+EFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEDEDDIDDLDNEFDYGNLDD  120

Query  489  --PEHMTEAALAARFNGGLG  542
              P H  E +  +  N G G
Sbjct  121  FGPRHAAEGSYGSHLNSGRG  140



>gb|EYU17480.1| hypothetical protein MIMGU_mgv1a000527mg [Erythranthe guttata]
Length=938

 Score =   200 bits (509),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/97 (94%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT GRL+AGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVE TVDGEPFVACNE
Sbjct  1    MDTNGRLVAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEFTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFP+CRPCYEYERREGNQ+CPQCKTR+KRIKGSPRV
Sbjct  61   CAFPICRPCYEYERREGNQSCPQCKTRFKRIKGSPRV  97



>ref|XP_004503981.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Cicer arietinum]
Length=1096

 Score =   201 bits (512),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 109/147 (74%), Positives = 124/147 (84%), Gaps = 8/147 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M T GRLIAGSHNRNEFVLINA+E GR+ SV+ELSGQICQICGDE+E+TVDGEPFVACNE
Sbjct  1    MHTGGRLIAGSHNRNEFVLINAEENGRIKSVRELSGQICQICGDEIEVTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-PEHM  500
            CAFPVCRPCYEYER+EGNQACPQCKTR+KRIKGS RVEGDE+E++ DDLD+EFDY P+ M
Sbjct  61   CAFPVCRPCYEYERKEGNQACPQCKTRFKRIKGSSRVEGDEDEDDTDDLDNEFDYDPDAM  120

Query  501  -----TEAALAARFNGGLGVNG--SGT  560
                 +++  A R N G G N   SGT
Sbjct  121  RHQPISDSLFAGRLNTGRGSNANISGT  147



>ref|XP_003630174.1| Cellulose synthase A catalytic subunit [Medicago truncatula]
 gb|AET04650.1| cellulose synthase-like protein [Medicago truncatula]
Length=1098

 Score =   201 bits (512),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M T GRLIAGSHNRNEFVLINA+E GR+ SV+ELSGQIC ICGDE+E+TVDGEPFVACNE
Sbjct  1    MHTGGRLIAGSHNRNEFVLINAEENGRIKSVRELSGQICMICGDEIEVTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYER+EGNQACPQCKTRYKR+KGSPRV
Sbjct  61   CAFPVCRPCYEYERKEGNQACPQCKTRYKRLKGSPRV  97



>ref|XP_007143558.1| hypothetical protein PHAVU_007G081700g [Phaseolus vulgaris]
 gb|ESW15552.1| hypothetical protein PHAVU_007G081700g [Phaseolus vulgaris]
Length=1093

 Score =   201 bits (510),  Expect = 9e-56, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT GRL+A SHNRNEF++INAD+ GRV +V EL GQICQICGDE+EIT DGEPFVACNE
Sbjct  1    MDTTGRLVASSHNRNEFIIINADQTGRVNAVTELCGQICQICGDEIEITADGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>ref|XP_010437052.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Camelina sativa]
Length=1074

 Score =   200 bits (509),  Expect = 9e-56, Method: Composition-based stats.
 Identities = 98/137 (72%), Positives = 112/137 (82%), Gaps = 4/137 (3%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ C+IC DE+E+TV+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSGQTCKICRDEIELTVNGELFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhef----dYP  491
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GD++EE+  D          +P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDDDEEDDIDDLEYEFDHGMHP  120

Query  492  EHMTEAALAARFNGGLG  542
            EH  EAAL++  N G G
Sbjct  121  EHAVEAALSSHLNTGRG  137



>gb|AGV22108.1| cellulose synthase 6 [Betula luminifera]
Length=1103

 Score =   200 bits (509),  Expect = 9e-56, Method: Composition-based stats.
 Identities = 113/153 (74%), Positives = 122/153 (80%), Gaps = 15/153 (10%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGR------VTSVKELSGQICQICGDEVEITVDGEP  305
            MDT+GRLIAGSHNRNE +LINADE GR      + SVKELSGQ+CQICGDEVEITVDGE 
Sbjct  1    MDTRGRLIAGSHNRNELILINADENGRGDENGRIKSVKELSGQMCQICGDEVEITVDGEL  60

Query  306  FVACNECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefd  485
            FVACNECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDLD+EFD
Sbjct  61   FVACNECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDLDNEFD  120

Query  486  Y-------PEHMTEAALAARFNGGLGV--NGSG  557
            Y       P+   EA L +  N G G   N SG
Sbjct  121  YGNLNGLGPQEGAEAMLYSHLNSGRGYHSNASG  153



>ref|XP_003548102.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Glycine max]
Length=1078

 Score =   200 bits (509),  Expect = 9e-56, Method: Composition-based stats.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 1/97 (1%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFVLINADE  RV +V ELSGQICQICGDE+E+TV+GEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADETARV-AVTELSGQICQICGDELEVTVNGEPFVACNE  59

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQ CPQCKTRYKRIKGSPRV
Sbjct  60   CAFPVCRPCYEYERREGNQVCPQCKTRYKRIKGSPRV  96



>gb|KHN00756.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine 
soja]
Length=1052

 Score =   200 bits (508),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 1/97 (1%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFVLINADE  RV +V ELSGQICQICGDE+E+TV+GEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADETARV-AVTELSGQICQICGDELEVTVNGEPFVACNE  59

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQ CPQCKTRYKRIKGSPRV
Sbjct  60   CAFPVCRPCYEYERREGNQVCPQCKTRYKRIKGSPRV  96



>ref|XP_003518592.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Glycine max]
Length=1078

 Score =   200 bits (508),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 1/97 (1%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFVLINADE  RV +V ELSGQICQICGDE+E+TV+GEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADETARV-AVTELSGQICQICGDELEVTVNGEPFVACNE  59

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQ CPQCKTRYKRIKGSPRV
Sbjct  60   CAFPVCRPCYEYERREGNQVCPQCKTRYKRIKGSPRV  96



>emb|CDY42621.1| BnaC01g00330D [Brassica napus]
Length=1069

 Score =   200 bits (508),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 96/134 (72%), Positives = 112/134 (84%), Gaps = 1/134 (1%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ S++ELSGQ CQICGD++E++V+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSLQELSGQTCQICGDDIELSVNGELFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVe-gdeeeeefddldhefdYPEHM  500
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+  DEE+++ D        PE +
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVQGDDEEDDDDDLDHDGMMDPELV  120

Query  501  TEAALAARFNGGLG  542
             EAAL++R N G G
Sbjct  121  AEAALSSRLNTGRG  134



>ref|XP_010678670.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Beta vulgaris subsp. vulgaris]
Length=1102

 Score =   200 bits (508),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 102/147 (69%), Positives = 120/147 (82%), Gaps = 7/147 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDTKGRL+AGSHNRNEFVLINAD+IGRVTSVKELSGQ+CQICGDE+E   + EPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADDIGRVTSVKELSGQLCQICGDEIENIENNEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCY+YER EGNQACPQCKTRYKRIKG  RVEGDE+E++ DD+++E  Y     
Sbjct  61   CAFPVCRPCYDYEREEGNQACPQCKTRYKRIKGCARVEGDEDEDDLDDIENELKYVSNNR  120

Query  489  -PEHMTEAALAARFNGGLG-VNGSGTT  563
             P+H+ EA  ++R + G    N SG +
Sbjct  121  DPQHIAEAIYSSRLSVGRAPSNASGLS  147



>ref|XP_010526630.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Tarenaya hassleriana]
Length=1073

 Score =   199 bits (507),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 85/97 (88%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E TVDGEPFVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADETARIRSVQELSGQNCQICGDEIEFTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>gb|AES62337.2| cellulose synthase-like protein [Medicago truncatula]
Length=1093

 Score =   199 bits (507),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT GRL+AGSHNRNEFVLINAD+  RV +V ELSGQICQICGDE+E TVD EPFVACNE
Sbjct  1    MDTNGRLVAGSHNRNEFVLINADDTARVNAVTELSGQICQICGDEIEFTVDDEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQACP CKT+YKRIKGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQACPHCKTKYKRIKGSPRV  97



>gb|KEH43649.1| cellulose synthase-like protein [Medicago truncatula]
Length=1097

 Score =   199 bits (507),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT GRL+AGSHNRNEFVLINAD+  RV +V ELSGQICQICGDE+E TVD EPFVACNE
Sbjct  5    MDTNGRLVAGSHNRNEFVLINADDTARVNAVTELSGQICQICGDEIEFTVDDEPFVACNE  64

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQACP CKT+YKRIKGSPRV
Sbjct  65   CAFPVCRPCYEYERREGNQACPHCKTKYKRIKGSPRV  101



>ref|XP_006399471.1| hypothetical protein EUTSA_v10012521mg [Eutrema salsugineum]
 gb|ESQ40924.1| hypothetical protein EUTSA_v10012521mg [Eutrema salsugineum]
Length=1073

 Score =   199 bits (505),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 85/97 (88%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+E+T DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQICQICGDEIELTDDGESFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQ+CPQCKTRYKRIKGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCKTRYKRIKGSPRV  97



>gb|KFK25282.1| hypothetical protein AALP_AA8G091900 [Arabis alpina]
Length=1071

 Score =   198 bits (504),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 85/97 (88%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+E++ DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQICQICGDEIELSDDGESFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|XP_009150553.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming] 
[Brassica rapa]
Length=1082

 Score =   198 bits (504),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQ C+IC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADESARIRSVQELSGQTCKICRDEIELTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>emb|CDY08854.1| BnaA06g23700D [Brassica napus]
Length=1082

 Score =   198 bits (504),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQ C+IC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADESARIRSVQELSGQTCKICRDEIELTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>emb|CDY14504.1| BnaC03g49550D [Brassica napus]
Length=1082

 Score =   198 bits (504),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQ C+IC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADESARIRSVQELSGQTCKICRDEIELTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|XP_009115076.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Brassica rapa]
Length=1074

 Score =   198 bits (504),  Expect = 5e-55, Method: Composition-based stats.
 Identities = 93/136 (68%), Positives = 112/136 (82%), Gaps = 3/136 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ S++ELSGQ CQICGD++E++V+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSLQELSGQTCQICGDDIELSVNGELFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVe---gdeeeeefddldhefdYPE  494
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+    ++++++ D        PE
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVQGDDEEDDDDDLDLDHDGMMDPE  120

Query  495  HMTEAALAARFNGGLG  542
             + EAAL++R N G G
Sbjct  121  LVAEAALSSRLNTGRG  136



>ref|XP_002871389.1| hypothetical protein ARALYDRAFT_908936 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47648.1| hypothetical protein ARALYDRAFT_908936 [Arabidopsis lyrata subsp. 
lyrata]
Length=1069

 Score =   198 bits (504),  Expect = 5e-55, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E++VDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQTCQICGDEIELSVDGESFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQ+CPQCKTRYKRIKGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCKTRYKRIKGSPRV  97



>emb|CDY41973.1| BnaA01g05450D [Brassica napus]
Length=1074

 Score =   198 bits (504),  Expect = 5e-55, Method: Composition-based stats.
 Identities = 93/136 (68%), Positives = 112/136 (82%), Gaps = 3/136 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ S++ELSGQ CQICGD++E++V+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSLQELSGQTCQICGDDIELSVNGELFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVe---gdeeeeefddldhefdYPE  494
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+    ++++++ D        PE
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVQGDDEEDDDDDLDLDHDGMMDPE  120

Query  495  HMTEAALAARFNGGLG  542
             + EAAL++R N G G
Sbjct  121  LVAEAALSSRLNTGRG  136



>gb|ACS68191.1| cellulose synthase 2.1 catalytic subunit [Brassica napus]
Length=1074

 Score =   198 bits (504),  Expect = 5e-55, Method: Composition-based stats.
 Identities = 93/136 (68%), Positives = 112/136 (82%), Gaps = 3/136 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ S++ELSGQ CQICGD++E++V+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSLQELSGQTCQICGDDIELSVNGELFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVe---gdeeeeefddldhefdYPE  494
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+    ++++++ D        PE
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVQGDDEEDDDDDLDLDHDGMMDPE  120

Query  495  HMTEAALAARFNGGLG  542
             + EAAL++R N G G
Sbjct  121  LVAEAALSSRLNTGRG  136



>ref|XP_002864919.1| hypothetical protein ARALYDRAFT_496689 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41178.1| hypothetical protein ARALYDRAFT_496689 [Arabidopsis lyrata subsp. 
lyrata]
Length=1089

 Score =   198 bits (504),  Expect = 6e-55, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQACPQCKTR+KR+KGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRFKRLKGSPRV  97



>ref|NP_196549.1| cellulose synthase A catalytic subunit 5 [UDP-forming] [Arabidopsis 
thaliana]
 sp|Q8L778.2|CESA5_ARATH RecName: Full=Cellulose synthase A catalytic subunit 5 [UDP-forming]; 
Short=AtCesA5 [Arabidopsis thaliana]
 dbj|BAB09408.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AED91458.1| cellulose synthase A catalytic subunit 5 [UDP-forming] [Arabidopsis 
thaliana]
Length=1069

 Score =   198 bits (503),  Expect = 7e-55, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E++VDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQTCQICGDEIELSVDGESFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQ+CPQCKTRYKRIKGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCKTRYKRIKGSPRV  97



>gb|KHG03006.1| Cellulose synthase A catalytic subunit 2 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1059

 Score =   197 bits (502),  Expect = 7e-55, Method: Composition-based stats.
 Identities = 109/139 (78%), Positives = 117/139 (84%), Gaps = 6/139 (4%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEI--TVDGEPFVAC  317
            MDT GRLIAGSHNRNEFVLINA E  R+ SVKELSGQ CQICGDE+EI  TVDGEPFVAC
Sbjct  1    MDTGGRLIAGSHNRNEFVLINAYENARIKSVKELSGQSCQICGDEIEIEITVDGEPFVAC  60

Query  318  NECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY---  488
            NECAFPVCR CYEY RREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDLD+EFDY   
Sbjct  61   NECAFPVCRTCYEYGRREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDLDNEFDYGTL  120

Query  489  -PEHMTEAALAARFNGGLG  542
             P+ +T+A L AR N   G
Sbjct  121  DPQQVTDAMLTARLNAVRG  139



>ref|NP_201279.1| cellulose synthase A catalytic subunit 6 [UDP-forming] [Arabidopsis 
thaliana]
 sp|Q94JQ6.2|CESA6_ARATH RecName: Full=Cellulose synthase A catalytic subunit 6 [UDP-forming]; 
Short=AtCesA6; AltName: Full=AraxCelA; AltName: Full=Isoxaben-resistant 
protein 2; AltName: Full=Protein PROCUSTE 
1; AltName: Full=Protein QUILL [Arabidopsis thaliana]
 dbj|BAB10307.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AED97945.1| cellulose synthase A catalytic subunit 6 [UDP-forming] [Arabidopsis 
thaliana]
 gb|AID66000.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1084

 Score =   198 bits (503),  Expect = 8e-55, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQACPQCKTR+KR+KGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRFKRLKGSPRV  97



>ref|XP_006279743.1| hypothetical protein CARUB_v10027598mg [Capsella rubella]
 gb|EOA12641.1| hypothetical protein CARUB_v10027598mg [Capsella rubella]
Length=1084

 Score =   198 bits (503),  Expect = 8e-55, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQACPQCKTR+KR+KGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRFKRLKGSPRV  97



>ref|XP_010491630.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming]-like 
[Camelina sativa]
Length=1068

 Score =   197 bits (501),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E+ VDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQTCQICGDEIELGVDGESFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQ+CPQCKTRYKRIKGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCKTRYKRIKGSPRV  97



>gb|AEK86669.1| cellulose synthase 5 [Arabidopsis thaliana]
Length=996

 Score =   196 bits (499),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E++VDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQTCQICGDEIELSVDGESFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQ+CPQCKTRYKRIKGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCKTRYKRIKGSPRV  97



>ref|XP_010444419.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Camelina sativa]
Length=1090

 Score =   197 bits (501),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGN+ACPQCKTRYKR+KGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNKACPQCKTRYKRLKGSPRV  97



>emb|CDX81249.1| BnaC09g06600D [Brassica napus]
Length=1084

 Score =   197 bits (500),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL GQ C+IC DEVE+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELRGQTCEICRDEVELTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>emb|CDY18696.1| BnaA09g06990D [Brassica napus]
Length=1084

 Score =   197 bits (500),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL GQ C+IC DEVE+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELRGQTCEICRDEVELTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>ref|XP_010452989.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming] 
[Camelina sativa]
Length=1068

 Score =   197 bits (500),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E+ VDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQTCQICGDEIELGVDGESFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQ+CPQCKTRYKRIKGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCKTRYKRIKGSPRV  97



>gb|ACS68196.1| cellulose synthase 6.1 catalytic subunit [Brassica napus]
Length=1084

 Score =   197 bits (500),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL GQ C+IC DEVE+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELRGQTCEICRDEVELTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>ref|XP_009112155.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Brassica rapa]
Length=1083

 Score =   196 bits (499),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL GQ C+IC DEVE+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELRGQTCEICRDEVELTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>ref|XP_010462809.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Camelina sativa]
Length=1084

 Score =   196 bits (498),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGN+ACPQCKTR+KR+KGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNKACPQCKTRFKRLKGSPRV  97



>ref|XP_010088737.1| Isoxaben-resistant protein 2 [Morus notabilis]
 gb|EXB36918.1| Isoxaben-resistant protein 2 [Morus notabilis]
Length=1082

 Score =   196 bits (497),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +3

Query  156  GRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNECAFP  335
            GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+EITVDGE FVACNECAFP
Sbjct  4    GRLVAGSHNRNEFVLINADENARIKSVQELSGQICQICGDEIEITVDGELFVACNECAFP  63

Query  336  VCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            VCRPCYEYERREGNQACPQCKT+YKRIKGSPRV
Sbjct  64   VCRPCYEYERREGNQACPQCKTQYKRIKGSPRV  96



>gb|KDO57138.1| hypothetical protein CISIN_1g001369mg [Citrus sinensis]
Length=791

 Score =   193 bits (491),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 119/138 (86%), Gaps = 7/138 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQIC DE+EIT +GEPFVACNE
Sbjct  1    MATGGRLIAGSHNRNEFVLINADETARIKSVKELSGQTCQICEDEIEITDNGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDLDHEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLDHEFDYGNLDG  120

Query  489  --PEHMTEAALAARFNGG  536
              P+H+++AAL+AR N  
Sbjct  121  FGPQHVSDAALSARLNAS  138



>ref|XP_011090445.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Sesamum indicum]
Length=1090

 Score =   195 bits (495),  Expect = 8e-54, Method: Composition-based stats.
 Identities = 85/97 (88%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRL+AGSHNRNEFVLINADEIGR+ SV ELSGQ CQICGDEVEITVDGE FVACNE
Sbjct  3    MNTGGRLVAGSHNRNEFVLINADEIGRIKSVHELSGQTCQICGDEVEITVDGELFVACNE  62

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCR CYEYER+EG Q CPQCKTRYKRIKGSPRV
Sbjct  63   CAFPVCRTCYEYERKEGTQCCPQCKTRYKRIKGSPRV  99



>ref|XP_010484268.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming] 
[Camelina sativa]
Length=1084

 Score =   195 bits (495),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TV GEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVGGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGN+ACPQCKTRYKR+KGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNKACPQCKTRYKRLKGSPRV  97



>gb|EYU31127.1| hypothetical protein MIMGU_mgv1a000549mg [Erythranthe guttata]
Length=1082

 Score =   194 bits (494),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRL+AGSHNR EFVLINADEIG + SV+ELSGQ C+ICGDEVEIT+DGE FVACNE
Sbjct  1    MNTGGRLVAGSHNRKEFVLINADEIGSIKSVQELSGQTCKICGDEVEITLDGELFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYER+EGNQ+CPQCKTRYKRIKGSPRV
Sbjct  61   CAFPVCRPCYEYERKEGNQSCPQCKTRYKRIKGSPRV  97



>ref|XP_006286951.1| hypothetical protein CARUB_v10000099mg [Capsella rubella]
 gb|EOA19849.1| hypothetical protein CARUB_v10000099mg [Capsella rubella]
Length=1068

 Score =   194 bits (492),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 81/97 (84%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL+GQ CQICGDE+E+ +DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELTGQTCQICGDEIELNLDGESFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQ+CPQCKTRYKRI+GSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCKTRYKRIQGSPRV  97



>emb|CDY31305.1| BnaA02g34360D [Brassica napus]
Length=1079

 Score =   194 bits (492),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 83/96 (86%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL GQ C+IC DE+E TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELRGQTCEICRDEIESTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPR  431
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPR
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPR  96



>ref|XP_006427905.1| hypothetical protein CICLE_v10024766mg [Citrus clementina]
 gb|ESR41145.1| hypothetical protein CICLE_v10024766mg [Citrus clementina]
Length=918

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 119/138 (86%), Gaps = 7/138 (5%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQIC DE+EIT +GEPFVACNE
Sbjct  1    MATGGRLIAGSHNRNEFVLINADETARIKSVKELSGQTCQICEDEIEITDNGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  488
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDLDHEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLDHEFDYGNLDG  120

Query  489  --PEHMTEAALAARFNGG  536
              P+H+++AAL+AR N  
Sbjct  121  FGPQHVSDAALSARLNAS  138



>ref|XP_010446473.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Camelina sativa]
Length=1075

 Score =   193 bits (491),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 96/138 (70%), Positives = 110/138 (80%), Gaps = 5/138 (4%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ C+IC DE+E+TV GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSGQTCKICRDEIELTVTGELFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhef-----dY  488
            CAFPVCRPCYE ERREG QACPQCKTR+KRIKGSPRV+GD++EE+  D           +
Sbjct  61   CAFPVCRPCYEDERREGKQACPQCKTRFKRIKGSPRVDGDDDEEDDIDDLEYEFDHHGMH  120

Query  489  PEHMTEAALAARFNGGLG  542
            PEH  EAAL++R N G G
Sbjct  121  PEHAVEAALSSRLNTGRG  138



>ref|NP_179768.1| cellulose synthase A9 [Arabidopsis thaliana]
 sp|Q9SJ22.1|CESA9_ARATH RecName: Full=Probable cellulose synthase A catalytic subunit 
9 [UDP-forming]; Short=AtCesA9 [Arabidopsis thaliana]
 gb|AAD20396.1| putative cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AEC07220.1| cellulose synthase A9 [Arabidopsis thaliana]
Length=1088

 Score =   193 bits (490),  Expect = 4e-53, Method: Composition-based stats.
 Identities = 100/138 (72%), Positives = 115/138 (83%), Gaps = 3/138 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINAD+  R+ S +ELSGQ C+IC DE+E+T +GEPF+ACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADDTARIRSAEELSGQTCKICRDEIELTDNGEPFIACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhe--fdYPEH  497
            CAFP CRPCYEYERREGNQACPQC TRYKRIKGSPRVEGDEE+++ DDL+HE     PEH
Sbjct  61   CAFPTCRPCYEYERREGNQACPQCGTRYKRIKGSPRVEGDEEDDDIDDLEHEFYGMDPEH  120

Query  498  MTEAAL-AARFNGGLGVN  548
            +TEAAL   R N G G +
Sbjct  121  VTEAALYYMRLNTGRGTD  138



>ref|XP_009130469.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Brassica rapa]
Length=1079

 Score =   192 bits (488),  Expect = 9e-53, Method: Composition-based stats.
 Identities = 82/96 (85%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GR+IAGSHNRNEFVLINADE  R+ SV+EL GQ C+IC DE+E TVDGEPFVACNE
Sbjct  1    MNTGGRVIAGSHNRNEFVLINADENARIRSVQELKGQTCEICRDEIESTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPR  431
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPR
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPR  96



>emb|CDY46820.1| BnaC02g43280D [Brassica napus]
Length=1079

 Score =   192 bits (487),  Expect = 9e-53, Method: Composition-based stats.
 Identities = 82/96 (85%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL GQ C+IC DE+E TV+GEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELRGQTCEICRDEIESTVEGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPR  431
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPR
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPR  96



>gb|AAC29067.1| cellulose synthase [Arabidopsis thaliana]
Length=1081

 Score =   192 bits (487),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 81/92 (88%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +3

Query  159  RLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNECAFPV  338
            RLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TVDGEPFVACNECAFPV
Sbjct  3    RLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNECAFPV  62

Query  339  CRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CRPCYEYERREGNQACPQCKTR+KR+KGSPRV
Sbjct  63   CRPCYEYERREGNQACPQCKTRFKRLKGSPRV  94



>ref|XP_002277635.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Vitis vinifera]
 emb|CAN72601.1| hypothetical protein VITISV_012984 [Vitis vinifera]
Length=1097

 Score =   191 bits (486),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 82/97 (85%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M T GRL+AGSH+RNEFVLINAD+I R+ SV+ELSGQIC ICGD VEITVDGE FVACNE
Sbjct  1    MATGGRLVAGSHHRNEFVLINADDIARIKSVRELSGQICHICGDGVEITVDGELFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGN+ CPQCKTRYKR+KGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNKVCPQCKTRYKRMKGSPRV  97



>ref|XP_009131129.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming] 
[Brassica rapa]
Length=1072

 Score =   191 bits (485),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 82/97 (85%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E++ DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQSCQICGDEIELSDDGESFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCR CYEYERREGNQ+CPQCKTRYKRIKGSPRV
Sbjct  61   CAFPVCRTCYEYERREGNQSCPQCKTRYKRIKGSPRV  97



>emb|CDY56540.1| BnaA03g55860D [Brassica napus]
Length=1074

 Score =   191 bits (485),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 82/97 (85%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E++ DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQSCQICGDEIELSDDGESFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCR CYEYERREGNQ+CPQCKTRYKRIKGSPRV
Sbjct  61   CAFPVCRTCYEYERREGNQSCPQCKTRYKRIKGSPRV  97



>emb|CDX81145.1| BnaC03g03990D [Brassica napus]
Length=1070

 Score =   191 bits (484),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 82/97 (85%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E++ DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQSCQICGDEIELSDDGESFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCR CYEYERREGNQ+CPQCKTRYKRIKGSPRV
Sbjct  61   CAFPVCRTCYEYERREGNQSCPQCKTRYKRIKGSPRV  97



>gb|ACS68195.1| cellulose synthase 5.1 catalytic subunit [Brassica napus]
Length=1070

 Score =   191 bits (484),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 82/97 (85%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E++ DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQSCQICGDEIELSDDGESFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCR CYEYERREGNQ+CPQCKTRYKRIKGSPRV
Sbjct  61   CAFPVCRTCYEYERREGNQSCPQCKTRYKRIKGSPRV  97



>emb|CBI21555.3| unnamed protein product [Vitis vinifera]
Length=1097

 Score =   190 bits (483),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 81/97 (84%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M T GRL+AGSH+RNEFVLINAD+I R+ SV+ELSGQIC ICGD VEITVDGE FVACNE
Sbjct  1    MATGGRLVAGSHHRNEFVLINADDIARIKSVRELSGQICHICGDGVEITVDGELFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGN+ CPQCKTRYKR+KG+PRV
Sbjct  61   CAFPVCRPCYEYERREGNKVCPQCKTRYKRMKGNPRV  97



>ref|XP_006394118.1| hypothetical protein EUTSA_v100035740mg, partial [Eutrema salsugineum]
 gb|ESQ31404.1| hypothetical protein EUTSA_v100035740mg, partial [Eutrema salsugineum]
Length=798

 Score =   187 bits (475),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|XP_003592086.1| Cellulose synthase [Medicago truncatula]
Length=1135

 Score =   189 bits (481),  Expect = 8e-52, Method: Composition-based stats.
 Identities = 81/97 (84%), Positives = 87/97 (90%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVT--SVKELSGQICQICGDEVEITVDGEPFVAC  317
            MDT GRL+AGSHNRNEFVLINAD+  RV+  +V ELSGQICQICGDE+E TVD EPFVAC
Sbjct  1    MDTNGRLVAGSHNRNEFVLINADDTARVSVNAVTELSGQICQICGDEIEFTVDDEPFVAC  60

Query  318  NECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSP  428
            NECAFPVCRPCYEYERREGNQACP CKT+YKRIKG P
Sbjct  61   NECAFPVCRPCYEYERREGNQACPHCKTKYKRIKGKP  97



>dbj|BAF01335.1| cellulose synthase [Arabidopsis thaliana]
Length=771

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQACPQCKTR+KR+KGSPRV
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRFKRLKGSPRV  97



>gb|EPS71230.1| hypothetical protein M569_03522 [Genlisea aurea]
Length=1086

 Score =   187 bits (475),  Expect = 5e-51, Method: Composition-based stats.
 Identities = 81/97 (84%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRL+AGSHNRNEFVLINADEIGR+ SV ELS Q CQICGDE+EIT D E FVACNE
Sbjct  3    MNTGGRLVAGSHNRNEFVLINADEIGRIKSVHELSDQTCQICGDELEITADRELFVACNE  62

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCR CYEYERREG+Q CPQC+TRYKRIKGSPRV
Sbjct  63   CAFPVCRTCYEYERREGSQCCPQCRTRYKRIKGSPRV  99



>ref|XP_006847152.1| hypothetical protein AMTR_s00017p00239550 [Amborella trichopoda]
 gb|ERN08733.1| hypothetical protein AMTR_s00017p00239550 [Amborella trichopoda]
Length=1087

 Score =   186 bits (472),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 82/97 (85%), Positives = 87/97 (90%), Gaps = 3/97 (3%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT GRL+AGSHNRNEFV+INADE      ++ELSGQ CQICGDE+EITVDGE FVACNE
Sbjct  1    MDTNGRLVAGSHNRNEFVVINADE---PKPLRELSGQTCQICGDEIEITVDGEAFVACNE  57

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERREGNQACPQCKTRYKR KGSPRV
Sbjct  58   CAFPVCRPCYEYERREGNQACPQCKTRYKRHKGSPRV  94



>gb|KHG02517.1| Cellulose synthase A catalytic subunit 2 [UDP-forming] [Gossypium 
arboreum]
Length=1106

 Score =   186 bits (472),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 107/155 (69%), Positives = 117/155 (75%), Gaps = 17/155 (11%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELS-GQIC----------QICGDEVEIT  290
            MDT GRLIAGSHNRNEFVLINADE  R  + +  +   +C          QICGDE+EIT
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARDCANRTFTTALVCTGFVVLAFHNQICGDEIEIT  60

Query  291  VDGEPFVACNECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddl  470
            VDGEPFVACNECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDL
Sbjct  61   VDGEPFVACNECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDL  120

Query  471  dhefdY----PEHMTEAALAARFNGGLGV--NGSG  557
            D+EFDY    P+ + EA L    N G G   NGSG
Sbjct  121  DNEFDYDALDPQQVAEAMLGGHLNTGRGFHPNGSG  155



>gb|EPS66740.1| hypothetical protein M569_08032, partial [Genlisea aurea]
Length=1015

 Score =   184 bits (466),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 82/97 (85%), Positives = 88/97 (91%), Gaps = 1/97 (1%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRLIAGSHNRNEFVLINADEIGR+ SV+ELSGQ CQICGDEVEI+  G+ FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADEIGRIKSVQELSGQTCQICGDEVEISA-GDLFVACNE  59

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCR CYEYERREG Q CPQC+TRYKRIKGSPRV
Sbjct  60   CAFPVCRTCYEYERREGTQCCPQCQTRYKRIKGSPRV  96



>ref|XP_004502891.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Cicer arietinum]
Length=1084

 Score =   184 bits (466),  Expect = 7e-50, Method: Composition-based stats.
 Identities = 78/97 (80%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+T GRL+AGSHNRNE VLINA+E G++ SV+ELSGQICQICGDE+EI   GE FVACNE
Sbjct  1    MNTGGRLVAGSHNRNELVLINAEENGKIKSVQELSGQICQICGDEIEIMDQGEIFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFP+CRPCYEYER EGNQACPQCKTR+KRI+GSPRV
Sbjct  61   CAFPICRPCYEYERLEGNQACPQCKTRFKRIRGSPRV  97



>ref|XP_006351001.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Solanum tuberosum]
Length=1090

 Score =   182 bits (462),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 86/97 (89%), Gaps = 1/97 (1%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT GRLIAGSH RNEFVLI ADE GRV SV  LS ++CQICGDE+EIT DGE FVACNE
Sbjct  4    MDTSGRLIAGSHIRNEFVLIKADEFGRVESVHALSARMCQICGDELEIT-DGELFVACNE  62

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCR CYEYERREGNQACPQCKTRYKRIKGSPRV
Sbjct  63   CAFPVCRLCYEYERREGNQACPQCKTRYKRIKGSPRV  99



>ref|XP_010312466.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming] 
[Solanum lycopersicum]
Length=1086

 Score =   181 bits (458),  Expect = 9e-49, Method: Composition-based stats.
 Identities = 83/100 (83%), Positives = 87/100 (87%), Gaps = 1/100 (1%)
 Frame = +3

Query  135  VGLMDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVA  314
            + +MDT GRLIAGSH RNEFVLI ADE GRV SV ELS Q+CQICGDE+E T DGE FVA
Sbjct  1    MAMMDTGGRLIAGSHIRNEFVLIKADEFGRVESVHELSEQMCQICGDELE-TSDGELFVA  59

Query  315  CNECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CNECAFPVCR CYEYERREG QACPQCKTRYKRIKGSPRV
Sbjct  60   CNECAFPVCRLCYEYERREGTQACPQCKTRYKRIKGSPRV  99



>ref|XP_010063847.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Eucalyptus grandis]
 gb|KCW71116.1| hypothetical protein EUGRSUZ_F04216 [Eucalyptus grandis]
Length=1092

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 86/97 (89%), Gaps = 1/97 (1%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT GRL+ GSHNRNE +LINADE+GRVT VK LSG+ICQIC DE+EIT DGEPFVACNE
Sbjct  1    MDT-GRLVTGSHNRNEIILINADEVGRVTCVKHLSGKICQICADEIEITGDGEPFVACNE  59

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCR CYEYER EG QACP CKTRYKRIKGSPRV
Sbjct  60   CAFPVCRHCYEYERSEGTQACPHCKTRYKRIKGSPRV  96



>ref|XP_010063851.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Eucalyptus grandis]
 gb|KCW71112.1| hypothetical protein EUGRSUZ_F04212 [Eucalyptus grandis]
Length=1091

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 86/97 (89%), Gaps = 1/97 (1%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT GRL+ GSHNRNE +LINADE+GRVT VK LSG+ICQIC DE+EIT DGEPFVACNE
Sbjct  1    MDT-GRLVTGSHNRNEIILINADEVGRVTCVKHLSGKICQICADEIEITGDGEPFVACNE  59

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCR CYEYER EG QACP CKTRYKRIKGSPRV
Sbjct  60   CAFPVCRHCYEYERSEGTQACPHCKTRYKRIKGSPRV  96



>gb|AFD33697.1| cellulose synthase A [Eucalyptus camaldulensis]
Length=1092

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 86/97 (89%), Gaps = 1/97 (1%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT GRL+ GSHNRNE +LINADE+GRVT VK LSG+IC+IC DE+EIT DGEPFVACNE
Sbjct  1    MDT-GRLVTGSHNRNEIILINADEVGRVTCVKHLSGKICRICADEIEITGDGEPFVACNE  59

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCR CYEYER EG QACP CKTRYKRIKGSPRV
Sbjct  60   CAFPVCRHCYEYERSEGTQACPHCKTRYKRIKGSPRV  96



>ref|XP_010927397.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming]-like 
[Elaeis guineensis]
Length=1097

 Score =   162 bits (409),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 71/98 (72%), Positives = 83/98 (85%), Gaps = 1/98 (1%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEI-TVDGEPFVACN  320
            MDT GRL+AGS NRNEFV+INAD+ GR  SV++ +G  CQICGD++EI   + EPFVACN
Sbjct  1    MDTGGRLVAGSRNRNEFVVINADDFGRSKSVQDSNGLNCQICGDDIEILEEEKEPFVACN  60

Query  321  ECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            ECAFPVCR CYEYERREG+Q+CPQC+TRYKR KGS RV
Sbjct  61   ECAFPVCRTCYEYERREGSQSCPQCRTRYKRHKGSARV  98



>ref|XP_011079381.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X2 [Sesamum indicum]
Length=1036

 Score =   160 bits (406),  Expect = 9e-42, Method: Composition-based stats.
 Identities = 68/97 (70%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E      +K L+GQ+C+ICGDE+ +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLTGQVCEICGDEIGLTVDGELFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREGNQ CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGNQQCPQCKTRYKRLKGSPRV  95



>ref|XP_011079380.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X1 [Sesamum indicum]
Length=1037

 Score =   160 bits (406),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 68/97 (70%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E      +K L+GQ+C+ICGDE+ +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLTGQVCEICGDEIGLTVDGELFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREGNQ CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGNQQCPQCKTRYKRLKGSPRV  95



>ref|XP_011079382.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X3 [Sesamum indicum]
Length=1029

 Score =   160 bits (406),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 68/97 (70%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E      +K L+GQ+C+ICGDE+ +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLTGQVCEICGDEIGLTVDGELFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREGNQ CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGNQQCPQCKTRYKRLKGSPRV  95



>ref|XP_009414591.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming]-like 
[Musa acuminata subsp. malaccensis]
Length=1097

 Score =   160 bits (405),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 71/97 (73%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            MDT  RL+AGS NRNEFV+INAD+  R    +  S QICQICGD++E+ V+ E FVACNE
Sbjct  1    MDTGRRLVAGSRNRNEFVVINADDFERPKFAQVSSRQICQICGDDIEVLVEEEFFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCR CYEYERREG QACPQCKTRYKR KGSPRV
Sbjct  61   CAFPVCRTCYEYERREGTQACPQCKTRYKRHKGSPRV  97



>gb|KJB49074.1| hypothetical protein B456_008G100100 [Gossypium raimondii]
Length=255

 Score =   151 bits (382),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 99/116 (85%), Gaps = 6/116 (5%)
 Frame = +3

Query  225  VTSVKELSGQICQICGDEVEITVDGEPFVACNECAFPVCRPCYEYERREGNQACPQCKTR  404
            + SVKELSGQ CQICGDE+EITVDGEPFVACNECAFPVCR CYEYERREGNQACPQCKTR
Sbjct  1    MKSVKELSGQSCQICGDEIEITVDGEPFVACNECAFPVCRTCYEYERREGNQACPQCKTR  60

Query  405  YKRIKGSPRVegdeeeeefddldhefdY----PEHMTEAALAARFNG--GLGVNGS  554
            YKRIKGSPRVEGDEEE++ DDLD+EFDY    P+ +T+A LAAR N   G  +N S
Sbjct  61   YKRIKGSPRVEGDEEEDDIDDLDNEFDYGTLDPQQVTDAMLAARLNAVRGSQLNSS  116



>ref|XP_009622821.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X1 [Nicotiana tomentosiformis]
Length=1079

 Score =   159 bits (403),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 80/97 (82%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E  +   +K+LSGQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKDLSGQVCEICGDEIGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>gb|EYU35355.1| hypothetical protein MIMGU_mgv1a000638mg [Erythranthe guttata]
Length=1036

 Score =   159 bits (402),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 69/97 (71%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E     ++K LSGQ C+ICGDEV +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKTLKNLSGQDCEICGDEVGLTVDGELFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREGNQ CPQCKTR+KR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGNQLCPQCKTRFKRLKGSPRV  95



>ref|XP_011083940.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Sesamum indicum]
Length=1041

 Score =   159 bits (402),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 68/97 (70%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E      +K LSGQ+C+ICGDE+ +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLSGQVCEICGDEIGLTVDGELFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>ref|XP_009777624.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Nicotiana sylvestris]
Length=1041

 Score =   159 bits (402),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 80/97 (82%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E  +   +K+LSGQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKDLSGQVCEICGDEIGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>ref|XP_009622822.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X2 [Nicotiana tomentosiformis]
Length=1041

 Score =   159 bits (402),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 80/97 (82%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E  +   +K+LSGQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKDLSGQVCEICGDEIGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>gb|AFW69155.1| putative cellulose synthase family protein [Zea mays]
Length=981

 Score =   159 bits (401),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 68/97 (70%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE VLI   E  +   ++ LSGQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEANAGLVAGSHNRNELVLIRGHEDPK--PLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>ref|XP_004242614.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Solanum lycopersicum]
Length=1041

 Score =   159 bits (401),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E  +   +K+LSGQ+C ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKDLSGQVCDICGDEIGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>ref|XP_004956855.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming]-like 
[Setaria italica]
Length=1050

 Score =   158 bits (400),  Expect = 7e-41, Method: Composition-based stats.
 Identities = 68/97 (70%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE VLI   E  +   ++ LSGQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHEDPK--PLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>ref|XP_002963550.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 ref|XP_002981528.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ17343.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ35421.1| family 2 glycosyltransferase [Selaginella moellendorffii]
Length=1093

 Score =   158 bits (400),  Expect = 8e-41, Method: Composition-based stats.
 Identities = 68/97 (70%), Positives = 80/97 (82%), Gaps = 1/97 (1%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I  +  G V  +K L+GQ+CQICGD+V  TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIRQEGDG-VKPLKHLNGQVCQICGDDVGCTVDGELFVACNE  59

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYER++GNQ+CPQCKTRY+R KGSPRV
Sbjct  60   CAFPVCRPCYEYERKDGNQSCPQCKTRYRRHKGSPRV  96



>ref|XP_006660635.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming]-like 
[Oryza brachyantha]
Length=1053

 Score =   158 bits (399),  Expect = 8e-41, Method: Composition-based stats.
 Identities = 68/97 (70%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE VLI   E      ++ LSGQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHE--EPKPLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>ref|XP_002460229.1| hypothetical protein SORBIDRAFT_02g025020 [Sorghum bicolor]
 gb|EER96750.1| hypothetical protein SORBIDRAFT_02g025020 [Sorghum bicolor]
Length=1049

 Score =   158 bits (399),  Expect = 8e-41, Method: Composition-based stats.
 Identities = 68/97 (70%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE VLI   E  +   ++ LSGQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHEDPK--PLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>ref|XP_006343620.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Solanum tuberosum]
Length=1041

 Score =   158 bits (399),  Expect = 8e-41, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E  +   +K+LSGQ+C ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEEHK--PLKDLSGQVCDICGDEIGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>gb|KCW78813.1| hypothetical protein EUGRSUZ_C00246 [Eucalyptus grandis]
Length=1012

 Score =   157 bits (398),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>ref|XP_008670200.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming] 
[Zea mays]
 tpg|DAA40096.1| TPA: putative cellulose synthase family protein [Zea mays]
 gb|AIL25252.1| cellulose synthase catalytic subunit 13 [Zea mays]
Length=1052

 Score =   157 bits (398),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 68/97 (70%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE VLI   E  +   ++ LSGQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEANAGLVAGSHNRNELVLIRGHEDPK--PLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>gb|AFR58756.2| cellulose synthase 3 [Eucalyptus tereticornis]
Length=1040

 Score =   157 bits (398),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>gb|AGE09566.1| cellulose synthase-like protein [Eucalyptus cladocalyx]
Length=1041

 Score =   157 bits (398),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>ref|NP_001105532.1| cellulose synthase catalytic subunit 12 [Zea mays]
 gb|AAR23312.1| cellulose synthase catalytic subunit 12 [Zea mays]
 tpg|DAA61528.1| TPA: putative cellulose synthase family protein [Zea mays]
Length=1052

 Score =   157 bits (398),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 68/97 (70%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE VLI   E  +   ++ LSGQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHEDPK--PLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>gb|AEK31217.1| cellulose synthase A [Eucalyptus camaldulensis]
Length=1040

 Score =   157 bits (398),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>gb|KCW78815.1| hypothetical protein EUGRSUZ_C00246 [Eucalyptus grandis]
Length=1041

 Score =   157 bits (398),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>gb|KCW78814.1| hypothetical protein EUGRSUZ_C00246 [Eucalyptus grandis]
Length=1040

 Score =   157 bits (398),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>ref|XP_010687624.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Beta vulgaris subsp. vulgaris]
Length=1036

 Score =   157 bits (398),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I   E      +K+LSGQ+C+ICGDE+ ++VDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIQGHE--EPKPLKDLSGQVCEICGDEIGLSVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQNCPQCKTRYKRLKGSPRV  95



>ref|XP_009417280.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Musa acuminata subsp. malaccensis]
Length=1091

 Score =   157 bits (398),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I  D       +++LSGQICQICGD+V +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIRRDGESGPKPLQQLSGQICQICGDDVGLTVDGDLFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCR CYEYERREGNQ CPQCKTR+KR+KG PRV
Sbjct  61   CAFPVCRTCYEYERREGNQVCPQCKTRFKRLKGCPRV  97



>gb|AGJ71354.1| cellulose synthase 3 [Eucalyptus urophylla]
Length=1040

 Score =   157 bits (398),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>ref|XP_009408434.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Musa acuminata subsp. malaccensis]
Length=1091

 Score =   157 bits (398),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I  D       +++LSGQICQICGD+V +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIRRDGESAPKPLQQLSGQICQICGDDVGLTVDGDLFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFP+CR CYEYERREGNQ CPQCKTR+KR+KG PRV
Sbjct  61   CAFPICRTCYEYERREGNQVCPQCKTRFKRLKGCPRV  97



>gb|KCW78812.1| hypothetical protein EUGRSUZ_C00246 [Eucalyptus grandis]
Length=1040

 Score =   157 bits (397),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>ref|NP_001289644.1| cellulose synthase A catalytic subunit 7 [Eucalyptus grandis]
 gb|AAY60845.1| cellulose synthase 3 [Eucalyptus grandis]
Length=1040

 Score =   157 bits (397),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>gb|EPS60781.1| hypothetical protein M569_14019 [Genlisea aurea]
Length=1043

 Score =   157 bits (397),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 68/97 (70%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E     +VK LSGQ+C+ICGD V +TV GE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKAVKNLSGQVCEICGDRVGVTVGGELFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQLCPQCKTRYKRLKGSPRV  95



>ref|XP_008794369.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming]-like 
[Phoenix dactylifera]
Length=1049

 Score =   157 bits (397),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE VLI   E      +K L+GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHE--EPKPLKALNGQVCEICGDEIGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQLCPQCKTRYKRLKGSPRV  95



>ref|XP_010265522.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Nelumbo nucifera]
Length=1034

 Score =   157 bits (397),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E      +K L GQ+C+ICGDEV IT +G+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKALDGQVCEICGDEVGITAEGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREGNQ CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGNQQCPQCKTRYKRLKGSPRV  95



>gb|EYU17477.1| hypothetical protein MIMGU_mgv1a016004mg [Erythranthe guttata]
Length=137

 Score =   145 bits (366),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 75/91 (82%), Gaps = 4/91 (4%)
 Frame = +3

Query  174  SHNRNEFV----LINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNECAFPVC  341
            SH   E +    ++ A     VTSVKELSGQICQICGDEVE TVDGEPFVACNECAFPVC
Sbjct  42   SHKHKEHLGEMGVVAASAFALVTSVKELSGQICQICGDEVEFTVDGEPFVACNECAFPVC  101

Query  342  RPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            R CYEY+RREGNQ+CPQCKTR+KRIKGSPRV
Sbjct  102  RSCYEYDRREGNQSCPQCKTRFKRIKGSPRV  132



>gb|KHG11460.1| Cellulose synthase A catalytic subunit 7 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=996

 Score =   157 bits (396),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E      +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQQCPQCKTRYKRLKGSPRV  95



>ref|XP_008450511.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Cucumis melo]
Length=1068

 Score =   157 bits (397),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E      +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  37   MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDEVGLTVDGDLFVACNE  94

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  95   CGFPVCRPCYEYERREGSQNCPQCKTRYKRLKGSPRV  131



>gb|AFB18637.1| CESA8 [Gossypium hirsutum]
Length=1039

 Score =   157 bits (396),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E      +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQQCPQCKTRYKRLKGSPRV  95



>gb|KJB53884.1| hypothetical protein B456_009G009700 [Gossypium raimondii]
Length=1039

 Score =   157 bits (396),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E      +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQQCPQCKTRYKRLKGSPRV  95



>ref|XP_010929171.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming]-like 
[Elaeis guineensis]
Length=1048

 Score =   157 bits (396),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE VLI   E      +K L+GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHE--EPKPLKALNGQVCEICGDEIGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQLCPQCKTRYKRLKGSPRV  95



>gb|KHG19749.1| Cellulose synthase A catalytic subunit 7 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1057

 Score =   157 bits (396),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E      +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDEIGVTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>gb|AFB18636.1| CESA7 [Gossypium hirsutum]
 gb|AIE38017.1| cellulose synthase-7 [Gossypium hirsutum]
Length=1042

 Score =   156 bits (395),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E      +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDEIGVTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>gb|KJB07761.1| hypothetical protein B456_001G044700 [Gossypium raimondii]
Length=1042

 Score =   156 bits (395),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E      +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDEIGVTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>gb|KJB07762.1| hypothetical protein B456_001G044700 [Gossypium raimondii]
Length=1043

 Score =   156 bits (395),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E      +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDEIGVTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>dbj|BAJ85783.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AIY30130.1| cellulose synthase 8 [Hordeum vulgare]
Length=1055

 Score =   156 bits (395),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 69/97 (71%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE VLI   E  +   V+ LSGQ+C+ICGDEV  TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVLIRGHEDHK--PVRALSGQVCEICGDEVGRTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>tpg|DAA61529.1| TPA: putative cellulose synthase family protein [Zea mays]
Length=1056

 Score =   156 bits (395),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE VLI   E  +   ++ LSGQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHEDPK--PLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KG+PRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGTPRV  95



>gb|AAM26299.1| cellulose synthase [Populus tremuloides]
Length=1032

 Score =   156 bits (395),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>ref|XP_009410192.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming] 
[Musa acuminata subsp. malaccensis]
Length=1047

 Score =   156 bits (395),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE VLI   E      ++ L+GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHE--EPKPLRALNGQVCEICGDEIGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQLCPQCKTRYKRLKGSPRV  95



>ref|XP_009385959.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Musa acuminata subsp. malaccensis]
Length=1091

 Score =   156 bits (395),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 68/98 (69%), Positives = 81/98 (83%), Gaps = 2/98 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINAD-EIGRVTSVKELSGQICQICGDEVEITVDGEPFVACN  320
            M+    L+AGSHNRNE V+I  D E+G    +++LSGQICQICGD+V +TVDG+ FVACN
Sbjct  1    MEASAGLVAGSHNRNELVVIRRDGELGP-KPLQQLSGQICQICGDDVGLTVDGDLFVACN  59

Query  321  ECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            ECAFP+CR CYEYERREGNQ CPQCKTR+KR+KG PRV
Sbjct  60   ECAFPICRTCYEYERREGNQVCPQCKTRFKRLKGCPRV  97



>ref|XP_002325122.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEF03687.1| cellulose synthase family protein [Populus trichocarpa]
Length=1032

 Score =   156 bits (395),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGVTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>gb|AFZ78551.1| cellulose synthase [Populus tomentosa]
Length=1032

 Score =   156 bits (394),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>ref|XP_007013859.1| Cellulose synthase family protein isoform 1 [Theobroma cacao]
 gb|EOY31478.1| Cellulose synthase family protein isoform 1 [Theobroma cacao]
Length=1043

 Score =   156 bits (394),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E      +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>ref|XP_008790154.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic 
subunit 9 [UDP-forming]-like [Phoenix dactylifera]
Length=1048

 Score =   156 bits (394),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE VLI   E      ++ L+GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHE--EPKPLRALNGQVCEICGDEIGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQLCPQCKTRYKRLKGSPRV  95



>ref|XP_011018058.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Populus euphratica]
Length=1032

 Score =   155 bits (393),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>ref|XP_011033387.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Populus euphratica]
Length=1036

 Score =   155 bits (393),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>dbj|BAJ05813.1| cellulose synthase catalytic subunit [Oryza sativa Indica Group]
Length=1055

 Score =   155 bits (393),  Expect = 6e-40, Method: Composition-based stats.
 Identities = 68/97 (70%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE VLI   E      ++ LSGQ+C+ICGDEV  TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHE--EPKPLRALSGQVCEICGDEVGRTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>ref|NP_001063207.1| Os09g0422500 [Oryza sativa Japonica Group]
 sp|Q69P51.1|CESA9_ORYSJ RecName: Full=Cellulose synthase A catalytic subunit 9 [UDP-forming]; 
AltName: Full=OsCesA9 [Oryza sativa Japonica Group]
 sp|A2Z1C8.1|CESA9_ORYSI RecName: Full=Cellulose synthase A catalytic subunit 9 [UDP-forming]; 
AltName: Full=OsCesA9 [Oryza sativa Indica Group]
 dbj|BAD33412.1| putative cellulose synthase [Oryza sativa Japonica Group]
 dbj|BAD33645.1| putative cellulose synthase [Oryza sativa Japonica Group]
 dbj|BAF25121.1| Os09g0422500 [Oryza sativa Japonica Group]
 gb|EAZ09139.1| hypothetical protein OsI_31409 [Oryza sativa Indica Group]
 gb|EAZ44775.1| hypothetical protein OsJ_29406 [Oryza sativa Japonica Group]
 dbj|BAH00349.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1055

 Score =   155 bits (393),  Expect = 6e-40, Method: Composition-based stats.
 Identities = 68/97 (70%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE VLI   E      ++ LSGQ+C+ICGDEV  TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHE--EPKPLRALSGQVCEICGDEVGRTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>gb|ACJ38667.1| cellulose synthase [Betula luminifera]
Length=1093

 Score =   155 bits (393),  Expect = 6e-40, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I  D       +++LSGQICQICGD+V +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIRRDGESAPRPLQQLSGQICQICGDDVGLTVDGELFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFP+CR CYEYERREGNQ CPQCKTR+KR+KG  RV
Sbjct  61   CAFPICRTCYEYERREGNQVCPQCKTRFKRLKGCARV  97



>ref|XP_004287144.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Fragaria vesca subsp. vesca]
Length=1049

 Score =   155 bits (393),  Expect = 6e-40, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E  +   ++ L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLRNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQNCPQCKTRYKRLKGSPRV  95



>ref|XP_010250039.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Nelumbo nucifera]
Length=1085

 Score =   155 bits (393),  Expect = 6e-40, Method: Composition-based stats.
 Identities = 65/97 (67%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+ K  ++AGSH RNEFV+I  +       +K L+GQ+CQICGD V +T  G+ FVACNE
Sbjct  1    MEAKAGMVAGSHKRNEFVMIRNEGEAGPKPLKHLNGQVCQICGDTVGVTATGDVFVACNE  60

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            CAFPVCRPCYEYERR+GNQ+CPQCKTRYKR KGSPRV
Sbjct  61   CAFPVCRPCYEYERRDGNQSCPQCKTRYKRHKGSPRV  97



>gb|AEE60897.1| cellulose synthase [Populus tomentosa]
Length=1032

 Score =   155 bits (392),  Expect = 6e-40, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>ref|XP_006842872.1| hypothetical protein AMTR_s00081p00171100 [Amborella trichopoda]
 gb|ERN04547.1| hypothetical protein AMTR_s00081p00171100 [Amborella trichopoda]
Length=1083

 Score =   155 bits (392),  Expect = 7e-40, Method: Composition-based stats.
 Identities = 66/98 (67%), Positives = 79/98 (81%), Gaps = 2/98 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINAD-EIGRVTSVKELSGQICQICGDEVEITVDGEPFVACN  320
            M+    ++AGSH RNEFV+I  + E+G    +K L+ Q+CQICGD V +T  GEPFVACN
Sbjct  1    MEANAGMVAGSHKRNEFVMIRHEGEVGP-KPIKNLNSQVCQICGDTVGLTASGEPFVACN  59

Query  321  ECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            ECAFPVCRPCYEYER++GNQ+CPQCKTRYKR KGSPRV
Sbjct  60   ECAFPVCRPCYEYERKDGNQSCPQCKTRYKRQKGSPRV  97



>gb|KEH32618.1| cellulose synthase-like protein [Medicago truncatula]
Length=1072

 Score =   155 bits (392),  Expect = 7e-40, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGD+V +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDDVGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGRQLCPQCKTRYKRLKGSPRV  95



>ref|XP_004507755.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Cicer arietinum]
Length=1039

 Score =   155 bits (392),  Expect = 8e-40, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGD+V +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDDVGLTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGRQLCPQCKTRYKRLKGSPRV  95



>gb|AFR38707.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38708.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38709.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38710.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38711.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38712.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38713.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38714.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38715.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38716.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38717.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38718.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38719.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38720.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38721.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38722.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38731.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38733.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38734.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38738.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38742.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38743.1| cellulose synthase, partial [Populus nigra]
 gb|AFR38744.1| cellulose synthase, partial [Populus nigra]
 gb|AFR38745.1| cellulose synthase, partial [Populus nigra]
 gb|AFR38746.1| cellulose synthase, partial [Populus nigra]
 gb|AFR38747.1| cellulose synthase, partial [Populus nigra]
 gb|AFR38748.1| cellulose synthase, partial [Populus nigra]
 gb|AFR38749.1| cellulose synthase, partial [Populus nigra]
 gb|AFR38750.1| cellulose synthase, partial [Populus nigra]
Length=98

 Score =   142 bits (358),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  323
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGVTVDGDLFVACNE  58

Query  324  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  434
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920