BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF007P14

Length=555
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009587222.1|  PREDICTED: multiple C2 and transmembrane dom...    142   9e-36   Nicotiana tomentosiformis
ref|XP_009785357.1|  PREDICTED: multiple C2 and transmembrane dom...    141   2e-35   Nicotiana sylvestris
ref|XP_006351338.1|  PREDICTED: multiple C2 and transmembrane dom...    141   2e-35   Solanum tuberosum [potatoes]
ref|XP_009799235.1|  PREDICTED: extended synaptotagmin-1-like           141   2e-35   Nicotiana sylvestris
ref|XP_009614150.1|  PREDICTED: multiple C2 and transmembrane dom...    141   2e-35   Nicotiana tomentosiformis
ref|XP_004249277.1|  PREDICTED: extended synaptotagmin-1-like           141   2e-35   Solanum lycopersicum
ref|XP_009594768.1|  PREDICTED: multiple C2 and transmembrane dom...    141   3e-35   Nicotiana tomentosiformis
ref|XP_004249278.1|  PREDICTED: multiple C2 and transmembrane dom...    140   5e-35   Solanum lycopersicum
ref|XP_006351337.1|  PREDICTED: multiple C2 and transmembrane dom...    140   8e-35   
ref|XP_011078851.1|  PREDICTED: multiple C2 and transmembrane dom...    139   1e-34   Sesamum indicum [beniseed]
ref|XP_004249163.1|  PREDICTED: extended synaptotagmin-1-like           139   2e-34   Solanum lycopersicum
ref|XP_006362239.1|  PREDICTED: multiple C2 and transmembrane dom...    139   2e-34   Solanum tuberosum [potatoes]
ref|XP_008360635.1|  PREDICTED: multiple C2 and transmembrane dom...    139   2e-34   
gb|EYU20709.1|  hypothetical protein MIMGU_mgv1a001689mg                138   4e-34   Erythranthe guttata [common monkey flower]
ref|XP_009376104.1|  PREDICTED: multiple C2 and transmembrane dom...    138   4e-34   Pyrus x bretschneideri [bai li]
ref|XP_007201936.1|  hypothetical protein PRUPE_ppa001850mg             137   5e-34   
ref|XP_006381053.1|  C2 domain-containing family protein                137   5e-34   Populus trichocarpa [western balsam poplar]
ref|XP_008240960.1|  PREDICTED: multiple C2 and transmembrane dom...    137   6e-34   Prunus mume [ume]
gb|KEH16148.1|  C2 calcium/lipid-binding and GRAM domain protein        137   1e-33   Medicago truncatula
emb|CDP10110.1|  unnamed protein product                                137   1e-33   Coffea canephora [robusta coffee]
ref|XP_011020270.1|  PREDICTED: multiple C2 and transmembrane dom...    136   1e-33   Populus euphratica
ref|XP_009766493.1|  PREDICTED: multiple C2 and transmembrane dom...    136   1e-33   Nicotiana sylvestris
ref|XP_009369854.1|  PREDICTED: multiple C2 and transmembrane dom...    136   2e-33   Pyrus x bretschneideri [bai li]
ref|XP_003535846.1|  PREDICTED: multiple C2 and transmembrane dom...    136   2e-33   Glycine max [soybeans]
ref|XP_007162297.1|  hypothetical protein PHAVU_001G140200g             136   2e-33   Phaseolus vulgaris [French bean]
ref|XP_003554197.1|  PREDICTED: multiple C2 and transmembrane dom...    136   2e-33   Glycine max [soybeans]
ref|XP_004136579.1|  PREDICTED: multiple C2 and transmembrane dom...    135   2e-33   Cucumis sativus [cucumbers]
ref|XP_008443079.1|  PREDICTED: extended synaptotagmin-1                135   2e-33   Cucumis melo [Oriental melon]
ref|XP_004493560.1|  PREDICTED: multiple C2 and transmembrane dom...    135   3e-33   Cicer arietinum [garbanzo]
ref|XP_003521201.1|  PREDICTED: multiple C2 and transmembrane dom...    135   3e-33   Glycine max [soybeans]
ref|XP_008387239.1|  PREDICTED: multiple C2 and transmembrane dom...    135   3e-33   
gb|KHN07409.1|  Multiple C2 and transmembrane domain-containing p...    135   3e-33   Glycine soja [wild soybean]
emb|CDY47660.1|  BnaC04g23970D                                          135   4e-33   Brassica napus [oilseed rape]
gb|EPS67145.1|  hypothetical protein M569_07629                         135   5e-33   Genlisea aurea
ref|XP_010111396.1|  Multiple C2 and transmembrane domain-contain...    135   6e-33   Morus notabilis
emb|CBI30044.3|  unnamed protein product                                131   6e-33   Vitis vinifera
ref|XP_010463385.1|  PREDICTED: multiple C2 and transmembrane dom...    132   8e-33   Camelina sativa [gold-of-pleasure]
ref|XP_007145661.1|  hypothetical protein PHAVU_007G257800g             134   9e-33   Phaseolus vulgaris [French bean]
gb|KDP24596.1|  hypothetical protein JCGZ_25512                         134   1e-32   Jatropha curcas
ref|XP_011033252.1|  PREDICTED: extended synaptotagmin-1                134   1e-32   Populus euphratica
ref|XP_004497931.1|  PREDICTED: uncharacterized protein LOC101499...    134   1e-32   Cicer arietinum [garbanzo]
ref|XP_006437045.1|  hypothetical protein CICLE_v10030764mg             133   2e-32   Citrus clementina [clementine]
gb|KDO57727.1|  hypothetical protein CISIN_1g004109mg                   133   2e-32   Citrus sinensis [apfelsine]
ref|XP_004304385.1|  PREDICTED: multiple C2 and transmembrane dom...    133   2e-32   Fragaria vesca subsp. vesca
ref|XP_002532333.1|  synaptotagmin, putative                            132   2e-32   
ref|XP_006393033.1|  hypothetical protein EUTSA_v10011254mg             133   2e-32   Eutrema salsugineum [saltwater cress]
ref|XP_002322682.2|  hypothetical protein POPTR_0016s04960g             133   2e-32   
ref|XP_010554852.1|  PREDICTED: multiple C2 and transmembrane dom...    133   2e-32   
ref|XP_010672701.1|  PREDICTED: multiple C2 and transmembrane dom...    133   3e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002894324.1|  C2 domain-containing protein                       133   3e-32   
ref|XP_006306818.1|  hypothetical protein CARUB_v10008360mg             132   4e-32   Capsella rubella
emb|CDX98254.1|  BnaC06g16150D                                          132   4e-32   
ref|XP_009104078.1|  PREDICTED: multiple C2 and transmembrane dom...    132   4e-32   Brassica rapa
emb|CDX67712.1|  BnaA07g17520D                                          132   4e-32   
emb|CDY69710.1|  BnaAnng31280D                                          132   5e-32   Brassica napus [oilseed rape]
ref|XP_009139005.1|  PREDICTED: extended synaptotagmin-1-like           132   5e-32   Brassica rapa
emb|CAN80955.1|  hypothetical protein VITISV_013781                     132   5e-32   Vitis vinifera
ref|XP_010504727.1|  PREDICTED: multiple C2 and transmembrane dom...    132   5e-32   Camelina sativa [gold-of-pleasure]
ref|XP_002278165.1|  PREDICTED: extended synaptotagmin-1                132   6e-32   Vitis vinifera
ref|XP_006290627.1|  hypothetical protein CARUB_v10016719mg             132   6e-32   Capsella rubella
ref|XP_002878177.1|  C2 domain-containing protein                       132   6e-32   
ref|XP_010516424.1|  PREDICTED: multiple C2 and transmembrane dom...    132   6e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010500735.1|  PREDICTED: extended synaptotagmin-1-like           131   9e-32   Camelina sativa [gold-of-pleasure]
ref|NP_175568.1|  calcium-dependent lipid-binding (CaLB domain) p...    131   9e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010479644.1|  PREDICTED: extended synaptotagmin-1-like iso...    131   9e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010057953.1|  PREDICTED: extended synaptotagmin-1-like           131   1e-31   Eucalyptus grandis [rose gum]
ref|XP_006402831.1|  hypothetical protein EUTSA_v10005798mg             131   1e-31   Eutrema salsugineum [saltwater cress]
dbj|BAF01685.1|  anthranilate phosphoribosyltransferase-like protein    130   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191347.1|  C2 domain-containing plant phosphoribosyltransf...    130   2e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AAK53020.1|AF375436_1  AT3g57880/T10K17_90                           130   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008442250.1|  PREDICTED: multiple C2 and transmembrane dom...    130   2e-31   Cucumis melo [Oriental melon]
gb|KFK35840.1|  hypothetical protein AALP_AA4G043900                    130   3e-31   Arabis alpina [alpine rockcress]
gb|KJB36100.1|  hypothetical protein B456_006G141200                    129   5e-31   Gossypium raimondii
ref|XP_003625221.1|  Anthranilate phosphoribosyltransferase-like ...    129   7e-31   Medicago truncatula
ref|XP_004144665.1|  PREDICTED: uncharacterized protein LOC101203...    128   9e-31   Cucumis sativus [cucumbers]
ref|XP_010548191.1|  PREDICTED: multiple C2 and transmembrane dom...    127   2e-30   Tarenaya hassleriana [spider flower]
ref|XP_008778691.1|  PREDICTED: multiple C2 and transmembrane dom...    127   4e-30   Phoenix dactylifera
ref|XP_007028941.1|  Calcium-dependent lipid-binding (CaLB domain...    124   3e-29   
ref|XP_007028942.1|  Calcium-dependent lipid-binding (CaLB domain...    124   3e-29   Theobroma cacao [chocolate]
ref|XP_006386096.1|  hypothetical protein POPTR_0003s22060g             123   6e-29   
ref|XP_010265829.1|  PREDICTED: multiple C2 and transmembrane dom...    123   8e-29   Nelumbo nucifera [Indian lotus]
ref|XP_009395864.1|  PREDICTED: extended synaptotagmin-1-like           122   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008243596.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    121   3e-28   Prunus mume [ume]
ref|XP_007208351.1|  hypothetical protein PRUPE_ppa001743mg             121   3e-28   Prunus persica
ref|XP_010928839.1|  PREDICTED: extended synaptotagmin-1-like           121   3e-28   Elaeis guineensis
ref|XP_008782885.1|  PREDICTED: multiple C2 and transmembrane dom...    121   4e-28   Phoenix dactylifera
ref|XP_011025253.1|  PREDICTED: multiple C2 and transmembrane dom...    120   6e-28   Populus euphratica
ref|XP_009364713.1|  PREDICTED: multiple C2 and transmembrane dom...    120   6e-28   Pyrus x bretschneideri [bai li]
ref|XP_008358865.1|  PREDICTED: multiple C2 and transmembrane dom...    120   6e-28   
ref|XP_009364728.1|  PREDICTED: multiple C2 and transmembrane dom...    120   6e-28   Pyrus x bretschneideri [bai li]
ref|XP_007014901.1|  Calcium-dependent lipid-binding (CaLB domain...    120   7e-28   
emb|CBI16433.3|  unnamed protein product                                119   9e-28   Vitis vinifera
ref|XP_008787291.1|  PREDICTED: extended synaptotagmin-1-like           120   1e-27   Phoenix dactylifera
ref|XP_004295231.1|  PREDICTED: multiple C2 and transmembrane dom...    120   1e-27   Fragaria vesca subsp. vesca
ref|XP_002297795.1|  C2 domain-containing family protein                119   1e-27   Populus trichocarpa [western balsam poplar]
ref|XP_010913922.1|  PREDICTED: multiple C2 and transmembrane dom...    119   2e-27   
gb|KJB83485.1|  hypothetical protein B456_013G250100                    119   2e-27   Gossypium raimondii
ref|XP_009374817.1|  PREDICTED: multiple C2 and transmembrane dom...    119   2e-27   Pyrus x bretschneideri [bai li]
gb|KHG04257.1|  Multiple C2 and transmembrane domain-containing 1       119   2e-27   Gossypium arboreum [tree cotton]
gb|KJB83481.1|  hypothetical protein B456_013G250100                    119   2e-27   Gossypium raimondii
ref|XP_002285588.1|  PREDICTED: multiple C2 and transmembrane dom...    119   2e-27   Vitis vinifera
ref|XP_002513446.1|  synaptotagmin, putative                            118   4e-27   Ricinus communis
ref|XP_006850074.1|  hypothetical protein AMTR_s00022p00214560          117   6e-27   
gb|KDP20200.1|  hypothetical protein JCGZ_07920                         117   6e-27   Jatropha curcas
ref|XP_006494723.1|  PREDICTED: multiple C2 and transmembrane dom...    117   9e-27   Citrus sinensis [apfelsine]
ref|XP_006445975.1|  hypothetical protein CICLE_v10014352mg             117   9e-27   Citrus clementina [clementine]
ref|XP_010091994.1|  Multiple C2 and transmembrane domain-contain...    117   1e-26   Morus notabilis
gb|KHG19030.1|  Multiple C2 and transmembrane domain-containing 1       116   2e-26   Gossypium arboreum [tree cotton]
gb|KJB66120.1|  hypothetical protein B456_010G128400                    116   2e-26   Gossypium raimondii
ref|XP_011037883.1|  PREDICTED: multiple C2 and transmembrane dom...    115   3e-26   Populus euphratica
ref|XP_010519731.1|  PREDICTED: multiple C2 and transmembrane dom...    115   3e-26   Tarenaya hassleriana [spider flower]
ref|XP_010238001.1|  PREDICTED: LOW QUALITY PROTEIN: extended syn...    114   7e-26   
ref|NP_001055351.1|  Os05g0370600                                       114   1e-25   
ref|XP_006654319.1|  PREDICTED: multiple C2 and transmembrane dom...    114   1e-25   Oryza brachyantha
gb|KEH30271.1|  C2 calcium/lipid-binding and GRAM domain protein        114   1e-25   Medicago truncatula
ref|NP_196801.1|  calcium-dependent lipid-binding domain-containi...    112   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002438680.1|  hypothetical protein SORBIDRAFT_10g024200          112   5e-25   Sorghum bicolor [broomcorn]
ref|XP_008658284.1|  PREDICTED: uncharacterized protein LOC100273...    112   5e-25   
ref|XP_003537951.1|  PREDICTED: multiple C2 and transmembrane dom...    112   7e-25   Glycine max [soybeans]
ref|XP_007131979.1|  hypothetical protein PHAVU_011G056600g             111   8e-25   Phaseolus vulgaris [French bean]
ref|XP_009131306.1|  PREDICTED: multiple C2 and transmembrane dom...    111   9e-25   Brassica rapa
emb|CDX78498.1|  BnaA03g04100D                                          111   1e-24   
ref|XP_010044995.1|  PREDICTED: multiple C2 and transmembrane dom...    111   1e-24   Eucalyptus grandis [rose gum]
ref|XP_010673580.1|  PREDICTED: multiple C2 and transmembrane dom...    110   2e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009121819.1|  PREDICTED: extended synaptotagmin-1-like           110   2e-24   Brassica rapa
ref|XP_010492034.1|  PREDICTED: multiple C2 and transmembrane dom...    110   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_002871539.1|  C2 domain-containing protein                       110   3e-24   
emb|CDX97214.1|  BnaC09g44110D                                          110   3e-24   
gb|EMT24491.1|  Multiple C2 and transmembrane domain-containing p...    109   3e-24   
gb|EMS45217.1|  Multiple C2 and transmembrane domain-containing p...    110   3e-24   Triticum urartu
ref|XP_006399782.1|  hypothetical protein EUTSA_v10012747mg             109   4e-24   Eutrema salsugineum [saltwater cress]
ref|XP_010227498.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    109   4e-24   
ref|XP_010419856.1|  PREDICTED: multiple C2 and transmembrane dom...    109   5e-24   
ref|XP_010419857.1|  PREDICTED: multiple C2 and transmembrane dom...    109   5e-24   Camelina sativa [gold-of-pleasure]
emb|CDY68091.1|  BnaAnng26150D                                          109   6e-24   Brassica napus [oilseed rape]
ref|XP_006289947.1|  hypothetical protein CARUB_v10003573mg             108   8e-24   Capsella rubella
ref|XP_007150401.1|  hypothetical protein PHAVU_005G150300g             107   2e-23   Phaseolus vulgaris [French bean]
ref|XP_003543552.1|  PREDICTED: multiple C2 and transmembrane dom...    107   2e-23   Glycine max [soybeans]
ref|XP_004142139.1|  PREDICTED: multiple C2 and transmembrane dom...    107   3e-23   Cucumis sativus [cucumbers]
emb|CDX70485.1|  BnaC03g05690D                                          107   3e-23   
ref|XP_008449758.1|  PREDICTED: multiple C2 and transmembrane dom...    106   5e-23   Cucumis melo [Oriental melon]
ref|XP_008647970.1|  PREDICTED: phosphoribosylanthranilate transf...    106   5e-23   
ref|XP_003546988.1|  PREDICTED: multiple C2 and transmembrane dom...    106   5e-23   Glycine max [soybeans]
ref|NP_001152102.1|  phosphoribosylanthranilate transferase             106   5e-23   
gb|KHN33324.1|  Multiple C2 and transmembrane domain-containing p...    106   6e-23   Glycine soja [wild soybean]
gb|KDP28646.1|  hypothetical protein JCGZ_14417                         106   9e-23   Jatropha curcas
emb|CDP14088.1|  unnamed protein product                                105   1e-22   Coffea canephora [robusta coffee]
ref|XP_002511838.1|  synaptotagmin, putative                            105   2e-22   Ricinus communis
ref|XP_009417304.1|  PREDICTED: multiple C2 and transmembrane dom...    104   3e-22   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI40337.3|  unnamed protein product                                102   8e-22   Vitis vinifera
ref|XP_010105960.1|  Multiple C2 and transmembrane domain-contain...    103   9e-22   Morus notabilis
ref|XP_006349900.1|  PREDICTED: multiple C2 and transmembrane dom...    102   1e-21   Solanum tuberosum [potatoes]
emb|CAN79812.1|  hypothetical protein VITISV_018822                     102   1e-21   Vitis vinifera
ref|XP_010255412.1|  PREDICTED: multiple C2 and transmembrane dom...    102   1e-21   Nelumbo nucifera [Indian lotus]
ref|XP_002271590.1|  PREDICTED: uncharacterized protein LOC100253432    102   1e-21   Vitis vinifera
ref|XP_010940465.1|  PREDICTED: multiple C2 and transmembrane dom...    102   2e-21   Elaeis guineensis
ref|XP_008806876.1|  PREDICTED: multiple C2 and transmembrane dom...    102   3e-21   Phoenix dactylifera
ref|XP_009386410.1|  PREDICTED: multiple C2 and transmembrane dom...    102   3e-21   
gb|KJB41306.1|  hypothetical protein B456_007G098200                    102   3e-21   Gossypium raimondii
ref|XP_009383872.1|  PREDICTED: multiple C2 and transmembrane dom...    101   3e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008778754.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    100   6e-21   
ref|XP_010934752.1|  PREDICTED: multiple C2 and transmembrane dom...    100   7e-21   Elaeis guineensis
ref|XP_010660813.1|  PREDICTED: uncharacterized protein LOC100264973    100   8e-21   Vitis vinifera
ref|XP_006445078.1|  hypothetical protein CICLE_v10018672mg             100   1e-20   Citrus clementina [clementine]
gb|KDO86111.1|  hypothetical protein CISIN_1g001835mg                 99.8    1e-20   Citrus sinensis [apfelsine]
ref|XP_007052594.1|  C2 calcium/lipid-binding plant phosphoribosy...  99.8    2e-20   
ref|XP_007220279.1|  hypothetical protein PRUPE_ppa000771mg           99.4    2e-20   Prunus persica
ref|XP_008244912.1|  PREDICTED: uncharacterized protein LOC103343020  99.4    2e-20   Prunus mume [ume]
ref|XP_007051844.1|  C2 calcium/lipid-binding plant phosphoribosy...  99.4    2e-20   
ref|XP_007051845.1|  C2 calcium/lipid-binding plant phosphoribosy...  99.0    3e-20   
dbj|BAK04937.1|  predicted protein                                    99.0    3e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT30716.1|  hypothetical protein F775_31640                       99.0    3e-20   
ref|XP_003580853.1|  PREDICTED: multiple C2 and transmembrane dom...  99.0    3e-20   
ref|XP_004235089.1|  PREDICTED: multiple C2 and transmembrane dom...  98.6    3e-20   Solanum lycopersicum
ref|XP_006342310.1|  PREDICTED: multiple C2 and transmembrane dom...  98.6    3e-20   Solanum tuberosum [potatoes]
ref|XP_002320122.2|  hypothetical protein POPTR_0014s07750g           99.0    3e-20   Populus trichocarpa [western balsam poplar]
ref|XP_010053272.1|  PREDICTED: uncharacterized protein LOC104441758  98.6    3e-20   
ref|XP_006439066.1|  hypothetical protein CICLE_v10033918mg           97.8    6e-20   Citrus clementina [clementine]
gb|KDO83486.1|  hypothetical protein CISIN_1g004208mg                 97.8    6e-20   Citrus sinensis [apfelsine]
ref|XP_006483675.1|  PREDICTED: multiple C2 and transmembrane dom...  97.8    6e-20   Citrus sinensis [apfelsine]
ref|XP_011023361.1|  PREDICTED: multiple C2 and transmembrane dom...  97.4    9e-20   Populus euphratica
ref|XP_011015655.1|  PREDICTED: multiple C2 and transmembrane dom...  97.1    1e-19   Populus euphratica
emb|CDP08834.1|  unnamed protein product                              97.1    1e-19   Coffea canephora [robusta coffee]
ref|XP_002301353.2|  hypothetical protein POPTR_0002s15950g           97.1    1e-19   Populus trichocarpa [western balsam poplar]
ref|XP_002509788.1|  synaptotagmin, putative                          96.7    2e-19   
ref|XP_009379435.1|  PREDICTED: multiple C2 and transmembrane dom...  96.7    2e-19   Pyrus x bretschneideri [bai li]
ref|XP_004299880.1|  PREDICTED: multiple C2 and transmembrane dom...  96.7    2e-19   Fragaria vesca subsp. vesca
emb|CBI24845.3|  unnamed protein product                              95.9    2e-19   Vitis vinifera
ref|XP_010659323.1|  PREDICTED: multiple C2 and transmembrane dom...  95.9    3e-19   Vitis vinifera
gb|EYU23487.1|  hypothetical protein MIMGU_mgv1a000757mg              95.9    3e-19   Erythranthe guttata [common monkey flower]
ref|XP_007217305.1|  hypothetical protein PRUPE_ppa015370mg           95.9    3e-19   
ref|XP_004138509.1|  PREDICTED: uncharacterized protein LOC101203632  95.5    4e-19   
emb|CDY01973.1|  BnaC02g27540D                                        95.5    4e-19   
ref|XP_008458254.1|  PREDICTED: uncharacterized protein LOC103497726  95.5    4e-19   Cucumis melo [Oriental melon]
gb|EMS48196.1|  Multiple C2 and transmembrane domain-containing p...  95.1    4e-19   Triticum urartu
ref|XP_009393442.1|  PREDICTED: uncharacterized protein LOC103979123  95.5    5e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004166328.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  95.5    5e-19   
ref|XP_011078852.1|  PREDICTED: multiple C2 and transmembrane dom...  95.1    5e-19   Sesamum indicum [beniseed]
gb|KDP24593.1|  hypothetical protein JCGZ_25509                       94.7    7e-19   Jatropha curcas
ref|XP_009763246.1|  PREDICTED: uncharacterized protein LOC104215187  94.4    8e-19   Nicotiana sylvestris
ref|XP_009611365.1|  PREDICTED: uncharacterized protein LOC104104885  94.4    9e-19   Nicotiana tomentosiformis
gb|AFN53655.1|  putative synaptotagmin protein                        94.0    1e-18   Linum usitatissimum
gb|KDO57729.1|  hypothetical protein CISIN_1g003882mg                 93.6    1e-18   Citrus sinensis [apfelsine]
ref|XP_009128492.1|  PREDICTED: uncharacterized protein LOC103853319  94.0    1e-18   Brassica rapa
gb|EYU46304.1|  hypothetical protein MIMGU_mgv1a001691mg              93.6    2e-18   Erythranthe guttata [common monkey flower]
ref|XP_004309445.1|  PREDICTED: multiple C2 and transmembrane dom...  93.6    2e-18   Fragaria vesca subsp. vesca
gb|KFK44354.1|  hypothetical protein AALP_AA1G246600                  93.6    2e-18   Arabis alpina [alpine rockcress]
ref|XP_010104492.1|  Multiple C2 and transmembrane domain-contain...  93.2    3e-18   
ref|XP_006483676.1|  PREDICTED: multiple C2 and transmembrane dom...  93.2    3e-18   Citrus sinensis [apfelsine]
gb|KJB25055.1|  hypothetical protein B456_004G174500                  92.8    3e-18   Gossypium raimondii
ref|XP_006439068.1|  hypothetical protein CICLE_v10030600mg           92.8    3e-18   
gb|KDO83484.1|  hypothetical protein CISIN_1g001696mg                 92.8    3e-18   Citrus sinensis [apfelsine]
ref|XP_011080250.1|  PREDICTED: multiple C2 and transmembrane dom...  92.4    3e-18   Sesamum indicum [beniseed]
ref|XP_006437049.1|  hypothetical protein CICLE_v10033973mg           92.4    4e-18   Citrus clementina [clementine]
ref|XP_008231338.1|  PREDICTED: multiple C2 and transmembrane dom...  92.8    4e-18   
gb|EMT11702.1|  hypothetical protein F775_07618                       92.4    4e-18   
ref|XP_008231334.1|  PREDICTED: multiple C2 and transmembrane dom...  92.8    4e-18   Prunus mume [ume]
ref|XP_007220593.1|  hypothetical protein PRUPE_ppa000616mg           92.8    4e-18   Prunus persica
ref|XP_008231335.1|  PREDICTED: multiple C2 and transmembrane dom...  92.8    4e-18   
ref|XP_007052573.1|  Calcium-dependent lipid-binding (CaLB domain...  92.0    4e-18   
ref|XP_008231337.1|  PREDICTED: multiple C2 and transmembrane dom...  92.4    4e-18   Prunus mume [ume]
gb|EYU20710.1|  hypothetical protein MIMGU_mgv1a023485mg              92.4    4e-18   Erythranthe guttata [common monkey flower]
emb|CDY54062.1|  BnaA02g36480D                                        92.4    4e-18   Brassica napus [oilseed rape]
emb|CDX81021.1|  BnaC03g02750D                                        89.4    4e-18   
ref|XP_006850085.1|  hypothetical protein AMTR_s00022p00218970        92.4    5e-18   Amborella trichopoda
ref|XP_008368132.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...  92.4    5e-18   
ref|XP_004497937.1|  PREDICTED: multiple C2 and transmembrane dom...  92.0    6e-18   Cicer arietinum [garbanzo]
gb|KDP43429.1|  hypothetical protein JCGZ_16716                       92.0    6e-18   Jatropha curcas
ref|XP_008350856.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...  92.0    7e-18   
ref|XP_008383982.1|  PREDICTED: multiple C2 and transmembrane dom...  92.0    7e-18   
ref|XP_009362439.1|  PREDICTED: uncharacterized protein LOC103952559  92.0    7e-18   Pyrus x bretschneideri [bai li]
ref|XP_009339918.1|  PREDICTED: multiple C2 and transmembrane dom...  91.7    8e-18   Pyrus x bretschneideri [bai li]
ref|XP_006304546.1|  hypothetical protein CARUB_v10011531mg           91.7    8e-18   Capsella rubella
ref|XP_008378754.1|  PREDICTED: uncharacterized protein LOC103441820  91.7    8e-18   Malus domestica [apple tree]
ref|XP_006598248.1|  PREDICTED: multiple C2 and transmembrane dom...  91.7    9e-18   Glycine max [soybeans]
gb|KHN49030.1|  Putative Ras GTPase-activating protein 4B             91.3    9e-18   Glycine soja [wild soybean]
ref|XP_003518076.1|  PREDICTED: multiple C2 and transmembrane dom...  91.3    1e-17   Glycine max [soybeans]
ref|XP_004150160.1|  PREDICTED: multiple C2 and transmembrane dom...  91.3    1e-17   Cucumis sativus [cucumbers]
ref|XP_008460787.1|  PREDICTED: multiple C2 and transmembrane dom...  91.3    1e-17   Cucumis melo [Oriental melon]
ref|XP_010672799.1|  PREDICTED: multiple C2 and transmembrane dom...  91.7    1e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008460789.1|  PREDICTED: multiple C2 and transmembrane dom...  91.3    1e-17   Cucumis melo [Oriental melon]
ref|XP_010273065.1|  PREDICTED: uncharacterized protein LOC104608707  91.3    1e-17   Nelumbo nucifera [Indian lotus]
gb|EPS70383.1|  hypothetical protein M569_04376                       91.3    1e-17   Genlisea aurea
ref|XP_007145658.1|  hypothetical protein PHAVU_007G257600g           91.3    1e-17   Phaseolus vulgaris [French bean]
ref|XP_007225292.1|  hypothetical protein PRUPE_ppa001339mg           90.9    1e-17   
gb|KHN15528.1|  Multiple C2 and transmembrane domain-containing p...  90.9    1e-17   Glycine soja [wild soybean]
ref|XP_009354691.1|  PREDICTED: multiple C2 and transmembrane dom...  91.3    1e-17   Pyrus x bretschneideri [bai li]
ref|XP_003537180.1|  PREDICTED: multiple C2 and transmembrane dom...  90.9    1e-17   Glycine max [soybeans]
gb|KDP35107.1|  hypothetical protein JCGZ_10949                       91.3    1e-17   Jatropha curcas
ref|XP_008238857.1|  PREDICTED: multiple C2 and transmembrane dom...  90.9    1e-17   Prunus mume [ume]
ref|XP_011035993.1|  PREDICTED: multiple C2 and transmembrane dom...  90.9    1e-17   Populus euphratica
ref|XP_007210407.1|  hypothetical protein PRUPE_ppa000781mg           90.9    1e-17   Prunus persica
ref|XP_009588959.1|  PREDICTED: multiple C2 and transmembrane dom...  90.9    1e-17   
ref|XP_006416181.1|  hypothetical protein EUTSA_v10006627mg           90.9    2e-17   
ref|XP_007204276.1|  hypothetical protein PRUPE_ppa001596mg           90.5    2e-17   Prunus persica
ref|XP_010534658.1|  PREDICTED: multiple C2 and transmembrane dom...  90.5    2e-17   Tarenaya hassleriana [spider flower]
ref|XP_008393597.1|  PREDICTED: uncharacterized protein LOC103455751  90.9    2e-17   
gb|AAC25524.1|  Strong similarity to phosphoribosylanthranilate t...  90.5    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010111400.1|  Multiple C2 and transmembrane domain-contain...  90.5    2e-17   Morus notabilis
ref|XP_002532394.1|  synaptotagmin, putative                          90.5    2e-17   Ricinus communis
ref|NP_173675.1|  C2 calcium/lipid-binding plant phosphoribosyltr...  90.5    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008387247.1|  PREDICTED: multiple C2 and transmembrane dom...  90.5    2e-17   
ref|XP_008240964.1|  PREDICTED: multiple C2 and transmembrane dom...  90.5    2e-17   Prunus mume [ume]
ref|XP_010928529.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...  90.5    2e-17   
ref|XP_011093373.1|  PREDICTED: multiple C2 and transmembrane dom...  90.5    2e-17   Sesamum indicum [beniseed]
ref|XP_011093374.1|  PREDICTED: multiple C2 and transmembrane dom...  90.5    2e-17   
ref|XP_002277970.2|  PREDICTED: multiple C2 and transmembrane dom...  90.1    2e-17   Vitis vinifera
emb|CAN75086.1|  hypothetical protein VITISV_010815                   90.1    2e-17   Vitis vinifera
ref|XP_010460017.1|  PREDICTED: multiple C2 and transmembrane dom...  90.5    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010477520.1|  PREDICTED: multiple C2 and transmembrane dom...  90.5    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010695175.1|  PREDICTED: multiple C2 and transmembrane dom...  90.1    3e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010498740.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...  90.5    3e-17   
ref|XP_009391825.1|  PREDICTED: uncharacterized protein LOC103977897  90.1    3e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003623908.1|  Extended synaptotagmin-2                         90.1    3e-17   
emb|CDY21373.1|  BnaA09g30540D                                        90.1    3e-17   Brassica napus [oilseed rape]
ref|XP_008795741.1|  PREDICTED: multiple C2 and transmembrane dom...  90.1    3e-17   
gb|AES80126.2|  calcium-dependent lipid-binding (CaLB domain) fam...  90.1    3e-17   Medicago truncatula
emb|CDY70344.1|  BnaA03g55080D                                        89.0    3e-17   Brassica napus [oilseed rape]
ref|XP_002521817.1|  synaptotagmin, putative                          90.1    3e-17   Ricinus communis
ref|XP_002265157.2|  PREDICTED: multiple C2 and transmembrane dom...  90.1    3e-17   
ref|XP_002513191.1|  synaptotagmin, putative                          90.1    3e-17   
gb|ABD33426.2|  C2                                                    90.1    3e-17   
gb|KHM98828.1|  Multiple C2 and transmembrane domain-containing p...  90.1    3e-17   
ref|XP_006585748.1|  PREDICTED: multiple C2 and transmembrane dom...  90.1    3e-17   
ref|XP_010930774.1|  PREDICTED: multiple C2 and transmembrane dom...  90.1    3e-17   
ref|XP_002890521.1|  C2 domain-containing protein                     90.1    3e-17   
emb|CDY04800.1|  BnaC05g17890D                                        90.1    3e-17   
emb|CDP07723.1|  unnamed protein product                              90.1    3e-17   
ref|XP_009115621.1|  PREDICTED: multiple C2 and transmembrane dom...  90.1    3e-17   
ref|XP_008219001.1|  PREDICTED: multiple C2 and transmembrane dom...  89.7    4e-17   
ref|XP_010908865.1|  PREDICTED: uncharacterized protein LOC105035134  89.7    4e-17   
ref|XP_011029251.1|  PREDICTED: multiple C2 and transmembrane dom...  89.7    4e-17   
ref|XP_009130968.1|  PREDICTED: multiple C2 and transmembrane dom...  89.7    4e-17   
ref|XP_009350731.1|  PREDICTED: extended synaptotagmin-1-like         89.7    4e-17   
ref|XP_002299538.2|  hypothetical protein POPTR_0001s09250g           89.7    4e-17   
ref|XP_011007360.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...  89.7    4e-17   
ref|XP_008392066.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...  89.4    4e-17   
ref|XP_008781559.1|  PREDICTED: multiple C2 and transmembrane dom...  89.4    5e-17   
ref|XP_008799189.1|  PREDICTED: uncharacterized protein LOC103713915  89.4    6e-17   
ref|XP_004250430.1|  PREDICTED: multiple C2 and transmembrane dom...  89.4    6e-17   
gb|ACN88792.1|  putative C2 domain-containing protein                 85.1    6e-17   
ref|XP_007131292.1|  hypothetical protein PHAVU_011G001600g           89.4    6e-17   
ref|XP_009369878.1|  PREDICTED: multiple C2 and transmembrane dom...  89.0    6e-17   
ref|XP_008228363.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  89.0    6e-17   
gb|KJB36093.1|  hypothetical protein B456_006G140900                  89.0    7e-17   
ref|XP_007040201.1|  C2 calcium/lipid-binding plant phosphoribosy...  89.0    7e-17   
ref|XP_010672707.1|  PREDICTED: multiple C2 and transmembrane dom...  88.6    7e-17   
ref|XP_009420494.1|  PREDICTED: uncharacterized protein LOC104000227  89.0    8e-17   
ref|XP_007028936.1|  C2 calcium/lipid-binding plant phosphoribosy...  88.6    8e-17   
ref|XP_006379108.1|  C2 domain-containing family protein              89.0    8e-17   
gb|KEH16165.1|  calcium-dependent lipid-binding (CaLB domain) fam...  88.6    8e-17   
gb|EMS45806.1|  Multiple C2 and transmembrane domain-containing p...  89.0    8e-17   
ref|XP_004306799.1|  PREDICTED: uncharacterized protein LOC101305880  89.0    8e-17   
gb|KCW51799.1|  hypothetical protein EUGRSUZ_J01251                   88.6    9e-17   
ref|XP_010244838.1|  PREDICTED: multiple C2 and transmembrane dom...  88.6    9e-17   
emb|CAJ86177.1|  H0306F12.8                                           88.6    1e-16   
ref|XP_007020084.1|  C2 calcium/lipid-binding plant phosphoribosy...  88.6    1e-16   
ref|XP_010032396.1|  PREDICTED: multiple C2 and transmembrane dom...  88.2    1e-16   
ref|XP_011468807.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...  88.6    1e-16   
ref|XP_008649064.1|  PREDICTED: uncharacterized protein LOC103629...  88.2    1e-16   
ref|XP_010534142.1|  PREDICTED: multiple C2 and transmembrane dom...  88.6    1e-16   
ref|XP_004960016.1|  PREDICTED: uncharacterized protein LOC101781...  88.6    1e-16   
ref|NP_001054305.1|  Os04g0683800                                     88.6    1e-16   
ref|XP_008375143.1|  PREDICTED: multiple C2 and transmembrane dom...  88.6    1e-16   
ref|XP_010535240.1|  PREDICTED: multiple C2 and transmembrane dom...  88.6    1e-16   
gb|EEC78281.1|  hypothetical protein OsI_17979                        88.6    1e-16   
ref|XP_006376235.1|  hypothetical protein POPTR_0013s11220g           88.6    1e-16   
gb|EEE61934.1|  hypothetical protein OsJ_16678                        88.6    1e-16   
ref|XP_010057923.1|  PREDICTED: multiple C2 and transmembrane dom...  88.2    1e-16   
ref|XP_010063756.1|  PREDICTED: multiple C2 and transmembrane dom...  88.6    1e-16   
ref|XP_009418126.1|  PREDICTED: uncharacterized protein LOC103998104  88.2    1e-16   
ref|XP_011001083.1|  PREDICTED: multiple C2 and transmembrane dom...  88.2    1e-16   
ref|XP_011033255.1|  PREDICTED: multiple C2 and transmembrane dom...  88.2    1e-16   
ref|XP_006399161.1|  hypothetical protein EUTSA_v10012726mg           87.8    1e-16   
dbj|BAK01357.1|  predicted protein                                    88.2    1e-16   
gb|KJB14262.1|  hypothetical protein B456_002G116500                  87.8    1e-16   
ref|NP_001168012.1|  uncharacterized protein LOC100381735             88.2    1e-16   
ref|XP_003538346.1|  PREDICTED: uncharacterized protein LOC100777...  88.2    1e-16   
gb|KHN35016.1|  Multiple C2 and transmembrane domain-containing p...  88.2    1e-16   
ref|XP_009419170.1|  PREDICTED: multiple C2 and transmembrane dom...  87.8    1e-16   
ref|XP_009773349.1|  PREDICTED: multiple C2 and transmembrane dom...  87.8    1e-16   
ref|XP_009781014.1|  PREDICTED: uncharacterized protein LOC104229981  88.2    2e-16   
emb|CDP10108.1|  unnamed protein product                              87.8    2e-16   
ref|XP_008461778.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...  88.2    2e-16   
gb|KDP25449.1|  hypothetical protein JCGZ_20605                       87.8    2e-16   
gb|KJB12302.1|  hypothetical protein B456_002G010600                  87.4    2e-16   
ref|XP_010053690.1|  PREDICTED: multiple C2 and transmembrane dom...  87.8    2e-16   
gb|KHG05718.1|  Multiple C2 and transmembrane domain-containing 1     87.8    2e-16   
gb|KJB24704.1|  hypothetical protein B456_004G157900                  87.4    2e-16   
ref|XP_004298739.1|  PREDICTED: uncharacterized protein LOC101313...  87.8    2e-16   
ref|XP_006381052.1|  hypothetical protein POPTR_0006s05760g           87.4    2e-16   
ref|XP_008663748.1|  PREDICTED: uncharacterized protein LOC103642209  87.8    2e-16   
ref|XP_003563116.1|  PREDICTED: uncharacterized protein LOC100824776  87.8    2e-16   
gb|ADT92187.1|  unknown                                               87.8    2e-16   
ref|XP_008775338.1|  PREDICTED: uncharacterized protein LOC103695724  87.4    2e-16   
gb|KJB24703.1|  hypothetical protein B456_004G157900                  87.4    2e-16   
ref|XP_011020275.1|  PREDICTED: multiple C2 and transmembrane dom...  87.4    2e-16   
ref|XP_002873282.1|  hypothetical protein ARALYDRAFT_908616           87.4    2e-16   
ref|XP_010452629.1|  PREDICTED: multiple C2 and transmembrane dom...  87.0    2e-16   
ref|XP_009399173.1|  PREDICTED: multiple C2 and transmembrane dom...  87.4    3e-16   
ref|XP_010423287.1|  PREDICTED: multiple C2 and transmembrane dom...  87.0    3e-16   
ref|XP_006287093.1|  hypothetical protein CARUB_v10000256mg           87.0    3e-16   
ref|NP_568175.2|  FT-interacting protein 1                            87.0    3e-16   
emb|CBI18160.3|  unnamed protein product                              87.4    3e-16   
ref|XP_010491269.1|  PREDICTED: multiple C2 and transmembrane dom...  87.0    3e-16   
ref|XP_002273003.1|  PREDICTED: multiple C2 and transmembrane dom...  87.0    3e-16   
ref|XP_004228622.1|  PREDICTED: multiple C2 and transmembrane dom...  87.0    3e-16   
ref|XP_006348415.1|  PREDICTED: multiple C2 and transmembrane dom...  87.0    3e-16   
ref|XP_006574306.1|  PREDICTED: uncharacterized protein LOC100817962  87.0    3e-16   
ref|XP_007158492.1|  hypothetical protein PHAVU_002G157000g           87.0    3e-16   
ref|XP_009587334.1|  PREDICTED: uncharacterized protein LOC104085087  87.0    3e-16   
ref|XP_006653047.1|  PREDICTED: uncharacterized protein LOC102701166  87.0    3e-16   
emb|CAB39932.1|  putative phosphoribosylanthranilate transferase      87.0    3e-16   
ref|NP_192898.2|  C2 calcium/lipid-binding plant phosphoribosyltr...  87.0    4e-16   
ref|XP_009346959.1|  PREDICTED: uncharacterized protein LOC103938656  87.0    4e-16   
ref|XP_010910862.1|  PREDICTED: uncharacterized protein LOC105036827  86.7    4e-16   
ref|XP_002323292.2|  hypothetical protein POPTR_0016s04980g           86.7    4e-16   
gb|KHN32471.1|  Multiple C2 and transmembrane domain-containing p...  86.7    5e-16   
ref|XP_003539945.1|  PREDICTED: multiple C2 and transmembrane dom...  86.7    5e-16   
ref|XP_010241420.1|  PREDICTED: multiple C2 and transmembrane dom...  86.3    5e-16   
ref|XP_010324263.1|  PREDICTED: multiple C2 and transmembrane dom...  86.3    6e-16   
emb|CDP10669.1|  unnamed protein product                              86.3    6e-16   
ref|XP_003607066.1|  Anthranilate phosphoribosyltransferase-like ...  85.9    7e-16   
ref|XP_004161406.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...  86.3    7e-16   
ref|XP_004149608.1|  PREDICTED: multiple C2 and transmembrane dom...  85.9    7e-16   
gb|EMT19394.1|  hypothetical protein F775_16907                       85.5    7e-16   
ref|XP_010918556.1|  PREDICTED: uncharacterized protein LOC105042892  85.9    8e-16   
ref|XP_009386055.1|  PREDICTED: uncharacterized protein LOC103973268  85.9    9e-16   
gb|EYU31344.1|  hypothetical protein MIMGU_mgv1a023675mg              85.5    9e-16   
ref|XP_008356954.1|  PREDICTED: uncharacterized protein LOC103420681  85.9    9e-16   
ref|XP_008376022.1|  PREDICTED: uncharacterized protein LOC103439257  85.5    9e-16   
gb|EMT16292.1|  hypothetical protein F775_12047                       85.5    1e-15   
ref|XP_011025029.1|  PREDICTED: uncharacterized protein LOC105126...  85.5    1e-15   
emb|CDP07720.1|  unnamed protein product                              85.5    1e-15   
ref|XP_010943582.1|  PREDICTED: multiple C2 and transmembrane dom...  85.5    1e-15   
ref|XP_006585342.1|  PREDICTED: multiple C2 and transmembrane dom...  85.5    1e-15   
ref|XP_010682327.1|  PREDICTED: multiple C2 and transmembrane dom...  85.5    1e-15   
ref|XP_006851306.1|  hypothetical protein AMTR_s00050p00157870        85.5    1e-15   
ref|XP_002298449.2|  C2 domain-containing family protein              85.5    1e-15   
ref|XP_010455572.1|  PREDICTED: multiple C2 and transmembrane dom...  85.5    1e-15   
ref|XP_010434689.1|  PREDICTED: multiple C2 and transmembrane dom...  85.5    1e-15   
ref|XP_002325538.2|  hypothetical protein POPTR_0019s10910g           85.1    1e-15   
ref|XP_004511581.1|  PREDICTED: multiple C2 and transmembrane dom...  85.1    1e-15   
ref|XP_011025028.1|  PREDICTED: multiple C2 and transmembrane dom...  85.1    1e-15   
ref|XP_006289911.1|  hypothetical protein CARUB_v10003526mg           85.1    1e-15   
ref|XP_010544470.1|  PREDICTED: LOW QUALITY PROTEIN: extended syn...  85.1    2e-15   
ref|XP_010113221.1|  Multiple C2 and transmembrane domain-contain...  84.7    2e-15   
gb|KHG10339.1|  Multiple C2 and transmembrane domain-containing 1     85.1    2e-15   
gb|KJB25820.1|  hypothetical protein B456_004G210900                  85.1    2e-15   
ref|XP_006657700.1|  PREDICTED: uncharacterized protein LOC102709856  85.1    2e-15   
ref|XP_003635987.1|  Multiple C2 and transmembrane domain-contain...  85.1    2e-15   
gb|KJB60077.1|  hypothetical protein B456_009G288400                  84.7    2e-15   
ref|XP_010521156.1|  PREDICTED: multiple C2 and transmembrane dom...  84.7    2e-15   
gb|KDO76164.1|  hypothetical protein CISIN_1g045058mg                 84.7    2e-15   
ref|XP_006439584.1|  hypothetical protein CICLE_v10023869mg           84.7    2e-15   
ref|XP_006476597.1|  PREDICTED: multiple C2 and transmembrane dom...  84.7    2e-15   
gb|EMT09637.1|  hypothetical protein F775_18960                       84.0    2e-15   
gb|EAZ37635.1|  hypothetical protein OsJ_21968                        84.3    2e-15   
gb|EAZ01666.1|  hypothetical protein OsI_23701                        84.3    2e-15   
ref|XP_004506488.1|  PREDICTED: uncharacterized protein LOC101502479  84.3    3e-15   
ref|XP_006350321.1|  PREDICTED: extended synaptotagmin-1-like         84.3    3e-15   
ref|XP_011031493.1|  PREDICTED: multiple C2 and transmembrane dom...  84.3    3e-15   
gb|KDO38276.1|  hypothetical protein CISIN_1g045512mg                 84.0    3e-15   
ref|XP_007214091.1|  hypothetical protein PRUPE_ppa015408mg           84.3    3e-15   
ref|XP_008225796.1|  PREDICTED: uncharacterized protein LOC103325419  84.3    3e-15   
ref|XP_011003982.1|  PREDICTED: multiple C2 and transmembrane dom...  84.0    3e-15   
ref|XP_002874704.1|  NADPH-dependent thioredoxin reductase B          84.0    3e-15   
ref|XP_004514073.1|  PREDICTED: multiple C2 and transmembrane dom...  84.0    3e-15   
emb|CDP09751.1|  unnamed protein product                              84.0    3e-15   
ref|XP_003580895.1|  PREDICTED: multiple C2 and transmembrane dom...  84.0    3e-15   
emb|CAN71789.1|  hypothetical protein VITISV_004288                   84.0    3e-15   
ref|XP_006366512.1|  PREDICTED: multiple C2 and transmembrane dom...  84.0    3e-15   
ref|XP_006473257.1|  PREDICTED: multiple C2 and transmembrane dom...  84.0    3e-15   
gb|EPS58331.1|  hypothetical protein M569_16484                       84.0    4e-15   
ref|XP_009774741.1|  PREDICTED: multiple C2 and transmembrane dom...  83.6    4e-15   
ref|XP_003611102.1|  Glutathione peroxidase                           83.6    5e-15   
ref|XP_010062431.1|  PREDICTED: uncharacterized protein LOC104449847  83.6    5e-15   
ref|XP_008800662.1|  PREDICTED: multiple C2 and transmembrane dom...  83.2    5e-15   
ref|XP_011022713.1|  PREDICTED: multiple C2 and transmembrane dom...  83.2    5e-15   
ref|XP_011022711.1|  PREDICTED: multiple C2 and transmembrane dom...  83.2    6e-15   
ref|XP_004231110.1|  PREDICTED: multiple C2 and transmembrane dom...  82.8    6e-15   
gb|KEH18888.1|  calcium-dependent lipid-binding (CaLB domain) fam...  82.8    7e-15   
ref|XP_009607021.1|  PREDICTED: multiple C2 and transmembrane dom...  82.8    8e-15   
ref|XP_006586753.1|  PREDICTED: multiple C2 and transmembrane dom...  82.8    8e-15   
gb|EYU28228.1|  hypothetical protein MIMGU_mgv1a000659mg              82.8    9e-15   
gb|KEH29293.1|  calcium-dependent lipid-binding (CaLB domain) fam...  82.8    9e-15   
ref|XP_011074957.1|  PREDICTED: multiple C2 and transmembrane dom...  82.8    9e-15   
ref|XP_006396881.1|  hypothetical protein EUTSA_v10028390mg           82.8    1e-14   
ref|XP_007149059.1|  hypothetical protein PHAVU_005G037500g           82.4    1e-14   
ref|XP_004506399.1|  PREDICTED: uncharacterized protein LOC101494825  82.8    1e-14   
gb|EPS65173.1|  hypothetical protein M569_09603                       82.4    1e-14   
ref|XP_002303582.2|  C2 domain-containing family protein              82.4    1e-14   
gb|KHN19431.1|  Multiple C2 and transmembrane domain-containing p...  82.4    1e-14   
ref|XP_008783369.1|  PREDICTED: uncharacterized protein LOC103702639  82.4    1e-14   
ref|XP_006434690.1|  hypothetical protein CICLE_v10000127mg           82.4    1e-14   
gb|KDO65760.1|  hypothetical protein CISIN_1g046822mg                 82.4    1e-14   
ref|XP_006443696.1|  hypothetical protein CICLE_v10024404mg           82.4    1e-14   
ref|XP_008226140.1|  PREDICTED: multiple C2 and transmembrane dom...  82.0    1e-14   
ref|NP_191689.1|  C2 calcium/lipid-binding and phosphoribosyltran...  82.4    1e-14   
ref|XP_007212656.1|  hypothetical protein PRUPE_ppa018242mg           82.0    1e-14   
ref|XP_004957702.1|  PREDICTED: uncharacterized protein LOC101764...  82.4    1e-14   
ref|XP_011096361.1|  PREDICTED: multiple C2 and transmembrane dom...  82.4    1e-14   
gb|EMS62772.1|  Multiple C2 and transmembrane domain-containing p...  82.0    1e-14   
ref|XP_010682530.1|  PREDICTED: uncharacterized protein LOC104897368  81.6    2e-14   
ref|XP_009798416.1|  PREDICTED: multiple C2 and transmembrane dom...  82.0    2e-14   
emb|CDY13273.1|  BnaC09g23830D                                        80.9    2e-14   
dbj|BAJ90708.1|  predicted protein                                    81.6    2e-14   
ref|XP_006827676.1|  hypothetical protein AMTR_s00009p00255480        82.0    2e-14   
gb|EYU22793.1|  hypothetical protein MIMGU_mgv1a000783mg              82.0    2e-14   
ref|XP_009596255.1|  PREDICTED: multiple C2 and transmembrane dom...  82.0    2e-14   
gb|KFK31920.1|  hypothetical protein AALP_AA6G176000                  81.6    2e-14   
gb|KFK31919.1|  hypothetical protein AALP_AA6G176000                  81.6    2e-14   
gb|KEH29978.1|  anthranilate phosphoribosyltransferase-like protein   81.3    2e-14   
ref|XP_009116796.1|  PREDICTED: multiple C2 and transmembrane dom...  81.6    2e-14   
ref|XP_008670402.1|  PREDICTED: uncharacterized protein LOC103647671  81.6    2e-14   
ref|XP_008653084.1|  PREDICTED: multiple C2 and transmembrane dom...  81.3    3e-14   
dbj|BAJ93730.1|  predicted protein                                    81.3    3e-14   
ref|XP_004486232.1|  PREDICTED: uncharacterized protein LOC101498310  80.9    3e-14   
ref|XP_002462865.1|  hypothetical protein SORBIDRAFT_02g033370        81.3    3e-14   
gb|KJB10065.1|  hypothetical protein B456_001G183000                  80.9    3e-14   
emb|CDX91899.1|  BnaC03g32010D                                        80.9    3e-14   
ref|XP_009108158.1|  PREDICTED: uncharacterized protein LOC103833855  80.9    4e-14   
ref|XP_009134537.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  80.9    4e-14   
emb|CDX86768.1|  BnaA09g21580D                                        80.9    4e-14   
emb|CDX74344.1|  BnaA03g27030D                                        80.9    4e-14   
ref|XP_010928846.1|  PREDICTED: multiple C2 and transmembrane dom...  80.5    4e-14   
emb|CDP03821.1|  unnamed protein product                              80.9    4e-14   
gb|EPS65882.1|  hypothetical protein M569_08887                       80.9    4e-14   
gb|KJB71785.1|  hypothetical protein B456_011G142300                  80.5    4e-14   
ref|XP_008459677.1|  PREDICTED: multiple C2 and transmembrane dom...  80.9    4e-14   
ref|XP_002875019.1|  C2 domain-containing protein                     80.9    4e-14   
ref|XP_006434685.1|  hypothetical protein CICLE_v10000346mg           80.5    5e-14   
ref|XP_007033953.1|  Calcium-dependent lipid-binding (CaLB domain...  80.5    5e-14   
ref|XP_010419620.1|  PREDICTED: uncharacterized protein LOC104705332  80.5    5e-14   
ref|XP_006286981.1|  hypothetical protein CARUB_v10000130mg           80.5    5e-14   
ref|XP_002876605.1|  C2 domain-containing protein                     80.5    5e-14   
gb|EYU32100.1|  hypothetical protein MIMGU_mgv1a000762mg              80.5    6e-14   
ref|NP_001059647.1|  Os07g0483500                                     80.5    6e-14   
gb|EAZ03872.1|  hypothetical protein OsI_26008                        80.5    6e-14   
ref|XP_003605062.1|  Phosphoribosyltransferase                        80.5    6e-14   



>ref|XP_009587222.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana tomentosiformis]
 ref|XP_009587223.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana tomentosiformis]
Length=773

 Score =   142 bits (359),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/72 (94%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPPQEDF LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKARDLP KDVTGSL
Sbjct  1    MQRPPQEDFSLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKARDLPGKDVTGSL  60

Query  519  DPYVEVRLGNYK  554
            DPYVEVRLGNYK
Sbjct  61   DPYVEVRLGNYK  72



>ref|XP_009785357.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana sylvestris]
 ref|XP_009785358.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana sylvestris]
 ref|XP_009785359.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana sylvestris]
Length=774

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPPQEDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPQEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  519  DPYVEVRLGNYK  554
            DPYVEVRLGNY+
Sbjct  61   DPYVEVRLGNYR  72



>ref|XP_006351338.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Solanum tuberosum]
Length=773

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPPQEDF+LKETKPHLGGGK+ GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPQEDFLLKETKPHLGGGKVMGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  519  DPYVEVRLGNYK  554
            DPYVEVRLGNYK
Sbjct  61   DPYVEVRLGNYK  72



>ref|XP_009799235.1| PREDICTED: extended synaptotagmin-1-like [Nicotiana sylvestris]
Length=776

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPPQEDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPQEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  519  DPYVEVRLGNYK  554
            DPYVEVRLGNY+
Sbjct  61   DPYVEVRLGNYR  72



>ref|XP_009614150.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana tomentosiformis]
Length=774

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPPQEDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPQEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  519  DPYVEVRLGNYK  554
            DPYVEVRLGNY+
Sbjct  61   DPYVEVRLGNYR  72



>ref|XP_004249277.1| PREDICTED: extended synaptotagmin-1-like [Solanum lycopersicum]
Length=775

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPPQEDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPQEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  519  DPYVEVRLGNYK  554
            DPYVEVRLGNY+
Sbjct  61   DPYVEVRLGNYR  72



>ref|XP_009594768.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana tomentosiformis]
Length=774

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPPQEDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPQEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  519  DPYVEVRLGNYK  554
            DPYVEVRLGNY+
Sbjct  61   DPYVEVRLGNYR  72



>ref|XP_004249278.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Solanum lycopersicum]
Length=774

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPPQEDF+LKETKPHLGGGK+ GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPQEDFLLKETKPHLGGGKVMGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  519  DPYVEVRLGNYK  554
            DPYVEVRLGNY+
Sbjct  61   DPYVEVRLGNYR  72



>ref|XP_006351337.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Solanum tuberosum]
Length=774

 Score =   140 bits (352),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPPQEDF LKETKPHLGGGK+ GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPQEDFSLKETKPHLGGGKVMGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSL  60

Query  519  DPYVEVRLGNYK  554
            DPYVEVRLGNY+
Sbjct  61   DPYVEVRLGNYR  72



>ref|XP_011078851.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Sesamum indicum]
Length=772

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPPQEDF LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPQEDFSLKETNPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEVRLGNYK
Sbjct  61   DPYVEVRLGNYK  72



>ref|XP_004249163.1| PREDICTED: extended synaptotagmin-1-like [Solanum lycopersicum]
Length=772

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRP QEDF LKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPHQEDFSLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSL  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>ref|XP_006362239.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Solanum tuberosum]
Length=773

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRP QEDF LKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPHQEDFSLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSL  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>ref|XP_008360635.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Malus domestica]
Length=774

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKETKPHLGGG+I+GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPSEDFALKETKPHLGGGRISGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEVRLGNYK
Sbjct  61   DPYVEVRLGNYK  72



>gb|EYU20709.1| hypothetical protein MIMGU_mgv1a001689mg [Erythranthe guttata]
Length=772

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDV GS 
Sbjct  1    MQRPPHEDFSLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVAGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEVRLGNYK
Sbjct  61   DPYVEVRLGNYK  72



>ref|XP_009376104.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Pyrus x bretschneideri]
Length=771

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKETKPHLGGG+I+GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPSEDFALKETKPHLGGGRISGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEVRLGNY+
Sbjct  61   DPYVEVRLGNYR  72



>ref|XP_007201936.1| hypothetical protein PRUPE_ppa001850mg [Prunus persica]
 gb|EMJ03135.1| hypothetical protein PRUPE_ppa001850mg [Prunus persica]
Length=756

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKETKPHLGGG+I+GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFALKETKPHLGGGRISGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEVRLGNYK
Sbjct  61   DPYVEVRLGNYK  72



>ref|XP_006381053.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|ERP58850.1| C2 domain-containing family protein [Populus trichocarpa]
Length=775

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQ+PPQ+DF+LKET PHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  2    MQKPPQDDFLLKETNPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  61

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  62   DPYVEVKLGNYK  73



>ref|XP_008240960.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Prunus mume]
Length=774

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKETKPHLGGG+I+GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFALKETKPHLGGGRISGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEVRLGNYK
Sbjct  61   DPYVEVRLGNYK  72



>gb|KEH16148.1| C2 calcium/lipid-binding and GRAM domain protein [Medicago truncatula]
Length=774

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF+LKETKPHLGGGKI+GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGGGKISGDKLTSTYDLVEQMQYLYVRVVKAKDLPSKDVTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPY EV+LGNYK
Sbjct  61   DPYAEVKLGNYK  72



>emb|CDP10110.1| unnamed protein product [Coffea canephora]
Length=775

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPPQEDF LKETKPHLGG KITGDKLTST+DLVEQMQYLYVRVVKARDLP KDVTGS 
Sbjct  1    MQRPPQEDFQLKETKPHLGGVKITGDKLTSTHDLVEQMQYLYVRVVKARDLPAKDVTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNY+
Sbjct  61   DPYVEVKLGNYR  72



>ref|XP_011020270.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
 ref|XP_011020271.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
Length=775

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQ+PPQ+DF+LKET PHLGGGKITGDKLTSTYDLVEQM YLYVRVVKA+DLP KDVTGS 
Sbjct  2    MQKPPQDDFLLKETYPHLGGGKITGDKLTSTYDLVEQMHYLYVRVVKAKDLPAKDVTGSC  61

Query  519  DPYVEVRLGNYK  554
            DPYVEVRLGNYK
Sbjct  62   DPYVEVRLGNYK  73



>ref|XP_009766493.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana sylvestris]
Length=774

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/73 (92%), Positives = 70/73 (96%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPP-QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQRPP QEDF LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKARDLP KDVTGS
Sbjct  1    MQRPPPQEDFSLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKARDLPGKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
            LDPYVEV+LGNYK
Sbjct  61   LDPYVEVKLGNYK  73



>ref|XP_009369854.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Pyrus x bretschneideri]
Length=774

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKETKPHLGGG+I+GDKLTSTYDLVEQMQYLYVRVVKARDLP KD TGS 
Sbjct  1    MQRPPPEDFALKETKPHLGGGRISGDKLTSTYDLVEQMQYLYVRVVKARDLPAKDATGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>ref|XP_003535846.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X1 [Glycine max]
 ref|XP_006588908.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X2 [Glycine max]
 ref|XP_006588909.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X3 [Glycine max]
Length=773

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF+LKETKPHLGGGK++GD+LTSTYDLVEQMQYLYVRVVKA+DLP KD+TGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGGGKVSGDRLTSTYDLVEQMQYLYVRVVKAKDLPAKDITGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>ref|XP_007162297.1| hypothetical protein PHAVU_001G140200g [Phaseolus vulgaris]
 gb|ESW34291.1| hypothetical protein PHAVU_001G140200g [Phaseolus vulgaris]
Length=775

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF+LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPY EV+LGNYK
Sbjct  61   DPYTEVKLGNYK  72



>ref|XP_003554197.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Glycine max]
Length=775

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF+LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPY EV+LGNYK
Sbjct  61   DPYTEVKLGNYK  72



>ref|XP_004136579.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cucumis sativus]
 ref|XP_004161488.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cucumis sativus]
 gb|KGN59322.1| hypothetical protein Csa_3G809980 [Cucumis sativus]
Length=774

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF+LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETNPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>ref|XP_008443079.1| PREDICTED: extended synaptotagmin-1 [Cucumis melo]
Length=774

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF+LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETNPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>ref|XP_004493560.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cicer arietinum]
Length=776

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF+LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKELPSKDVTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>ref|XP_003521201.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoformX1 [Glycine max]
 ref|XP_003521202.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoformX2 [Glycine max]
 ref|XP_006576848.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X3 [Glycine max]
 ref|XP_006576849.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X4 [Glycine max]
Length=775

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF+LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPY EV+LGNYK
Sbjct  61   DPYTEVKLGNYK  72



>ref|XP_008387239.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Malus domestica]
 ref|XP_008387240.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Malus domestica]
 ref|XP_008387241.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Malus domestica]
 ref|XP_008387242.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Malus domestica]
Length=774

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKETKPHLGGG+I+GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFALKETKPHLGGGRISGDKLTSTYDLVEQMQYLYVRVVKAKDLPXKDVTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>gb|KHN07409.1| Multiple C2 and transmembrane domain-containing protein 2 [Glycine 
soja]
Length=775

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF+LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPY EV+LGNYK
Sbjct  61   DPYTEVKLGNYK  72



>emb|CDY47660.1| BnaC04g23970D [Brassica napus]
Length=828

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 78/101 (77%), Gaps = 6/101 (6%)
 Frame = +3

Query  270  FNSD*GLEGCLVF---VVLWKK---NNHKMQRPPQEDFMLKETKPHLGGGKITGDKLTST  431
             NS   L+ C  F   V+ W       + MQRPP EDF LKET+PHLGGGKITGDKLTST
Sbjct  25   LNSLILLQWCSCFRSSVLKWSNVFLEANMMQRPPPEDFSLKETRPHLGGGKITGDKLTST  84

Query  432  YDLVEQMQYLYVRVVKARDLPPKDVTGSLDPYVEVRLGNYK  554
            YDLVEQMQYLYVRVVKA++LP KD+TGS DPYVEV+LGNYK
Sbjct  85   YDLVEQMQYLYVRVVKAKELPGKDLTGSCDPYVEVKLGNYK  125



>gb|EPS67145.1| hypothetical protein M569_07629 [Genlisea aurea]
Length=772

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKET P LGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPPEDFALKETNPRLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  519  DPYVEVRLGNYK  554
            DPYVEVRLGNYK
Sbjct  61   DPYVEVRLGNYK  72



>ref|XP_010111396.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
 gb|EXC30874.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
Length=774

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKET PHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1    MQRPPPEDFSLKETNPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKELPAKDVTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>emb|CBI30044.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            M RPP +DF LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MHRPPPDDFSLKETSPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPSKDVTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>ref|XP_010463385.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
Length=431

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKETKPHLGGGK+TGDKLT+TYDLVEQMQYLY RVVKA+DLP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETKPHLGGGKVTGDKLTTTYDLVEQMQYLYARVVKAKDLPGKDLTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNY+
Sbjct  61   DPYVEVKLGNYR  72



>ref|XP_007145661.1| hypothetical protein PHAVU_007G257800g [Phaseolus vulgaris]
 ref|XP_007145662.1| hypothetical protein PHAVU_007G257800g [Phaseolus vulgaris]
 gb|ESW17655.1| hypothetical protein PHAVU_007G257800g [Phaseolus vulgaris]
 gb|ESW17656.1| hypothetical protein PHAVU_007G257800g [Phaseolus vulgaris]
Length=774

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF+LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKELPAKDVTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPY EV+LGNYK
Sbjct  61   DPYAEVKLGNYK  72



>gb|KDP24596.1| hypothetical protein JCGZ_25512 [Jatropha curcas]
Length=776

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +3

Query  336  KMQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            +MQRPP E+++LKET PHLGGGK+TGDKLT+TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  2    QMQRPPPEEYVLKETNPHLGGGKVTGDKLTTTYDLVEQMQYLYVRVVKAKDLPAKDVTGS  61

Query  516  LDPYVEVRLGNYK  554
             DPYVEVRLGNYK
Sbjct  62   CDPYVEVRLGNYK  74



>ref|XP_011033252.1| PREDICTED: extended synaptotagmin-1 [Populus euphratica]
 ref|XP_011033253.1| PREDICTED: extended synaptotagmin-1 [Populus euphratica]
 ref|XP_011033254.1| PREDICTED: extended synaptotagmin-1 [Populus euphratica]
Length=774

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRP  EDF+LKET PHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1    MQRPLHEDFLLKETNPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKELPAKDVTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>ref|XP_004497931.1| PREDICTED: uncharacterized protein LOC101499168 isoform X1 [Cicer 
arietinum]
 ref|XP_004497932.1| PREDICTED: uncharacterized protein LOC101499168 isoform X2 [Cicer 
arietinum]
 ref|XP_004497933.1| PREDICTED: uncharacterized protein LOC101499168 isoform X3 [Cicer 
arietinum]
 ref|XP_004497934.1| PREDICTED: uncharacterized protein LOC101499168 isoform X4 [Cicer 
arietinum]
Length=774

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP +DF+LKETKPHLGGGKI+GDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1    MQRPPPDDFLLKETKPHLGGGKISGDKLTSTYDLVEQMQYLYVRVVKAKELPSKDVTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPY EV+LGNYK
Sbjct  61   DPYAEVKLGNYK  72



>ref|XP_006437045.1| hypothetical protein CICLE_v10030764mg [Citrus clementina]
 ref|XP_006485025.1| PREDICTED: extended synaptotagmin-1-like isoform X1 [Citrus sinensis]
 ref|XP_006485026.1| PREDICTED: extended synaptotagmin-1-like isoform X2 [Citrus sinensis]
 gb|ESR50285.1| hypothetical protein CICLE_v10030764mg [Citrus clementina]
 gb|KDO57725.1| hypothetical protein CISIN_1g004109mg [Citrus sinensis]
 gb|KDO57726.1| hypothetical protein CISIN_1g004109mg [Citrus sinensis]
Length=773

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +3

Query  345  RPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDP  524
            RPP E+F LKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA+DLPPKDVTGS DP
Sbjct  2    RPPLEEFSLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPPKDVTGSCDP  61

Query  525  YVEVRLGNYK  554
            YVEV++GNYK
Sbjct  62   YVEVKMGNYK  71



>gb|KDO57727.1| hypothetical protein CISIN_1g004109mg [Citrus sinensis]
Length=763

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +3

Query  345  RPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDP  524
            RPP E+F LKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA+DLPPKDVTGS DP
Sbjct  2    RPPLEEFSLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPPKDVTGSCDP  61

Query  525  YVEVRLGNYK  554
            YVEV++GNYK
Sbjct  62   YVEVKMGNYK  71



>ref|XP_004304385.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Fragaria vesca subsp. vesca]
 ref|XP_011468070.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Fragaria vesca subsp. vesca]
Length=774

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKETKPHLGGG+I+GDK TSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFALKETKPHLGGGRISGDKHTSTYDLVEQMQYLYVRVVKAKDLPSKDVTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>ref|XP_002532333.1| synaptotagmin, putative [Ricinus communis]
 gb|EEF30035.1| synaptotagmin, putative [Ricinus communis]
Length=681

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP E+F+LKET PHLGGGK+TGDKLT+TYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEEFVLKETNPHLGGGKVTGDKLTTTYDLVEQMQYLYVRVVKAKDLPGKDVTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>ref|XP_006393033.1| hypothetical protein EUTSA_v10011254mg [Eutrema salsugineum]
 gb|ESQ30319.1| hypothetical protein EUTSA_v10011254mg [Eutrema salsugineum]
Length=778

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>ref|XP_002322682.2| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 ref|XP_006373765.1| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 ref|XP_006373766.1| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 ref|XP_006373767.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEF04443.2| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 gb|ERP51562.1| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 gb|ERP51563.1| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 gb|ERP51564.1| C2 domain-containing family protein [Populus trichocarpa]
Length=774

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRP  EDF+LKET PHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1    MQRPLHEDFLLKETNPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKELPAKDVTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>ref|XP_010554852.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Tarenaya hassleriana]
 ref|XP_010554853.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Tarenaya hassleriana]
 ref|XP_010554854.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Tarenaya hassleriana]
 ref|XP_010554855.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Tarenaya hassleriana]
Length=773

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDMTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>ref|XP_010672701.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Beta vulgaris subsp. vulgaris]
Length=775

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQ+PP EDF LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP  DVTG  
Sbjct  1    MQKPPHEDFSLKETNPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPSMDVTGGC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEVRLGNYK
Sbjct  61   DPYVEVRLGNYK  72



>ref|XP_002894324.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70583.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=776

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKETKPHLGGGK+TGDKLT+TYDLVEQMQYLYVRVVKA+DLP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETKPHLGGGKVTGDKLTTTYDLVEQMQYLYVRVVKAKDLPGKDLTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNY+
Sbjct  61   DPYVEVKLGNYR  72



>ref|XP_006306818.1| hypothetical protein CARUB_v10008360mg [Capsella rubella]
 gb|EOA39716.1| hypothetical protein CARUB_v10008360mg [Capsella rubella]
Length=774

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKETKPHLGGGK+TGDKLT+TYDLVEQMQYLY RVVKA+DLP KD+TGS 
Sbjct  1    MQRPPHEDFSLKETKPHLGGGKVTGDKLTTTYDLVEQMQYLYARVVKAKDLPGKDLTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNY+
Sbjct  61   DPYVEVKLGNYR  72



>emb|CDX98254.1| BnaC06g16150D [Brassica napus]
Length=774

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKET+PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  2    MQRPPPEDFSLKETRPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  61

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  62   DPYVEVKLGNYK  73



>ref|XP_009104078.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Brassica rapa]
 ref|XP_009104079.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Brassica rapa]
Length=774

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKET+PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  2    MQRPPPEDFSLKETRPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  61

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  62   DPYVEVKLGNYK  73



>emb|CDX67712.1| BnaA07g17520D [Brassica napus]
Length=774

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKET+PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  2    MQRPPPEDFSLKETRPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  61

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  62   DPYVEVKLGNYK  73



>emb|CDY69710.1| BnaAnng31280D [Brassica napus]
Length=779

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKET+PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  2    MQRPPPEDFSLKETRPHLGGGKLTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  61

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  62   DPYVEVKLGNYK  73



>ref|XP_009139005.1| PREDICTED: extended synaptotagmin-1-like [Brassica rapa]
 ref|XP_009139006.1| PREDICTED: extended synaptotagmin-1-like [Brassica rapa]
Length=778

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKET+PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  2    MQRPPPEDFSLKETRPHLGGGKLTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  61

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  62   DPYVEVKLGNYK  73



>emb|CAN80955.1| hypothetical protein VITISV_013781 [Vitis vinifera]
Length=752

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            M RPP +DF LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MHRPPPDDFSLKETSPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPSKDVTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>ref|XP_010504727.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
Length=773

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKET+PHLGGGKI+GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETRPHLGGGKISGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>ref|XP_002278165.1| PREDICTED: extended synaptotagmin-1 [Vitis vinifera]
 ref|XP_010653909.1| PREDICTED: extended synaptotagmin-1 [Vitis vinifera]
 ref|XP_010653910.1| PREDICTED: extended synaptotagmin-1 [Vitis vinifera]
Length=777

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            M RPP +DF LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MHRPPPDDFSLKETSPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPSKDVTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>ref|XP_006290627.1| hypothetical protein CARUB_v10016719mg [Capsella rubella]
 ref|XP_006290628.1| hypothetical protein CARUB_v10016719mg [Capsella rubella]
 gb|EOA23525.1| hypothetical protein CARUB_v10016719mg [Capsella rubella]
 gb|EOA23526.1| hypothetical protein CARUB_v10016719mg [Capsella rubella]
Length=773

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKET+PHLGGGKI+GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETRPHLGGGKISGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>ref|XP_002878177.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54436.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=773

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKET+PHLGGGKI+GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETRPHLGGGKISGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDMTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>ref|XP_010516424.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X1 [Camelina sativa]
 ref|XP_010516425.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X2 [Camelina sativa]
 ref|XP_010516426.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X1 [Camelina sativa]
 ref|XP_010427678.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010427679.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010427680.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010427681.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
Length=773

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKET+PHLGGGKI+GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETRPHLGGGKISGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>ref|XP_010500735.1| PREDICTED: extended synaptotagmin-1-like [Camelina sativa]
Length=776

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKETKPHLGGGK+TGDKLT+TYDLVEQMQYLY RVVKA+DLP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETKPHLGGGKVTGDKLTTTYDLVEQMQYLYARVVKAKDLPGKDLTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNY+
Sbjct  61   DPYVEVKLGNYR  72



>ref|NP_175568.1| calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein [Arabidopsis thaliana]
 gb|AAG50882.1|AC025294_20 unknown protein [Arabidopsis thaliana]
 gb|AEE32684.1| calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein [Arabidopsis thaliana]
Length=776

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKETKPHLGGGK+TGDKLT+TYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETKPHLGGGKVTGDKLTTTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNY+
Sbjct  61   DPYVEVKLGNYR  72



>ref|XP_010479644.1| PREDICTED: extended synaptotagmin-1-like isoform X1 [Camelina 
sativa]
 ref|XP_010479645.1| PREDICTED: extended synaptotagmin-1-like isoform X2 [Camelina 
sativa]
Length=776

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKETKPHLGGGK+TGDKLT+TYDLVEQMQYLY RVVKA+DLP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETKPHLGGGKVTGDKLTTTYDLVEQMQYLYARVVKAKDLPGKDLTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNY+
Sbjct  61   DPYVEVKLGNYR  72



>ref|XP_010057953.1| PREDICTED: extended synaptotagmin-1-like [Eucalyptus grandis]
 ref|XP_010057962.1| PREDICTED: extended synaptotagmin-1-like [Eucalyptus grandis]
 ref|XP_010057968.1| PREDICTED: extended synaptotagmin-1-like [Eucalyptus grandis]
 gb|KCW90293.1| hypothetical protein EUGRSUZ_A02437 [Eucalyptus grandis]
Length=777

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 68/73 (93%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            M RPP  EDF LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS
Sbjct  2    MHRPPHLEDFALKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKELPAKDVTGS  61

Query  516  LDPYVEVRLGNYK  554
            LDPYVEV+LGNYK
Sbjct  62   LDPYVEVKLGNYK  74



>ref|XP_006402831.1| hypothetical protein EUTSA_v10005798mg [Eutrema salsugineum]
 ref|XP_006402832.1| hypothetical protein EUTSA_v10005798mg [Eutrema salsugineum]
 gb|ESQ44284.1| hypothetical protein EUTSA_v10005798mg [Eutrema salsugineum]
 gb|ESQ44285.1| hypothetical protein EUTSA_v10005798mg [Eutrema salsugineum]
Length=774

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKET+PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETRPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDMTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>dbj|BAF01685.1| anthranilate phosphoribosyltransferase-like protein [Arabidopsis 
thaliana]
Length=773

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKET+PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETRPHLGGGKLSGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDMTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>ref|NP_191347.1| C2 domain-containing plant phosphoribosyltransferase-like protein 
[Arabidopsis thaliana]
 emb|CAB67616.1| anthranilate phosphoribosyltransferase-like protein [Arabidopsis 
thaliana]
 gb|AEE79712.1| C2 domain-containing plant phosphoribosyltransferase-like protein 
[Arabidopsis thaliana]
Length=773

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKET+PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETRPHLGGGKLSGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDMTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>gb|AAK53020.1|AF375436_1 AT3g57880/T10K17_90 [Arabidopsis thaliana]
 gb|AAM52232.1| AT3g57880/T10K17_90 [Arabidopsis thaliana]
Length=773

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKET+PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETRPHLGGGKLSGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDMTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>ref|XP_008442250.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Cucumis melo]
 ref|XP_008442251.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Cucumis melo]
 ref|XP_008442253.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Cucumis melo]
Length=776

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQ+PP EDF+LKET PHLGGGK+TGDKL STYDLVEQM YLYVRVVKA+DLP KDVTGS 
Sbjct  2    MQKPPPEDFLLKETNPHLGGGKVTGDKLASTYDLVEQMYYLYVRVVKAKDLPGKDVTGSC  61

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  62   DPYVEVKLGNYK  73



>gb|KFK35840.1| hypothetical protein AALP_AA4G043900 [Arabis alpina]
Length=775

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF LKETKP LGGGKI+GDKLT+TYDLVEQMQYLYVRVVKA+DLP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETKPFLGGGKISGDKLTTTYDLVEQMQYLYVRVVKAKDLPGKDLTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  61   DPYVEVKLGNYK  72



>gb|KJB36100.1| hypothetical protein B456_006G141200 [Gossypium raimondii]
 gb|KJB36101.1| hypothetical protein B456_006G141200 [Gossypium raimondii]
 gb|KJB36102.1| hypothetical protein B456_006G141200 [Gossypium raimondii]
 gb|KJB36103.1| hypothetical protein B456_006G141200 [Gossypium raimondii]
Length=775

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            M RPP EDF LKET PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  2    MPRPPPEDFALKETNPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSC  61

Query  519  DPYVEVRLGNY  551
            DPYVEV+LGNY
Sbjct  62   DPYVEVKLGNY  72



>ref|XP_003625221.1| Anthranilate phosphoribosyltransferase-like protein [Medicago 
truncatula]
 gb|ABN08649.1| C2 [Medicago truncatula]
 gb|AES81439.1| C2 calcium/lipid-binding and GRAM domain protein [Medicago truncatula]
Length=775

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 1/72 (1%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPP EDF+LKETKPHLGG K++GDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGG-KVSGDKLTSTYDLVEQMQYLYVRVVKAKELPSKDVTGSC  59

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  60   DPYVEVKLGNYK  71



>ref|XP_004144665.1| PREDICTED: uncharacterized protein LOC101203090 isoform 1 [Cucumis 
sativus]
 ref|XP_004144666.1| PREDICTED: uncharacterized protein LOC101203090 isoform 2 [Cucumis 
sativus]
 ref|XP_004168423.1| PREDICTED: uncharacterized LOC101203090 [Cucumis sativus]
 gb|KGN54869.1| hypothetical protein Csa_4G567200 [Cucumis sativus]
Length=776

 Score =   128 bits (322),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQ+PP EDF+LKET PHLGGGK+ GDKL STYDLVEQM YLYVRVVKA+DLP KDVTGS 
Sbjct  2    MQKPPPEDFLLKETNPHLGGGKVAGDKLASTYDLVEQMYYLYVRVVKAKDLPGKDVTGSC  61

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  62   DPYVEVKLGNYK  73



>ref|XP_010548191.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Tarenaya hassleriana]
 ref|XP_010548275.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Tarenaya hassleriana]
Length=774

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            M RPP EDF LKETKP LGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTG  
Sbjct  2    MHRPPPEDFSLKETKPQLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDVTGGC  61

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGNYK
Sbjct  62   DPYVEVKLGNYK  73



>ref|XP_008778691.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008778692.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008778693.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008778694.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008778695.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
Length=773

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRP-PQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQRP  QED+ LK T PHLGGG I GDKLTSTYDLVEQMQYLYVRVVKA+DLPPKDVTGS
Sbjct  1    MQRPLSQEDYSLKATSPHLGGGGIAGDKLTSTYDLVEQMQYLYVRVVKAKDLPPKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_007028941.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 gb|EOY09443.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
Length=877

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  339  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            M RPP  +DF LKET PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  2    MHRPPPPDDFALKETNPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGS  61

Query  516  LDPYVEVRLGNY  551
             DPYVEV+LGNY
Sbjct  62   CDPYVEVKLGNY  73



>ref|XP_007028942.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 ref|XP_007028943.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 ref|XP_007028944.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 gb|EOY09444.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 gb|EOY09445.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 gb|EOY09446.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
Length=776

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  339  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            M RPP  +DF LKET PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  2    MHRPPPPDDFALKETNPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGS  61

Query  516  LDPYVEVRLGNY  551
             DPYVEV+LGNY
Sbjct  62   CDPYVEVKLGNY  73



>ref|XP_006386096.1| hypothetical protein POPTR_0003s22060g [Populus trichocarpa]
 gb|ERP63893.1| hypothetical protein POPTR_0003s22060g [Populus trichocarpa]
Length=772

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+PPQ  DF LKET P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLPPKD+TGS
Sbjct  1    MQKPPQSVDFALKETSPNIGAGSVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPPKDITGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_010265829.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nelumbo nucifera]
 ref|XP_010265830.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nelumbo nucifera]
Length=776

 Score =   123 bits (308),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 66/73 (90%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRP-PQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQRP P E++ LKET PHLGGG +TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTG+
Sbjct  1    MQRPLPPEEYSLKETSPHLGGGGVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGT  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_009395864.1| PREDICTED: extended synaptotagmin-1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395871.1| PREDICTED: extended synaptotagmin-1-like [Musa acuminata subsp. 
malaccensis]
Length=776

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 67/73 (92%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQRP + E++ LKET PHLGGG ++GDKLT+TYDLVEQMQYLYVRVVKA+DLPPKDVTGS
Sbjct  2    MQRPLRPEEYSLKETSPHLGGGGVSGDKLTTTYDLVEQMQYLYVRVVKAKDLPPKDVTGS  61

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  62   CDPYVEVKLGNYK  74



>ref|XP_008243596.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 2 [Prunus mume]
Length=755

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+PPQ +DF LKET P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPQPQDFALKETSPNIGAGSVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPAKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_007208351.1| hypothetical protein PRUPE_ppa001743mg [Prunus persica]
 gb|EMJ09550.1| hypothetical protein PRUPE_ppa001743mg [Prunus persica]
Length=772

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+PPQ +DF LKET P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPQPQDFALKETSPNIGAGSVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPAKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_010928839.1| PREDICTED: extended synaptotagmin-1-like [Elaeis guineensis]
 ref|XP_010928840.1| PREDICTED: extended synaptotagmin-1-like [Elaeis guineensis]
Length=774

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQRP Q +++ LKET PHLGGG + GDKLT+TYDLVEQMQYLYVRVVKARDLP KDVTGS
Sbjct  1    MQRPLQPQEYSLKETSPHLGGGGVAGDKLTTTYDLVEQMQYLYVRVVKARDLPTKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_008782885.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Phoenix dactylifera]
 ref|XP_008782886.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Phoenix dactylifera]
 ref|XP_008782888.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Phoenix dactylifera]
Length=775

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 65/74 (88%), Gaps = 3/74 (4%)
 Frame = +3

Query  339  MQRP--PQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  512
            MQRP  PQE + LKET PHLGGG + GDKLT+TYDLVEQMQYLYVRVVKARDLP KDVTG
Sbjct  1    MQRPLHPQE-YSLKETSPHLGGGGVAGDKLTTTYDLVEQMQYLYVRVVKARDLPAKDVTG  59

Query  513  SLDPYVEVRLGNYK  554
            S DPYVEV+LGNYK
Sbjct  60   SCDPYVEVKLGNYK  73



>ref|XP_011025253.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
Length=772

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 64/73 (88%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+PPQ  DF LKET P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLP KD+TGS
Sbjct  1    MQKPPQSVDFALKETSPNIGAGSVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPSKDITGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_009364713.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Pyrus x bretschneideri]
Length=772

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 64/73 (88%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+PPQ +DF LKET P++G G ITGDKL+ TYDLVEQM YLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPQSQDFALKETSPNIGAGSITGDKLSCTYDLVEQMHYLYVRVVKAKDLPAKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_008358865.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Malus domestica]
Length=772

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 64/73 (88%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+PPQ +DF LKET P++G G ITGDKL+ TYDLVEQM YLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPQSQDFALKETSPNIGAGSITGDKLSCTYDLVEQMHYLYVRVVKAKDLPAKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_009364728.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Pyrus x bretschneideri]
Length=772

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 64/73 (88%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+PPQ +DF LKET P++G G ITGDKL+ TYDLVEQM YLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPQSQDFALKETSPNIGAGSITGDKLSCTYDLVEQMHYLYVRVVKAKDLPAKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_007014901.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 ref|XP_007014902.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 ref|XP_007014903.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 ref|XP_007014904.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 gb|EOY32520.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 gb|EOY32521.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 gb|EOY32522.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 gb|EOY32523.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
Length=771

 Score =   120 bits (301),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 64/73 (88%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+PPQ  DF LKET P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPQSVDFALKETSPNIGAGAVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>emb|CBI16433.3| unnamed protein product [Vitis vinifera]
Length=605

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+PP   +F LKETKP LGGG + GDKLT  YDLVEQM YLYVRVVKA+DLPPKDVTGS
Sbjct  1    MQKPPPSVEFALKETKPQLGGGSVIGDKLTCAYDLVEQMHYLYVRVVKAKDLPPKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPY+EV+LGNYK
Sbjct  61   CDPYIEVKLGNYK  73



>ref|XP_008787291.1| PREDICTED: extended synaptotagmin-1-like [Phoenix dactylifera]
Length=776

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRP-PQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQRP P +++ LKET PHLGGG + GDKLT+TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  2    MQRPLPPQEYSLKETSPHLGGGGVAGDKLTTTYDLVEQMQYLYVRVVKAKDLPVKDVTGS  61

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  62   CDPYVEVKLGNYK  74



>ref|XP_004295231.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Fragaria vesca subsp. vesca]
 ref|XP_011461911.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Fragaria vesca subsp. vesca]
Length=772

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 64/73 (88%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+PPQ  DF LKET P++G G ITGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDV+GS
Sbjct  1    MQKPPQSTDFALKETSPNIGAGSITGDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVSGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_002297795.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEE82600.1| C2 domain-containing family protein [Populus trichocarpa]
Length=772

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 64/73 (88%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+ PQ  DF LKET P++G G +TG+KL+ TYDLVEQMQYLYVRVVKARDLPPKDVTGS
Sbjct  1    MQKLPQSVDFALKETSPNIGAGSVTGNKLSCTYDLVEQMQYLYVRVVKARDLPPKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_010913922.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Elaeis guineensis]
Length=776

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 65/74 (88%), Gaps = 3/74 (4%)
 Frame = +3

Query  339  MQRP--PQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  512
            MQRP  PQE + LKET PHLGGG + GDKLT+TYDLVEQMQYLYVRVVKA+DLP KDVTG
Sbjct  2    MQRPLHPQE-YSLKETSPHLGGGGVAGDKLTTTYDLVEQMQYLYVRVVKAKDLPTKDVTG  60

Query  513  SLDPYVEVRLGNYK  554
            S DPYVEV+LGNYK
Sbjct  61   SCDPYVEVKLGNYK  74



>gb|KJB83485.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
Length=737

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 63/73 (86%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+PPQ  DF LKET P +G G +TGDKL+STYDLVEQMQYLYVRVVKA+DLP KDVTG 
Sbjct  1    MQKPPQSIDFALKETSPKIGAGAVTGDKLSSTYDLVEQMQYLYVRVVKAKDLPGKDVTGG  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_009374817.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Pyrus x bretschneideri]
Length=774

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 64/73 (88%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPP-QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+PP  +DF LKET P++G G ITGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPPSQDFALKETSPNIGAGSITGDKLSCTYDLVEQMQYLYVRVVKAKDLPAKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   SDPYVEVKLGNYK  73



>gb|KHG04257.1| Multiple C2 and transmembrane domain-containing 1 [Gossypium 
arboreum]
Length=771

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 63/73 (86%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+PPQ  DF LKET P +G G +TGDKL+STYDLVEQMQYLYVRVVKA+DLP KDVTG 
Sbjct  1    MQKPPQSIDFALKETSPKIGAGAVTGDKLSSTYDLVEQMQYLYVRVVKAKDLPGKDVTGG  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>gb|KJB83481.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83482.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83483.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83484.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83486.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83487.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83488.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
Length=771

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 63/73 (86%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+PPQ  DF LKET P +G G +TGDKL+STYDLVEQMQYLYVRVVKA+DLP KDVTG 
Sbjct  1    MQKPPQSIDFALKETSPKIGAGAVTGDKLSSTYDLVEQMQYLYVRVVKAKDLPGKDVTGG  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_002285588.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Vitis vinifera]
 ref|XP_010651282.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Vitis vinifera]
Length=774

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+PP   +F LKETKP LGGG + GDKLT  YDLVEQM YLYVRVVKA+DLPPKDVTGS
Sbjct  1    MQKPPPSVEFALKETKPQLGGGSVIGDKLTCAYDLVEQMHYLYVRVVKAKDLPPKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPY+EV+LGNYK
Sbjct  61   CDPYIEVKLGNYK  73



>ref|XP_002513446.1| synaptotagmin, putative [Ricinus communis]
 gb|EEF48849.1| synaptotagmin, putative [Ricinus communis]
Length=772

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 63/73 (86%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+PPQ  DF LKET P++G   +TGDKL+ TYDLVEQMQYLYVRVVKARDLP KDVTGS
Sbjct  1    MQKPPQAVDFALKETSPNIGAAAVTGDKLSCTYDLVEQMQYLYVRVVKARDLPGKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPY+EV++GNYK
Sbjct  61   CDPYIEVKMGNYK  73



>ref|XP_006850074.1| hypothetical protein AMTR_s00022p00214560 [Amborella trichopoda]
 gb|ERN11655.1| hypothetical protein AMTR_s00022p00214560 [Amborella trichopoda]
Length=772

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 64/73 (88%), Gaps = 2/73 (3%)
 Frame = +3

Query  339  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQRP Q ED+ LKET PHLGGG + GDKLTSTYDLVEQMQYLYVRVVKA+DL P DVTGS
Sbjct  1    MQRPLQSEDYSLKETSPHLGGGGVHGDKLTSTYDLVEQMQYLYVRVVKAKDL-PTDVTGS  59

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  60   CDPYVEVKLGNYK  72



>gb|KDP20200.1| hypothetical protein JCGZ_07920 [Jatropha curcas]
Length=773

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+PPQ  DF LKET P++G G +T DKL  TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPQAIDFALKETSPNIGAGAVTADKLACTYDLVEQMQYLYVRVVKAKDLPGKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_006494723.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Citrus sinensis]
 gb|KDO64911.1| hypothetical protein CISIN_1g004127mg [Citrus sinensis]
Length=772

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+ PQ  DF LKET P +G G ITGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKSPQAIDFALKETSPKIGAGSITGDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_006445975.1| hypothetical protein CICLE_v10014352mg [Citrus clementina]
 gb|ESR59215.1| hypothetical protein CICLE_v10014352mg [Citrus clementina]
Length=772

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+ PQ  DF LKET P +G G ITGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKSPQAIDFALKETSPKIGAGSITGDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_010091994.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
 gb|EXB48400.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
Length=772

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +3

Query  348  PPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPY  527
            P Q DF LKET P++G G ITGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS DPY
Sbjct  5    PQQVDFALKETSPNIGAGSITGDKLSCTYDLVEQMQYLYVRVVKAKDLPAKDVTGSCDPY  64

Query  528  VEVRLGNYK  554
            VEV+LGNYK
Sbjct  65   VEVKLGNYK  73



>gb|KHG19030.1| Multiple C2 and transmembrane domain-containing 1 [Gossypium 
arboreum]
Length=772

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = +3

Query  339  MQRPPQE--DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  512
            MQ+PP +  DF LK+T P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTG
Sbjct  1    MQKPPPQSVDFALKQTSPNIGAGAVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTG  60

Query  513  SLDPYVEVRLGNYK  554
            S DPYVEV+LGNYK
Sbjct  61   SCDPYVEVKLGNYK  74



>gb|KJB66120.1| hypothetical protein B456_010G128400 [Gossypium raimondii]
 gb|KJB66121.1| hypothetical protein B456_010G128400 [Gossypium raimondii]
 gb|KJB66122.1| hypothetical protein B456_010G128400 [Gossypium raimondii]
Length=772

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = +3

Query  339  MQRPPQE--DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  512
            MQ+PP +  DF LK+T P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTG
Sbjct  1    MQKPPPQSVDFALKQTSPNIGAGAVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTG  60

Query  513  SLDPYVEVRLGNYK  554
            S DPYVEV+LGNYK
Sbjct  61   SCDPYVEVKLGNYK  74



>ref|XP_011037883.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X1 [Populus euphratica]
 ref|XP_011037884.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X2 [Populus euphratica]
Length=772

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 63/73 (86%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+ PQ  DF LKET P++G G +TG+KL+ TYDLVEQMQYLYVRVVKARDLP KDVTGS
Sbjct  1    MQKLPQSVDFALKETSPNIGAGSVTGNKLSCTYDLVEQMQYLYVRVVKARDLPLKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_010519731.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Tarenaya hassleriana]
 ref|XP_010519732.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Tarenaya hassleriana]
Length=768

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+PPQ  DF LKET P +G G + GDKL+ TYDLVEQM YLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPQNIDFALKETSPKIGAGAVAGDKLSCTYDLVEQMHYLYVRVVKAKDLPGKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_010238001.1| PREDICTED: LOW QUALITY PROTEIN: extended synaptotagmin-1-like 
[Brachypodium distachyon]
Length=771

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRP  E+++LK+T PHLGG    GDKLT TYDLVEQMQYLYV VVKA+DLP KD+TGS 
Sbjct  1    MQRPRSEEYLLKDTSPHLGGFMAAGDKLTRTYDLVEQMQYLYVHVVKAKDLPFKDLTGSC  60

Query  519  DPYVEVRLGNYK  554
            DPYVE++LGNYK
Sbjct  61   DPYVEIKLGNYK  72



>ref|NP_001055351.1| Os05g0370600 [Oryza sativa Japonica Group]
 gb|AAV31232.1| putative anthranilate phosphoribosyltransferase [Oryza sativa 
Japonica Group]
 dbj|BAF17265.1| Os05g0370600 [Oryza sativa Japonica Group]
 gb|EAY97780.1| hypothetical protein OsI_19693 [Oryza sativa Indica Group]
 gb|EEE63479.1| hypothetical protein OsJ_18293 [Oryza sativa Japonica Group]
Length=774

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 64/73 (88%), Gaps = 2/73 (3%)
 Frame = +3

Query  339  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQRP + E++ LKET PHLGGG   GDKLT+TYDLVEQMQYLYVRVVKA+DLP KD+TGS
Sbjct  2    MQRPFRPEEYSLKETSPHLGGGA-AGDKLTTTYDLVEQMQYLYVRVVKAKDLPSKDITGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_006654319.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Oryza brachyantha]
Length=774

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 64/73 (88%), Gaps = 2/73 (3%)
 Frame = +3

Query  339  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQRP + E++ LKET PHLGGG   GDKLT+TYDLVEQMQYLYVRVVKA+DLP KD+TGS
Sbjct  2    MQRPFRPEEYSLKETSPHLGGGA-AGDKLTTTYDLVEQMQYLYVRVVKAKDLPSKDITGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>gb|KEH30271.1| C2 calcium/lipid-binding and GRAM domain protein [Medicago truncatula]
Length=770

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 63/73 (86%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+PP   +F LKET P++G G +T DKL+ TYDLVEQMQYLYVRVVKA++LP KDVTGS
Sbjct  1    MQKPPNSHEFALKETTPNIGAGAVTRDKLSCTYDLVEQMQYLYVRVVKAKELPTKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
            LDPYVEV+LGNYK
Sbjct  61   LDPYVEVKLGNYK  73



>ref|NP_196801.1| calcium-dependent lipid-binding domain-containing plant phosphoribosyltransferase-like 
protein [Arabidopsis thaliana]
 emb|CAB88261.1| anthranilate phosphoribosyltransferase-like protein [Arabidopsis 
thaliana]
 gb|AED91836.1| calcium-dependent lipid-binding domain-containing plant phosphoribosyltransferase-like 
protein [Arabidopsis thaliana]
Length=769

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+P Q  DF LKET P +G G +TGDKL STYDLVEQM YLYVRVVKA++LP KDVTGS
Sbjct  1    MQKPGQNIDFALKETSPKIGAGSVTGDKLCSTYDLVEQMHYLYVRVVKAKELPGKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNY+
Sbjct  61   CDPYVEVKLGNYR  73



>ref|XP_002438680.1| hypothetical protein SORBIDRAFT_10g024200 [Sorghum bicolor]
 gb|EER90047.1| hypothetical protein SORBIDRAFT_10g024200 [Sorghum bicolor]
Length=775

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 63/74 (85%), Gaps = 3/74 (4%)
 Frame = +3

Query  339  MQRPPQ--EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  512
            MQRPP   E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP KD+TG
Sbjct  2    MQRPPLRPEEYSLKETSPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPNKDITG  60

Query  513  SLDPYVEVRLGNYK  554
            S DPYVEV+LGNYK
Sbjct  61   SCDPYVEVKLGNYK  74



>ref|XP_008658284.1| PREDICTED: uncharacterized protein LOC100273873 isoform X1 [Zea 
mays]
 ref|XP_008658285.1| PREDICTED: uncharacterized protein LOC100273873 isoform X1 [Zea 
mays]
 ref|XP_008658286.1| PREDICTED: uncharacterized protein LOC100273873 isoform X1 [Zea 
mays]
 gb|AFW87459.1| hypothetical protein ZEAMMB73_550028 [Zea mays]
 gb|AFW87460.1| hypothetical protein ZEAMMB73_550028 [Zea mays]
Length=775

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 63/74 (85%), Gaps = 3/74 (4%)
 Frame = +3

Query  339  MQRPPQ--EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  512
            MQRPP   E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP KD+TG
Sbjct  2    MQRPPLRPEEYSLKETTPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPNKDITG  60

Query  513  SLDPYVEVRLGNYK  554
            S DPYVEV+LGNYK
Sbjct  61   SCDPYVEVKLGNYK  74



>ref|XP_003537951.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X1 [Glycine max]
 ref|XP_006590953.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X2 [Glycine max]
 gb|KHN21877.1| Multiple C2 and transmembrane domain-containing protein 1 [Glycine 
soja]
Length=777

 Score =   112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 61/75 (81%), Gaps = 3/75 (4%)
 Frame = +3

Query  339  MQRPP---QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVT  509
            MQ+ P     +F LKET P +G G +T DKL+ TYDLVEQMQYLYVRVVKA+DLP KDVT
Sbjct  1    MQKAPLAHSNEFALKETSPKIGAGAVTRDKLSCTYDLVEQMQYLYVRVVKAKDLPSKDVT  60

Query  510  GSLDPYVEVRLGNYK  554
            GSLDPYVEV+LGNYK
Sbjct  61   GSLDPYVEVKLGNYK  75



>ref|XP_007131979.1| hypothetical protein PHAVU_011G056600g [Phaseolus vulgaris]
 gb|ESW03973.1| hypothetical protein PHAVU_011G056600g [Phaseolus vulgaris]
Length=775

 Score =   111 bits (278),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 61/75 (81%), Gaps = 3/75 (4%)
 Frame = +3

Query  339  MQRPP---QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVT  509
            MQR P     +F LKET P++G G +T DKL+ TYDLVEQMQYLYVRVVKA DLP KDVT
Sbjct  1    MQRAPLAHSHEFALKETSPNIGAGAVTRDKLSCTYDLVEQMQYLYVRVVKAMDLPAKDVT  60

Query  510  GSLDPYVEVRLGNYK  554
            GSLDPYVEV+LGN+K
Sbjct  61   GSLDPYVEVKLGNFK  75



>ref|XP_009131306.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Brassica rapa]
 ref|XP_009131307.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Brassica rapa]
 ref|XP_009131308.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Brassica rapa]
Length=769

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYVRVVKA++LP KDVTGS
Sbjct  1    MQKPGQNIDFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVVKAKELPGKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNY+
Sbjct  61   CDPYVEVKLGNYR  73



>emb|CDX78498.1| BnaA03g04100D [Brassica napus]
Length=769

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYVRVVKA++LP KDVTGS
Sbjct  1    MQKPGQNIDFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVVKAKELPGKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNY+
Sbjct  61   CDPYVEVKLGNYR  73



>ref|XP_010044995.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Eucalyptus grandis]
 gb|KCW87135.1| hypothetical protein EUGRSUZ_B03663 [Eucalyptus grandis]
Length=775

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = +3

Query  339  MQRPPQ-EDFMLKETKPHLGGGKIT-GDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  512
            MQ+PPQ +DF L+ET P++G G++T  DKL  TYDLVEQMQYLYVRVVKA++LP KDVTG
Sbjct  1    MQKPPQPQDFALRETSPNIGAGQVTPADKLACTYDLVEQMQYLYVRVVKAKELPGKDVTG  60

Query  513  SLDPYVEVRLGNYK  554
            + DPYVEV+LGNYK
Sbjct  61   TCDPYVEVKLGNYK  74



>ref|XP_010673580.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010673581.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010673582.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Beta vulgaris subsp. vulgaris]
Length=770

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +3

Query  348  PPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPY  527
            PP+E+F L+ET P +G   I GDKL STYDLVEQMQYLYVRVVKA++LP KDVTGS DPY
Sbjct  5    PPREEFALRETSPAIGVAGIAGDKLNSTYDLVEQMQYLYVRVVKAKELPGKDVTGSCDPY  64

Query  528  VEVRLGNYK  554
            VEV+LGNYK
Sbjct  65   VEVKLGNYK  73



>ref|XP_009121819.1| PREDICTED: extended synaptotagmin-1-like [Brassica rapa]
 ref|XP_009121820.1| PREDICTED: extended synaptotagmin-1-like [Brassica rapa]
Length=769

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYV+VVKA++LP KDVTGS
Sbjct  1    MQKPGQNIDFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVQVVKAKELPGKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_010492034.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010492035.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010492036.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010492037.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
Length=769

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+P Q  +F LKET P +G G +TGDKL+ TYDLVEQM YLYVRV+KA++LP KDVTGS
Sbjct  1    MQKPGQNIEFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVMKAKELPAKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_002871539.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47798.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=769

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+P Q  +F LKET P +G G +TGDKL+ TYDLVEQM YLYVRVVKA++LP KDVTGS
Sbjct  1    MQKPGQNIEFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVVKAKELPGKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNY+
Sbjct  61   CDPYVEVKLGNYR  73



>emb|CDX97214.1| BnaC09g44110D [Brassica napus]
Length=769

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYV+VVKA++LP KDVTGS
Sbjct  1    MQKPGQNIDFALKETSPKIGAGALTGDKLSCTYDLVEQMHYLYVQVVKAKELPGKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>gb|EMT24491.1| Multiple C2 and transmembrane domain-containing protein 1 [Aegilops 
tauschii]
Length=703

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 63/73 (86%), Gaps = 2/73 (3%)
 Frame = +3

Query  339  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQRP + E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP KD+TGS
Sbjct  2    MQRPFRPEEYSLKETTPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPAKDLTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>gb|EMS45217.1| Multiple C2 and transmembrane domain-containing protein 1 [Triticum 
urartu]
Length=774

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 63/73 (86%), Gaps = 2/73 (3%)
 Frame = +3

Query  339  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQRP + E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP KD+TGS
Sbjct  2    MQRPFRPEEYSLKETTPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPAKDLTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_006399782.1| hypothetical protein EUTSA_v10012747mg [Eutrema salsugineum]
 gb|ESQ41235.1| hypothetical protein EUTSA_v10012747mg [Eutrema salsugineum]
Length=769

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYVRV+KA++LP KD+TGS
Sbjct  1    MQKPGQNIDFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVMKAKELPGKDMTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_010227498.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 2-like [Brachypodium distachyon]
Length=774

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 63/73 (86%), Gaps = 2/73 (3%)
 Frame = +3

Query  339  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQRP + E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP KD++GS
Sbjct  2    MQRPFRPEEYSLKETSPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPSKDISGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_010419856.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X1 [Camelina sativa]
 ref|XP_010419858.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X1 [Camelina sativa]
Length=769

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+P Q  +F LKET P +G G +TGDKL+ TYDLVEQM YLYVRV+KA++LP KDVTGS
Sbjct  1    MQKPGQNIEFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVMKAKELPGKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_010419857.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X2 [Camelina sativa]
Length=769

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+P Q  +F LKET P +G G +TGDKL+ TYDLVEQM YLYVRV+KA++LP KDVTGS
Sbjct  1    MQKPGQNIEFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVMKAKELPGKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>emb|CDY68091.1| BnaAnng26150D [Brassica napus]
Length=769

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYV+VVKA++LP KDVTGS
Sbjct  1    MQKPGQNIDFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVQVVKAKELPGKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             +PYVEV+LGNYK
Sbjct  61   CNPYVEVKLGNYK  73



>ref|XP_006289947.1| hypothetical protein CARUB_v10003573mg [Capsella rubella]
 gb|EOA22845.1| hypothetical protein CARUB_v10003573mg [Capsella rubella]
Length=769

 Score =   108 bits (271),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+P Q  +F LKET P +G G +TGDKL++TYDLVEQM YLYVRV+KA++LP KDVTGS
Sbjct  1    MQKPGQNIEFALKETSPKIGAGAVTGDKLSNTYDLVEQMHYLYVRVMKAKELPGKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNY+
Sbjct  61   CDPYVEVKLGNYR  73



>ref|XP_007150401.1| hypothetical protein PHAVU_005G150300g [Phaseolus vulgaris]
 ref|XP_007150402.1| hypothetical protein PHAVU_005G150300g [Phaseolus vulgaris]
 gb|ESW22395.1| hypothetical protein PHAVU_005G150300g [Phaseolus vulgaris]
 gb|ESW22396.1| hypothetical protein PHAVU_005G150300g [Phaseolus vulgaris]
Length=774

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 61/74 (82%), Gaps = 2/74 (3%)
 Frame = +3

Query  333  HKMQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  512
            HK + PP+  F LKET P++G G +  DKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTG
Sbjct  2    HKPEGPPE--FALKETSPNIGAGAVMRDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTG  59

Query  513  SLDPYVEVRLGNYK  554
             +DPYVEV+LGNYK
Sbjct  60   GVDPYVEVKLGNYK  73



>ref|XP_003543552.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X1 [Glycine max]
 ref|XP_006595053.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X2 [Glycine max]
 gb|KHN30112.1| Multiple C2 and transmembrane domain-containing protein 2 [Glycine 
soja]
Length=775

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            M +P +  DF LKET P++G G +  DKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTG 
Sbjct  1    MHKPAEALDFALKETSPNIGAGAVMRDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTGG  60

Query  516  LDPYVEVRLGNYK  554
            +DPYVEV+LGNYK
Sbjct  61   VDPYVEVKLGNYK  73



>ref|XP_004142139.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cucumis sativus]
 ref|XP_004162018.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cucumis sativus]
 gb|KGN54116.1| hypothetical protein Csa_4G286400 [Cucumis sativus]
Length=771

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+  Q  DF LKET P +G   ITGDKL+STYDLVEQMQYLYV VVKA+DLP KDVTGS
Sbjct  1    MQKILQPHDFALKETYPKIGAVSITGDKLSSTYDLVEQMQYLYVYVVKAKDLPGKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>emb|CDX70485.1| BnaC03g05690D [Brassica napus]
Length=769

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            M++P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYVRVVKA++L  KDVTGS
Sbjct  1    MEKPGQNIDFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVVKAKELSGKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNY+
Sbjct  61   CDPYVEVKLGNYR  73



>ref|XP_008449758.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Cucumis melo]
Length=771

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            MQ+  Q  DF LKET P +G   ITGDKL+ TYDLVEQMQYLYV VVKA+DLP KDVTGS
Sbjct  1    MQKTLQPHDFALKETYPKIGAVSITGDKLSCTYDLVEQMQYLYVYVVKAKDLPGKDVTGS  60

Query  516  LDPYVEVRLGNYK  554
             DPYVEV+LGNYK
Sbjct  61   CDPYVEVKLGNYK  73



>ref|XP_008647970.1| PREDICTED: phosphoribosylanthranilate transferase isoform X1 
[Zea mays]
 ref|XP_008647971.1| PREDICTED: phosphoribosylanthranilate transferase isoform X1 
[Zea mays]
 gb|AFW76297.1| phosphoribosylanthranilate transferase isoform 1 [Zea mays]
 gb|AFW76298.1| phosphoribosylanthranilate transferase isoform 2 [Zea mays]
 gb|AFW76299.1| phosphoribosylanthranilate transferase isoform 3 [Zea mays]
Length=774

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 61/74 (82%), Gaps = 3/74 (4%)
 Frame = +3

Query  339  MQRP--PQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  512
            MQRP    E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP  D+TG
Sbjct  2    MQRPLLRPEEYSLKETSPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPNMDITG  60

Query  513  SLDPYVEVRLGNYK  554
            S DPYVEV+LGNYK
Sbjct  61   SCDPYVEVKLGNYK  74



>ref|XP_003546988.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Glycine max]
Length=774

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            M +P +  DF L+ET P++G G +  DKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTG 
Sbjct  1    MHKPAEALDFALRETSPNIGAGAVMRDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTGG  60

Query  516  LDPYVEVRLGNYK  554
            +DPYVEV+LGNYK
Sbjct  61   VDPYVEVKLGNYK  73



>ref|NP_001152102.1| phosphoribosylanthranilate transferase [Zea mays]
 gb|ACG45776.1| phosphoribosylanthranilate transferase [Zea mays]
Length=774

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 61/74 (82%), Gaps = 3/74 (4%)
 Frame = +3

Query  339  MQRP--PQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  512
            MQRP    E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP  D+TG
Sbjct  2    MQRPLLRPEEYSLKETSPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPNMDITG  60

Query  513  SLDPYVEVRLGNYK  554
            S DPYVEV+LGNYK
Sbjct  61   SCDPYVEVKLGNYK  74



>gb|KHN33324.1| Multiple C2 and transmembrane domain-containing protein 1 [Glycine 
soja]
Length=774

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +3

Query  339  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            M +P +  DF L+ET P++G G +  DKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTG 
Sbjct  1    MHKPAEALDFALRETSPNIGAGAVMRDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTGG  60

Query  516  LDPYVEVRLGNYK  554
            +DPYVEV+LGNYK
Sbjct  61   VDPYVEVKLGNYK  73



>gb|KDP28646.1| hypothetical protein JCGZ_14417 [Jatropha curcas]
Length=1025

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 59/71 (83%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+ LKET P LGGG+I G      D++TSTYDLVEQM+YL+VRVVKARDLP  DVTGSLD
Sbjct  250  DYALKETSPFLGGGQIVGGRVIRGDRMTSTYDLVEQMRYLFVRVVKARDLPTMDVTGSLD  309

Query  522  PYVEVRLGNYK  554
            PYVEVR+GNYK
Sbjct  310  PYVEVRVGNYK  320



>emb|CDP14088.1| unnamed protein product [Coffea canephora]
Length=762

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 58/74 (78%), Gaps = 2/74 (3%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGG--GKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  512
            M+ P  E+F LKET P + G    I GDKLT TYDLVEQMQYLYVRVVKARDLP KDVTG
Sbjct  1    MKLPQPEEFALKETAPKIAGSGAIIDGDKLTCTYDLVEQMQYLYVRVVKARDLPGKDVTG  60

Query  513  SLDPYVEVRLGNYK  554
            S DPY EV++GNYK
Sbjct  61   SCDPYAEVKVGNYK  74



>ref|XP_002511838.1| synaptotagmin, putative [Ricinus communis]
 gb|EEF50507.1| synaptotagmin, putative [Ricinus communis]
Length=1017

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 59/71 (83%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+ LKET P LGGG+I G      D++ STYDLVEQM+YL+VRVVKAR+LP KDVTGSLD
Sbjct  244  DYALKETSPFLGGGQIVGGRVIRRDRIASTYDLVEQMKYLFVRVVKARELPSKDVTGSLD  303

Query  522  PYVEVRLGNYK  554
            PYVEVR+GNYK
Sbjct  304  PYVEVRVGNYK  314



>ref|XP_009417304.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Musa acuminata subsp. malaccensis]
Length=777

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 65/76 (86%), Gaps = 4/76 (5%)
 Frame = +3

Query  339  MQRP---PQEDFMLKETKPHLGGGKITG-DKLTSTYDLVEQMQYLYVRVVKARDLPPKDV  506
            MQRP   PQEDF LKET P LGGG + G DKLT+TYDLVEQMQYLYVRVVKA+DLP KDV
Sbjct  1    MQRPFPLPQEDFSLKETAPRLGGGGLGGGDKLTNTYDLVEQMQYLYVRVVKAKDLPAKDV  60

Query  507  TGSLDPYVEVRLGNYK  554
            TGS DPYVEV+LGNYK
Sbjct  61   TGSCDPYVEVKLGNYK  76



>emb|CBI40337.3| unnamed protein product [Vitis vinifera]
Length=640

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 57/71 (80%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+ LKET P LGGG+I G      DK  STYDLVEQM YL+VRVVKARDLP KDVTGSLD
Sbjct  164  DYQLKETSPILGGGQIVGGRVIRADKPASTYDLVEQMHYLFVRVVKARDLPTKDVTGSLD  223

Query  522  PYVEVRLGNYK  554
            P+VEVR+GNYK
Sbjct  224  PFVEVRVGNYK  234



>ref|XP_010105960.1| Multiple C2 and transmembrane domain-containing protein 1 [Morus 
notabilis]
 gb|EXC06842.1| Multiple C2 and transmembrane domain-containing protein 1 [Morus 
notabilis]
Length=1006

 Score =   103 bits (256),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 59/71 (83%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITGDKL------TSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+ LKET P LGGG+I G ++      TSTYDLVE+MQYL++RVVKARDLP KDVTGSLD
Sbjct  232  DYSLKETSPFLGGGQIIGGRVIPGNRPTSTYDLVEKMQYLFIRVVKARDLPAKDVTGSLD  291

Query  522  PYVEVRLGNYK  554
            PYVEV++GNYK
Sbjct  292  PYVEVKMGNYK  302



>ref|XP_006349900.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Solanum tuberosum]
Length=771

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 55/72 (76%), Gaps = 9/72 (13%)
 Frame = +3

Query  339  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            MQRPPQEDF       HL GGK+TGD  T TYDLVEQMQYLYVRVVKA+DLP KD    L
Sbjct  1    MQRPPQEDF-----SAHLDGGKVTGDMFTRTYDLVEQMQYLYVRVVKAKDLPGKD----L  51

Query  519  DPYVEVRLGNYK  554
            DPYVEVRLGNY 
Sbjct  52   DPYVEVRLGNYS  63



>emb|CAN79812.1| hypothetical protein VITISV_018822 [Vitis vinifera]
Length=1020

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 57/71 (80%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+ LKET P LGGG+I G      DK  STYDLVEQM YL+VRVVKARDLP KDVTGSLD
Sbjct  240  DYQLKETSPILGGGQIVGGRVIRADKPASTYDLVEQMHYLFVRVVKARDLPTKDVTGSLD  299

Query  522  PYVEVRLGNYK  554
            P+VEVR+GNYK
Sbjct  300  PFVEVRVGNYK  310



>ref|XP_010255412.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Nelumbo nucifera]
 ref|XP_010255414.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Nelumbo nucifera]
 ref|XP_010255415.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Nelumbo nucifera]
Length=1011

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 58/71 (82%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+ LKET P LGGG+I G      DK  STYDLVEQMQ+L+VRVVKAR+LPP D+TGSLD
Sbjct  235  DYALKETSPFLGGGQIVGGRVIRADKPASTYDLVEQMQFLFVRVVKARELPPMDITGSLD  294

Query  522  PYVEVRLGNYK  554
            PYVEV++GNYK
Sbjct  295  PYVEVKVGNYK  305



>ref|XP_002271590.1| PREDICTED: uncharacterized protein LOC100253432 [Vitis vinifera]
Length=1018

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 57/71 (80%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+ LKET P LGGG+I G      DK  STYDLVEQM YL+VRVVKARDLP KDVTGSLD
Sbjct  238  DYQLKETSPILGGGQIVGGRVIRADKPASTYDLVEQMHYLFVRVVKARDLPTKDVTGSLD  297

Query  522  PYVEVRLGNYK  554
            P+VEVR+GNYK
Sbjct  298  PFVEVRVGNYK  308



>ref|XP_010940465.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Elaeis guineensis]
 ref|XP_010940466.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Elaeis guineensis]
 ref|XP_010940467.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Elaeis guineensis]
Length=1004

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 58/71 (82%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+ LKET P LGGG+I G      +K TSTYDLVEQMQYL+VRVVKARDLP  DV+GSLD
Sbjct  232  DYALKETSPFLGGGQIVGGRVIRAEKPTSTYDLVEQMQYLFVRVVKARDLPAMDVSGSLD  291

Query  522  PYVEVRLGNYK  554
            PYVEVR+GNY+
Sbjct  292  PYVEVRVGNYR  302



>ref|XP_008806876.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008806877.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
Length=1002

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 57/71 (80%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+ LKET P LGGG+I G      +K  STYDLVEQMQYL+VRVVKARDLP  DVTGSLD
Sbjct  230  DYALKETSPFLGGGQIVGGRVIRAEKPASTYDLVEQMQYLFVRVVKARDLPAMDVTGSLD  289

Query  522  PYVEVRLGNYK  554
            PYVEVR+GNY+
Sbjct  290  PYVEVRVGNYR  300



>ref|XP_009386410.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386411.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386412.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386413.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386414.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386415.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
Length=1004

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 57/71 (80%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+ LKET P LGGG+I G      DK  STYDLVEQMQYL+VRVVKA+DLP  DVTGSLD
Sbjct  232  DYALKETSPFLGGGQIVGGRVIRADKPASTYDLVEQMQYLFVRVVKAKDLPAMDVTGSLD  291

Query  522  PYVEVRLGNYK  554
            P+VEVR+GNYK
Sbjct  292  PFVEVRVGNYK  302



>gb|KJB41306.1| hypothetical protein B456_007G098200 [Gossypium raimondii]
Length=1005

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 58/71 (82%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            DF LKET P LG G+I G      D+ TSTYDLVEQM+YL+VRVVKARDLP KD+TGSLD
Sbjct  232  DFALKETSPFLGEGRIIGGRVIRGDRPTSTYDLVEQMRYLFVRVVKARDLPSKDLTGSLD  291

Query  522  PYVEVRLGNYK  554
            PYVEV++GNYK
Sbjct  292  PYVEVKVGNYK  302



>ref|XP_009383872.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Musa acuminata subsp. malaccensis]
Length=1012

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 57/71 (80%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+ LKET P LGGG+I G      +K  STYDLVEQMQYL+VRVVKARDLP  DVTGSLD
Sbjct  241  DYALKETSPFLGGGQIVGGRVIRAEKPASTYDLVEQMQYLFVRVVKARDLPAMDVTGSLD  300

Query  522  PYVEVRLGNYK  554
            PYVEV++GNYK
Sbjct  301  PYVEVKVGNYK  311



>ref|XP_008778754.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 1-like [Phoenix dactylifera]
Length=1005

 Score =   100 bits (250),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+ LKET P LGGG+I G      +K  STYDLVEQMQYL+VRVVKARDLP  DV+GSLD
Sbjct  232  DYALKETNPFLGGGQIVGGRVIRAEKPASTYDLVEQMQYLFVRVVKARDLPAMDVSGSLD  291

Query  522  PYVEVRLGNYK  554
            PYVEVR+GNY+
Sbjct  292  PYVEVRVGNYR  302



>ref|XP_010934752.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Elaeis guineensis]
 ref|XP_010934753.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Elaeis guineensis]
 ref|XP_010934755.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Elaeis guineensis]
Length=1004

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+ LKET P LGGG+I G      +K  STYDLVEQMQYL+VRVVKARDLP  DVTGSLD
Sbjct  232  DYALKETSPFLGGGQIVGGRVIRAEKPASTYDLVEQMQYLFVRVVKARDLPAMDVTGSLD  291

Query  522  PYVEVRLGNYK  554
            P+VEVR+GNY+
Sbjct  292  PFVEVRVGNYR  302



>ref|XP_010660813.1| PREDICTED: uncharacterized protein LOC100264973 [Vitis vinifera]
 ref|XP_010660820.1| PREDICTED: uncharacterized protein LOC100264973 [Vitis vinifera]
 ref|XP_010660822.1| PREDICTED: uncharacterized protein LOC100264973 [Vitis vinifera]
Length=1002

 Score =   100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 56/71 (79%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            DF LKET P LGGG+      I  DK  STYDLVEQMQ+L+VRVVKAR+LP  DVTGSLD
Sbjct  229  DFALKETSPFLGGGQVVRGRVIRSDKTASTYDLVEQMQFLFVRVVKARELPAMDVTGSLD  288

Query  522  PYVEVRLGNYK  554
            PYVEV++GNYK
Sbjct  289  PYVEVKIGNYK  299



>ref|XP_006445078.1| hypothetical protein CICLE_v10018672mg [Citrus clementina]
 ref|XP_006491075.1| PREDICTED: uncharacterized protein LOC102617920 [Citrus sinensis]
 gb|ESR58318.1| hypothetical protein CICLE_v10018672mg [Citrus clementina]
Length=1008

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 58/71 (82%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITGDKL------TSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+ LKET P LGGG++ G ++       STYDLVEQM+YL+VRVVKARDLP KDVTGSLD
Sbjct  235  DYALKETSPFLGGGQVIGGRVVRGDLRASTYDLVEQMRYLFVRVVKARDLPSKDVTGSLD  294

Query  522  PYVEVRLGNYK  554
            P+VEV++GNYK
Sbjct  295  PFVEVKVGNYK  305



>gb|KDO86111.1| hypothetical protein CISIN_1g001835mg [Citrus sinensis]
 gb|KDO86112.1| hypothetical protein CISIN_1g001835mg [Citrus sinensis]
Length=1008

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 58/71 (82%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITGDKL------TSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+ LKET P LGGG++ G ++       STYDLVEQM+YL+VRVVKARDLP KDVTGSLD
Sbjct  235  DYALKETSPFLGGGQVIGGRVVRGDLRASTYDLVEQMRYLFVRVVKARDLPSKDVTGSLD  294

Query  522  PYVEVRLGNYK  554
            P+VEV++GNYK
Sbjct  295  PFVEVKVGNYK  305



>ref|XP_007052594.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein [Theobroma cacao]
 gb|EOX96751.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein [Theobroma cacao]
Length=1050

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 62/86 (72%), Gaps = 11/86 (13%)
 Frame = +3

Query  330  NHKMQRPPQEDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVV  476
            N + Q   QED+ LK+T P LG         GG+  I+G++ TSTYDLVEQM YLYVRVV
Sbjct  257  NAQAQPGYQEDYNLKDTNPQLGERWPNGGAYGGRGWISGERFTSTYDLVEQMFYLYVRVV  316

Query  477  KARDLPPKDVTGSLDPYVEVRLGNYK  554
            KA+DLPP  VTGS DPYVEV+LGNYK
Sbjct  317  KAKDLPPSSVTGSCDPYVEVKLGNYK  342



>ref|XP_007220279.1| hypothetical protein PRUPE_ppa000771mg [Prunus persica]
 gb|EMJ21478.1| hypothetical protein PRUPE_ppa000771mg [Prunus persica]
Length=1009

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 58/71 (82%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+ LKET P+LGGG+I G      D+ + TYDLV++MQYL+VRVVKARDLP  DVTGSLD
Sbjct  233  DYSLKETSPYLGGGQIVGGRVIRADRPSGTYDLVQKMQYLFVRVVKARDLPHMDVTGSLD  292

Query  522  PYVEVRLGNYK  554
            PYVEVR+GNYK
Sbjct  293  PYVEVRIGNYK  303



>ref|XP_008244912.1| PREDICTED: uncharacterized protein LOC103343020 [Prunus mume]
Length=1009

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 58/71 (82%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+ LKET P+LGGG+I G      D+ + TYDLV++MQYL+VRVVKARDLP  DVTGSLD
Sbjct  233  DYSLKETSPYLGGGQIVGGRVIRADRPSGTYDLVQKMQYLFVRVVKARDLPHMDVTGSLD  292

Query  522  PYVEVRLGNYK  554
            PYVEVR+GNYK
Sbjct  293  PYVEVRIGNYK  303



>ref|XP_007051844.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein isoform 1 [Theobroma cacao]
 gb|EOX96001.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein isoform 1 [Theobroma cacao]
Length=1001

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+ LKET P LGGG+I G      D+  STYDLVEQM+YL+VRVVKA+DLP KDV GSLD
Sbjct  230  DYALKETSPFLGGGQIVGGRVIRGDRPASTYDLVEQMRYLFVRVVKAQDLPSKDVAGSLD  289

Query  522  PYVEVRLGNYK  554
            PYVEV++GNYK
Sbjct  290  PYVEVKVGNYK  300



>ref|XP_007051845.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein isoform 2 [Theobroma cacao]
 gb|EOX96002.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein isoform 2 [Theobroma cacao]
Length=949

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+ LKET P LGGG+I G      D+  STYDLVEQM+YL+VRVVKA+DLP KDV GSLD
Sbjct  230  DYALKETSPFLGGGQIVGGRVIRGDRPASTYDLVEQMRYLFVRVVKAQDLPSKDVAGSLD  289

Query  522  PYVEVRLGNYK  554
            PYVEV++GNYK
Sbjct  290  PYVEVKVGNYK  300



>dbj|BAK04937.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1016

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 57/71 (80%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+ LKET P LGGG+I G      +K  STYDLVE+MQYL+VRVVKARDLP  D+TGSLD
Sbjct  242  DYALKETSPFLGGGQIVGGRVIGGEKHASTYDLVERMQYLFVRVVKARDLPNMDITGSLD  301

Query  522  PYVEVRLGNYK  554
            P+VEVR+GNY+
Sbjct  302  PFVEVRVGNYR  312



>gb|EMT30716.1| hypothetical protein F775_31640 [Aegilops tauschii]
Length=983

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 57/71 (80%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+ LKET P LGGG+I G      +K  STYDLVE+MQYL+VRVVKARDLP  D+TGSLD
Sbjct  242  DYALKETSPFLGGGQIVGGRVIGGEKHASTYDLVERMQYLFVRVVKARDLPNMDITGSLD  301

Query  522  PYVEVRLGNYK  554
            P+VEVR+GNY+
Sbjct  302  PFVEVRVGNYR  312



>ref|XP_003580853.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Brachypodium distachyon]
Length=1009

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 57/71 (80%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+ LKET P LGGG+I G      +K  STYDLVE+MQYL+VRVVKARDLP  D+TGSLD
Sbjct  235  DYALKETSPFLGGGQIVGGRVIRGEKHASTYDLVERMQYLFVRVVKARDLPDMDITGSLD  294

Query  522  PYVEVRLGNYK  554
            P+VEVR+GNY+
Sbjct  295  PFVEVRVGNYR  305



>ref|XP_004235089.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Solanum lycopersicum]
Length=789

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 59/79 (75%), Gaps = 11/79 (14%)
 Frame = +3

Query  351  PQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPP  497
            PQ+D+  KETKP LG           GG I+ D++TSTYDLVEQM +LYVRVVKARDLPP
Sbjct  9    PQDDYKAKETKPQLGERWPHGGFRGGGGWISSDRVTSTYDLVEQMHFLYVRVVKARDLPP  68

Query  498  KDVTGSLDPYVEVRLGNYK  554
              VTGS DPYVEV+LGNYK
Sbjct  69   NPVTGSCDPYVEVKLGNYK  87



>ref|XP_006342310.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Solanum tuberosum]
Length=791

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 59/79 (75%), Gaps = 11/79 (14%)
 Frame = +3

Query  351  PQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPP  497
            PQ+D+  KETKP LG           GG I+ D++TSTYDLVEQM +LYVRVVKARDLPP
Sbjct  9    PQDDYKAKETKPQLGERWPHGGFRGGGGWISSDRVTSTYDLVEQMHFLYVRVVKARDLPP  68

Query  498  KDVTGSLDPYVEVRLGNYK  554
              VTGS DPYVEV+LGNYK
Sbjct  69   NPVTGSCDPYVEVKLGNYK  87



>ref|XP_002320122.2| hypothetical protein POPTR_0014s07750g [Populus trichocarpa]
 gb|EEE98437.2| hypothetical protein POPTR_0014s07750g [Populus trichocarpa]
Length=1008

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+ LKET P LGGG+I G      D+ +S+YDLVEQM+YLYVRVVKA DLP  DVTGSLD
Sbjct  236  DYALKETSPFLGGGQIVGGRVIRGDRPSSSYDLVEQMKYLYVRVVKAHDLPTMDVTGSLD  295

Query  522  PYVEVRLGNYK  554
            PYVEV++GNYK
Sbjct  296  PYVEVKVGNYK  306



>ref|XP_010053272.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053273.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053274.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053275.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053276.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053277.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053278.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 gb|KCW77541.1| hypothetical protein EUGRSUZ_D01859 [Eucalyptus grandis]
Length=1009

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 57/71 (80%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            ++ LKET P+LGGG+      I GDK  STYDLVEQM +LYVRVVKAR+LP  D++GS+D
Sbjct  236  EYALKETSPYLGGGRVVAGRVIRGDKTASTYDLVEQMHFLYVRVVKARELPAMDISGSID  295

Query  522  PYVEVRLGNYK  554
            PYVEVR+GNYK
Sbjct  296  PYVEVRVGNYK  306



>ref|XP_006439066.1| hypothetical protein CICLE_v10033918mg [Citrus clementina]
 gb|ESR52306.1| hypothetical protein CICLE_v10033918mg [Citrus clementina]
Length=768

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +3

Query  354  QEDFMLKETKPHLGGGKITG-DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPYV  530
            +EDF LKET P +GGG+++G ++LTS++DLVEQM++LYVR+V+ARDL    VTG+ DPYV
Sbjct  5    KEDFSLKETSPKIGGGRVSGRERLTSSFDLVEQMEFLYVRIVRARDLQVNQVTGTCDPYV  64

Query  531  EVRLGNYK  554
            EV++GNYK
Sbjct  65   EVKIGNYK  72



>gb|KDO83486.1| hypothetical protein CISIN_1g004208mg [Citrus sinensis]
Length=768

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +3

Query  354  QEDFMLKETKPHLGGGKITG-DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPYV  530
            +EDF LKET P +GGG+++G ++LTS++DLVEQM++LYVR+V+ARDL    VTG+ DPYV
Sbjct  5    KEDFSLKETSPKIGGGRVSGRERLTSSFDLVEQMEFLYVRIVRARDLQVNQVTGTCDPYV  64

Query  531  EVRLGNYK  554
            EV++GNYK
Sbjct  65   EVKIGNYK  72



>ref|XP_006483675.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Citrus sinensis]
Length=768

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +3

Query  354  QEDFMLKETKPHLGGGKITG-DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPYV  530
            +EDF LKET P +GGG+++G ++LTS++DLVEQM++LYVR+V+ARDL    VTG+ DPYV
Sbjct  5    KEDFSLKETSPKIGGGRVSGRERLTSSFDLVEQMEFLYVRIVRARDLQVNQVTGTCDPYV  64

Query  531  EVRLGNYK  554
            EV++GNYK
Sbjct  65   EVKIGNYK  72



>ref|XP_011023361.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
Length=1007

 Score = 97.4 bits (241),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+  KET P LGGG+I G      D+ +S+YDLVEQM+YLYVRVVKARDLP  DVTGSLD
Sbjct  235  DYTPKETSPFLGGGQIVGGRVIRGDRPSSSYDLVEQMKYLYVRVVKARDLPTMDVTGSLD  294

Query  522  PYVEVRLGNYK  554
            PYVEV++GNYK
Sbjct  295  PYVEVKVGNYK  305



>ref|XP_011015655.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
Length=1007

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 56/71 (79%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+  KET P LGGG+I G      D+  STYDLVEQM+YL+VRVVKARDLP  DVTGSLD
Sbjct  235  DYTPKETSPFLGGGQIVGGRVIRGDRPASTYDLVEQMKYLFVRVVKARDLPTMDVTGSLD  294

Query  522  PYVEVRLGNYK  554
            PYVEV++GNYK
Sbjct  295  PYVEVKVGNYK  305



>emb|CDP08834.1| unnamed protein product [Coffea canephora]
Length=1004

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 56/71 (79%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            ++ LKET P LGGG+      I  DK  STYDLVE MQ+L+VRVVKARDLP KDVTGSLD
Sbjct  235  EYALKETSPVLGGGQVVQGRVIRADKPASTYDLVEPMQFLFVRVVKARDLPSKDVTGSLD  294

Query  522  PYVEVRLGNYK  554
            PYVEVR+GNY+
Sbjct  295  PYVEVRVGNYR  305



>ref|XP_002301353.2| hypothetical protein POPTR_0002s15950g [Populus trichocarpa]
 gb|EEE80626.2| hypothetical protein POPTR_0002s15950g [Populus trichocarpa]
Length=1008

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 56/71 (79%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+  KET P LGGG+I G      D+  STYDLVEQM+YL+VRVVKARDLP  DVTGSLD
Sbjct  236  DYTPKETSPFLGGGQIVGGRVIRGDRPASTYDLVEQMKYLFVRVVKARDLPTMDVTGSLD  295

Query  522  PYVEVRLGNYK  554
            PYVEV++GNYK
Sbjct  296  PYVEVKVGNYK  306



>ref|XP_002509788.1| synaptotagmin, putative [Ricinus communis]
 gb|EEF51175.1| synaptotagmin, putative [Ricinus communis]
Length=980

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 56/71 (79%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+ LKET P LGGG+      I GDK  STYDLVE+M +LYVRVVKARDLP  DVTGS+D
Sbjct  235  DYALKETSPLLGGGRVVHGRVIHGDKTASTYDLVERMFFLYVRVVKARDLPAMDVTGSID  294

Query  522  PYVEVRLGNYK  554
            P+VEV++GNYK
Sbjct  295  PFVEVKIGNYK  305



>ref|XP_009379435.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Pyrus x bretschneideri]
Length=1026

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 56/78 (72%), Gaps = 4/78 (5%)
 Frame = +3

Query  333  HKMQRPPQE-DFMLKETKPHLGGGKITG---DKLTSTYDLVEQMQYLYVRVVKARDLPPK  500
            H  Q PPQ  +F L ET P L   +  G   DK +STYDLVEQM YLYV VVKARDLP  
Sbjct  248  HMQQTPPQNPEFSLVETSPPLAARRYRGFGVDKTSSTYDLVEQMHYLYVSVVKARDLPTM  307

Query  501  DVTGSLDPYVEVRLGNYK  554
            DVTGSLDPYVEV+LGNYK
Sbjct  308  DVTGSLDPYVEVKLGNYK  325



>ref|XP_004299880.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Fragaria vesca subsp. vesca]
Length=1036

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 58/82 (71%), Gaps = 8/82 (10%)
 Frame = +3

Query  333  HKMQRPPQED--FMLKETKPHLGG------GKITGDKLTSTYDLVEQMQYLYVRVVKARD  488
            H  Q PP+++  F L ET P L        G  TGDK +STYDLVEQM YLYV VVKARD
Sbjct  254  HMQQGPPRQNPEFALVETSPPLAARLRYRPGGFTGDKTSSTYDLVEQMHYLYVSVVKARD  313

Query  489  LPPKDVTGSLDPYVEVRLGNYK  554
            LP  DV+GSLDPYVEV+LGNY+
Sbjct  314  LPTMDVSGSLDPYVEVKLGNYR  335



>emb|CBI24845.3| unnamed protein product [Vitis vinifera]
Length=621

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +3

Query  354  QEDFMLKETKPHLGGGKIT-GDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPYV  530
            ++D+ LKET P+LGGG+++ GDKLT+ +DLVEQM YLYVRVVKA++LP KD + S DPYV
Sbjct  120  EDDYCLKETSPNLGGGRLSRGDKLTTAFDLVEQMHYLYVRVVKAKELPGKDGSESCDPYV  179

Query  531  EVRLGNYK  554
            EV++GN+K
Sbjct  180  EVKVGNFK  187



>ref|XP_010659323.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Vitis vinifera]
Length=776

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +3

Query  354  QEDFMLKETKPHLGGGKIT-GDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPYV  530
            ++D+ LKET P+LGGG+++ GDKLT+ +DLVEQM YLYVRVVKA++LP KD + S DPYV
Sbjct  13   EDDYCLKETSPNLGGGRLSRGDKLTTAFDLVEQMHYLYVRVVKAKELPGKDGSESCDPYV  72

Query  531  EVRLGNYK  554
            EV++GN+K
Sbjct  73   EVKVGNFK  80



>gb|EYU23487.1| hypothetical protein MIMGU_mgv1a000757mg [Erythranthe guttata]
Length=993

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 55/73 (75%), Gaps = 8/73 (11%)
 Frame = +3

Query  360  DFMLKETKPHLGGGKITGDKLT--------STYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            DF LKET P LGGG+I G K+          TYDLVE+M +L+VRVVKAR+LP  DVTGS
Sbjct  221  DFALKETSPFLGGGRIVGGKVVKTDRTTAGGTYDLVEKMHFLFVRVVKARELPAMDVTGS  280

Query  516  LDPYVEVRLGNYK  554
            LDPYVEV++GNYK
Sbjct  281  LDPYVEVKIGNYK  293



>ref|XP_007217305.1| hypothetical protein PRUPE_ppa015370mg [Prunus persica]
 gb|EMJ18504.1| hypothetical protein PRUPE_ppa015370mg [Prunus persica]
Length=929

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 48/81 (59%), Positives = 57/81 (70%), Gaps = 7/81 (9%)
 Frame = +3

Query  330  NHKMQRPPQEDFMLKETKPHLGGGKIT------GDKLTSTYDLVEQMQYLYVRVVKARDL  491
            N +++ PP E F L ET P LGGG++       G+K  S YDLVEQM +LYVRVVKARDL
Sbjct  171  NAEVEIPPHE-FSLTETSPKLGGGRVASGRVIHGEKTASAYDLVEQMYFLYVRVVKARDL  229

Query  492  PPKDVTGSLDPYVEVRLGNYK  554
            P  DVTG L PY EVR+G+YK
Sbjct  230  PAMDVTGRLAPYTEVRVGDYK  250



>ref|XP_004138509.1| PREDICTED: uncharacterized protein LOC101203632 [Cucumis sativus]
 gb|KGN45648.1| hypothetical protein Csa_6G003400 [Cucumis sativus]
Length=1018

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 57/72 (79%), Gaps = 6/72 (8%)
 Frame = +3

Query  357  EDFMLKETKPHLGGGKITGDKL------TSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
             D+ ++ET P+LGGG + G +L      T+TYDLVE+M YL+VRVVKARDLP KD+TG L
Sbjct  238  NDYSIRETSPYLGGGMVVGGRLALRDRPTNTYDLVEKMHYLFVRVVKARDLPTKDLTGGL  297

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGN+K
Sbjct  298  DPYVEVKLGNFK  309



>emb|CDY01973.1| BnaC02g27540D [Brassica napus]
Length=991

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 59/76 (78%), Gaps = 8/76 (11%)
 Frame = +3

Query  351  PQEDFMLKETKPHLGGGKITGDKL--------TSTYDLVEQMQYLYVRVVKARDLPPKDV  506
            P  DF +KET P LGGG+I G ++        + TYDLVE+M++L+VRVVKARDLP +D+
Sbjct  213  PPSDFSVKETSPFLGGGQIIGGRVVRGTKRPASGTYDLVEEMRFLFVRVVKARDLPDRDL  272

Query  507  TGSLDPYVEVRLGNYK  554
            TGSLDPYVEV++GN+K
Sbjct  273  TGSLDPYVEVKIGNFK  288



>ref|XP_008458254.1| PREDICTED: uncharacterized protein LOC103497726 [Cucumis melo]
 ref|XP_008458255.1| PREDICTED: uncharacterized protein LOC103497726 [Cucumis melo]
Length=1018

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 57/72 (79%), Gaps = 6/72 (8%)
 Frame = +3

Query  357  EDFMLKETKPHLGGGKITGDKL------TSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
             D+ ++ET P+LGGG + G +L      T+TYDLVE+M YL+VRVVKARDLP KD+TG L
Sbjct  238  NDYSIRETSPYLGGGMVVGGRLALRDRPTNTYDLVEKMHYLFVRVVKARDLPTKDLTGGL  297

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGN+K
Sbjct  298  DPYVEVKLGNFK  309



>gb|EMS48196.1| Multiple C2 and transmembrane domain-containing protein 1 [Triticum 
urartu]
Length=750

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 56/73 (77%), Gaps = 3/73 (4%)
 Frame = +3

Query  345  RPPQ---EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            +PPQ   ED++LKET P LGG    GDK TSTYDLVEQM YLYVR VKA+DL  KD +GS
Sbjct  2    QPPQPRPEDYLLKETTPCLGGFMAAGDKRTSTYDLVEQMPYLYVRAVKAKDLRAKDGSGS  61

Query  516  LDPYVEVRLGNYK  554
             DP VE++LGNY+
Sbjct  62   CDPSVEIKLGNYR  74



>ref|XP_009393442.1| PREDICTED: uncharacterized protein LOC103979123 [Musa acuminata 
subsp. malaccensis]
Length=1041

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 55/70 (79%), Gaps = 2/70 (3%)
 Frame = +3

Query  351  PQEDFMLKETKPHLGG--GKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDP  524
            P  DF + ET P L G  G  +GDK+ STYDLVEQM+YLYV VVKARDLP  D+TGSLDP
Sbjct  269  PGPDFGIVETAPPLAGRLGYRSGDKIASTYDLVEQMRYLYVNVVKARDLPTMDLTGSLDP  328

Query  525  YVEVRLGNYK  554
            YVEV+LGNYK
Sbjct  329  YVEVKLGNYK  338



>ref|XP_004166328.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101203632 
[Cucumis sativus]
Length=1018

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 57/72 (79%), Gaps = 6/72 (8%)
 Frame = +3

Query  357  EDFMLKETKPHLGGGKITGDKL------TSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
             D+ ++ET P+LGGG + G +L      T+TYDLVE+M YL+VRVVKARDLP KD+TG L
Sbjct  238  NDYSIRETSPYLGGGMVVGGRLALRDRPTNTYDLVEKMHYLFVRVVKARDLPTKDLTGGL  297

Query  519  DPYVEVRLGNYK  554
            DPYVEV+LGN+K
Sbjct  298  DPYVEVKLGNFK  309



>ref|XP_011078852.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Sesamum indicum]
Length=789

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 59/79 (75%), Gaps = 11/79 (14%)
 Frame = +3

Query  351  PQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPP  497
            PQ+D+ +K+TKP LG           GG I+ D++TSTYDLVEQM YLYVRVVKARDLP 
Sbjct  6    PQDDYKIKDTKPQLGERWPHGGVRGGGGWISSDRVTSTYDLVEQMYYLYVRVVKARDLPT  65

Query  498  KDVTGSLDPYVEVRLGNYK  554
              VTGS DPYVEV+LGNYK
Sbjct  66   NPVTGSCDPYVEVKLGNYK  84



>gb|KDP24593.1| hypothetical protein JCGZ_25509 [Jatropha curcas]
Length=788

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 57/78 (73%), Gaps = 11/78 (14%)
 Frame = +3

Query  354  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  500
            +EDF LK+TKP LG           GG I+ D+ TSTYDLVEQM YLYVRV KARDLP  
Sbjct  7    KEDFKLKDTKPQLGERWPHGGLRSGGGWISSDRATSTYDLVEQMFYLYVRVEKARDLPTN  66

Query  501  DVTGSLDPYVEVRLGNYK  554
             VTG+LDPYVEV++GNY+
Sbjct  67   PVTGNLDPYVEVKVGNYR  84



>ref|XP_009763246.1| PREDICTED: uncharacterized protein LOC104215187 [Nicotiana sylvestris]
 ref|XP_009763247.1| PREDICTED: uncharacterized protein LOC104215187 [Nicotiana sylvestris]
Length=785

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 58/78 (74%), Gaps = 11/78 (14%)
 Frame = +3

Query  354  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  500
            ++D+  KETKP LG           GG I+ D++TSTYDLVEQM +LYVRVVKARDLPP 
Sbjct  4    EDDYKAKETKPQLGERWPHGGFRGGGGWISSDRVTSTYDLVEQMHFLYVRVVKARDLPPN  63

Query  501  DVTGSLDPYVEVRLGNYK  554
             VTGS DPYVEV+LGNYK
Sbjct  64   PVTGSCDPYVEVKLGNYK  81



>ref|XP_009611365.1| PREDICTED: uncharacterized protein LOC104104885 [Nicotiana tomentosiformis]
Length=785

 Score = 94.4 bits (233),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 58/78 (74%), Gaps = 11/78 (14%)
 Frame = +3

Query  354  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  500
            ++D+  KETKP LG           GG I+ D++TSTYDLVEQM +LYVRVVKARDLPP 
Sbjct  4    EDDYKAKETKPQLGERWPHGGFRGGGGWISSDRVTSTYDLVEQMHFLYVRVVKARDLPPN  63

Query  501  DVTGSLDPYVEVRLGNYK  554
             VTGS DPYVEV+LGNYK
Sbjct  64   PVTGSCDPYVEVKLGNYK  81



>gb|AFN53655.1| putative synaptotagmin protein [Linum usitatissimum]
Length=793

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 58/78 (74%), Gaps = 11/78 (14%)
 Frame = +3

Query  354  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  500
            +EDF LK+TKP LG           GG I+ ++ TSTYDLVEQM YLYVRVVKARDLPP 
Sbjct  10   KEDFKLKDTKPQLGERWPHGGSRGGGGWISSERATSTYDLVEQMFYLYVRVVKARDLPPN  69

Query  501  DVTGSLDPYVEVRLGNYK  554
             V+GS DPYVEV+LGNYK
Sbjct  70   PVSGSCDPYVEVKLGNYK  87



>gb|KDO57729.1| hypothetical protein CISIN_1g003882mg [Citrus sinensis]
Length=789

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 56/78 (72%), Gaps = 11/78 (14%)
 Frame = +3

Query  354  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  500
            QED+ LK+TKP LG           GG I+ ++ TSTYDLVEQM YLYVRV KARDLP  
Sbjct  10   QEDYKLKDTKPQLGERWPHGGIRGAGGWISSERATSTYDLVEQMFYLYVRVEKARDLPTN  69

Query  501  DVTGSLDPYVEVRLGNYK  554
             V+GS DPYVEV+LGNYK
Sbjct  70   PVSGSCDPYVEVKLGNYK  87



>ref|XP_009128492.1| PREDICTED: uncharacterized protein LOC103853319 [Brassica rapa]
 ref|XP_009128493.1| PREDICTED: uncharacterized protein LOC103853319 [Brassica rapa]
Length=995

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 58/76 (76%), Gaps = 8/76 (11%)
 Frame = +3

Query  351  PQEDFMLKETKPHLGGGKITGDKL--------TSTYDLVEQMQYLYVRVVKARDLPPKDV  506
            P  DF +KET P LGGG+I G ++        +  YDLVE+M++L+VRVVKARDLP +D+
Sbjct  217  PPSDFSVKETSPFLGGGQIIGGRVVRGTKRPASGAYDLVEEMRFLFVRVVKARDLPDRDL  276

Query  507  TGSLDPYVEVRLGNYK  554
            TGSLDPYVEV++GN+K
Sbjct  277  TGSLDPYVEVKIGNFK  292



>gb|EYU46304.1| hypothetical protein MIMGU_mgv1a001691mg [Erythranthe guttata]
Length=772

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 59/75 (79%), Gaps = 3/75 (4%)
 Frame = +3

Query  339  MQR-PPQEDFMLKETKPHLGG-GKITG-DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVT  509
            MQ+ P  E+F LK+T P + G G ITG DK+   YDLVEQM+YLYVRVVKA++LP KD+T
Sbjct  1    MQKYPVPEEFALKQTAPKIAGSGVITGGDKVNCAYDLVEQMEYLYVRVVKAKELPVKDIT  60

Query  510  GSLDPYVEVRLGNYK  554
            G+  PYVEVRLGNYK
Sbjct  61   GTCHPYVEVRLGNYK  75



>ref|XP_004309445.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Fragaria vesca subsp. vesca]
Length=796

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 58/79 (73%), Gaps = 11/79 (14%)
 Frame = +3

Query  351  PQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPP  497
            PQED+ LK+TKP LG           GG I+ ++ TSTYDLVEQM YLYVRVVKA+DLP 
Sbjct  9    PQEDYKLKDTKPQLGERWPHGGVRGGGGWISNERATSTYDLVEQMFYLYVRVVKAKDLPT  68

Query  498  KDVTGSLDPYVEVRLGNYK  554
              VTGS DPYVEV+LGNYK
Sbjct  69   NPVTGSCDPYVEVKLGNYK  87



>gb|KFK44354.1| hypothetical protein AALP_AA1G246600 [Arabis alpina]
Length=1000

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 58/83 (70%), Gaps = 10/83 (12%)
 Frame = +3

Query  336  KMQRPPQE---DFMLKETKPHLGGG-------KITGDKLTSTYDLVEQMQYLYVRVVKAR  485
            +MQ PPQ    +F L ET P L          + +GDK +STYDLVEQM YLYV VVKAR
Sbjct  216  QMQVPPQRQNPEFQLIETSPPLAARMRQSYYYRSSGDKTSSTYDLVEQMHYLYVNVVKAR  275

Query  486  DLPPKDVTGSLDPYVEVRLGNYK  554
            DLP  DV+GSLDPYVEV+LGNYK
Sbjct  276  DLPVMDVSGSLDPYVEVKLGNYK  298



>ref|XP_010104492.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
 gb|EXC01093.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
Length=1024

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = +3

Query  336  KMQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  512
            +MQ P Q  +F L ET+P +   +  GDK  STYDLVEQM YLYV VVKARDLP  D++G
Sbjct  252  RMQVPSQNPEFALVETRPPVAARR--GDKTASTYDLVEQMHYLYVSVVKARDLPVMDISG  309

Query  513  SLDPYVEVRLGNYK  554
            SLDPYVEV+LGNYK
Sbjct  310  SLDPYVEVKLGNYK  323



>ref|XP_006483676.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Citrus sinensis]
Length=1035

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 57/78 (73%), Gaps = 11/78 (14%)
 Frame = +3

Query  354  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  500
            QE++ LK+T P LG            G ++G++ TSTYDLVEQM YLYVRVVKA+DLPP 
Sbjct  250  QEEYNLKDTNPQLGERWLNGGGYGGRGWMSGERFTSTYDLVEQMSYLYVRVVKAKDLPPS  309

Query  501  DVTGSLDPYVEVRLGNYK  554
             +TGS DPYVEV++GNYK
Sbjct  310  SITGSCDPYVEVKMGNYK  327



>gb|KJB25055.1| hypothetical protein B456_004G174500 [Gossypium raimondii]
Length=805

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 55/79 (70%), Gaps = 12/79 (15%)
 Frame = +3

Query  354  QEDFMLKETKPHLG------------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPP  497
            QED+ LK+T P LG            G    GD+ TSTYDLVEQM YLYVRVVKA++LPP
Sbjct  20   QEDYNLKDTSPQLGERWPNGGTFGGRGWMNGGDRFTSTYDLVEQMFYLYVRVVKAKELPP  79

Query  498  KDVTGSLDPYVEVRLGNYK  554
              +TGS DPYVEV+LGNYK
Sbjct  80   SSLTGSCDPYVEVKLGNYK  98



>ref|XP_006439068.1| hypothetical protein CICLE_v10030600mg [Citrus clementina]
 gb|ESR52308.1| hypothetical protein CICLE_v10030600mg [Citrus clementina]
Length=1026

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 57/78 (73%), Gaps = 11/78 (14%)
 Frame = +3

Query  354  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  500
            QE++ LK+T P LG            G ++G++ TSTYDLVEQM YLYVRVVKA+DLPP 
Sbjct  241  QEEYNLKDTNPQLGERWPNGGGYGGRGWMSGERFTSTYDLVEQMSYLYVRVVKAKDLPPS  300

Query  501  DVTGSLDPYVEVRLGNYK  554
             +TGS DPYVEV++GNYK
Sbjct  301  SITGSCDPYVEVKMGNYK  318



>gb|KDO83484.1| hypothetical protein CISIN_1g001696mg [Citrus sinensis]
Length=1026

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 57/78 (73%), Gaps = 11/78 (14%)
 Frame = +3

Query  354  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  500
            QE++ LK+T P LG            G ++G++ TSTYDLVEQM YLYVRVVKA+DLPP 
Sbjct  241  QEEYNLKDTNPQLGERWPNGGGYGGRGWMSGERFTSTYDLVEQMSYLYVRVVKAKDLPPS  300

Query  501  DVTGSLDPYVEVRLGNYK  554
             +TGS DPYVEV++GNYK
Sbjct  301  SITGSCDPYVEVKMGNYK  318



>ref|XP_011080250.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Sesamum indicum]
Length=770

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 57/75 (76%), Gaps = 3/75 (4%)
 Frame = +3

Query  339  MQR-PPQEDFMLKETKPHLGGGK--ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVT  509
            MQ+ P  E+F LK+T P + G    I GDK+   YDLVEQM+Y YVRVV+A++LP KDVT
Sbjct  1    MQKFPVPEEFALKQTAPKIAGSGVIIGGDKVVCAYDLVEQMEYFYVRVVRAKELPGKDVT  60

Query  510  GSLDPYVEVRLGNYK  554
            G+ DPYVEV+LGNYK
Sbjct  61   GTCDPYVEVKLGNYK  75



>ref|XP_006437049.1| hypothetical protein CICLE_v10033973mg [Citrus clementina]
 ref|XP_006485020.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Citrus sinensis]
 gb|ESR50289.1| hypothetical protein CICLE_v10033973mg [Citrus clementina]
Length=789

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 56/78 (72%), Gaps = 11/78 (14%)
 Frame = +3

Query  354  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  500
            QED+ LK+TKP LG           GG I+ ++ TSTYDLVEQM YLYVRV KARDLP  
Sbjct  10   QEDYKLKDTKPQLGERWPHGGIRGAGGWISSERATSTYDLVEQMFYLYVRVEKARDLPTN  69

Query  501  DVTGSLDPYVEVRLGNYK  554
             ++GS DPYVEV+LGNYK
Sbjct  70   PMSGSCDPYVEVKLGNYK  87



>ref|XP_008231338.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X4 [Prunus mume]
Length=1029

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 59/78 (76%), Gaps = 11/78 (14%)
 Frame = +3

Query  354  QEDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  500
            Q+D+ LK+T P LG         GG+  ++G++ TSTYDLVEQM YL+VRVVKA++LPP 
Sbjct  242  QDDYELKDTNPQLGERWPNGGAHGGRGWMSGERFTSTYDLVEQMFYLFVRVVKAKELPPS  301

Query  501  DVTGSLDPYVEVRLGNYK  554
             +TGS DPYVEV+LGNYK
Sbjct  302  SITGSCDPYVEVKLGNYK  319



>gb|EMT11702.1| hypothetical protein F775_07618 [Aegilops tauschii]
Length=773

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 54/73 (74%), Gaps = 3/73 (4%)
 Frame = +3

Query  345  RPPQ---EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  515
            +PPQ   ED+ LKE  P LGG    GDK TSTYDLVEQM YLYVR VKA+DL  KD +GS
Sbjct  2    QPPQPRPEDYTLKEITPRLGGFMAAGDKRTSTYDLVEQMPYLYVRAVKAKDLHAKDGSGS  61

Query  516  LDPYVEVRLGNYK  554
             DP VE++LGNY+
Sbjct  62   CDPSVEIKLGNYR  74



>ref|XP_008231334.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X1 [Prunus mume]
Length=1070

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 59/78 (76%), Gaps = 11/78 (14%)
 Frame = +3

Query  354  QEDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  500
            Q+D+ LK+T P LG         GG+  ++G++ TSTYDLVEQM YL+VRVVKA++LPP 
Sbjct  283  QDDYELKDTNPQLGERWPNGGAHGGRGWMSGERFTSTYDLVEQMFYLFVRVVKAKELPPS  342

Query  501  DVTGSLDPYVEVRLGNYK  554
             +TGS DPYVEV+LGNYK
Sbjct  343  SITGSCDPYVEVKLGNYK  360



>ref|XP_007220593.1| hypothetical protein PRUPE_ppa000616mg [Prunus persica]
 gb|EMJ21792.1| hypothetical protein PRUPE_ppa000616mg [Prunus persica]
Length=1070

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 59/78 (76%), Gaps = 11/78 (14%)
 Frame = +3

Query  354  QEDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  500
            Q+++ LK+T P LG         GG+  ++G++ TSTYDLVEQM YL+VRVVKA+DLPP 
Sbjct  283  QDEYELKDTNPQLGERWPNGGAHGGRGWMSGERFTSTYDLVEQMFYLFVRVVKAKDLPPS  342

Query  501  DVTGSLDPYVEVRLGNYK  554
             +TGS DPYVEV+LGNYK
Sbjct  343  SITGSCDPYVEVKLGNYK  360



>ref|XP_008231335.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X2 [Prunus mume]
Length=1054

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 59/78 (76%), Gaps = 11/78 (14%)
 Frame = +3

Query  354  QEDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  500
            Q+D+ LK+T P LG         GG+  ++G++ TSTYDLVEQM YL+VRVVKA++LPP 
Sbjct  267  QDDYELKDTNPQLGERWPNGGAHGGRGWMSGERFTSTYDLVEQMFYLFVRVVKAKELPPS  326

Query  501  DVTGSLDPYVEVRLGNYK  554
             +TGS DPYVEV+LGNYK
Sbjct  327  SITGSCDPYVEVKLGNYK  344



>ref|XP_007052573.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein [Theobroma cacao]
 gb|EOX96730.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein [Theobroma cacao]
Length=695

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 59/72 (82%), Gaps = 3/72 (4%)
 Frame = +3

Query  348  PPQE--DFMLKETKPHLGGGKITG-DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  518
            PP+E  DF LKETKP++GGG+++G  KLTS++DLVE+  +L+VRVVKARDLP  +   + 
Sbjct  2    PPEEEPDFSLKETKPNIGGGRVSGGAKLTSSFDLVEETHFLFVRVVKARDLPWNNARSTC  61

Query  519  DPYVEVRLGNYK  554
            DP+VE+++GNY+
Sbjct  62   DPFVEIKIGNYR  73



>ref|XP_008231337.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X3 [Prunus mume]
Length=1047

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 59/78 (76%), Gaps = 11/78 (14%)
 Frame = +3

Query  354  QEDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  500
            Q+D+ LK+T P LG         GG+  ++G++ TSTYDLVEQM YL+VRVVKA++LPP 
Sbjct  260  QDDYELKDTNPQLGERWPNGGAHGGRGWMSGERFTSTYDLVEQMFYLFVRVVKAKELPPS  319

Query  501  DVTGSLDPYVEVRLGNYK  554
             +TGS DPYVEV+LGNYK
Sbjct  320  SITGSCDPYVEVKLGNYK  337



>gb|EYU20710.1| hypothetical protein MIMGU_mgv1a023485mg [Erythranthe guttata]
Length=785

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 58/79 (73%), Gaps = 11/79 (14%)
 Frame = +3

Query  351  PQEDFMLKETKPHLG-----GGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPP  497
            PQ+D+ +KETKP LG     GG   G      +++TSTYDLVEQM YLYVRVVKA+DLP 
Sbjct  3    PQDDYKIKETKPQLGERWPHGGARGGLWWTGSERITSTYDLVEQMYYLYVRVVKAKDLPT  62

Query  498  KDVTGSLDPYVEVRLGNYK  554
              V+GS DPYVEV+LGNYK
Sbjct  63   NPVSGSCDPYVEVKLGNYK  81



>emb|CDY54062.1| BnaA02g36480D [Brassica napus]
Length=995

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 58/76 (76%), Gaps = 8/76 (11%)
 Frame = +3

Query  351  PQEDFMLKETKPHLGGGKITGDKL--------TSTYDLVEQMQYLYVRVVKARDLPPKDV  506
            P  DF +KET P LGGG+I G ++        +  YDLVE+M++L+VRVVKARDLP +D+
Sbjct  217  PPLDFSVKETSPFLGGGQIIGGRVVRGTKRPASGAYDLVEEMRFLFVRVVKARDLPDRDL  276

Query  507  TGSLDPYVEVRLGNYK  554
            TGSLDPYVEV++GN+K
Sbjct  277  TGSLDPYVEVKIGNFK  292



>emb|CDX81021.1| BnaC03g02750D [Brassica napus]
Length=287

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 55/78 (71%), Gaps = 11/78 (14%)
 Frame = +3

Query  354  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  500
            QED+ LK+ KP LG            G I+ +++ STYDLVEQM YLYVRVVKA+DLPP 
Sbjct  9    QEDYKLKDMKPDLGEKWPHGGQRGGSGWISSERVASTYDLVEQMFYLYVRVVKAKDLPPN  68

Query  501  DVTGSLDPYVEVRLGNYK  554
             VT + DPYVEV++GNYK
Sbjct  69   PVTSNCDPYVEVKIGNYK  86



>ref|XP_006850085.1| hypothetical protein AMTR_s00022p00218970 [Amborella trichopoda]
 gb|ERN11666.1| hypothetical protein AMTR_s00022p00218970 [Amborella trichopoda]
Length=1036

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 55/82 (67%), Gaps = 7/82 (9%)
 Frame = +3

Query  327  NNHKMQRPP------QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARD  488
            NN++   PP        DF LK T PHLG G  +  +  STYDLVEQM YLYVRVVKA+D
Sbjct  253  NNYQNIVPPPPGTHHHGDFGLKNTSPHLGTG-WSNREFASTYDLVEQMHYLYVRVVKAKD  311

Query  489  LPPKDVTGSLDPYVEVRLGNYK  554
            LP   VTGS DPY EV+LGNYK
Sbjct  312  LPASSVTGSCDPYAEVKLGNYK  333



>ref|XP_008368132.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 1-like [Malus domestica]
Length=1044

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 57/81 (70%), Gaps = 7/81 (9%)
 Frame = +3

Query  333  HKMQRPPQED--FMLKETKPHLG-----GGKITGDKLTSTYDLVEQMQYLYVRVVKARDL  491
            H  Q+ P+++  F L ET P L      G    GDK +STYDLVEQM +LYV VVKARDL
Sbjct  270  HMQQQAPRQNPEFALVETSPPLAARRYRGFGFGGDKTSSTYDLVEQMHFLYVSVVKARDL  329

Query  492  PPKDVTGSLDPYVEVRLGNYK  554
            P  DVTGSLDPYVEV+LGNYK
Sbjct  330  PTMDVTGSLDPYVEVKLGNYK  350



>ref|XP_004497937.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cicer arietinum]
Length=798

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 60/84 (71%), Gaps = 11/84 (13%)
 Frame = +3

Query  336  KMQRPPQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKA  482
            K  +P Q+D+ LK+TKP LG            G I  ++ TSTYDLVEQM YLYVRVVKA
Sbjct  6    KDSKPNQDDYKLKDTKPELGEKWPHGGQRGGTGWIYTERATSTYDLVEQMFYLYVRVVKA  65

Query  483  RDLPPKDVTGSLDPYVEVRLGNYK  554
            ++LPP  VTG++DPYVEV++GNYK
Sbjct  66   KELPPNPVTGNVDPYVEVKVGNYK  89



>gb|KDP43429.1| hypothetical protein JCGZ_16716 [Jatropha curcas]
Length=1030

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 59/89 (66%), Gaps = 15/89 (17%)
 Frame = +3

Query  333  HKMQRP----PQEDFMLKETKPHLG-----GGKITG------DKLTSTYDLVEQMQYLYV  467
            H + +P     Q+D+ LK+T P LG     GG   G      ++  STYDLVEQM YLYV
Sbjct  234  HSVNQPDHPSEQDDYSLKDTNPQLGERWPAGGAFGGRGWMNSERYASTYDLVEQMSYLYV  293

Query  468  RVVKARDLPPKDVTGSLDPYVEVRLGNYK  554
            RVVKA+DLPP  +TGS DPYVEV+LGNYK
Sbjct  294  RVVKAKDLPPSSITGSCDPYVEVKLGNYK  322



>ref|XP_008350856.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 2 [Malus domestica]
Length=1029

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 55/79 (70%), Gaps = 12/79 (15%)
 Frame = +3

Query  354  QEDFMLKETKPHLG------------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPP  497
            Q+D+ LK+T P LG            G    G++ TSTYDLVEQM YLYVRVVKA+DLPP
Sbjct  241  QDDYDLKDTSPQLGERWPNGGEYGGRGWMSGGERFTSTYDLVEQMFYLYVRVVKAKDLPP  300

Query  498  KDVTGSLDPYVEVRLGNYK  554
              +TGS DPYVEV+LGNYK
Sbjct  301  SSITGSCDPYVEVKLGNYK  319



>ref|XP_008383982.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Malus domestica]
Length=1011

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            DF LKET P+LGGG+      I GDK  STYDLVE+M +LYVRVVKAR+LP  DVTGSLD
Sbjct  238  DFALKETSPYLGGGRVVGGRVIHGDKTASTYDLVERMYFLYVRVVKARELPAMDVTGSLD  297

Query  522  PYVEVRLGNYK  554
            PYVEVR+GNY+
Sbjct  298  PYVEVRIGNYR  308



>ref|XP_009362439.1| PREDICTED: uncharacterized protein LOC103952559 [Pyrus x bretschneideri]
Length=1055

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 57/81 (70%), Gaps = 7/81 (9%)
 Frame = +3

Query  333  HKMQRPPQED--FMLKETKPHLG-----GGKITGDKLTSTYDLVEQMQYLYVRVVKARDL  491
            H  Q+ P+++  F L ET P L      G    GDK +STYDLVEQM +LYV VVKARDL
Sbjct  272  HMQQQAPRQNPEFALVETSPPLAARRYRGFGFGGDKTSSTYDLVEQMHFLYVSVVKARDL  331

Query  492  PPKDVTGSLDPYVEVRLGNYK  554
            P  DVTGSLDPYVEV+LGNY+
Sbjct  332  PAMDVTGSLDPYVEVKLGNYR  352



>ref|XP_009339918.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Pyrus x bretschneideri]
Length=1011

 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            DF LKET P+LGGG+      I GDK  STYDLVE+M +LYVRVVKAR+LP  DVTGSLD
Sbjct  238  DFALKETSPYLGGGRVVGGRVIHGDKTASTYDLVERMYFLYVRVVKARELPAMDVTGSLD  297

Query  522  PYVEVRLGNYK  554
            PYVEVR+GNY+
Sbjct  298  PYVEVRIGNYR  308



>ref|XP_006304546.1| hypothetical protein CARUB_v10011531mg [Capsella rubella]
 gb|EOA37444.1| hypothetical protein CARUB_v10011531mg [Capsella rubella]
Length=1027

 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 57/81 (70%), Gaps = 8/81 (10%)
 Frame = +3

Query  336  KMQRPPQE-DFMLKETKPHLGGG-------KITGDKLTSTYDLVEQMQYLYVRVVKARDL  491
            +MQ P Q  DF L ET P L          + +GDK +STYDLVEQM YLYV VVKARDL
Sbjct  245  QMQPPRQNPDFQLIETSPPLAARMRQSYYYRSSGDKTSSTYDLVEQMHYLYVSVVKARDL  304

Query  492  PPKDVTGSLDPYVEVRLGNYK  554
            P  DV+GSLDPYVEV+LGNYK
Sbjct  305  PVMDVSGSLDPYVEVKLGNYK  325



>ref|XP_008378754.1| PREDICTED: uncharacterized protein LOC103441820 [Malus domestica]
Length=1036

 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 55/77 (71%), Gaps = 5/77 (6%)
 Frame = +3

Query  333  HKMQRPPQEDFMLKETKPHLGGGK---ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKD  503
            H  Q+ P+  F L ET P L   +     GDK +STYDLVEQM YLYV VVKARDLP  D
Sbjct  260  HMQQQNPE--FSLVETDPPLAARRYRGFGGDKTSSTYDLVEQMHYLYVSVVKARDLPTMD  317

Query  504  VTGSLDPYVEVRLGNYK  554
            VTGSLDPYVEV+LGNYK
Sbjct  318  VTGSLDPYVEVKLGNYK  334



>ref|XP_006598248.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Glycine max]
Length=810

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 8/74 (11%)
 Frame = +3

Query  357  EDFMLKETKPHLGG--------GKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  512
            ED+ L+ET P LGG        G I G++ +STYDLVEQM YLYVRVVKA+DL P  +T 
Sbjct  29   EDYNLRETDPQLGGDRWPNARRGWIGGERFSSTYDLVEQMFYLYVRVVKAKDLSPSTLTS  88

Query  513  SLDPYVEVRLGNYK  554
            S DPYVEV+LGNYK
Sbjct  89   SCDPYVEVKLGNYK  102



>gb|KHN49030.1| Putative Ras GTPase-activating protein 4B [Glycine soja]
Length=796

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 8/74 (11%)
 Frame = +3

Query  357  EDFMLKETKPHLGG--------GKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  512
            ED+ L+ET P LGG        G I G++ +STYDLVEQM YLYVRVVKA+DL P  +T 
Sbjct  15   EDYNLRETDPQLGGDRWPNARRGWIGGERFSSTYDLVEQMFYLYVRVVKAKDLSPSTLTS  74

Query  513  SLDPYVEVRLGNYK  554
            S DPYVEV+LGNYK
Sbjct  75   SCDPYVEVKLGNYK  88



>ref|XP_003518076.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Glycine max]
 gb|KHM98983.1| Multiple C2 and transmembrane domain-containing protein 1 [Glycine 
soja]
Length=796

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 56/78 (72%), Gaps = 11/78 (14%)
 Frame = +3

Query  354  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  500
            QED+ LK+TKP LG            G I  ++ TSTYDLVEQM YLYVRVVKA+DLPP 
Sbjct  12   QEDYKLKDTKPELGEKWPHGGQRGGSGWIYNERATSTYDLVEQMFYLYVRVVKAKDLPPN  71

Query  501  DVTGSLDPYVEVRLGNYK  554
             VT ++DPYVEV++GNYK
Sbjct  72   PVTSNVDPYVEVKVGNYK  89



>ref|XP_004150160.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cucumis sativus]
 ref|XP_004154715.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cucumis sativus]
 gb|KGN53830.1| hypothetical protein Csa_4G153810 [Cucumis sativus]
Length=789

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 58/78 (74%), Gaps = 11/78 (14%)
 Frame = +3

Query  354  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  500
            + D+ LK+TKP+LG           GG IT ++ TSTYDLVEQM YLYVRVVKA+DLPP 
Sbjct  10   EADYKLKDTKPNLGERWPHGGIRGGGGWITSERATSTYDLVEQMFYLYVRVVKAKDLPPD  69

Query  501  DVTGSLDPYVEVRLGNYK  554
             VTGS DPYVEV+LGNYK
Sbjct  70   PVTGSCDPYVEVKLGNYK  87



>ref|XP_008460787.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 isoform X1 [Cucumis melo]
Length=789

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 58/78 (74%), Gaps = 11/78 (14%)
 Frame = +3

Query  354  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  500
            + D+ LK+TKP+LG           GG IT ++ TSTYDLVEQM YLYVRVVKA+DLPP 
Sbjct  10   EADYKLKDTKPNLGERWPHGGIRGGGGWITSERATSTYDLVEQMFYLYVRVVKAKDLPPD  69

Query  501  DVTGSLDPYVEVRLGNYK  554
             VTGS DPYVEV+LGNYK
Sbjct  70   PVTGSCDPYVEVKLGNYK  87



>ref|XP_010672799.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010672802.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Beta vulgaris subsp. vulgaris]
Length=1007

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            DF LKET P+LGGG+      +  DK  STYDLVE+MQ+LYVRVVKARDLP  D+TGSLD
Sbjct  233  DFALKETSPYLGGGRVVGGRIVHADKTASTYDLVERMQFLYVRVVKARDLPNMDLTGSLD  292

Query  522  PYVEVRLGNYK  554
            P+VEVR+GNYK
Sbjct  293  PFVEVRVGNYK  303



>ref|XP_008460789.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 isoform X2 [Cucumis melo]
Length=724

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 58/78 (74%), Gaps = 11/78 (14%)
 Frame = +3

Query  354  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  500
            + D+ LK+TKP+LG           GG IT ++ TSTYDLVEQM YLYVRVVKA+DLPP 
Sbjct  10   EADYKLKDTKPNLGERWPHGGIRGGGGWITSERATSTYDLVEQMFYLYVRVVKAKDLPPD  69

Query  501  DVTGSLDPYVEVRLGNYK  554
             VTGS DPYVEV+LGNYK
Sbjct  70   PVTGSCDPYVEVKLGNYK  87



>ref|XP_010273065.1| PREDICTED: uncharacterized protein LOC104608707 [Nelumbo nucifera]
Length=1009

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 59/71 (83%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            D+ LKET P LGGG+      I  DKL+STYDLVE+MQ+L+VRVVKAR+LP KD+TGSLD
Sbjct  236  DYALKETSPFLGGGQVVGGRVIRVDKLSSTYDLVEKMQFLFVRVVKARELPAKDITGSLD  295

Query  522  PYVEVRLGNYK  554
            PYVEV++GNYK
Sbjct  296  PYVEVKVGNYK  306



>gb|EPS70383.1| hypothetical protein M569_04376, partial [Genlisea aurea]
Length=780

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 54/77 (70%), Gaps = 12/77 (16%)
 Frame = +3

Query  360  DFMLKETKPHLG-----------GGKI-TGDKLTSTYDLVEQMQYLYVRVVKARDLPPKD  503
            D+ +K+TKP LG            G I  GD+ TSTYDLVEQM YLYVRVVKARDLPP  
Sbjct  1    DYSVKDTKPELGEKWPHGGIRGGAGWIPVGDRATSTYDLVEQMHYLYVRVVKARDLPPSP  60

Query  504  VTGSLDPYVEVRLGNYK  554
            VTGS DPY EV+LGNY+
Sbjct  61   VTGSCDPYAEVKLGNYR  77



>ref|XP_007145658.1| hypothetical protein PHAVU_007G257600g [Phaseolus vulgaris]
 gb|ESW17652.1| hypothetical protein PHAVU_007G257600g [Phaseolus vulgaris]
Length=796

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 56/78 (72%), Gaps = 11/78 (14%)
 Frame = +3

Query  354  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  500
            QED+ LK+TKP LG            G +  ++ TSTYDLVEQM YLYVRVVKA+DLPP 
Sbjct  11   QEDYKLKDTKPDLGERWPHGGQRGGSGWLYSERATSTYDLVEQMFYLYVRVVKAKDLPPN  70

Query  501  DVTGSLDPYVEVRLGNYK  554
             VT +LDPYVEV++GNYK
Sbjct  71   PVTSNLDPYVEVKVGNYK  88



>ref|XP_007225292.1| hypothetical protein PRUPE_ppa001339mg [Prunus persica]
 gb|EMJ26491.1| hypothetical protein PRUPE_ppa001339mg [Prunus persica]
Length=850

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 55/79 (70%), Gaps = 5/79 (6%)
 Frame = +3

Query  333  HKMQRPPQE-DFMLKETKPHLGGG----KITGDKLTSTYDLVEQMQYLYVRVVKARDLPP  497
            H  Q P Q  +F L ET P L        I GDK +STYDLVEQM +LYV VVKARDLP 
Sbjct  71   HMQQVPRQNPEFALVETSPPLAARLRYRGIGGDKTSSTYDLVEQMHFLYVSVVKARDLPT  130

Query  498  KDVTGSLDPYVEVRLGNYK  554
             DV+GSLDPYVEV+LGNYK
Sbjct  131  MDVSGSLDPYVEVKLGNYK  149



>gb|KHN15528.1| Multiple C2 and transmembrane domain-containing protein 1 [Glycine 
soja]
Length=797

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 56/78 (72%), Gaps = 11/78 (14%)
 Frame = +3

Query  354  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  500
            QED+ LK+TKP LG            G I  ++ TSTYD+VEQM YLYVRVVKA+DLPP 
Sbjct  12   QEDYKLKDTKPELGEKWPHGGQRGGSGWIYSERATSTYDMVEQMFYLYVRVVKAKDLPPN  71

Query  501  DVTGSLDPYVEVRLGNYK  554
             VT ++DPYVEV++GNYK
Sbjct  72   PVTSNVDPYVEVKVGNYK  89



>ref|XP_009354691.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Pyrus x bretschneideri]
Length=1051

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 54/79 (68%), Gaps = 12/79 (15%)
 Frame = +3

Query  354  QEDFMLKETKPHLG------------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPP  497
            Q D+ LK+T P LG            G    G++ TSTYDLVEQM YLYVRVVKA+DLPP
Sbjct  263  QGDYELKDTSPQLGERWPNGGAYGGRGWMSGGERFTSTYDLVEQMFYLYVRVVKAKDLPP  322

Query  498  KDVTGSLDPYVEVRLGNYK  554
              +TGS DPYVEV+LGNYK
Sbjct  323  SSITGSCDPYVEVKLGNYK  341



>ref|XP_003537180.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Glycine max]
Length=797

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 56/78 (72%), Gaps = 11/78 (14%)
 Frame = +3

Query  354  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  500
            QED+ LK+TKP LG            G I  ++ TSTYD+VEQM YLYVRVVKA+DLPP 
Sbjct  12   QEDYKLKDTKPELGEKWPHGGQRGGSGWIYSERATSTYDMVEQMFYLYVRVVKAKDLPPN  71

Query  501  DVTGSLDPYVEVRLGNYK  554
             VT ++DPYVEV++GNYK
Sbjct  72   PVTSNVDPYVEVKVGNYK  89



>gb|KDP35107.1| hypothetical protein JCGZ_10949 [Jatropha curcas]
Length=1044

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 57/76 (75%), Gaps = 3/76 (4%)
 Frame = +3

Query  336  KMQRPPQE-DFMLKETKPHLGGGKI--TGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDV  506
            +MQ P Q  +F+L ET+P +        GDK +STYDLVEQM YLYV VVKARDLP  DV
Sbjct  270  RMQMPMQNPEFLLVETRPPVAARMRYRGGDKTSSTYDLVEQMHYLYVSVVKARDLPVMDV  329

Query  507  TGSLDPYVEVRLGNYK  554
            TGS+DPYVEV+LGNYK
Sbjct  330  TGSVDPYVEVKLGNYK  345



>ref|XP_008238857.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Prunus mume]
 ref|XP_008238858.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Prunus mume]
 ref|XP_008238859.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Prunus mume]
 ref|XP_008238860.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Prunus mume]
Length=1005

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 6/71 (8%)
 Frame = +3

Query  360  DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  521
            DF LKET P+LGGG+      I GDK  STYDLVE+M +LYVRVVKAR+LP  DVTGSLD
Sbjct  233  DFALKETSPYLGGGRVVGGRVIHGDKTASTYDLVERMYFLYVRVVKARELPAMDVTGSLD  292

Query  522  PYVEVRLGNYK  554
            P+VEVR+GNY+
Sbjct  293  PFVEVRIGNYR  303



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 617525281800