BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF007J18

Length=573
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO51842.1|  UDP-glycosyltransferase 85A32                          295   2e-94   Ipomoea batatas [batate]
ref|XP_006360268.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       287   2e-91   Solanum tuberosum [potatoes]
ref|XP_009775754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    285   1e-90   Nicotiana sylvestris
ref|XP_004252531.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    285   2e-90   Solanum lycopersicum
ref|XP_009590778.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    285   2e-90   Nicotiana tomentosiformis
dbj|BAD93690.1|  glycosyltransferase                                    285   2e-90   Nicotiana tabacum [American tobacco]
dbj|BAG80542.1|  glycosyltransferase                                    281   3e-89   Lycium barbarum [Duke of Argyll's teatree]
gb|ADG65641.1|  glycosyltransferase                                     281   5e-89   Withania somnifera [ashwagandha]
ref|XP_006473006.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       272   9e-89   Citrus sinensis [apfelsine]
ref|XP_009612691.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    279   2e-88   Nicotiana tomentosiformis
ref|XP_004252533.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    279   2e-88   Solanum lycopersicum
ref|XP_006433961.1|  hypothetical protein CICLE_v10000958mg             274   4e-86   Citrus clementina [clementine]
ref|XP_007018744.1|  UDP-glucosyl transferase 85A2                      273   1e-85   
emb|CDP01076.1|  unnamed protein product                                272   2e-85   Coffea canephora [robusta coffee]
ref|XP_002513939.1|  UDP-glucuronosyltransferase, putative              268   4e-85   
ref|XP_004252532.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    271   4e-85   Solanum lycopersicum
ref|XP_009612740.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    269   3e-84   Nicotiana tomentosiformis
ref|XP_004237928.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    268   7e-84   Solanum lycopersicum
sp|F8WLS6.1|UGT6_CATRO  RecName: Full=7-deoxyloganetin glucosyltr...    267   1e-83   Catharanthus roseus [chatas]
ref|XP_009791953.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    266   2e-83   Nicotiana sylvestris
ref|NP_001277170.1|  UDP-glycosyltransferase 85A2-like                  266   4e-83   Vitis vinifera
ref|XP_006363269.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       265   8e-83   Solanum tuberosum [potatoes]
gb|KJB59011.1|  hypothetical protein B456_009G235700                    265   1e-82   Gossypium raimondii
sp|F8WKW1.1|UGT2_GARJA  RecName: Full=7-deoxyloganetin glucosyltr...    263   3e-82   Gardenia jasminoides
ref|XP_006363270.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       263   4e-82   Solanum tuberosum [potatoes]
ref|XP_011069754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    263   8e-82   
emb|CDP21827.1|  unnamed protein product                                259   1e-81   Coffea canephora [robusta coffee]
gb|KCW45339.1|  hypothetical protein EUGRSUZ_L009911                    251   2e-81   Eucalyptus grandis [rose gum]
ref|XP_004237929.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    261   3e-81   Solanum lycopersicum
emb|CDP01078.1|  unnamed protein product                                261   3e-81   Coffea canephora [robusta coffee]
ref|XP_010248035.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    260   5e-81   Nelumbo nucifera [Indian lotus]
ref|XP_007042920.1|  UDP-glucosyl transferase 85A2                      261   6e-81   
ref|XP_002513938.1|  UDP-glucuronosyltransferase, putative              259   8e-81   Ricinus communis
gb|AIL51400.1|  glycosyltransferase                                     259   9e-81   Actinidia deliciosa [Chinese gooseberry]
ref|XP_004299647.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    258   4e-80   Fragaria vesca subsp. vesca
ref|XP_011016634.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    258   5e-80   Populus euphratica
ref|XP_008466222.1|  PREDICTED: UDP-glycosyltransferase 85A2            258   6e-80   Cucumis melo [Oriental melon]
ref|XP_004237927.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    258   7e-80   Solanum lycopersicum
gb|EYU19971.1|  hypothetical protein MIMGU_mgv1a024760mg                256   3e-79   Erythranthe guttata [common monkey flower]
ref|XP_010060016.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    254   9e-79   Eucalyptus grandis [rose gum]
gb|AID16086.1|  flavonol-3-O-glucoside L-rhamnosyltransferase           253   1e-78   Morus alba
gb|EYU19972.1|  hypothetical protein MIMGU_mgv1a018325mg                252   1e-78   Erythranthe guttata [common monkey flower]
ref|XP_010534080.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       254   1e-78   Tarenaya hassleriana [spider flower]
emb|CDO97426.1|  unnamed protein product                                254   1e-78   Coffea canephora [robusta coffee]
gb|ACU19718.1|  unknown                                                 246   2e-78   Glycine max [soybeans]
ref|XP_010060020.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    254   2e-78   Eucalyptus grandis [rose gum]
ref|XP_010060023.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    254   2e-78   Eucalyptus grandis [rose gum]
ref|XP_008219317.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       253   3e-78   Prunus mume [ume]
ref|XP_010040274.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    253   3e-78   Eucalyptus grandis [rose gum]
ref|XP_004299648.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    253   3e-78   Fragaria vesca subsp. vesca
gb|KDP41399.1|  hypothetical protein JCGZ_15806                         253   3e-78   Jatropha curcas
ref|XP_002302305.1|  UDP-glucuronosyltransferase family protein         253   4e-78   Populus trichocarpa [western balsam poplar]
ref|XP_004237926.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    253   4e-78   Solanum lycopersicum
ref|XP_002285767.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    253   4e-78   Vitis vinifera
ref|XP_008219318.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       253   5e-78   Prunus mume [ume]
ref|XP_006363268.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       253   6e-78   
gb|KCW66556.1|  hypothetical protein EUGRSUZ_F00355                     251   6e-78   Eucalyptus grandis [rose gum]
ref|XP_004136284.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       252   7e-78   Cucumis sativus [cucumbers]
ref|XP_009391314.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    251   1e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009592743.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    251   2e-77   Nicotiana tomentosiformis
gb|EYU19973.1|  hypothetical protein MIMGU_mgv1a005383mg                251   3e-77   Erythranthe guttata [common monkey flower]
gb|KDP41397.1|  hypothetical protein JCGZ_15804                         251   3e-77   Jatropha curcas
ref|XP_002285771.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    250   3e-77   Vitis vinifera
gb|KCW66541.1|  hypothetical protein EUGRSUZ_F00338                     250   3e-77   Eucalyptus grandis [rose gum]
ref|XP_010060017.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    251   3e-77   Eucalyptus grandis [rose gum]
dbj|BAG80547.1|  glycosyltransferase                                    250   5e-77   Lycium barbarum [Duke of Argyll's teatree]
gb|KCW66553.1|  hypothetical protein EUGRSUZ_F00351                     249   6e-77   Eucalyptus grandis [rose gum]
ref|XP_002513937.1|  UDP-glucuronosyltransferase, putative              250   6e-77   Ricinus communis
ref|XP_010273031.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    249   7e-77   Nelumbo nucifera [Indian lotus]
ref|XP_010647463.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    246   8e-77   Vitis vinifera
gb|KCW66555.1|  hypothetical protein EUGRSUZ_F00353                     249   1e-76   Eucalyptus grandis [rose gum]
ref|XP_010060024.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    249   1e-76   Eucalyptus grandis [rose gum]
ref|XP_003526577.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       249   1e-76   
ref|XP_008219313.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       249   1e-76   Prunus mume [ume]
ref|XP_003542333.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       249   1e-76   Glycine max [soybeans]
ref|XP_002285778.2|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    249   2e-76   
ref|XP_007224069.1|  hypothetical protein PRUPE_ppa015357mg             248   3e-76   Prunus persica
gb|AFK34769.1|  unknown                                                 248   4e-76   Lotus japonicus
emb|CBI23550.3|  unnamed protein product                                246   4e-76   Vitis vinifera
ref|XP_007227225.1|  hypothetical protein PRUPE_ppa018697mg             248   4e-76   Prunus persica
ref|XP_006416206.1|  hypothetical protein EUTSA_v100074991mg            237   6e-76   
emb|CAN65645.1|  hypothetical protein VITISV_012510                     249   8e-76   Vitis vinifera
ref|XP_010060018.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    247   1e-75   Eucalyptus grandis [rose gum]
ref|XP_003544800.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       246   1e-75   Glycine max [soybeans]
gb|KHN42553.1|  UDP-glycosyltransferase 85A2                            246   1e-75   Glycine soja [wild soybean]
emb|CBI19181.3|  unnamed protein product                                251   1e-75   Vitis vinifera
ref|XP_007222804.1|  hypothetical protein PRUPE_ppa005043mg             246   1e-75   Prunus persica
gb|KCW66549.1|  hypothetical protein EUGRSUZ_F003461                    236   2e-75   Eucalyptus grandis [rose gum]
ref|XP_002301060.1|  hypothetical protein POPTR_0002s09850g             246   2e-75   
ref|XP_003635298.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    245   3e-75   Vitis vinifera
dbj|BAO51844.1|  UDP-glycosyltransferase 85A28                          245   3e-75   Vitis vinifera
emb|CBI34065.3|  unnamed protein product                                236   3e-75   Vitis vinifera
ref|XP_008343335.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       235   4e-75   
ref|XP_010056398.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    245   4e-75   Eucalyptus grandis [rose gum]
ref|XP_010056400.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    244   6e-75   Eucalyptus grandis [rose gum]
ref|XP_011016624.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    245   7e-75   Populus euphratica
ref|XP_010064217.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    244   8e-75   Eucalyptus grandis [rose gum]
ref|XP_002285770.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    244   9e-75   Vitis vinifera
ref|XP_011092429.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    243   1e-74   Sesamum indicum [beniseed]
gb|ABW96222.1|  glucosyltransferase                                     244   2e-74   Linum usitatissimum
gb|KJB79644.1|  hypothetical protein B456_013G060400                    243   2e-74   Gossypium raimondii
gb|KFK44335.1|  hypothetical protein AALP_AA1G244700                    243   2e-74   Arabis alpina [alpine rockcress]
gb|KJB79650.1|  hypothetical protein B456_013G060700                    243   2e-74   Gossypium raimondii
ref|XP_008219315.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       243   3e-74   
ref|XP_007141200.1|  hypothetical protein PHAVU_008G175500g             243   3e-74   Phaseolus vulgaris [French bean]
ref|XP_010477496.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       243   4e-74   Camelina sativa [gold-of-pleasure]
gb|AID16084.1|  flavonoid 3-O-glucosyltransferase                       238   5e-74   Morus alba
gb|KFK44329.1|  hypothetical protein AALP_AA1G244100                    242   5e-74   Arabis alpina [alpine rockcress]
gb|EYU43443.1|  hypothetical protein MIMGU_mgv1a018722mg                242   5e-74   Erythranthe guttata [common monkey flower]
gb|KCW73112.1|  hypothetical protein EUGRSUZ_E01563                     234   6e-74   Eucalyptus grandis [rose gum]
ref|XP_010477495.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       242   8e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010056397.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    241   1e-73   Eucalyptus grandis [rose gum]
gb|AFJ52992.1|  UDP-glycosyltransferase 1                               241   2e-73   Linum usitatissimum
ref|XP_006373048.1|  hypothetical protein POPTR_0017s079102g            231   2e-73   
ref|XP_010459988.1|  PREDICTED: UDP-glycosyltransferase 85A2            241   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_009145352.1|  PREDICTED: UDP-glycosyltransferase 85A7 isof...    239   2e-73   Brassica rapa
gb|KEH28097.1|  UDP-glucosyltransferase family protein                  241   2e-73   Medicago truncatula
ref|XP_008808008.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       240   2e-73   Phoenix dactylifera
ref|XP_008219322.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       241   2e-73   Prunus mume [ume]
emb|CDP01079.1|  unnamed protein product                                240   2e-73   Coffea canephora [robusta coffee]
ref|XP_009341756.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    241   2e-73   Pyrus x bretschneideri [bai li]
emb|CDP01087.1|  unnamed protein product                                240   2e-73   Coffea canephora [robusta coffee]
ref|XP_002285779.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    240   2e-73   Vitis vinifera
ref|XP_010498706.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       240   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_002323758.2|  hypothetical protein POPTR_0017s07930g             240   3e-73   
ref|XP_010676160.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    240   4e-73   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010060021.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    240   4e-73   
emb|CDY46643.1|  BnaA07g10530D                                          240   4e-73   Brassica napus [oilseed rape]
gb|KCW73111.1|  hypothetical protein EUGRSUZ_E01562                     238   4e-73   Eucalyptus grandis [rose gum]
ref|XP_009103242.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       240   4e-73   Brassica rapa
gb|KFK44331.1|  hypothetical protein AALP_AA1G244300                    239   5e-73   Arabis alpina [alpine rockcress]
ref|XP_007047909.1|  UDP-glucosyl transferase 85A2                      239   5e-73   Theobroma cacao [chocolate]
ref|XP_002532877.1|  UDP-glucuronosyltransferase, putative              239   5e-73   
ref|XP_010937416.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    239   6e-73   Elaeis guineensis
ref|XP_006307682.1|  hypothetical protein CARUB_v10009316mg             237   6e-73   
ref|XP_009145349.1|  PREDICTED: UDP-glycosyltransferase 85A7 isof...    239   6e-73   Brassica rapa
gb|ABK95289.1|  unknown                                                 239   6e-73   Populus trichocarpa [western balsam poplar]
ref|XP_008234165.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       239   6e-73   Prunus mume [ume]
ref|XP_011009481.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    239   7e-73   Populus euphratica
gb|KJB79645.1|  hypothetical protein B456_013G060500                    239   7e-73   Gossypium raimondii
gb|KFK44336.1|  hypothetical protein AALP_AA1G244800                    239   8e-73   Arabis alpina [alpine rockcress]
ref|XP_002885822.1|  hypothetical protein ARALYDRAFT_319356             239   8e-73   
gb|KFK44333.1|  hypothetical protein AALP_AA1G244500                    239   9e-73   Arabis alpina [alpine rockcress]
dbj|BAH56949.1|  AT1G22360                                              237   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973885.1|  UDP-glucosyl transferase 85A5                         238   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006433960.1|  hypothetical protein CICLE_v10000925mg             239   1e-72   Citrus clementina [clementine]
gb|AHL38933.1|  glycosyltransferase                                     238   1e-72   Arabidopsis thaliana [mouse-ear cress]
dbj|BAO51839.1|  UDP-glycosyltransferase 85A34                          239   1e-72   Humulus lupulus [common hop]
ref|NP_173653.1|  UDP-glucosyl transferase 85A2                         238   1e-72   Arabidopsis thaliana [mouse-ear cress]
gb|AAL32657.1|  UDP-glucose glucosyltransferase                         238   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001277168.1|  UDP-glycosyltransferase 85A2-like                  238   1e-72   Vitis vinifera
gb|AAV32497.1|  UDP-glucuronosyltransferase                             238   1e-72   Arabidopsis thaliana [mouse-ear cress]
dbj|BAO51841.1|  UDP-glycosyltransferase 85A35                          238   1e-72   Humulus lupulus [common hop]
ref|XP_010039826.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    228   2e-72   Eucalyptus grandis [rose gum]
ref|NP_001031078.1|  UDP-glucosyl transferase 85A2                      238   2e-72   Arabidopsis thaliana [mouse-ear cress]
gb|KCW45697.1|  hypothetical protein EUGRSUZ_L00500                     228   2e-72   Eucalyptus grandis [rose gum]
ref|XP_003544213.2|  PREDICTED: UDP-glycosyltransferase 85A2-like       238   2e-72   Glycine max [soybeans]
ref|XP_003544799.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       238   3e-72   Glycine max [soybeans]
ref|XP_007208223.1|  hypothetical protein PRUPE_ppa018343mg             238   3e-72   Prunus persica
emb|CDY21359.1|  BnaA09g30680D                                          236   3e-72   Brassica napus [oilseed rape]
ref|XP_009341754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    238   4e-72   Pyrus x bretschneideri [bai li]
ref|XP_010498707.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       237   4e-72   Camelina sativa [gold-of-pleasure]
dbj|BAO51840.1|  UDP-glycosyltransferase 85K12                          237   4e-72   Humulus lupulus [common hop]
ref|XP_010060022.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    238   4e-72   Eucalyptus grandis [rose gum]
ref|XP_009145346.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    237   4e-72   Brassica rapa
ref|XP_009145347.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    237   4e-72   Brassica rapa
gb|KHN24339.1|  UDP-glycosyltransferase 85A2                            237   5e-72   Glycine soja [wild soybean]
gb|KCW44218.1|  hypothetical protein EUGRSUZ_L023572                    227   5e-72   Eucalyptus grandis [rose gum]
ref|XP_009145345.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    237   5e-72   Brassica rapa
ref|XP_004299646.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    237   5e-72   Fragaria vesca subsp. vesca
ref|XP_002306303.2|  hypothetical protein POPTR_0005s07500g             237   5e-72   
dbj|BAO51838.1|  UDP-glycosyltransferase 85A36                          237   6e-72   Humulus lupulus [common hop]
ref|XP_002893224.1|  UDP-glucosyl transferase 85A1                      237   7e-72   
gb|ADV71371.1|  glycosyltransferase GT14M03                             236   7e-72   Pueraria montana var. lobata [kudzu]
ref|XP_008359320.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       236   8e-72   
ref|XP_008219314.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       227   8e-72   
ref|XP_007207648.1|  hypothetical protein PRUPE_ppa021414mg             236   9e-72   Prunus persica
gb|KFK44334.1|  hypothetical protein AALP_AA1G244600                    236   1e-71   Arabis alpina [alpine rockcress]
ref|XP_008219319.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       236   1e-71   Prunus mume [ume]
ref|XP_006351765.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       236   1e-71   Solanum tuberosum [potatoes]
gb|AAV32498.1|  UDP-glucuronosyltransferase                             234   2e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307366.1|  hypothetical protein CARUB_v10008992mg             236   2e-71   Capsella rubella
emb|CDP01073.1|  unnamed protein product                                236   2e-71   Coffea canephora [robusta coffee]
ref|XP_009598263.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    226   2e-71   Nicotiana tomentosiformis
ref|XP_010040275.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    236   2e-71   
ref|XP_007207189.1|  hypothetical protein PRUPE_ppa017055mg             235   2e-71   Prunus persica
ref|XP_006472584.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       236   2e-71   Citrus sinensis [apfelsine]
ref|XP_011465456.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    235   2e-71   Fragaria vesca subsp. vesca
gb|AAF87258.1|AC068562_5  Strong similarity to UDP-glucose glucos...    234   2e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010087621.1|  UDP-glycosyltransferase 85A1                       236   2e-71   
ref|XP_006303659.1|  hypothetical protein CARUB_v10011698mg             235   2e-71   Capsella rubella
ref|XP_007222658.1|  hypothetical protein PRUPE_ppa004956mg             235   2e-71   Prunus persica
ref|XP_006304665.1|  hypothetical protein CARUB_v10011877mg             235   3e-71   Capsella rubella
ref|XP_010098615.1|  UDP-glycosyltransferase 85A1                       235   3e-71   Morus notabilis
ref|XP_010039907.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    235   3e-71   Eucalyptus grandis [rose gum]
gb|KHN24338.1|  UDP-glycosyltransferase 85A3                            234   3e-71   Glycine soja [wild soybean]
ref|XP_007222427.1|  hypothetical protein PRUPE_ppa004909mg             235   3e-71   Prunus persica
gb|KCW73113.1|  hypothetical protein EUGRSUZ_E01564                     233   3e-71   Eucalyptus grandis [rose gum]
ref|XP_002268845.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    234   4e-71   Vitis vinifera
gb|KEH17174.1|  UDP-glucosyltransferase family protein                  234   4e-71   Medicago truncatula
gb|ACJ84649.1|  unknown                                                 234   5e-71   Medicago truncatula
gb|AFK33787.1|  unknown                                                 234   5e-71   Medicago truncatula
ref|XP_003615138.1|  Cytokinin-O-glucosyltransferase                    234   5e-71   Medicago truncatula
emb|CDP01072.1|  unnamed protein product                                232   5e-71   Coffea canephora [robusta coffee]
emb|CDY46645.1|  BnaA07g10510D                                          234   5e-71   Brassica napus [oilseed rape]
emb|CDY46644.1|  BnaA07g10520D                                          229   5e-71   Brassica napus [oilseed rape]
emb|CDY38225.1|  BnaC05g17420D                                          234   6e-71   Brassica napus [oilseed rape]
ref|XP_006416205.1|  hypothetical protein EUTSA_v10007502mg             234   6e-71   Eutrema salsugineum [saltwater cress]
gb|AFK37311.1|  unknown                                                 234   6e-71   Medicago truncatula
ref|XP_008219456.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       234   7e-71   Prunus mume [ume]
ref|XP_006472583.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       234   7e-71   Citrus sinensis [apfelsine]
ref|XP_002893221.1|  UDP-glycosyltransferase                            234   7e-71   
ref|XP_009387949.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       227   8e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011031049.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    234   8e-71   Populus euphratica
ref|XP_011031048.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    234   8e-71   Populus euphratica
ref|XP_006433964.1|  hypothetical protein CICLE_v10004031mg             236   8e-71   
emb|CDP01082.1|  unnamed protein product                                238   9e-71   Coffea canephora [robusta coffee]
ref|XP_006304493.1|  hypothetical protein CARUB_v10011262mg             234   9e-71   Capsella rubella
ref|XP_006388803.1|  hypothetical protein POPTR_0098s003001g            224   1e-70   
ref|XP_007226586.1|  hypothetical protein PRUPE_ppa023851mg             233   1e-70   
ref|XP_010035387.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    233   1e-70   Eucalyptus grandis [rose gum]
ref|XP_002298702.2|  hypothetical protein POPTR_0001s32000g             233   1e-70   Populus trichocarpa [western balsam poplar]
ref|XP_010267412.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    233   1e-70   Nelumbo nucifera [Indian lotus]
ref|XP_006416203.1|  hypothetical protein EUTSA_v10009957mg             239   2e-70   
ref|XP_003544801.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       233   2e-70   Glycine max [soybeans]
ref|XP_010459992.1|  PREDICTED: UDP-glycosyltransferase 85A5            233   3e-70   Camelina sativa [gold-of-pleasure]
ref|XP_009103240.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       233   3e-70   Brassica rapa
ref|XP_010535401.1|  PREDICTED: UDP-glycosyltransferase 85A1-like...    233   3e-70   Tarenaya hassleriana [spider flower]
emb|CDP01479.1|  unnamed protein product                                231   4e-70   Coffea canephora [robusta coffee]
ref|XP_009413654.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    225   4e-70   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY41486.1|  BnaA08g20880D                                          232   4e-70   Brassica napus [oilseed rape]
emb|CDX91674.1|  BnaC08g05930D                                          231   6e-70   
ref|XP_008234175.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       231   7e-70   Prunus mume [ume]
ref|XP_008386313.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       231   8e-70   
ref|XP_002263158.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    231   8e-70   Vitis vinifera
emb|CDO97432.1|  unnamed protein product                                231   1e-69   Coffea canephora [robusta coffee]
ref|XP_007199087.1|  hypothetical protein PRUPE_ppa018904mg             221   1e-69   
ref|NP_173656.1|  UDP-glycosyltransferase 85A1                          231   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009380209.1|  PREDICTED: LOW QUALITY PROTEIN: 7-deoxylogan...    231   1e-69   
ref|XP_007141201.1|  hypothetical protein PHAVU_008G175600g             231   1e-69   Phaseolus vulgaris [French bean]
ref|NP_173652.1|  UDP-glucosyl transferase 85A7                         231   1e-69   Arabidopsis thaliana [mouse-ear cress]
emb|CDY62991.1|  BnaC07g48390D                                          230   2e-69   Brassica napus [oilseed rape]
ref|XP_011045673.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    230   2e-69   Populus euphratica
ref|XP_010459994.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       231   2e-69   Camelina sativa [gold-of-pleasure]
ref|XP_007141191.1|  hypothetical protein PHAVU_008G174700g             230   2e-69   Phaseolus vulgaris [French bean]
ref|XP_003579871.2|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    232   3e-69   Brachypodium distachyon [annual false brome]
ref|XP_010040276.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    232   3e-69   
ref|XP_008219468.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       232   3e-69   Prunus mume [ume]
ref|XP_010039828.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    230   3e-69   
ref|XP_007222664.1|  hypothetical protein PRUPE_ppa004979mg             230   3e-69   Prunus persica
ref|XP_009341757.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    229   3e-69   Pyrus x bretschneideri [bai li]
ref|XP_010477498.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    231   3e-69   
ref|XP_008386105.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       229   4e-69   Malus domestica [apple tree]
gb|EMT29523.1|  Cytokinin-O-glucosyltransferase 2                       228   4e-69   
ref|XP_010498708.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       230   5e-69   Camelina sativa [gold-of-pleasure]
ref|XP_004308659.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    229   6e-69   Fragaria vesca subsp. vesca
dbj|BAG80552.1|  UDP-glucose:glucosyltransferase                        229   6e-69   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_011045674.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    229   6e-69   Populus euphratica
ref|NP_173655.2|  UDP-glucosyl transferase 85A3                         229   7e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893222.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    229   7e-69   
emb|CBI38430.3|  unnamed protein product                                233   7e-69   Vitis vinifera
gb|EMT03956.1|  Cytokinin-O-glucosyltransferase 2                       224   8e-69   
ref|XP_002893223.1|  transcription factor/ transferase, transferr...    229   8e-69   Arabidopsis lyrata subsp. lyrata
ref|XP_006853219.1|  hypothetical protein AMTR_s00038p00218410          228   8e-69   
ref|XP_010521179.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       228   9e-69   Tarenaya hassleriana [spider flower]
ref|XP_006416204.1|  hypothetical protein EUTSA_v10007489mg             229   9e-69   Eutrema salsugineum [saltwater cress]
ref|XP_010030028.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    228   1e-68   Eucalyptus grandis [rose gum]
ref|XP_010041627.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    228   1e-68   Eucalyptus grandis [rose gum]
gb|KDP41396.1|  hypothetical protein JCGZ_15803                         228   1e-68   Jatropha curcas
ref|XP_008386293.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       235   1e-68   
gb|KGN43727.1|  hypothetical protein Csa_7G063420                       219   1e-68   
dbj|BAO51833.1|  UDP-glycosyltransferase 85K10                          228   2e-68   Camellia sinensis [black tea]
ref|XP_008219316.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       228   2e-68   Prunus mume [ume]
gb|KFK44332.1|  hypothetical protein AALP_AA1G244400                    228   2e-68   Arabis alpina [alpine rockcress]
ref|XP_007047910.1|  UDP-glucosyl transferase 85A2                      227   2e-68   Theobroma cacao [chocolate]
gb|KGN43726.1|  hypothetical protein Csa_7G062920                       221   2e-68   
ref|XP_004230580.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    228   2e-68   Solanum lycopersicum
tpg|DAA37525.1|  TPA: cytokinin-O-glucosyltransferase 2                 227   3e-68   
ref|XP_008234196.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       227   3e-68   Prunus mume [ume]
ref|XP_007047908.1|  UDP-glucosyl transferase 85A2                      227   3e-68   
ref|XP_008386170.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       226   5e-68   
ref|NP_177950.1|  UDP-glucosyl transferase 85A4                         227   5e-68   
gb|KGN43728.1|  hypothetical protein Csa_7G063920                       220   6e-68   
gb|KDP41398.1|  hypothetical protein JCGZ_15805                         226   6e-68   
ref|NP_001148091.1|  cytokinin-O-glucosyltransferase 2                  226   7e-68   
dbj|BAB86928.1|  glucosyltransferase-10                                 226   7e-68   
gb|KDO35986.1|  hypothetical protein CISIN_1g029508mg                   217   8e-68   
ref|XP_007216637.1|  hypothetical protein PRUPE_ppb025266mg             216   9e-68   
ref|XP_010477499.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    226   9e-68   
ref|XP_010477497.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       226   1e-67   
ref|XP_009370709.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    226   1e-67   
ref|XP_002525851.1|  UDP-glucuronosyltransferase, putative              226   1e-67   
ref|XP_006304973.1|  hypothetical protein CARUB_v10011467mg             226   1e-67   
ref|XP_002893219.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    226   1e-67   
dbj|BAJ90289.1|  predicted protein                                      226   1e-67   
ref|XP_008219459.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       226   1e-67   
emb|CAD27851.2|  glucosyltransferase                                    217   2e-67   
ref|XP_004172440.1|  PREDICTED: UDP-glycosyltransferase 85A4-like       216   2e-67   
gb|AAR06913.1|  UDP-glycosyltransferase 85A8                            225   2e-67   
ref|XP_007225655.1|  hypothetical protein PRUPE_ppa004945mg             225   2e-67   
ref|XP_010910271.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    224   2e-67   
ref|XP_007227474.1|  hypothetical protein PRUPE_ppa004968mg             225   2e-67   
gb|EYU18465.1|  hypothetical protein MIMGU_mgv1a006002mg                224   2e-67   
ref|XP_010025432.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    224   3e-67   
ref|XP_010025429.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    224   3e-67   
ref|XP_010025433.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    224   3e-67   
gb|KCW62086.1|  hypothetical protein EUGRSUZ_H04754                     224   3e-67   
gb|ABV68925.1|  mandelonitrile glucosyltransferase UGT85A19             224   3e-67   
ref|XP_003575222.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    224   3e-67   
ref|XP_006426368.1|  hypothetical protein CICLE_v10025476mg             224   4e-67   
ref|XP_007141198.1|  hypothetical protein PHAVU_008G175300g             224   4e-67   
emb|CDY62992.1|  BnaC07g48400D                                          224   4e-67   
gb|KDO36703.1|  hypothetical protein CISIN_1g029948mg                   215   5e-67   
ref|XP_009103241.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       224   5e-67   
ref|XP_006652346.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       224   5e-67   
ref|XP_002525850.1|  UDP-glucuronosyltransferase, putative              224   5e-67   
emb|CAN68409.1|  hypothetical protein VITISV_022913                     223   5e-67   
emb|CDY67802.1|  BnaC05g50340D                                          223   7e-67   
gb|KDP29701.1|  hypothetical protein JCGZ_18636                         214   7e-67   
ref|XP_008455179.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       224   8e-67   
ref|XP_009364608.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    223   9e-67   
ref|XP_011468341.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    223   1e-66   
ref|XP_004136879.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       223   1e-66   
ref|NP_001183028.1|  hypothetical protein                               223   1e-66   
ref|XP_008219457.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       223   1e-66   
ref|XP_002310553.1|  hypothetical protein POPTR_0007s05230g             223   1e-66   
ref|XP_011008563.1|  PREDICTED: uncharacterized protein LOC105113904    230   1e-66   
ref|XP_004237925.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    223   1e-66   
ref|XP_007146161.1|  hypothetical protein PHAVU_006G017500g             223   2e-66   
ref|XP_006388793.1|  hypothetical protein POPTR_0098s002201g            213   2e-66   
ref|XP_008234156.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       223   2e-66   
emb|CDY14621.1|  BnaC02g24920D                                          222   2e-66   
emb|CDY26859.1|  BnaA02g18840D                                          222   2e-66   
ref|XP_007047907.1|  UDP-glucosyl transferase 85A2                      222   3e-66   
ref|XP_002889182.1|  hypothetical protein ARALYDRAFT_476994             222   3e-66   
ref|XP_011100190.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    222   3e-66   
ref|XP_010676178.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    222   3e-66   
ref|XP_009348490.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    222   3e-66   
ref|XP_009128289.1|  PREDICTED: UDP-glycosyltransferase 85A4            222   3e-66   
ref|XP_008455196.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       222   3e-66   
ref|XP_009334337.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    222   4e-66   
ref|XP_004155505.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       222   4e-66   
gb|EYU18467.1|  hypothetical protein MIMGU_mgv1a005587mg                221   4e-66   
gb|KGN43695.1|  hypothetical protein Csa_7G059660                       222   4e-66   
ref|XP_002268162.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    221   5e-66   
ref|XP_010098617.1|  UDP-glycosyltransferase 85A2                       221   5e-66   
gb|EYU18464.1|  hypothetical protein MIMGU_mgv1a005689mg                221   5e-66   
dbj|BAJ94765.1|  predicted protein                                      222   5e-66   
gb|EMT26410.1|  Cytokinin-O-glucosyltransferase 2                       219   5e-66   
ref|XP_010027911.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    221   6e-66   
ref|XP_010459993.1|  PREDICTED: UDP-glycosyltransferase 85A3            221   6e-66   
ref|XP_002446588.1|  hypothetical protein SORBIDRAFT_06g018490          221   7e-66   
gb|KCW45706.1|  hypothetical protein EUGRSUZ_L00512                     221   8e-66   
gb|EMT13628.1|  Cytokinin-O-glucosyltransferase 2                       227   9e-66   
ref|XP_008380053.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       221   9e-66   
ref|XP_002271368.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    221   1e-65   
ref|XP_009145344.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       221   1e-65   
dbj|BAD34262.1|  putative glucosyltransferase-10                        221   1e-65   
emb|CDY21360.1|  BnaA09g30670D                                          221   1e-65   
ref|XP_007148402.1|  hypothetical protein PHAVU_006G205500g             220   1e-65   
ref|XP_002525852.1|  UDP-glucuronosyltransferase, putative              220   2e-65   
ref|XP_007224375.1|  hypothetical protein PRUPE_ppa021058mg             220   2e-65   
ref|XP_010027305.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    220   2e-65   
gb|KCW73114.1|  hypothetical protein EUGRSUZ_E01567                     218   2e-65   
ref|XP_010025434.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    220   2e-65   
ref|XP_004975806.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       220   2e-65   
ref|XP_007042919.1|  UDP-glycosyltransferase 85A1                       220   2e-65   
gb|KDP29705.1|  hypothetical protein JCGZ_18640                         219   2e-65   
ref|NP_001047223.2|  Os02g0578100                                       220   3e-65   
gb|KJB40363.1|  hypothetical protein B456_007G060200                    217   3e-65   
ref|XP_002300186.1|  hypothetical protein POPTR_0001s31950g             219   3e-65   
ref|XP_006466245.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       219   3e-65   
gb|EEE57246.1|  hypothetical protein OsJ_07253                          219   4e-65   
ref|XP_011003867.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    219   4e-65   
ref|XP_008811180.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       219   4e-65   
gb|KCW66540.1|  hypothetical protein EUGRSUZ_F00337                     218   4e-65   
ref|XP_009350108.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    219   5e-65   
gb|KCW62089.1|  hypothetical protein EUGRSUZ_H04760                     219   5e-65   
ref|XP_009341609.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    219   5e-65   
dbj|BAO51834.1|  UDP-glycosyltransferase 85K11                          219   6e-65   
ref|XP_008229743.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       219   6e-65   
gb|KHN13067.1|  UDP-glycosyltransferase 85A3                            218   8e-65   
gb|EMS51148.1|  UDP-glycosyltransferase 85A3                            218   9e-65   
ref|XP_006388801.1|  hypothetical protein POPTR_0098s002901g            214   1e-64   
gb|EMS64266.1|  UDP-glycosyltransferase 85A2                            216   1e-64   
ref|XP_008359346.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       213   1e-64   
ref|XP_010248134.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       208   1e-64   
ref|XP_002262743.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    218   1e-64   
gb|KDP37429.1|  hypothetical protein JCGZ_07956                         218   2e-64   
ref|XP_008808010.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       208   2e-64   
gb|EMS58460.1|  UDP-glycosyltransferase 85A2                            218   2e-64   
emb|CDP13142.1|  unnamed protein product                                218   2e-64   
ref|XP_011087901.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    217   2e-64   
ref|XP_006390003.1|  hypothetical protein EUTSA_v10019687mg             217   2e-64   
emb|CDP01085.1|  unnamed protein product                                216   2e-64   
ref|XP_007221625.1|  hypothetical protein PRUPE_ppb016872mg             208   3e-64   
ref|XP_006853218.1|  hypothetical protein AMTR_s00038p00217680          217   3e-64   
ref|XP_006466241.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       217   3e-64   
ref|XP_010676190.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    217   3e-64   
ref|XP_003546715.1|  PREDICTED: UDP-glycosyltransferase 85A3            216   3e-64   
ref|XP_002447939.1|  hypothetical protein SORBIDRAFT_06g018460          217   3e-64   
gb|KHN34757.1|  UDP-glycosyltransferase 85A2                            216   3e-64   
ref|XP_002513010.1|  UDP-glucuronosyltransferase, putative              216   4e-64   
ref|XP_010320181.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    216   5e-64   
gb|EMS64263.1|  UDP-glycosyltransferase 85A2                            216   5e-64   
ref|XP_006374018.1|  hypothetical protein POPTR_0016s13230g             208   5e-64   
ref|XP_006426369.1|  hypothetical protein CICLE_v10025504mg             216   5e-64   
ref|XP_011023081.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    216   6e-64   
ref|XP_008455233.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       216   6e-64   
ref|NP_001152029.1|  cytokinin-O-glucosyltransferase 2                  216   6e-64   
ref|XP_009110142.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       216   7e-64   
gb|KDP33196.1|  hypothetical protein JCGZ_12718                         216   8e-64   
ref|XP_002308831.2|  hypothetical protein POPTR_0006s02390g             216   8e-64   
gb|KHN33502.1|  UDP-glycosyltransferase 85A2                            216   8e-64   
ref|XP_003547073.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       216   8e-64   
emb|CAH67108.1|  H0818E04.25                                            216   8e-64   
ref|XP_004305878.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    216   9e-64   
ref|XP_008229795.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       216   9e-64   
ref|NP_001052946.1|  Os04g0451200                                       216   1e-63   
gb|EAY94339.1|  hypothetical protein OsI_16107                          216   1e-63   
ref|XP_003545683.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       215   1e-63   
ref|XP_004975278.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       215   1e-63   
ref|XP_002454243.1|  hypothetical protein SORBIDRAFT_04g027420          215   1e-63   
ref|XP_007227077.1|  hypothetical protein PRUPE_ppa016380mg             206   1e-63   
ref|XP_010937418.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    215   1e-63   
ref|XP_002323188.2|  hypothetical protein POPTR_0016s02200g             216   1e-63   
ref|XP_008789348.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    215   1e-63   
ref|XP_002891115.1|  predicted protein                                  215   2e-63   
ref|XP_010030926.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    220   2e-63   
dbj|BAJ88498.1|  predicted protein                                      214   2e-63   
ref|XP_008378362.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       206   2e-63   
ref|XP_006366324.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       214   2e-63   
gb|KCW66542.1|  hypothetical protein EUGRSUZ_F00339                     214   2e-63   
ref|XP_010646820.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    214   2e-63   
ref|XP_006593894.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       214   2e-63   
dbj|BAJ85429.1|  predicted protein                                      214   3e-63   
gb|ACU24374.1|  unknown                                                 214   3e-63   
ref|XP_011014886.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    214   3e-63   
ref|XP_007146160.1|  hypothetical protein PHAVU_006G017400g             214   3e-63   
ref|XP_010646819.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    214   3e-63   
ref|XP_011008540.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    214   3e-63   
emb|CBI38429.3|  unnamed protein product                                210   3e-63   
ref|XP_003559911.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    214   4e-63   
gb|EYU18466.1|  hypothetical protein MIMGU_mgv1a005711mg                214   4e-63   
ref|XP_008391265.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       214   4e-63   
ref|XP_004137048.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       214   4e-63   
emb|CBI38431.3|  unnamed protein product                                216   4e-63   
ref|XP_011014889.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    214   5e-63   
ref|XP_010676201.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    214   5e-63   
ref|XP_008224048.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    214   5e-63   
ref|XP_008224049.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    213   5e-63   
gb|ABK95502.1|  unknown                                                 204   6e-63   
gb|KHN33534.1|  UDP-glycosyltransferase 85A2                            213   6e-63   
ref|NP_001147350.1|  LOC100280958                                       213   7e-63   
ref|XP_003519003.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       213   8e-63   
gb|KDP29702.1|  hypothetical protein JCGZ_18637                         211   8e-63   
gb|KGN43735.1|  hypothetical protein Csa_7G063990                       204   1e-62   
ref|XP_008342461.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       204   1e-62   
ref|XP_002462695.1|  hypothetical protein SORBIDRAFT_02g030370          213   1e-62   
emb|CBI29442.3|  unnamed protein product                                218   1e-62   
gb|KHG13575.1|  hypothetical protein F383_20274                         212   1e-62   
ref|XP_009790488.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    212   1e-62   
dbj|BAJ89621.1|  predicted protein                                      213   1e-62   
gb|EPS66053.1|  hypothetical protein M569_08723                         212   1e-62   
ref|XP_010025430.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    212   2e-62   
ref|XP_008229481.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       212   2e-62   
gb|ACG28831.1|  cytokinin-O-glucosyltransferase 2                       213   2e-62   
ref|XP_008229739.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       212   2e-62   
ref|XP_004485548.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       212   2e-62   
ref|XP_004305885.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    212   2e-62   
ref|XP_004235064.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    212   2e-62   
gb|KDP45150.1|  hypothetical protein JCGZ_19350                         211   2e-62   
ref|XP_008229792.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       212   3e-62   
ref|XP_010027304.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    212   3e-62   
ref|XP_008372493.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       211   3e-62   
ref|XP_011014888.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    212   3e-62   
ref|XP_002268637.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    211   3e-62   
ref|XP_010676225.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    212   3e-62   
gb|AFJ52993.1|  UDP-glycosyltransferase 1                               212   3e-62   
gb|EMS64923.1|  UDP-glycosyltransferase 85A5                            211   3e-62   
ref|XP_004953968.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       211   5e-62   
ref|XP_009413574.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    211   5e-62   
ref|XP_008804762.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       211   5e-62   
ref|XP_006852717.1|  hypothetical protein AMTR_s00033p00056330          211   5e-62   
gb|EMT22184.1|  Cytokinin-O-glucosyltransferase 2                       213   5e-62   
ref|XP_003575223.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    211   5e-62   
ref|XP_003570608.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    211   5e-62   
ref|XP_010039829.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    211   5e-62   
gb|AFJ52996.1|  UDP-glycosyltransferase 1                               211   6e-62   
ref|XP_007042950.1|  UDP-glycosyltransferase 85A1                       211   6e-62   
gb|KDP33206.1|  hypothetical protein JCGZ_12728                         210   6e-62   
ref|XP_009349617.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    211   7e-62   
ref|XP_006380939.1|  hypothetical protein POPTR_0006s02350g             211   7e-62   
ref|XP_008229477.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    211   7e-62   
gb|AFW64431.1|  hypothetical protein ZEAMMB73_262515                    203   7e-62   
ref|XP_008229476.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    211   7e-62   
ref|XP_008224050.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       210   7e-62   
ref|XP_009377940.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    211   8e-62   
gb|EYU18463.1|  hypothetical protein MIMGU_mgv1a005662mg                210   8e-62   
ref|XP_008789349.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    210   9e-62   



>dbj|BAO51842.1| UDP-glycosyltransferase 85A32 [Ipomoea batatas]
Length=485

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS + E +K PHAVC+PYPAQ HIN MLKLAK+LH+KGFHITFVNTEFNHRRL+R+RGP
Sbjct  1    MGSLSSELDK-PHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLERTRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            ESLRGLPSFRFETIPDGLP SD D TQDIPSLC ST+ TCLGPFKDLLARLN T A +N 
Sbjct  60   ESLRGLPSFRFETIPDGLPVSDADVTQDIPSLCESTSATCLGPFKDLLARLNDT-AVSNA  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG+MSFT+ AAEELGIP+VLFW  SA GF+G MH++QL+DKGYTPLK
Sbjct  119  PPVSCIVSDGVMSFTVDAAEELGIPEVLFWTTSACGFLGYMHFTQLLDKGYTPLK  173



>ref|XP_006360268.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=486

 Score =   287 bits (735),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 150/175 (86%), Gaps = 1/175 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGSNN E   KPHAVC+PYPAQ HIN MLKLAK+LH+KGFHITFVNTEFNHRRL +SRGP
Sbjct  1    MGSNNVEL-NKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GL SFRFETIPDGLP  D DATQDIPSLC ST  TCL PF+DLLA+LN T+  +NV
Sbjct  60   HSLDGLSSFRFETIPDGLPTCDADATQDIPSLCKSTTETCLAPFRDLLAKLNETSNTSNV  119

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPV+CIVSDGIMSFTLAAA+E+G+P+VLFW  SA GF+G MHY+ L++KG+TPLK
Sbjct  120  PPVTCIVSDGIMSFTLAAAQEIGVPEVLFWTTSACGFLGYMHYTTLIEKGFTPLK  174



>ref|XP_009775754.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
sylvestris]
Length=485

 Score =   285 bits (730),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   EF  KPHAVC+PYPAQ HIN MLKLAK+LH+KGFHITFVNTEFNHRRL +SRGP
Sbjct  1    MGSIGAEF-SKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL+GL SFRFETIPDGLPP D DATQDIPSLC ST  TCLGPF+DLLA+LN+T   +NV
Sbjct  60   DSLKGLSSFRFETIPDGLPPCDADATQDIPSLCESTTNTCLGPFRDLLAKLNNT-NTSNV  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG+MSFTLAAA+ELG+P++LFW  SA GF+G MHY ++++KGY PLK
Sbjct  119  PPVSCIVSDGVMSFTLAAAQELGVPEILFWTTSACGFLGYMHYYKVIEKGYAPLK  173



>ref|XP_004252531.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=486

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 148/175 (85%), Gaps = 1/175 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGSNN E   KPHAVC+PYPAQ HIN MLKLAK+LH+KGFHITFVNTEFNHRRL +SRGP
Sbjct  1    MGSNNVEL-NKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GL SFRFETIPDGLP  D DATQDIPSLC ST  TCL PF+DLLA+LN T   +NV
Sbjct  60   HSLDGLSSFRFETIPDGLPTCDADATQDIPSLCKSTTETCLAPFRDLLAKLNGTNNTSNV  119

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPV+CIVSDGIMSFTLAAA+E+G+P+VLFW  SA GF+G MHY+ L++KGY PLK
Sbjct  120  PPVTCIVSDGIMSFTLAAAQEIGVPEVLFWTTSACGFLGYMHYTTLIEKGYIPLK  174



>ref|XP_009590778.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=485

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 151/175 (86%), Gaps = 2/175 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   EF  KPHAVC+PYPAQ HIN MLKLAK+LH+KGFHITFVNTEFNHRRL +SRGP
Sbjct  1    MGSIGAEF-TKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL+GL SFRFETIPDGLPP D DATQDIPSLC ST  TCLGPF+DLLA+LN T  + NV
Sbjct  60   DSLKGLSSFRFETIPDGLPPCDADATQDIPSLCESTTNTCLGPFRDLLAKLNDTNTS-NV  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCI+SDG+MSFTLAAA+ELG+P+VLFW  SA GF+G MHY ++++KGY PLK
Sbjct  119  PPVSCIISDGVMSFTLAAAQELGVPEVLFWTTSACGFLGYMHYYKVIEKGYAPLK  173



>dbj|BAD93690.1| glycosyltransferase [Nicotiana tabacum]
Length=485

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 151/175 (86%), Gaps = 2/175 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   EF  KPHAVC+PYPAQ HIN MLKLAK+LH+KGFHITFVNTEFNHRRL +SRGP
Sbjct  1    MGSIGAEF-TKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL+GL SFRFETIPDGLPP D DATQDIPSLC ST  TCLGPF+DLLA+LN T   +NV
Sbjct  60   DSLKGLSSFRFETIPDGLPPCDADATQDIPSLCESTTNTCLGPFRDLLAKLNDT-NTSNV  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCI+SDG+MSFTLAAA+ELG+P+VLFW  SA GF+G MHY ++++KGY PLK
Sbjct  119  PPVSCIISDGVMSFTLAAAQELGVPEVLFWTTSACGFLGYMHYYKVIEKGYAPLK  173



>dbj|BAG80542.1| glycosyltransferase [Lycium barbarum]
Length=484

 Score =   281 bits (720),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 150/175 (86%), Gaps = 4/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS + E  KKPHAVC+P+PAQ HIN MLKLAK+LH+KGFHITFVNTE+NHRRL +SRGP
Sbjct  1    MGSISAEL-KKPHAVCIPFPAQGHINPMLKLAKILHHKGFHITFVNTEYNHRRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GL SFR+ETIPDGLPP D DATQDIPSLC ST TTCLGPFKDLLA+LN+T     V
Sbjct  60   NALNGLSSFRYETIPDGLPPCDADATQDIPSLCESTTTTCLGPFKDLLAKLNNTL---EV  116

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG+MSFT AAA+ELG+P+VLFW  SA GF+G MHYS +++KGYTPLK
Sbjct  117  PPVSCIVSDGVMSFTFAAAQELGVPEVLFWTTSACGFLGYMHYSTIIEKGYTPLK  171



>gb|ADG65641.1| glycosyltransferase [Withania somnifera]
Length=485

 Score =   281 bits (719),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS + E  +KPHAVC+PYPAQ HIN ML+LAK+LH KGFHITFVNTEFNHRRL +SRGP
Sbjct  1    MGSISAE-SQKPHAVCIPYPAQGHINPMLELAKILHQKGFHITFVNTEFNHRRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GL SFRFETIPDGLPPSD DATQDIPSLC ST  TCLGPF+DLLA+LN+T  + NV
Sbjct  60   HALDGLSSFRFETIPDGLPPSDADATQDIPSLCESTTKTCLGPFRDLLAKLNNTYTS-NV  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG+M+FTLAAA+ELG+P+VLFW  SA GF+G MHYS + +KGY PLK
Sbjct  119  PPVSCIVSDGVMTFTLAAAQELGVPEVLFWTTSACGFLGYMHYSTVTEKGYVPLK  173



>ref|XP_006473006.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
Length=240

 Score =   272 bits (696),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 148/175 (85%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS     E  PHAVC+PYPAQ HIN MLKLAK+LH+KGFHITFVNTEFNH+RL +SRGP
Sbjct  1    MGSLAAAIEM-PHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHKRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL GLPSFRFETIPDGLPP+DVDATQDIPSLC ST  TCL PFK+LL +LN    ++NV
Sbjct  60   DSLNGLPSFRFETIPDGLPPTDVDATQDIPSLCYSTTRTCLAPFKELLHKLND--PSSNV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPV+CIVSDG+MSFT+ AAEELG+P+VLFW  SA GF+  +H+ QL+DKGYTPLK
Sbjct  118  PPVTCIVSDGVMSFTVDAAEELGVPEVLFWTTSACGFLAYLHFRQLIDKGYTPLK  172



>ref|XP_009612691.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
 dbj|BAD93689.1| glycosyltransferase [Nicotiana tabacum]
Length=485

 Score =   279 bits (714),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 149/175 (85%), Gaps = 2/175 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   E   KPHAVC+PYPAQ HIN MLKLAK+LH+KGFHITFVNTEFNHRRL +SRGP
Sbjct  1    MGSIGAEL-TKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL+GL SFRFETIPDGLPP + DATQDIPSLC ST  TCL PF+DLLA+LN T   +NV
Sbjct  60   DSLKGLSSFRFETIPDGLPPCEADATQDIPSLCESTTNTCLAPFRDLLAKLNDT-NTSNV  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG+MSFTLAAA+ELG+P+VLFW  SA GF+G MHY ++++KGY PLK
Sbjct  119  PPVSCIVSDGVMSFTLAAAQELGVPEVLFWTTSACGFLGYMHYCKVIEKGYAPLK  173



>ref|XP_004252533.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=486

 Score =   279 bits (714),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 148/175 (85%), Gaps = 1/175 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS + E   KPHAVC+PYPAQ HIN MLKLAK+LH+KGFHITFVNTEFNHRRL +SRGP
Sbjct  1    MGSISTEI-NKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GL SFRFETIPDGLP  D DATQDIPSLC ST  TCL PF+DLLA+LN T+  +NV
Sbjct  60   HSLDGLSSFRFETIPDGLPTCDADATQDIPSLCKSTTETCLAPFRDLLAKLNGTSNTSNV  119

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPV+CIVSDG+MSFTLAAA+E+G+P+VLFW  SA GF+G MHYS +++KGY PLK
Sbjct  120  PPVTCIVSDGVMSFTLAAAQEIGVPEVLFWTTSACGFLGYMHYSTVIEKGYAPLK  174



>ref|XP_006433961.1| hypothetical protein CICLE_v10000958mg [Citrus clementina]
 gb|ESR47201.1| hypothetical protein CICLE_v10000958mg [Citrus clementina]
Length=489

 Score =   274 bits (700),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 148/175 (85%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS     E  PHAVC+PYPAQ HIN MLKLAK+LH+KGFHITFVNTEFNH+RL +SRGP
Sbjct  1    MGSVAAAIEM-PHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHKRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL GLPSFRFETIPDGLPP+DVDATQDIPSLC ST  TCL PFK+LL +LN    ++NV
Sbjct  60   DSLNGLPSFRFETIPDGLPPTDVDATQDIPSLCYSTTRTCLAPFKELLHKLND--PSSNV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPV+CIVSDG+MSFT+ AAEELG+P+VLFW  SA GF+  +H+ QL+DKGYTPLK
Sbjct  118  PPVTCIVSDGVMSFTVDAAEELGVPEVLFWTTSACGFLAYLHFRQLIDKGYTPLK  172



>ref|XP_007018744.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOY15969.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=487

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = +1

Query  70   FEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLP  249
            F  KPHAVC+PYPAQ HIN MLKLAK+LH++GFHITFVNTEFNH+RL ++RGP++L GLP
Sbjct  6    FADKPHAVCIPYPAQGHINPMLKLAKILHHRGFHITFVNTEFNHKRLLKARGPDALNGLP  65

Query  250  SFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            SFRFETIPDGLPP+DVDATQDIPSLC ST  TCL  FK LL +LN +++A NVPPVSCIV
Sbjct  66   SFRFETIPDGLPPTDVDATQDIPSLCESTRKTCLPHFKQLLHKLNDSSSA-NVPPVSCIV  124

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            SDG+MSFTL AAEELG+P+VLFW  SA GF+G +HY QL++KGYTPLK
Sbjct  125  SDGVMSFTLDAAEELGVPEVLFWTTSACGFLGYVHYRQLMEKGYTPLK  172



>emb|CDP01076.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLKLAKLLH+KGFHITFVNTEFNH+RL +SRGP++L GLP F
Sbjct  8    EKPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEFNHKRLLKSRGPDALNGLPDF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +F+ IPDGLPPSDVDATQD+PSLC ST T CLGPF+DLLA LN T +++ VPPVSCIVSD
Sbjct  68   QFKAIPDGLPPSDVDATQDVPSLCESTTTHCLGPFRDLLAELNDT-SSSQVPPVSCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+MSFTL AA ELG+P++LFW  SA GF+G MHY++L++KG TPLK
Sbjct  127  GVMSFTLEAAAELGVPEILFWTPSACGFLGYMHYAKLIEKGLTPLK  172



>ref|XP_002513939.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF48522.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=385

 Score =   268 bits (685),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 147/168 (88%), Gaps = 2/168 (1%)
 Frame = +1

Query  70   FEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLP  249
            F +KPHAVC+PYPAQ HIN MLKLAKLLH+KGFHITFVNTE+N+RRL +SRGP+SL GL 
Sbjct  6    FLEKPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEYNYRRLLKSRGPDSLNGLS  65

Query  250  SFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            SFRFETIPDGLPP+D DATQDIPSLCVST +TCL  FK++L++LN+T++  NVPPVSCI+
Sbjct  66   SFRFETIPDGLPPTDTDATQDIPSLCVSTKSTCLPHFKNILSKLNNTSS--NVPPVSCII  123

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            SDG+MSFTL AA+ELGIP+VLFW  SA GF+  +HY Q + +G+TPLK
Sbjct  124  SDGVMSFTLDAAQELGIPEVLFWTTSACGFLAYVHYHQFIKRGFTPLK  171



>ref|XP_004252532.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=484

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M SNN E   KPHAVCVPYPAQ HIN MLKLAK+LH+KGFHITFVNTEF HRRL +SRGP
Sbjct  1    MSSNNVEI-NKPHAVCVPYPAQGHINPMLKLAKILHHKGFHITFVNTEFIHRRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL  L SFRFETIPDGLP  D DATQDIPS+C ST  TCL PF+DLLA+LN T+  +NV
Sbjct  60   HSLECLSSFRFETIPDGLPTCDADATQDIPSVCKSTTETCLAPFRDLLAKLNGTSNTSNV  119

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPV+CIVSDGIMSFTLAAA+EL +P+V  W  SA GF+G MHY+ L++KGY PLK
Sbjct  120  PPVTCIVSDGIMSFTLAAAQELAVPEVQLWTTSACGFLGYMHYTTLIEKGYIPLK  174



>ref|XP_009612740.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=484

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 144/175 (82%), Gaps = 1/175 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS     + KPHAVC+PYP Q HIN MLKLAK+LH+KGFHITFVNTE+NHRRL +SRGP
Sbjct  1    MGSIKTHGQAKPHAVCIPYPCQGHINPMLKLAKILHHKGFHITFVNTEYNHRRLLKSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL G PSFRFETIPDGLPP D DATQDIPSLC ST TTCL PFK+LLA+LN T +++NV
Sbjct  61   DSLNGFPSFRFETIPDGLPPCDADATQDIPSLCESTTTTCLRPFKELLAKLN-TISSSNV  119

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            P VSCIVSDG MSFTL AA++LGIP+VLFW  SA G +G MHY  L DKGY PLK
Sbjct  120  PRVSCIVSDGCMSFTLDAAQDLGIPEVLFWTPSACGLLGYMHYRDLSDKGYFPLK  174



>ref|XP_004237928.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=482

 Score =   268 bits (684),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 142/165 (86%), Gaps = 1/165 (1%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+PYPAQ HIN MLKLAK+L+ KGFHITFVN E+NHRRL +SRGP+SL+GLPSF+
Sbjct  9    KPHAVCIPYPAQGHINPMLKLAKILNYKGFHITFVNNEYNHRRLLKSRGPDSLKGLPSFQ  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLPP D D+TQDIP+LC ST  TCLGPFK+LLA+LN T  ++NVPPVSCI+SDG
Sbjct  69   FETIPDGLPPCDADSTQDIPALCESTTKTCLGPFKELLAKLNDT-CSSNVPPVSCIISDG  127

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             MSFTLAAA+ELGIP+V FW  SA GF+G MHY +L  KGY PLK
Sbjct  128  CMSFTLAAAQELGIPEVFFWTPSACGFLGYMHYHELAKKGYFPLK  172



>sp|F8WLS6.1|UGT6_CATRO RecName: Full=7-deoxyloganetin glucosyltransferase; AltName: 
Full=Iridoid 1-O-glucosyltransferase; AltName: Full=UDP-glucose 
glucosyltransferase 6; Short=CrUGT6; AltName: Full=UDP-glycosyltransferase 
85A23 [Catharanthus roseus]
 dbj|BAK55749.1| UDP-glucose iridoid glucosyltransferase [Catharanthus roseus]
Length=487

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 150/176 (85%), Gaps = 2/176 (1%)
 Frame = +1

Query  49   MGS-NNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRG  225
            MGS ++ ++ KKPHAVC+PYPAQ HIN MLKLAKLLH KGFHITFVNTEFNH+RL +SRG
Sbjct  1    MGSLSSSDYSKKPHAVCIPYPAQGHINPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRG  60

Query  226  PESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN  405
             +SL+GL SF+F+TIPDGLPPSDVDATQDIPSLC ST T CL PFK LL +LN T+++  
Sbjct  61   SDSLKGLHSFQFKTIPDGLPPSDVDATQDIPSLCESTTTHCLVPFKQLLQKLNDTSSS-E  119

Query  406  VPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            VPPVSC+VSD +MSFT++AA+EL IP+VLFW  SA G +G MHY+QL+DKG TPLK
Sbjct  120  VPPVSCVVSDAVMSFTISAAQELDIPEVLFWTPSACGVLGYMHYAQLIDKGLTPLK  175



>ref|XP_009791953.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
sylvestris]
Length=484

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 144/175 (82%), Gaps = 1/175 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S     + KPHAVC+PYP Q HIN MLKLAK+LH+KGFHITFVNTE+NHRRL +SRGP
Sbjct  1    MDSIRIHGQDKPHAVCIPYPCQGHINPMLKLAKILHHKGFHITFVNTEYNHRRLLKSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL G PSFRFETIPDGLPP D DATQDIPSLC ST TTCLGPFK+LLA+LN T +++NV
Sbjct  61   DSLNGFPSFRFETIPDGLPPCDADATQDIPSLCESTTTTCLGPFKELLAKLN-TTSSSNV  119

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            P VSCIVSDG MSFTL AA++LGIP+VLFW  SA G +G MHY  L +KGY PLK
Sbjct  120  PRVSCIVSDGCMSFTLDAAQDLGIPEVLFWTPSACGSLGYMHYRDLSEKGYFPLK  174



>ref|NP_001277170.1| UDP-glycosyltransferase 85A2-like [Vitis vinifera]
 dbj|BAO51845.1| UDP-glycosyltransferase 85A30 [Vitis vinifera]
Length=484

 Score =   266 bits (679),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 142/165 (86%), Gaps = 1/165 (1%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            +PHAVCVP+PAQ HIN M+KLAKLLH+KGFHITFVNTEFNH+RL +SRGP SLRGLPSF+
Sbjct  8    RPHAVCVPFPAQGHINPMMKLAKLLHHKGFHITFVNTEFNHQRLLKSRGPNSLRGLPSFQ  67

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETI DGLPPSD+DATQD+PSLC ST   CL PF+DLLA+LN T +++ VPPV+CIVSDG
Sbjct  68   FETIADGLPPSDIDATQDVPSLCASTHNDCLAPFRDLLAKLNDT-SSSKVPPVTCIVSDG  126

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            IMSFTL AAEELGIP+V FW  SA GFMG + Y  L+D+G+ PLK
Sbjct  127  IMSFTLKAAEELGIPEVFFWTTSACGFMGYVQYRHLIDRGFFPLK  171



>ref|XP_006363269.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Solanum tuberosum]
Length=485

 Score =   265 bits (677),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 142/165 (86%), Gaps = 1/165 (1%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+PYPAQ HIN MLKLAK+ ++KGFHITFVNTE+NHRRL +SRGP+SL+GLPSFR
Sbjct  12   KPHAVCIPYPAQGHINPMLKLAKIFNHKGFHITFVNTEYNHRRLLKSRGPDSLKGLPSFR  71

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLPPSD D+TQDI SL  ST  TCLGPFK+LLA+LN+T ++ NVPPVSCIVSDG
Sbjct  72   FETIPDGLPPSDADSTQDIVSLGKSTTNTCLGPFKELLAKLNNTCSS-NVPPVSCIVSDG  130

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             MSFTLAAA+ELGIP++ FW  SA G +G MHY  L +KGY PLK
Sbjct  131  CMSFTLAAAQELGIPEIFFWTPSACGLLGYMHYRDLAEKGYFPLK  175



>gb|KJB59011.1| hypothetical protein B456_009G235700 [Gossypium raimondii]
Length=483

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = +1

Query  85   HAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFRFE  264
            HAVC+P+PAQ HIN MLKLAK+LH KGF+ITFVNTEFNH+RL +SRGP++L GLPSFRFE
Sbjct  9    HAVCIPFPAQGHINPMLKLAKILHQKGFYITFVNTEFNHKRLLKSRGPDALNGLPSFRFE  68

Query  265  TIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDGIM  444
            TIPDGLPP+DVDATQDIPSLC ST+ TCL  FK LL +LN  A+ + VP VSCIVSDG+M
Sbjct  69   TIPDGLPPTDVDATQDIPSLCDSTSKTCLPHFKQLLRKLNDFASTSKVPHVSCIVSDGVM  128

Query  445  SFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            SFTL AAEELGIP+VLFW  SA GF+G +HY QL++KGYTPLK
Sbjct  129  SFTLDAAEELGIPEVLFWTTSACGFLGYVHYRQLMEKGYTPLK  171



>sp|F8WKW1.1|UGT2_GARJA RecName: Full=7-deoxyloganetin glucosyltransferase; AltName: 
Full=Genipin glucosyltransferase; AltName: Full=UDP-glucose 
glucosyltransferase 2; Short=GjUGT2; AltName: Full=UDP-glycosyltransferase 
85A24 [Gardenia jasminoides]
 dbj|BAK55737.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=481

 Score =   263 bits (673),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +K HAVC+PYPAQ HIN MLKLAK+LH+KGFHITFVNTEFNH+RL +SRGP++L GLP F
Sbjct  8    EKHHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHKRLLKSRGPDALNGLPDF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +F+TIPDGLPPSDVDATQDIPSLC ST T CL PF++LLA LN   +++ VPPVSCIVSD
Sbjct  68   QFKTIPDGLPPSDVDATQDIPSLCESTTTRCLDPFRNLLAELN-GPSSSQVPPVSCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+MSFTL AA ELG+P++LFW  SA GF+G MHY++L++KG TPLK
Sbjct  127  GVMSFTLEAAAELGVPEILFWTTSACGFLGYMHYAKLIEKGLTPLK  172



>ref|XP_006363270.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Solanum tuberosum]
Length=482

 Score =   263 bits (673),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 141/165 (85%), Gaps = 1/165 (1%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+PYPAQ HIN MLKLAK+L++KGFHITFVN E+NHRRL +SRGP+SL+GLPSF+
Sbjct  9    KPHAVCIPYPAQGHINPMLKLAKILNHKGFHITFVNNEYNHRRLLKSRGPDSLKGLPSFQ  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLPP D D+TQDI +LC ST  TCLGPFK+LLA+LN T  ++NVPPVSCI+SDG
Sbjct  69   FETIPDGLPPCDADSTQDIAALCESTTKTCLGPFKELLAKLNDT-CSSNVPPVSCIISDG  127

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             MSFTLAAA+ELGIP+V FW  SA G +G MHY +L  KGY PLK
Sbjct  128  CMSFTLAAAQELGIPEVFFWTPSACGLLGYMHYHELAKKGYFPLK  172



>ref|XP_011069754.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Sesamum 
indicum]
Length=485

 Score =   263 bits (671),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 141/166 (85%), Gaps = 2/166 (1%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+P+PAQ HIN MLKLAKLLH+ GFHITFVNTE+NH+RL +SRGP SL GLPSF
Sbjct  8    EKPHAVCIPFPAQGHINPMLKLAKLLHHNGFHITFVNTEYNHQRLLKSRGPSSLEGLPSF  67

Query  256  RFETIPDGLPPSD-VDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            RFETIPDGLPPSD  DATQDIPSLC ST TTCL PF+DLLA+LN T  ++NVPPVSCIVS
Sbjct  68   RFETIPDGLPPSDAADATQDIPSLCQSTTTTCLAPFRDLLAKLNDT-GSSNVPPVSCIVS  126

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPL  570
            DG+MSFT+ AAEELGIP++ FW  SA GF     Y +L++KGY+PL
Sbjct  127  DGVMSFTVEAAEELGIPEIFFWTPSACGFFAYTQYEKLIEKGYSPL  172



>emb|CDP21827.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 142/166 (86%), Gaps = 1/166 (1%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLKLAKLLH+KGFHITFVNTEFNH+RL +SRGP++L GLP F
Sbjct  8    EKPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEFNHKRLLKSRGPDALNGLPDF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +F+ IPDGLPP+DVDATQD+PSL  ST T CLGPF+DLLA LN   +++ VPPVSCIVSD
Sbjct  68   QFKAIPDGLPPADVDATQDVPSLSESTTTHCLGPFRDLLAELND-PSSSQVPPVSCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G MSFTL AA ELG+P++LFW  SA GF+G MHY++L++KG  PLK
Sbjct  127  GAMSFTLEAAAELGVPEILFWTPSACGFLGYMHYAKLIEKGLIPLK  172



>gb|KCW45339.1| hypothetical protein EUGRSUZ_L009911, partial [Eucalyptus grandis]
Length=174

 Score =   251 bits (642),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 140/176 (80%), Gaps = 3/176 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   +  +KPHA+C+PYPAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL RSRGP
Sbjct  1    MGS--IDMIQKPHALCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDV-DATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN  405
             SL GLPSFRF TIPDGLPPSDV DATQDIP+LC ST+  CL  F+DLL RLN  +  + 
Sbjct  59   SSLDGLPSFRFRTIPDGLPPSDVADATQDIPALCQSTSKFCLPYFRDLLERLNEESTTSG  118

Query  406  VPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             PPVSC+VSDG+MSFTL AAE +G+P+VLFW  SA GFMG + Y  L+DKG TPLK
Sbjct  119  SPPVSCVVSDGVMSFTLDAAEAIGVPEVLFWTTSACGFMGYVQYRNLIDKGLTPLK  174



>ref|XP_004237929.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=482

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 140/165 (85%), Gaps = 1/165 (1%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+PYPAQ HIN MLKLAK+L+ KGFHITFVN E+NHRRL +SRGP+SL+GLPSFR
Sbjct  9    KPHAVCIPYPAQGHINPMLKLAKILNYKGFHITFVNNEYNHRRLLKSRGPDSLKGLPSFR  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLPP D D+TQDIP+LC ST  TCLGPFK+LLA+LN T  ++NVP VSCI+SDG
Sbjct  69   FETIPDGLPPCDADSTQDIPALCESTTKTCLGPFKELLAKLNDT-CSSNVPTVSCIISDG  127

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             MSFTLAAA+ELGIP+V FW  SA G +G +HY +L  KGY PLK
Sbjct  128  CMSFTLAAAQELGIPEVFFWTPSACGSLGYLHYHELAKKGYFPLK  172



>emb|CDP01078.1| unnamed protein product [Coffea canephora]
Length=501

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 147/175 (84%), Gaps = 2/175 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS +   EKKPHAVC+P+PAQ HIN ML+LAKLLH+KGFHITFVN+EFNH+RL +SRGP
Sbjct  1    MGSISL-LEKKPHAVCIPFPAQGHINPMLELAKLLHHKGFHITFVNSEFNHKRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL GLP F+F+TIPDGLPPSDVDATQDI SLC ST    LGPF++LLARLN T +++NV
Sbjct  60   DSLNGLPDFQFQTIPDGLPPSDVDATQDIASLCESTDKHGLGPFRELLARLNDT-SSSNV  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCI+SD  MSFTLAAAEELGIP++  W  SA  ++ + H+SQL+DKG TPLK
Sbjct  119  PPVSCIISDAAMSFTLAAAEELGIPEIYLWTASACSYLAIFHFSQLIDKGITPLK  173



>ref|XP_010248035.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nelumbo 
nucifera]
Length=488

 Score =   260 bits (665),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLKLAKLLH KGFH+TFV+TE+N RR+ +SRGP+S++GLP F
Sbjct  8    EKPHAVCIPYPAQGHINPMLKLAKLLHYKGFHVTFVHTEYNLRRMVKSRGPDSIKGLPGF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLPPSDVDATQDIPSLC ST  TCL PF  LL+RLN ++ + N+P V+CIVSD
Sbjct  68   RFETIPDGLPPSDVDATQDIPSLCDSTRNTCLVPFXSLLSRLNDSSNSDNIPLVTCIVSD  127

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+MSFTL AA+ELGIP+VL WP SA  FM  +HYS L+++G TPL+
Sbjct  128  GVMSFTLDAAQELGIPEVLLWPTSACSFMSFLHYSHLIERGLTPLR  173



>ref|XP_007042920.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOX98751.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=519

 Score =   261 bits (667),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 141/165 (85%), Gaps = 4/165 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+PYPAQ H+N MLK+AKLLH KGFHITFVNTE+NH+RL +SRGP +L G+P FR
Sbjct  9    KPHAVCLPYPAQGHVNPMLKVAKLLHFKGFHITFVNTEYNHKRLLKSRGPNALDGVPDFR  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLPP D+DATQDIP+LC ST+  CL PF+ LLA+LN    ++ VPPV+CIVSDG
Sbjct  69   FETIPDGLPPPDIDATQDIPALCDSTSKNCLAPFRQLLAKLN----SSGVPPVTCIVSDG  124

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            +MSFTL AAEELGIP+VLFW  SA GF+G MHY +L+++G+TPLK
Sbjct  125  VMSFTLKAAEELGIPEVLFWTTSACGFLGYMHYPRLIERGFTPLK  169



>ref|XP_002513938.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF48521.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=482

 Score =   259 bits (663),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 142/168 (85%), Gaps = 2/168 (1%)
 Frame = +1

Query  70   FEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLP  249
            F +K HAVC+PYPAQ HIN MLKLAK L++KGFHITFVN+E+NHRRL +SRGP+SL GL 
Sbjct  6    FLEKSHAVCIPYPAQGHINPMLKLAKFLYHKGFHITFVNSEYNHRRLLKSRGPDSLDGLS  65

Query  250  SFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            SFRFETIPDGLPP+D DATQDIPSLCVST   CL  FK++L++LN T ++  VPPVSCI+
Sbjct  66   SFRFETIPDGLPPTDTDATQDIPSLCVSTKNACLPHFKNVLSKLNDTPSS--VPPVSCII  123

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            SDG+MSFTL AA+ELGIP+VLFW  SA GF+  +HY QL+ KGYTPLK
Sbjct  124  SDGVMSFTLDAAQELGIPEVLFWTTSACGFLAYLHYHQLIKKGYTPLK  171



>gb|AIL51400.1| glycosyltransferase [Actinidia deliciosa]
Length=484

 Score =   259 bits (663),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 139/166 (84%), Gaps = 1/166 (1%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HI  MLKLAKLLH+KGFH+TFVNTEFNH+RL +SRGP+SL GL SF
Sbjct  8    EKPHAVCLPYPAQGHITPMLKLAKLLHSKGFHVTFVNTEFNHKRLLKSRGPDSLTGLSSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLP SD+DATQ IPSLC ST   CLGPF+ LL +LN+T  ++ VPPVSC+VSD
Sbjct  68   RFETIPDGLPESDLDATQFIPSLCESTRKNCLGPFRQLLGKLNNT-VSSGVPPVSCVVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+MSF+L AAEELGIP VLFW  S  GFM  +HY  L++KGYTPLK
Sbjct  127  GVMSFSLDAAEELGIPQVLFWTTSVCGFMAYVHYRNLIEKGYTPLK  172



>ref|XP_004299647.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=483

 Score =   258 bits (659),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 141/166 (85%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+P+PAQ HIN MLKLAKLLH+KGFHITFVNTE+NH+RL +SRGP SL GLPSF
Sbjct  6    EKPHAVCIPFPAQGHINPMLKLAKLLHHKGFHITFVNTEYNHKRLLKSRGPNSLDGLPSF  65

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
             FETIPDGLPP+D +ATQDI SLCVST T CL  F+DLL++LN   +++N+PPVSCIVSD
Sbjct  66   TFETIPDGLPPTDANATQDILSLCVSTRTKCLPHFRDLLSKLN---SSSNIPPVSCIVSD  122

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+MSFT+ AA+ELGIP+VLFW  SA GFMG M Y  L+D+G  PLK
Sbjct  123  GVMSFTVEAAQELGIPEVLFWTTSACGFMGYMQYQNLIDEGLIPLK  168



>ref|XP_011016634.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Populus euphratica]
Length=483

 Score =   258 bits (658),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 144/175 (82%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS    F + PHAVC+PYPAQ HIN MLKLAKLLH++GFHITFVNTE+NH+R+ RSRGP
Sbjct  1    MGS--LAFLENPHAVCIPYPAQGHINPMLKLAKLLHHRGFHITFVNTEYNHKRILRSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSF+F+ IPDGLPP+  D TQDIPSLC ST+ TCL PFK+L+  LN T+++ NV
Sbjct  59   NSLDGLPSFQFKAIPDGLPPTSNDVTQDIPSLCESTSKTCLVPFKNLITNLNDTSSS-NV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPV+CIVSDG+MSFTL AA+ELGIP+VLFW  SA GF+   HY QL++KG TPLK
Sbjct  118  PPVTCIVSDGVMSFTLEAAQELGIPEVLFWTTSACGFLAYAHYHQLIEKGLTPLK  172



>ref|XP_008466222.1| PREDICTED: UDP-glycosyltransferase 85A2 [Cucumis melo]
Length=487

 Score =   258 bits (658),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 141/167 (84%), Gaps = 3/167 (2%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            E++PHAVC+PYPAQ HIN MLKLAKLLH+ GFHITFVNT+FNHRRL +SRGP++L GL S
Sbjct  8    EQQPHAVCIPYPAQGHINPMLKLAKLLHSFGFHITFVNTDFNHRRLLKSRGPKALDGLSS  67

Query  253  FRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            FRFE+IPDGLPP+DVDATQDIPSLC ST   CL PFK+L+++LN      NVP VSCIVS
Sbjct  68   FRFESIPDGLPPTDVDATQDIPSLCQSTRQFCLQPFKELVSKLN---CDPNVPQVSCIVS  124

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            DG+MSFT+ AA+ELG+P VLFW  SA GF+G +HY QLV++GYTP K
Sbjct  125  DGVMSFTIDAADELGVPVVLFWTTSACGFLGYLHYQQLVERGYTPFK  171



>ref|XP_004237927.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=488

 Score =   258 bits (658),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 141/175 (81%), Gaps = 4/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S N E   KPHAVC+PYPAQ HI+ MLKLAK+L+ KGFHITFVNTE NH+RL +SRGP
Sbjct  1    MCSINAEISDKPHAVCLPYPAQGHISPMLKLAKILNRKGFHITFVNTEHNHKRLLKSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL GLPSFRFE IPDGLPP D DATQDI SLC ST TTCLGPFK+LLA+L +    TNV
Sbjct  61   DSLNGLPSFRFEAIPDGLPPCDPDATQDISSLCKSTTTTCLGPFKELLAKLKN----TNV  116

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            P VSCIVSDG MSFTL+AA++LGIP VLFW  SA G +  M+Y  LV+KGYTPLK
Sbjct  117  PRVSCIVSDGSMSFTLSAAQDLGIPQVLFWTPSACGLLCYMYYRDLVEKGYTPLK  171



>gb|EYU19971.1| hypothetical protein MIMGU_mgv1a024760mg [Erythranthe guttata]
Length=483

 Score =   256 bits (653),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+P+PAQ HIN MLKLAKLLHN GFHITFVNTE+NH RL +SRGP+SL GLPSFR
Sbjct  8    KPHAVCIPFPAQGHINPMLKLAKLLHNNGFHITFVNTEYNHHRLLKSRGPDSLTGLPSFR  67

Query  259  FETIPDGLPP---SDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            FETIPDGLPP    D DATQDIPSLC ST  TCL PF+DLLA+LN T A++ VPPVSCIV
Sbjct  68   FETIPDGLPPPSEDDADATQDIPSLCESTTNTCLAPFRDLLAKLNDT-ASSEVPPVSCIV  126

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPL  570
            SDG+MSFT  AAEELGIP++LFW  SA GF     Y  +  KGY PL
Sbjct  127  SDGVMSFTADAAEELGIPEILFWTTSACGFYAYTQYEYVFQKGYAPL  173



>ref|XP_010060016.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=480

 Score =   254 bits (650),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 136/166 (82%), Gaps = 0/166 (0%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+P+PAQSHINAML LAKLLH++GFH+TFVNTE+NH RL RSRGP SL GLPSF
Sbjct  3    QKPHAVCIPFPAQSHINAMLNLAKLLHHRGFHVTFVNTEYNHNRLLRSRGPSSLDGLPSF  62

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RF TIPDGLPPSD DATQD+P+LC ST   CL  F+DLL RLN  +A +  PPVSC+VSD
Sbjct  63   RFRTIPDGLPPSDDDATQDVPALCQSTQKCCLPYFQDLLKRLNEESATSGSPPVSCVVSD  122

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G  +FTL AAE +G+P+VLFWPISA  FMG +H+  LVD+G  PLK
Sbjct  123  GWTTFTLDAAEAVGVPEVLFWPISACAFMGFLHFRSLVDEGRAPLK  168



>gb|AID16086.1| flavonol-3-O-glucoside L-rhamnosyltransferase, partial [Morus 
alba]
Length=447

 Score =   253 bits (647),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 141/175 (81%), Gaps = 5/175 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS    F +KPHAVC+P+PAQ H+N MLKLAKLLH+KGFHITFVNTEFNH+RL +SRG 
Sbjct  1    MGS--LSFLEKPHAVCIPFPAQGHVNPMLKLAKLLHSKGFHITFVNTEFNHKRLLKSRGA  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSFRFE IPDGLPP+D DATQ IP++C ST    L PF+DLL +LN   ++  V
Sbjct  59   HALDGLPSFRFEAIPDGLPPTDADATQSIPAICESTPKHSLAPFRDLLLKLN---SSPEV  115

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSC+VSDG MSFTL AAEELGIP+VLFW  SA GF+G +HY  LV+KGYTPLK
Sbjct  116  PPVSCVVSDGAMSFTLDAAEELGIPEVLFWTTSACGFLGYLHYRALVEKGYTPLK  170



>gb|EYU19972.1| hypothetical protein MIMGU_mgv1a018325mg [Erythranthe guttata]
Length=394

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+P+PAQ HIN MLKLAKLLHN GFHITFVNT +NH RL +SRGP+SL GLPSFR
Sbjct  9    KPHAVCIPFPAQGHINPMLKLAKLLHNNGFHITFVNTVYNHHRLLKSRGPDSLTGLPSFR  68

Query  259  FETIPDGLPP---SDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            FETIPDGLPP    D DATQDIPSLC ST  TCL PF+DLLA+LN T A++ VPPVSC+V
Sbjct  69   FETIPDGLPPPSEDDADATQDIPSLCESTTNTCLAPFRDLLAKLNDT-ASSEVPPVSCVV  127

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPL  570
            SDG+MSFT  AAEELGIP+VLFW  SA GF     Y  +  KGY PL
Sbjct  128  SDGVMSFTADAAEELGIPEVLFWTTSACGFYAYTQYEYVFRKGYAPL  174



>ref|XP_010534080.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Tarenaya hassleriana]
Length=486

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 135/166 (81%), Gaps = 2/166 (1%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVCVPYPAQ HIN MLK+AKLLH +GFH+TFVNTEFNHRRL RSRGP +L  LPSF
Sbjct  10   QKPHAVCVPYPAQGHINPMLKVAKLLHARGFHVTFVNTEFNHRRLLRSRGPHALDKLPSF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLP ++VDATQDIP+LC ST   CL PFK+LL R+N   A   +PPVSC+VSD
Sbjct  70   RFETIPDGLPETEVDATQDIPALCDSTRKNCLAPFKELLRRIN--LAGGEIPPVSCVVSD  127

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G MSFTL AAEELG+P+VLFW  SA GF   +HY QLV+KG  PLK
Sbjct  128  GCMSFTLDAAEELGVPEVLFWTTSACGFWAYLHYYQLVEKGLVPLK  173



>emb|CDO97426.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 136/165 (82%), Gaps = 2/165 (1%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVCVPYPAQ HIN MLKLAKLLH+KGFHITFVNTE+NH RL +SRGP SL GLP FR
Sbjct  10   KPHAVCVPYPAQGHINPMLKLAKLLHHKGFHITFVNTEYNHNRLLKSRGPNSLDGLPDFR  69

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLPP+D D+TQDIPSLC ST+ TCL PF  LL+RLN+  AA +VPPV+CIVSDG
Sbjct  70   FETIPDGLPPNDADSTQDIPSLCDSTSKTCLAPFSSLLSRLNN--AAPDVPPVTCIVSDG  127

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             MSFT+ AA + G+P+ LFW  SA G +G   YS LV++GYTPLK
Sbjct  128  CMSFTVEAAHQFGLPEALFWTPSACGLLGYTQYSHLVERGYTPLK  172



>gb|ACU19718.1| unknown [Glycine max]
Length=231

 Score =   246 bits (627),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 137/165 (83%), Gaps = 4/165 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+P+PAQ HIN MLKLAKLLH KGFHITFVNTE+NH+RL ++RGP+SL GL SFR
Sbjct  10   KPHAVCIPHPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPDSLNGLSSFR  69

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLP +D+DATQDIPSLC +T  TC   FK+LL ++N++ A    PPVSCIVSDG
Sbjct  70   FETIPDGLPETDLDATQDIPSLCEATRRTCSPHFKNLLTKINNSDA----PPVSCIVSDG  125

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            +MSFTL AAEELG+P+VLFW  SA GFM  + Y QL++KG TPLK
Sbjct  126  VMSFTLDAAEELGLPEVLFWTTSACGFMCYVQYEQLIEKGLTPLK  170



>ref|XP_010060020.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 139/176 (79%), Gaps = 3/176 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   +  +KPHAVC+PYPAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL RSRGP
Sbjct  1    MGS--IDMIQKPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDV-DATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN  405
             SL GLPSFRF TIPDGLPPSDV DATQDIP+LC ST+  CL  F+DLL RLN  +  + 
Sbjct  59   SSLDGLPSFRFRTIPDGLPPSDVADATQDIPALCQSTSKFCLPYFRDLLERLNEESTTSG  118

Query  406  VPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             PPVSC+VSDG MSFTL AAE +G+P+VLFW  SA GFMG + Y  LVDKG TPLK
Sbjct  119  SPPVSCVVSDGAMSFTLDAAEAIGVPEVLFWTTSACGFMGYVQYRNLVDKGLTPLK  174



>ref|XP_010060023.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW66547.1| hypothetical protein EUGRSUZ_F00343 [Eucalyptus grandis]
Length=486

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL RSRGP SL GLPSF
Sbjct  8    QKPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPSSLDGLPSF  67

Query  256  RFETIPDGLPPSDV-DATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            RF TIPDGLPPSDV DATQDIP+LC ST+  CL  F+DLL RLN  +     PPVSC+VS
Sbjct  68   RFRTIPDGLPPSDVADATQDIPALCQSTSKFCLPYFRDLLERLNEESTTLGSPPVSCVVS  127

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            DG+MSFTL AAE +G+P+VLFW  SA GFMG + Y  L+DKG TPLK
Sbjct  128  DGVMSFTLDAAEAIGVPEVLFWTTSACGFMGYVQYRNLIDKGLTPLK  174



>ref|XP_008219317.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 142/175 (81%), Gaps = 5/175 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGSN     +KPHAVC+P+PAQ HIN MLKLAKLLH KGFHITFVNTEFNH+RL +SRGP
Sbjct  1    MGSNG--LIEKPHAVCIPFPAQGHINPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSFRFETIPDGLPP+D +ATQDIPSLC ST    L  F+DLL++LN   ++T  
Sbjct  59   NSLDGLPSFRFETIPDGLPPTDANATQDIPSLCESTRKHSLPYFRDLLSKLN---SSTGC  115

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG+MSFTL AA ELGIP+VLFW  SA GF+  +HY +L++KG TPLK
Sbjct  116  PPVSCIVSDGVMSFTLDAAHELGIPEVLFWTTSACGFLAYVHYHRLIEKGLTPLK  170



>ref|XP_010040274.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 140/176 (80%), Gaps = 3/176 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   +  +KPHA+C+PYPAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL RSRGP
Sbjct  1    MGS--IDMIQKPHALCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDV-DATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN  405
             SL GLPSFRF TIPDGLPPSDV DATQDIP+LC ST+  CL  F+DLL RLN  +  + 
Sbjct  59   SSLDGLPSFRFRTIPDGLPPSDVADATQDIPALCQSTSKFCLPYFRDLLERLNEESTTSG  118

Query  406  VPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             PPVSC+VSDG+MSFTL AAE +G+P+VLFW  SA GFMG + Y  L+DKG TPLK
Sbjct  119  SPPVSCVVSDGVMSFTLDAAEAIGVPEVLFWTTSACGFMGYVQYRNLIDKGLTPLK  174



>ref|XP_004299648.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=488

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 140/176 (80%), Gaps = 4/176 (2%)
 Frame = +1

Query  49   MGSNNCEFE-KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRG  225
            MGSN    E  KPHAVC+PYPAQ HIN MLKLAKLLH+KGFH+TFVN+E+NHRRL  SRG
Sbjct  1    MGSNALMVETNKPHAVCIPYPAQGHINPMLKLAKLLHHKGFHVTFVNSEYNHRRLLNSRG  60

Query  226  PESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN  405
            P +L GLPSF+F+TIPDGLPP+D +ATQDIPSLC ST   CL  F+ LL  +N   +  N
Sbjct  61   PNALDGLPSFQFKTIPDGLPPTDTNATQDIPSLCESTRKYCLPHFRKLLEEVN---SEEN  117

Query  406  VPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             PPVSC+VSDG+MSFTL AAEELG+P+VLFW  SA GFM  +HY  L++KGYTPLK
Sbjct  118  SPPVSCVVSDGVMSFTLDAAEELGVPEVLFWTTSACGFMAYVHYKHLIEKGYTPLK  173



>gb|KDP41399.1| hypothetical protein JCGZ_15806 [Jatropha curcas]
Length=487

 Score =   253 bits (646),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 141/166 (85%), Gaps = 1/166 (1%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLKLAKLLH+KGFHITFV+TE+NH+RL RSRG +S+ GLPSF
Sbjct  8    EKPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVHTEYNHKRLLRSRGSDSVIGLPSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +F TIPDGLPP+D D TQDIPSLC ST+  CL PFK+LL+ LN T+++ NVPPVSCIVSD
Sbjct  68   QFRTIPDGLPPTDSDVTQDIPSLCQSTSKYCLAPFKNLLSELNDTSSS-NVPPVSCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+MSFT+ AA+EL IP VLFW  SA GFMG + Y QL+++G +PLK
Sbjct  127  GVMSFTVDAAQELCIPLVLFWTTSACGFMGYVQYRQLIERGLSPLK  172



>ref|XP_002302305.1| UDP-glucuronosyltransferase family protein [Populus trichocarpa]
 gb|EEE81578.1| UDP-glucuronosyltransferase family protein [Populus trichocarpa]
Length=483

 Score =   253 bits (646),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 139/168 (83%), Gaps = 1/168 (1%)
 Frame = +1

Query  70   FEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLP  249
            F + PHAVC+PYPAQ HIN MLKLAKLLH+KGFHITFVNTE+NH+R+ RSRG  SL GLP
Sbjct  6    FLENPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEYNHKRILRSRGLNSLDGLP  65

Query  250  SFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            SF+F+ IPDGLPP+  D TQDIPSLC ST+ TC+ PFKDL+  LN T +++NVPPV+CIV
Sbjct  66   SFQFKAIPDGLPPTSNDVTQDIPSLCESTSKTCMVPFKDLITNLNDT-SSSNVPPVTCIV  124

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            SDG+MSFTL AA+ELGIP+VLFW  SA GF+   H  QL++KG TPLK
Sbjct  125  SDGVMSFTLEAAQELGIPEVLFWTTSACGFLAYAHCRQLIEKGLTPLK  172



>ref|XP_004237926.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=491

 Score =   253 bits (646),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 139/175 (79%), Gaps = 2/175 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S   E +K PHAVCVPYPAQ HIN MLKLAK+L++KGFHITFVNTE+NHRRL +SRGP
Sbjct  1    MASTGAELDK-PHAVCVPYPAQGHINPMLKLAKILNHKGFHITFVNTEYNHRRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
               + LPSFRFE IPDGLPP D DATQDI +LC ST TTCLGPF++LLA+LN+T  ++ V
Sbjct  60   HGFKNLPSFRFEAIPDGLPPCDADATQDIIALCKSTDTTCLGPFRELLAKLNNT-CSSKV  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG  S+TL AA+ELGIP V FW  +A G +  MHY  LVDKGY PLK
Sbjct  119  PPVSCIVSDGSNSYTLTAAQELGIPQVHFWTFAACGTLSYMHYCNLVDKGYIPLK  173



>ref|XP_002285767.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=476

 Score =   253 bits (645),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 136/166 (82%), Gaps = 5/166 (3%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLKLAK LH +GFHITFVNTE+NH RL +SRGP+SL+G+PSF
Sbjct  8    EKPHAVCIPYPAQGHINPMLKLAKFLHFRGFHITFVNTEYNHNRLLKSRGPDSLKGIPSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +F+TIPDGLPPS+VDATQD P+LCVST   CL PF+DLL+ LNH       PPV+CIVSD
Sbjct  68   QFKTIPDGLPPSNVDATQDTPALCVSTTKHCLPPFRDLLSNLNHDG-----PPVTCIVSD  122

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G MSFTL AA+ELG+P+VLFW  SA GFMG + Y  L+DKG  PLK
Sbjct  123  GAMSFTLDAAQELGVPEVLFWTTSACGFMGYVQYRNLIDKGLAPLK  168



>ref|XP_008219318.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=480

 Score =   253 bits (645),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 142/173 (82%), Gaps = 4/173 (2%)
 Frame = +1

Query  55   SNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPES  234
            S+NC  EK PHAVC+P+PAQ HIN ML+LAKLLH KGFHITFVNTEFNH+RL +SRGP S
Sbjct  2    SSNCLIEK-PHAVCIPFPAQGHINPMLELAKLLHYKGFHITFVNTEFNHKRLLKSRGPNS  60

Query  235  LRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPP  414
            L GLPSFRFETIPDGLPP+D +ATQDIPSLC ST    L  F+DLL++LN   ++T  PP
Sbjct  61   LDGLPSFRFETIPDGLPPTDANATQDIPSLCESTRKHSLPYFRDLLSKLN---SSTGCPP  117

Query  415  VSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            VSCIVSDG+MSFTL AA ELGIP+VLFW  SA GF+  +HY +L++KG TPLK
Sbjct  118  VSCIVSDGVMSFTLDAAHELGIPEVLFWTTSACGFLAYVHYHRLIEKGLTPLK  170



>ref|XP_006363268.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Solanum tuberosum]
Length=492

 Score =   253 bits (645),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 140/175 (80%), Gaps = 1/175 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S N E   KPHAVC+PYPAQ HI+ MLKLAK+L++KGFHITFVNTE N +RL +SRGP
Sbjct  1    MCSINAENSDKPHAVCLPYPAQGHISPMLKLAKILNHKGFHITFVNTEHNQKRLLKSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            + L+ LPSFRFE IPDGLPP D DATQDI +LC ST TTCLGPF++LLA+LN+T  ++ V
Sbjct  61   DGLKNLPSFRFEAIPDGLPPCDADATQDIIALCKSTDTTCLGPFRELLAKLNNT-CSSKV  119

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG +SFTL AA+ELGIP V FW  +A G +  MHY  LVDKGY PLK
Sbjct  120  PPVSCIVSDGSISFTLTAAQELGIPQVFFWTFAACGTLSYMHYCNLVDKGYIPLK  174



>gb|KCW66556.1| hypothetical protein EUGRSUZ_F00355 [Eucalyptus grandis]
Length=444

 Score =   251 bits (641),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 136/172 (79%), Gaps = 0/172 (0%)
 Frame = +1

Query  58   NNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESL  237
            ++ E  + PHAVC+PYPAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL RSRGP SL
Sbjct  2    SSIEMTQMPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPSSL  61

Query  238  RGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPV  417
             GLPSF+F  IPDGLPPSD DATQDIP+LC ST  +C   F+DLL RLN  +A +  PPV
Sbjct  62   DGLPSFQFHAIPDGLPPSDADATQDIPALCQSTQKSCSPYFRDLLERLNEESATSGSPPV  121

Query  418  SCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            SC+VSDG MSFTL AAE +G+P+VLFW  SA GFMG +HY  L+D+G TPLK
Sbjct  122  SCVVSDGAMSFTLDAAEAVGVPEVLFWTTSACGFMGYVHYRSLIDRGLTPLK  173



>ref|XP_004136284.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
 ref|XP_004167272.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
 gb|KGN60220.1| hypothetical protein Csa_3G889760 [Cucumis sativus]
Length=486

 Score =   252 bits (644),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 139/167 (83%), Gaps = 3/167 (2%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            +++PHAVC+PYPAQ HIN MLKLAKLLH+ GFHITFVNT+FNHRRL +SRGP +L G+ S
Sbjct  8    QQQPHAVCIPYPAQGHINPMLKLAKLLHSFGFHITFVNTDFNHRRLLKSRGPTALDGISS  67

Query  253  FRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            F+FE+IPDGLPP+DVDATQDIPSLC ST   CL PFK+L+++LN      NVP VSCIVS
Sbjct  68   FQFESIPDGLPPTDVDATQDIPSLCQSTRRLCLQPFKELVSKLN---CDPNVPQVSCIVS  124

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            DG+MSFT+ AAEELG+P VLFW  SA GF+  +HY QLV++GYTP K
Sbjct  125  DGVMSFTVDAAEELGVPVVLFWTTSACGFLAYLHYQQLVERGYTPFK  171



>ref|XP_009391314.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Musa acuminata 
subsp. malaccensis]
Length=482

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 134/164 (82%), Gaps = 2/164 (1%)
 Frame = +1

Query  82   PHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFRF  261
            PHAVC+PYPAQ HI  MLKLAKLLH+KGF ITFVNTE+NHRRL  +RGP +L GLP FRF
Sbjct  9    PHAVCIPYPAQGHITPMLKLAKLLHSKGFRITFVNTEYNHRRLLNARGPSALDGLPDFRF  68

Query  262  ETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDGI  441
            ETIPDGLPPSD DATQDIP+LC ST TTCL PF DLL+ LN    ++  PPVSCIVSDG+
Sbjct  69   ETIPDGLPPSDDDATQDIPALCRSTMTTCLPPFLDLLSELND--PSSERPPVSCIVSDGV  126

Query  442  MSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            MSFTL AA +LGIP+VLFW  SA GFMG +HY  LV++G TPLK
Sbjct  127  MSFTLDAARQLGIPEVLFWTTSACGFMGYIHYRHLVERGLTPLK  170



>ref|XP_009592743.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=483

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 141/175 (81%), Gaps = 2/175 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M SN  + +  PHA+CVP P Q HIN MLKLAK LH +GFHITFVNTE+NHRRL +SRGP
Sbjct  1    MASNYAQLDV-PHAICVPAPTQGHINPMLKLAKFLHFRGFHITFVNTEYNHRRLLKSRGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL+GL SFRFETIPDGLPPSD D+TQDI SL  S  TT L PFK+LLA+LNHT +++NV
Sbjct  60   DSLKGLHSFRFETIPDGLPPSDADSTQDIASLSKSLTTTGLVPFKELLAKLNHT-SSSNV  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PP SCI+SDG+MSFTLAAA++LGIP V FW + A G +G MHY  L++K YTPLK
Sbjct  119  PPASCIISDGVMSFTLAAAQDLGIPLVFFWTLCACGLLGYMHYCNLIEKDYTPLK  173



>gb|EYU19973.1| hypothetical protein MIMGU_mgv1a005383mg [Erythranthe guttata]
Length=486

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+P+PAQ HIN MLKLAKLLHN GFHITFVNTE+NH RL +SRGP+SL GLPSFR
Sbjct  10   KPHAVCIPFPAQGHINPMLKLAKLLHNNGFHITFVNTEYNHHRLLKSRGPDSLTGLPSFR  69

Query  259  FETIPDGLPP---SDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            FETIPDGLPP    D DATQDIPSLC ST  TCL PF+DLLA+LN T A++ VP VSC+V
Sbjct  70   FETIPDGLPPPSEDDADATQDIPSLCESTTNTCLAPFRDLLAKLNDT-ASSEVPHVSCVV  128

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPL  570
            SDG+MSFT  AAEELGIP+VLFW  SA GF     Y  +++KGY  L
Sbjct  129  SDGVMSFTADAAEELGIPEVLFWTTSACGFYCYTQYGNVIEKGYASL  175



>gb|KDP41397.1| hypothetical protein JCGZ_15804 [Jatropha curcas]
Length=487

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 140/166 (84%), Gaps = 1/166 (1%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+ YPAQ HIN MLKLAKLLH+KGFHITFV+TE+NH+RL RSRG +S+ GLPSF
Sbjct  8    EKPHAVCISYPAQGHINPMLKLAKLLHHKGFHITFVHTEYNHKRLLRSRGSDSVIGLPSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +F TIPDGLPP+D D TQDIPSLC ST+  CL PFK+LL+ LN T+++ NVPPVSCIVSD
Sbjct  68   QFRTIPDGLPPTDSDVTQDIPSLCQSTSKYCLAPFKNLLSELNDTSSS-NVPPVSCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+MSFT+ AA+EL IP VLFW  SA GFMG + Y QL+++G +PLK
Sbjct  127  GVMSFTVDAAQELCIPLVLFWTTSACGFMGYVQYRQLIERGLSPLK  172



>ref|XP_002285771.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=476

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 136/166 (82%), Gaps = 5/166 (3%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLKLAK LH +GFHITFVNTE+NH RL +SRGP+SL+G+PSF
Sbjct  8    EKPHAVCIPYPAQGHINPMLKLAKFLHFRGFHITFVNTEYNHNRLLKSRGPDSLKGIPSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +F+TIPDGL PS+VDATQDIP+LCVST   CL PF+DLL+ LNH       PPV+CIVSD
Sbjct  68   QFKTIPDGLLPSNVDATQDIPALCVSTRKHCLPPFRDLLSNLNHDG-----PPVTCIVSD  122

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G MSFTL AA+ELG+P+VLFW  SA GFMG + Y  L+DKG  PLK
Sbjct  123  GAMSFTLDAAQELGVPEVLFWTTSACGFMGYVQYRNLIDKGLAPLK  168



>gb|KCW66541.1| hypothetical protein EUGRSUZ_F00338, partial [Eucalyptus grandis]
Length=478

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 139/176 (79%), Gaps = 3/176 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   +  +KPHAVC+P PAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL RSRGP
Sbjct  1    MGS--IDMIQKPHAVCIPAPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSD-VDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN  405
             SL GLPSFRF TIPDGLPPSD  D TQDIP+LC ST+  CL  F+DLL RLN  +AA+ 
Sbjct  59   SSLDGLPSFRFRTIPDGLPPSDAADVTQDIPALCQSTSKLCLPYFRDLLQRLNEESAASG  118

Query  406  VPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             PPVSC+VSDG+M+FTL AAE +G+P+VLFW  SA GFMG + Y  LVDKG TPLK
Sbjct  119  SPPVSCVVSDGMMTFTLDAAEAIGVPEVLFWTASACGFMGYVQYRSLVDKGLTPLK  174



>ref|XP_010060017.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 139/176 (79%), Gaps = 3/176 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   +  +KPHAVC+P PAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL RSRGP
Sbjct  1    MGS--IDMIQKPHAVCIPAPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSD-VDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN  405
             SL GLPSFRF TIPDGLPPSD  D TQDIP+LC ST+  CL  F+DLL RLN  +AA+ 
Sbjct  59   SSLDGLPSFRFRTIPDGLPPSDAADVTQDIPALCQSTSKLCLPYFRDLLQRLNEESAASG  118

Query  406  VPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             PPVSC+VSDG+M+FTL AAE +G+P+VLFW  SA GFMG + Y  LVDKG TPLK
Sbjct  119  SPPVSCVVSDGMMTFTLDAAEAIGVPEVLFWTASACGFMGYVQYRSLVDKGLTPLK  174



>dbj|BAG80547.1| glycosyltransferase [Lycium barbarum]
Length=490

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 141/175 (81%), Gaps = 1/175 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S + E   KPHAVC+PYPAQ HI+ MLKLAK+LH+ GFHITFVNTE NH+RL +SRGP
Sbjct  1    MYSISAEDLDKPHAVCIPYPAQGHISPMLKLAKILHHNGFHITFVNTEHNHKRLLKSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +S++GLPSF+FETIPDGLPP D D TQDI SL  ST  +C GPFK+LL +LN+T+ + NV
Sbjct  61   DSVKGLPSFQFETIPDGLPPCDPDTTQDIFSLSESTTNSCSGPFKELLTKLNNTSLS-NV  119

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG MSFTLAAA++LGIP V FW  SA G +  MHY  LV+KGYTPLK
Sbjct  120  PPVSCIVSDGAMSFTLAAAQDLGIPQVFFWTPSACGLLSYMHYRDLVEKGYTPLK  174



>gb|KCW66553.1| hypothetical protein EUGRSUZ_F00351 [Eucalyptus grandis]
Length=440

 Score =   249 bits (635),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS +    + PHAVC+PYPAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL RSRGP
Sbjct  1    MGSTD--MTQMPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSF+F TIPDGLPPSD DATQD+P+LC ST  +CL  F+DLL RLN  +A +  
Sbjct  59   SSLNGLPSFQFRTIPDGLPPSDADATQDVPALCQSTQKSCLPYFRDLLERLNEESARSGS  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSC+VSDG+MSFTL AAE + +P+VLFW  S  GFMG + Y  L+D+G  PLK
Sbjct  119  PPVSCVVSDGVMSFTLDAAEAVSVPEVLFWTTSLCGFMGYVQYRSLIDRGLAPLK  173



>ref|XP_002513937.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF48520.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=492

 Score =   250 bits (638),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 148/184 (80%), Gaps = 3/184 (2%)
 Frame = +1

Query  25   RSRERKREMGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHR  204
            ++++++R+MGS  C     PHAVCVP+PAQ HIN MLKLAKLLH KGFHITFVNTE+NH+
Sbjct  2    QAKQKERQMGSL-CPENLPPHAVCVPFPAQGHINPMLKLAKLLHQKGFHITFVNTEYNHQ  60

Query  205  RLQRSRGPESLRGLPSFRFETIPDGLPPSD-VDATQDIPSLCVSTATTCLGPFKDLLARL  381
            RL +SRGP+SL GLPSFRFETIPDGLP S+  ++TQD+PSLC ST   CL PF+ LL++L
Sbjct  61   RLLKSRGPDSLNGLPSFRFETIPDGLPSSENANSTQDVPSLCYSTKRNCLAPFRYLLSKL  120

Query  382  NHTAAATNVPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGY  561
            N++ A++NVPPV+CIV D IMSFTL A +ELG+P VLFW  S  GFM  +HY  LV+KG+
Sbjct  121  NNS-ASSNVPPVTCIVFDCIMSFTLQAGQELGVPVVLFWTASVCGFMAYLHYRPLVEKGF  179

Query  562  TPLK  573
             PLK
Sbjct  180  VPLK  183



>ref|XP_010273031.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nelumbo 
nucifera]
Length=483

 Score =   249 bits (637),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 140/167 (84%), Gaps = 2/167 (1%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            KKPH VC+PYPAQ HIN MLKLAKLLH KGFH+TFVNTE+NHRRL +SRGP+S++GLP F
Sbjct  8    KKPHVVCIPYPAQGHINPMLKLAKLLHYKGFHVTFVNTEYNHRRLVKSRGPDSVKGLPGF  67

Query  256  RFETIPDGLPPS-DVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            RFETIPDGLP S D++ATQ IPSLC ST  TCL PF++LL++LN  +++++ PPVSCIVS
Sbjct  68   RFETIPDGLPHSDDIEATQHIPSLCDSTRKTCLSPFRNLLSKLND-SSSSDTPPVSCIVS  126

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            DG+MSFTL AA+E GIP+VLFW  SA GFM  +HY  L+ +G TPLK
Sbjct  127  DGVMSFTLTAAQECGIPEVLFWTTSACGFMSYVHYPHLIHRGLTPLK  173



>ref|XP_010647463.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Vitis vinifera]
Length=371

 Score =   246 bits (628),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 136/166 (82%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVCVPYP+Q H+  +++LAKL+H++GFHITFVNTEFNHRRL RS GP+S+RGL  F
Sbjct  7    RKPHAVCVPYPSQGHVTPLMQLAKLVHSRGFHITFVNTEFNHRRLIRSAGPDSVRGLVDF  66

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE IPDGLPPSD+DATQD+P+LC ST   CL PF+DLLARLN   ++++VPPVSCI+SD
Sbjct  67   RFEAIPDGLPPSDLDATQDVPALCDSTRKNCLAPFRDLLARLN---SSSDVPPVSCIISD  123

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+MSF + AAEELGIP+V FW  SA  FMG +HY + + +G  P K
Sbjct  124  GVMSFAIQAAEELGIPEVQFWTASACSFMGYLHYREFIRRGIFPFK  169



>gb|KCW66555.1| hypothetical protein EUGRSUZ_F00353, partial [Eucalyptus grandis]
Length=477

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS +    + PHAVC+PYPAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL RSRGP
Sbjct  1    MGSTD--MTQMPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSFRF TIPDGLPPSD DATQD+P+LC ST  +CL  F+DLL +LN  +A +  
Sbjct  59   SSLDGLPSFRFRTIPDGLPPSDADATQDVPALCQSTQKSCLPYFRDLLEKLNEESAMSGS  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSC+VSDG+MSFTL AAE + +P+VLFW  S  GFMG + Y  L+D+G  PLK
Sbjct  119  PPVSCVVSDGVMSFTLDAAEAVSVPEVLFWTTSLCGFMGYVQYRSLIDRGLAPLK  173



>ref|XP_010060024.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS +    + PHAVC+PYPAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL RSRGP
Sbjct  1    MGSTD--MTQMPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSFRF TIPDGLPPSD DATQD+P+LC ST  +CL  F+DLL +LN  +A +  
Sbjct  59   SSLDGLPSFRFRTIPDGLPPSDADATQDVPALCQSTQKSCLPYFRDLLEKLNEESAMSGS  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSC+VSDG+MSFTL AAE + +P+VLFW  S  GFMG + Y  L+D+G  PLK
Sbjct  119  PPVSCVVSDGVMSFTLDAAEAVSVPEVLFWTTSLCGFMGYVQYRSLIDRGLAPLK  173



>ref|XP_003526577.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Glycine max]
 gb|KHN08945.1| UDP-glycosyltransferase 85A3 [Glycine soja]
Length=486

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 138/175 (79%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S +    +KPHAVC+PYPAQ HI  MLKLAK+LH KGFHITFVNTEFNH+RL +SRG 
Sbjct  1    MNSLDITTVEKPHAVCIPYPAQGHITPMLKLAKVLHFKGFHITFVNTEFNHKRLLKSRGA  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL G PSFRFETIPDGLP SDVDATQD P+LC S   TCL PF++LLA+LNH   + +V
Sbjct  61   DSLNGFPSFRFETIPDGLPESDVDATQDTPTLCESLRKTCLVPFRNLLAKLNH---SRHV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG+MSFTL A+EELGIP+V FW ISA G +  +H  QLV KG  PLK
Sbjct  118  PPVSCIVSDGVMSFTLIASEELGIPEVFFWTISACGLLCYLHNGQLVKKGLVPLK  172



>ref|XP_008219313.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 141/175 (81%), Gaps = 5/175 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGSN     +KPHAVC+P+PAQ HIN MLKLAKLLH KGF+ITFVNTEFNH+RL +SRGP
Sbjct  1    MGSNG--LIEKPHAVCIPFPAQGHINPMLKLAKLLHYKGFYITFVNTEFNHKRLLKSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSFRFETIPDGLPP+D +ATQDIPSLC ST    L  F+DLL++LN   ++T  
Sbjct  59   NSLDGLPSFRFETIPDGLPPTDANATQDIPSLCESTRKHSLPYFRDLLSKLN---SSTGC  115

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG+MSFTL AA ELGIP+VLFW  SA G +  +HY +L++KG TPLK
Sbjct  116  PPVSCIVSDGVMSFTLDAAHELGIPEVLFWTTSACGLLAYVHYHRLIEKGLTPLK  170



>ref|XP_003542333.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Glycine max]
Length=485

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 137/165 (83%), Gaps = 4/165 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+PYPAQ HIN MLKLAKLLH KGFHITFVNTE+NH+RL ++RGP+SL GL SFR
Sbjct  10   KPHAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPDSLNGLSSFR  69

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLP +D+DATQDIPSLC +T  TC   FK+LL ++N++ A    PPVSCIVSDG
Sbjct  70   FETIPDGLPETDLDATQDIPSLCEATRRTCSPHFKNLLTKINNSDA----PPVSCIVSDG  125

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            +MSFTL AAEELG+P+VLFW  SA GFM  + Y QL++KG TPLK
Sbjct  126  VMSFTLDAAEELGLPEVLFWTTSACGFMCYVQYEQLIEKGLTPLK  170



>ref|XP_002285778.2| PREDICTED: 7-deoxyloganetin glucosyltransferase isoform X1 [Vitis 
vinifera]
Length=492

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 132/166 (80%), Gaps = 5/166 (3%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLKLAKLLH +GF ITFVNTEFNH RL  ++GP  L GLP+F
Sbjct  24   EKPHAVCIPYPAQGHINPMLKLAKLLHCRGFRITFVNTEFNHTRLLNAQGPNCLSGLPTF  83

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +FETIPDGLPPSDVDATQDIPSLCVST   CL PF+ LLA+LNH       PPV+CI SD
Sbjct  84   QFETIPDGLPPSDVDATQDIPSLCVSTKKNCLAPFRRLLAKLNHDG-----PPVTCIFSD  138

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             IMSFTL AA+ELGIPD+L W  SA GFM  + Y  L+DKG+TPLK
Sbjct  139  AIMSFTLDAAQELGIPDLLLWTASACGFMAYVQYRSLIDKGFTPLK  184



>ref|XP_007224069.1| hypothetical protein PRUPE_ppa015357mg [Prunus persica]
 gb|EMJ25268.1| hypothetical protein PRUPE_ppa015357mg [Prunus persica]
Length=482

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 140/175 (80%), Gaps = 5/175 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGSN     +KPHAVC+P+PAQ HIN MLKLAKLLH KGFHITFVNTEFNH+RL +SRGP
Sbjct  1    MGSNG--LIEKPHAVCIPFPAQGHINPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSFRFETIPDGLP +D +ATQDIPSLC ST    L  F+DLL++LN   ++T  
Sbjct  59   NSLDGLPSFRFETIPDGLPLTDANATQDIPSLCESTRKHSLPYFRDLLSKLN---SSTGC  115

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG+MSFTL AA ELGIP+VLFW  SA GF+  +HY +L++ G TPLK
Sbjct  116  PPVSCIVSDGVMSFTLDAAHELGIPEVLFWTTSACGFLAYVHYHRLIENGLTPLK  170



>gb|AFK34769.1| unknown [Lotus japonicus]
Length=484

 Score =   248 bits (632),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 137/167 (82%), Gaps = 3/167 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKG-FHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            KKPH VC+PYPAQ HIN MLKLAKLLH KG FH+TFVNTE+NH+RL +SRGP+SL GLPS
Sbjct  9    KKPHVVCIPYPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKSRGPDSLNGLPS  68

Query  253  FRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            FRFETIPDGLP +DVD TQDIPSLC+ST  TCL  FK LL++LN    +++VPPV+CIVS
Sbjct  69   FRFETIPDGLPETDVDVTQDIPSLCISTRKTCLPHFKKLLSKLND--VSSDVPPVTCIVS  126

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            DG MSFTL AA EL IP+VLFW  SA GFMG + Y +L++KG  PLK
Sbjct  127  DGCMSFTLDAAIELNIPEVLFWTTSACGFMGYVQYRELIEKGIIPLK  173



>emb|CBI23550.3| unnamed protein product [Vitis vinifera]
Length=414

 Score =   246 bits (627),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 136/166 (82%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVCVPYP+Q H+  +++LAKL+H++GFHITFVNTEFNHRRL RS GP+S+RGL  F
Sbjct  7    RKPHAVCVPYPSQGHVTPLMQLAKLVHSRGFHITFVNTEFNHRRLIRSAGPDSVRGLVDF  66

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE IPDGLPPSD+DATQD+P+LC ST   CL PF+DLLARLN   ++++VPPVSCI+SD
Sbjct  67   RFEAIPDGLPPSDLDATQDVPALCDSTRKNCLAPFRDLLARLN---SSSDVPPVSCIISD  123

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+MSF + AAEELGIP+V FW  SA  FMG +HY + + +G  P K
Sbjct  124  GVMSFAIQAAEELGIPEVQFWTASACSFMGYLHYREFIRRGIFPFK  169



>ref|XP_007227225.1| hypothetical protein PRUPE_ppa018697mg [Prunus persica]
 gb|EMJ28424.1| hypothetical protein PRUPE_ppa018697mg [Prunus persica]
Length=483

 Score =   248 bits (632),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 136/166 (82%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLK+AKLLH KGFHITFVNTEFNH+RL +SRGP SL GLPSF
Sbjct  8    EKPHAVCIPYPAQGHINPMLKVAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGLPSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE IPDGLPP+D   TQDIPSLC ST   CL  F++LL++LN   ++ + PPVSCIVSD
Sbjct  68   RFENIPDGLPPTDASVTQDIPSLCYSTRRHCLPHFRELLSKLN---SSPDSPPVSCIVSD  124

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+MSFTL AAEELGIP+VLFW  SA GFM  + Y +L++KG TPLK
Sbjct  125  GVMSFTLDAAEELGIPEVLFWTTSACGFMSYVQYHRLIEKGLTPLK  170



>ref|XP_006416206.1| hypothetical protein EUTSA_v100074991mg, partial [Eutrema salsugineum]
 gb|ESQ34559.1| hypothetical protein EUTSA_v100074991mg, partial [Eutrema salsugineum]
Length=172

 Score =   237 bits (605),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 134/175 (77%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S+     +KPH VCVPYPAQ HIN MLK+AKLLH KGFH+TFVNT +NH RL RSRGP
Sbjct  1    MESHVVSNAQKPHVVCVPYPAQGHINPMLKVAKLLHAKGFHVTFVNTIYNHNRLLRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSFRFE+IPDGLP  DVD TQDIP+LC ST    L PFK+LL R+N   A  +V
Sbjct  61   NALDGLPSFRFESIPDGLPEIDVDVTQDIPALCESTMKNGLAPFKELLGRIN---AGDDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG MSFTL AAEELG+P+VLFW  SA GF+  +H+ + ++K  +PLK
Sbjct  118  PPVSCIVSDGCMSFTLDAAEELGVPEVLFWTTSACGFLTYLHFYRFIEKDLSPLK  172



>emb|CAN65645.1| hypothetical protein VITISV_012510 [Vitis vinifera]
Length=582

 Score =   249 bits (637),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 132/166 (80%), Gaps = 5/166 (3%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLKLAKLLH +GF ITFVNTEFNH RL  ++GP  L GLP+F
Sbjct  4    EKPHAVCIPYPAQGHINPMLKLAKLLHCRGFRITFVNTEFNHTRLLNAQGPNCLSGLPTF  63

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +FETIPDGLPPSDVDATQDIPSLCVST   CL PF+ LLA+LNH       PPV+CI SD
Sbjct  64   QFETIPDGLPPSDVDATQDIPSLCVSTKKNCLAPFRRLLAKLNHDG-----PPVTCIFSD  118

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             IMSFTL AA+ELGIPD+L W  SA GFM  + Y  L+DKG+TPLK
Sbjct  119  AIMSFTLDAAQELGIPDLLLWTASACGFMAYVQYRSLIDKGFTPLK  164



>ref|XP_010060018.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = +1

Query  67   EFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGL  246
            E  +KPHAVC+P+PAQSHINAML LAKLLH++GFH+TFVNTE+NH RL RSRGP SL  L
Sbjct  5    EMTQKPHAVCIPFPAQSHINAMLNLAKLLHDRGFHVTFVNTEYNHNRLLRSRGPSSLDSL  64

Query  247  PSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCI  426
            PSFRF TIPDGLPPSD DATQDIP+LC ST   CL  F+DLL RL+  +A +  PPVSC+
Sbjct  65   PSFRFRTIPDGLPPSDGDATQDIPALCQSTQERCLPYFQDLLKRLDEESATSGSPPVSCV  124

Query  427  VSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            VSD   +FTL AAE +G+P+VLFWPISA  FMG + +  L+D+G  PLK
Sbjct  125  VSDVSTTFTLDAAEAVGVPEVLFWPISACAFMGFLQFRSLIDEGLAPLK  173



>ref|XP_003544800.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Glycine max]
Length=482

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 136/165 (82%), Gaps = 4/165 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+PYPAQ HIN MLKLAKLLH KGFHITFVNTE+NH+RL ++RGP+SL GL SFR
Sbjct  9    KPHAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPDSLNGLSSFR  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLP +D+DATQDIPSLC +T  TC   FK+LLA++N + A    PPVSCIVSDG
Sbjct  69   FETIPDGLPETDLDATQDIPSLCEATRRTCSPHFKNLLAKINDSDA----PPVSCIVSDG  124

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            +M+FTL AAEELG+P+VLFW  SA GFM  + Y QL++K  TPLK
Sbjct  125  VMTFTLDAAEELGVPEVLFWTTSACGFMCYVQYQQLIEKDLTPLK  169



>gb|KHN42553.1| UDP-glycosyltransferase 85A2 [Glycine soja]
Length=482

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 136/165 (82%), Gaps = 4/165 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+PYPAQ HIN MLKLAKLLH KGFHITFVNTE+NH+RL ++RGP+SL GL SFR
Sbjct  9    KPHAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPDSLNGLSSFR  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLP +D+DATQDIPSLC +T  TC   FK+LLA++N + A    PPVSCIVSDG
Sbjct  69   FETIPDGLPETDLDATQDIPSLCEATRRTCSPHFKNLLAKINDSDA----PPVSCIVSDG  124

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            +M+FTL AAEELG+P+VLFW  SA GFM  + Y QL++K  TPLK
Sbjct  125  VMTFTLDAAEELGVPEVLFWTTSACGFMCYVQYQQLIEKDLTPLK  169



>emb|CBI19181.3| unnamed protein product [Vitis vinifera]
Length=654

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 136/166 (82%), Gaps = 5/166 (3%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLKLAK LH +GFHITFVNTE+NH RL +SRGP+SL+G+PSF
Sbjct  8    EKPHAVCIPYPAQGHINPMLKLAKFLHFRGFHITFVNTEYNHNRLLKSRGPDSLKGIPSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +F+TIPDGLPPS+VDATQD P+LCVST   CL PF+DLL+ LNH       PPV+CIVSD
Sbjct  68   QFKTIPDGLPPSNVDATQDTPALCVSTTKHCLPPFRDLLSNLNHDG-----PPVTCIVSD  122

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G MSFTL AA+ELG+P+VLFW  SA GFMG + Y  L+DKG  PLK
Sbjct  123  GAMSFTLDAAQELGVPEVLFWTTSACGFMGYVQYRNLIDKGLAPLK  168


 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 123/181 (68%), Gaps = 30/181 (17%)
 Frame = +1

Query  31   RERKREMGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRL  210
            RER   + S      +KPHAVC+PYPAQ HIN MLKLAK LH +GFHITF          
Sbjct  387  RERMGSLAS-----AEKPHAVCIPYPAQGHINPMLKLAKFLHFRGFHITF----------  431

Query  211  QRSRGPESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHT  390
                      G+PSF+F+TIPDGL PS+VDATQDIP+LCVST   CL PF+DLL+ LNH 
Sbjct  432  ----------GIPSFQFKTIPDGLLPSNVDATQDIPALCVSTRKHCLPPFRDLLSNLNHD  481

Query  391  AAATNVPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPL  570
                  PPV+CIVSDG MSFTL AA+ELG+P+VLFW  SA GFMG + Y  L+DKG  PL
Sbjct  482  G-----PPVTCIVSDGAMSFTLDAAQELGVPEVLFWTTSACGFMGYVQYRNLIDKGLAPL  536

Query  571  K  573
            K
Sbjct  537  K  537



>ref|XP_007222804.1| hypothetical protein PRUPE_ppa005043mg [Prunus persica]
 gb|EMJ24003.1| hypothetical protein PRUPE_ppa005043mg [Prunus persica]
Length=480

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 140/173 (81%), Gaps = 4/173 (2%)
 Frame = +1

Query  55   SNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPES  234
            S+NC  EK PHAVC+P+PAQ HIN MLKLAKLLH KGFHITFVNTEFNH+RL +SRGP S
Sbjct  2    SSNCLIEK-PHAVCIPFPAQGHINPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNS  60

Query  235  LRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPP  414
            L G PSFRFETIPDGLPP+D +ATQDIPSLC ST    L  F+DLL++LN   ++ + PP
Sbjct  61   LDGFPSFRFETIPDGLPPTDANATQDIPSLCDSTRKRGLPYFRDLLSKLN---SSPDCPP  117

Query  415  VSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            VSC+VSDG M FTL AA+ELG+P+VLFW  SA GF+  +HY +L++KG TPLK
Sbjct  118  VSCVVSDGAMGFTLDAAQELGLPEVLFWTTSACGFLAYVHYHRLIEKGLTPLK  170



>gb|KCW66549.1| hypothetical protein EUGRSUZ_F003461, partial [Eucalyptus grandis]
Length=174

 Score =   236 bits (602),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 134/176 (76%), Gaps = 3/176 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   +  +KPHAVC+PYPAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL  SRGP
Sbjct  1    MGS--IDMIQKPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLHSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDV-DATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN  405
             SL GLPSFRF TIP+GLPPSDV DATQDIP+LC ST+  CL  F+D L RLN  +    
Sbjct  59   SSLDGLPSFRFRTIPNGLPPSDVADATQDIPALCQSTSKFCLPYFRDQLERLNEESTTLG  118

Query  406  VPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             PPVSC+VSDG+MSFTL AA+ +G+ +VLFW  S  GFMG + Y  LVDKG  PLK
Sbjct  119  SPPVSCVVSDGMMSFTLDAAKVIGVSEVLFWTTSVCGFMGYVQYCNLVDKGLAPLK  174



>ref|XP_002301060.1| hypothetical protein POPTR_0002s09850g [Populus trichocarpa]
 gb|EEE80333.1| hypothetical protein POPTR_0002s09850g [Populus trichocarpa]
Length=505

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            E  PHAVC+P+PAQ HIN MLKLAK+LH K FHITFVNTEFNHRRL +SRG  SL GLP+
Sbjct  8    EFPPHAVCLPFPAQGHINPMLKLAKILHRKDFHITFVNTEFNHRRLLKSRGLGSLDGLPT  67

Query  253  FRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            FRFETIPDGLPPSD D+TQ +PSLC ST   CL PF+DLL+RLN+T+++  VPPV+CIVS
Sbjct  68   FRFETIPDGLPPSDADSTQHVPSLCDSTKKNCLAPFRDLLSRLNNTSSS-KVPPVTCIVS  126

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            D IMSFTL AA+ELGIP+VLFW  S  GFM  + Y  L++KG+ PLK
Sbjct  127  DCIMSFTLKAAQELGIPNVLFWTASVCGFMSYLQYRPLIEKGFVPLK  173



>ref|XP_003635298.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Vitis vinifera]
Length=478

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 136/166 (82%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVCVPYP+Q H+  +++LAKL+H++GFHITFVNTEFNHRRL RS GP+S+RGL  F
Sbjct  7    RKPHAVCVPYPSQGHVTPLMQLAKLVHSRGFHITFVNTEFNHRRLIRSAGPDSVRGLVDF  66

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE IPDGLPPSD+DATQD+P+LC ST   CL PF+DLLARLN   ++++VPPVSCI+SD
Sbjct  67   RFEAIPDGLPPSDLDATQDVPALCDSTRKNCLAPFRDLLARLN---SSSDVPPVSCIISD  123

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+MSF + AAEELGIP+V FW  SA  FMG +HY + + +G  P K
Sbjct  124  GVMSFAIEAAEELGIPEVQFWTASACSFMGYLHYREFIRRGIFPFK  169



>dbj|BAO51844.1| UDP-glycosyltransferase 85A28 [Vitis vinifera]
Length=473

 Score =   245 bits (625),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 132/166 (80%), Gaps = 5/166 (3%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLKLAKLLH +GF ITFVNTEFNH RL +++GP SL GLP+F
Sbjct  5    EKPHAVCIPYPAQGHINPMLKLAKLLHFRGFRITFVNTEFNHTRLLKAQGPNSLNGLPTF  64

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +FETIPDGLPPS+VDATQDIPSLC ST   CL PF+ LLA+LN        PPV+CI SD
Sbjct  65   QFETIPDGLPPSNVDATQDIPSLCASTKKNCLAPFRRLLAKLNDRG-----PPVTCIFSD  119

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             +MSFTL AA+ELGIPD+L W  SA GFM  + Y  L+DKG+TPLK
Sbjct  120  AVMSFTLDAAQELGIPDLLLWTASACGFMAYVQYRSLIDKGFTPLK  165



>emb|CBI34065.3| unnamed protein product [Vitis vinifera]
Length=202

 Score =   236 bits (603),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 129/165 (78%), Gaps = 1/165 (1%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPH V +PYPAQ H+N MLKLAKLLHNKGF ++FVNTE+NH+RL RSRGP SL GL  FR
Sbjct  9    KPHVVLIPYPAQGHVNPMLKLAKLLHNKGFFVSFVNTEYNHKRLLRSRGPNSLDGLSDFR  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLPPSD DATQDIPSLCVST   CL PF  L+ +LN  + +   PPVSCIVSDG
Sbjct  69   FETIPDGLPPSDADATQDIPSLCVSTTKNCLAPFCALITKLNDPSYSPG-PPVSCIVSDG  127

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            +MSFTL AAE+ G+P+V+FW  SA GF+G  HY  L+ +G  PL+
Sbjct  128  VMSFTLDAAEKFGVPEVVFWTTSACGFLGYRHYRNLIRRGLIPLQ  172



>ref|XP_008343335.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=176

 Score =   235 bits (600),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 136/166 (82%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVCVP+PAQ HIN ML +AKLLH KGFHITFV TEFNH+RL +SRGP +L GLPSF
Sbjct  8    EKPHAVCVPFPAQGHINPMLNVAKLLHFKGFHITFVYTEFNHKRLLKSRGPNALDGLPSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +FETIPDGLPP+D + TQDIPSLC ST   CL  F++LL+++N   ++ + PPVSC+VSD
Sbjct  68   QFETIPDGLPPTDANVTQDIPSLCHSTRKKCLPHFRELLSKVN---SSPDSPPVSCVVSD  124

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+MSFTL AA+ELGIP+VLFW  SA GF+  M + +L++KG TPLK
Sbjct  125  GVMSFTLDAAQELGIPEVLFWTTSACGFLAYMQFYRLIEKGLTPLK  170



>ref|XP_010056398.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   245 bits (626),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M SN  E  +KPHAVCVP+PAQ HI  ML LAKLLH++GFHITFVNTE+NH+RL RSRGP
Sbjct  1    MSSN--EMTQKPHAVCVPFPAQGHIKPMLCLAKLLHHRGFHITFVNTEYNHKRLLRSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSFRF TIPDGLPPSD DATQDIP+LC S+   CL  F+DLL  L+  +A +  
Sbjct  59   SALDGLPSFRFRTIPDGLPPSDADATQDIPTLCRSSRDLCLPYFRDLLRTLDEESATSGS  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSC+VSDG+MSFTL AAE  G+P VLFW  SA GFMG + Y  LVDKG +PL+
Sbjct  119  PPVSCVVSDGVMSFTLDAAEAAGVPLVLFWTTSACGFMGYVQYRSLVDKGLSPLR  173



>ref|XP_010056400.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   244 bits (624),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M SN  E  +KPHAVC+P+PAQ HI  ML LAKLLH++GFHITFVNTE+NH+RL RSRGP
Sbjct  1    MSSN--EMTQKPHAVCMPFPAQGHIKPMLSLAKLLHHRGFHITFVNTEYNHKRLLRSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSFRF TIPDGLPPSD DATQD+P+LC S+   CL  F+DLL  L+  +A +  
Sbjct  59   SALDGLPSFRFRTIPDGLPPSDADATQDVPTLCRSSRDLCLPYFRDLLRTLDEESATSGS  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSC+VSDG+MSFTL AAE  G+P VLFW  SA GFMG + Y  LVDKG +PL+
Sbjct  119  PPVSCVVSDGVMSFTLDAAEAAGVPLVLFWTTSACGFMGYVQYRSLVDKGLSPLR  173



>ref|XP_011016624.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=505

 Score =   245 bits (625),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 133/164 (81%), Gaps = 1/164 (1%)
 Frame = +1

Query  82   PHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFRF  261
            PH VC+P+PAQ HIN MLKLAK+LH K FHITFVNTEFNHRRL RSRG +SL GL +FRF
Sbjct  11   PHVVCLPFPAQGHINPMLKLAKILHQKDFHITFVNTEFNHRRLLRSRGLDSLDGLSTFRF  70

Query  262  ETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDGI  441
            ETIPDGLPPSD D+TQ +PSLC ST   CL PF+DLL+RLN+T+++  VPPV+CIVSD I
Sbjct  71   ETIPDGLPPSDADSTQHVPSLCDSTKKNCLAPFRDLLSRLNNTSSS-KVPPVTCIVSDCI  129

Query  442  MSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            MSFTL AA+ELGIP+V FW  S  GFM  + Y  L++KGY PLK
Sbjct  130  MSFTLKAAQELGIPNVFFWTASVCGFMSYLQYRPLIEKGYVPLK  173



>ref|XP_010064217.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   244 bits (623),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 134/175 (77%), Gaps = 2/175 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   +  +KPHAVC+P PAQ HIN ML LAKLLH +GFH+TFVNTE+NH RL RSRGP
Sbjct  1    MGS--IDMIQKPHAVCIPAPAQGHINPMLNLAKLLHCRGFHVTFVNTEYNHSRLLRSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSFRF TIPDGLPPSD D TQDIP+LC ST   CL  F+DLL RLN  +A +  
Sbjct  59   SSLDGLPSFRFRTIPDGLPPSDGDTTQDIPALCQSTQRCCLPYFQDLLKRLNEESATSGS  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSC+VSD  M+FTL AAE +G+P+VLFWPISA  FMG + +  L+DKG  PLK
Sbjct  119  PPVSCVVSDITMTFTLDAAEAIGVPEVLFWPISACAFMGFLQFRSLIDKGLVPLK  173



>ref|XP_002285770.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=473

 Score =   244 bits (622),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 132/166 (80%), Gaps = 5/166 (3%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLK+AKLLH +GF ITFVNTEFNH RL +++GP SL GLP+F
Sbjct  5    EKPHAVCIPYPAQGHINPMLKVAKLLHFRGFRITFVNTEFNHTRLLKAQGPNSLNGLPTF  64

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +FETIPDGLPPS+VDATQDIPSLC ST   CL PF+ LLA+LN        PPV+CI SD
Sbjct  65   QFETIPDGLPPSNVDATQDIPSLCASTKKNCLAPFRRLLAKLNDRG-----PPVTCIFSD  119

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             +MSFTL AA+ELGIPD+L W  SA GFM  + Y  L+DKG+TPLK
Sbjct  120  AVMSFTLDAAQELGIPDLLLWTASACGFMAYVQYRSLIDKGFTPLK  165



>ref|XP_011092429.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Sesamum 
indicum]
Length=478

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 134/168 (80%), Gaps = 6/168 (4%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKG-FHITFVNTEFNHRRLQRSRGPESLRGLP  249
            E KPHAVC+PYPAQ H+N MLKLAKLLH+ G FHITFVNTE+NHRRL +S GP ++ GL 
Sbjct  8    ESKPHAVCIPYPAQGHVNPMLKLAKLLHHHGGFHITFVNTEYNHRRLIKSGGPSAVEGLS  67

Query  250  SFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
             FRF TIPDGLPPSD D TQD+PSLCVST TTCL PF DLL++LN  A     PPVSCIV
Sbjct  68   DFRFHTIPDGLPPSDADTTQDVPSLCVSTTTTCLEPFCDLLSKLNSEA-----PPVSCIV  122

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            SDG+MSFTL AAE  G+P+VLFW  SA GF+G   Y +LV++G+TPL+
Sbjct  123  SDGVMSFTLKAAERFGLPEVLFWTTSACGFLGYRQYRRLVEEGHTPLR  170



>gb|ABW96222.1| glucosyltransferase [Linum usitatissimum]
Length=491

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 139/176 (79%), Gaps = 4/176 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS     + KPHAVC+PYPAQ HI  MLKLAKLLH++GFH+TFVNTE+NH RL++S   
Sbjct  1    MGSMGHSEKPKPHAVCIPYPAQGHITPMLKLAKLLHHRGFHVTFVNTEYNHNRLRKS---  57

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN-  405
            +++  LPSFRF TIPDGLPP+D D TQDIPSLC ST  TCL  FK+LLA+LN  A+  + 
Sbjct  58   QAVSDLPSFRFATIPDGLPPTDSDVTQDIPSLCESTRRTCLPHFKELLAKLNDVASFEDG  117

Query  406  VPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            VPPVSC+VSDG+MSFTL AAEELG+P+VLFW  SA GF+G MHY  L+D+G  PLK
Sbjct  118  VPPVSCVVSDGVMSFTLDAAEELGVPEVLFWTTSACGFLGYMHYRDLIDRGIVPLK  173



>gb|KJB79644.1| hypothetical protein B456_013G060400 [Gossypium raimondii]
Length=482

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 134/165 (81%), Gaps = 3/165 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+PYPAQ H+N MLK+AKLLH KGFHITFVNTE+NH+RL +SRGP +L GLP FR
Sbjct  9    KPHAVCIPYPAQGHVNPMLKVAKLLHFKGFHITFVNTEYNHKRLLKSRGPHALDGLPDFR  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            F TIPDGLPP D+DATQDIP+L  ST+  CL PF+ LL +LN   A + VPPV+CIV+DG
Sbjct  69   FGTIPDGLPPPDIDATQDIPALSDSTSKHCLAPFRRLLVKLN---ATSGVPPVTCIVADG  125

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             MSFTL AA+ELGIP VLFW  SA GF+   HY +L+D+G+TPLK
Sbjct  126  CMSFTLEAAKELGIPGVLFWTPSACGFLAYCHYRRLIDEGFTPLK  170



>gb|KFK44335.1| hypothetical protein AALP_AA1G244700 [Arabis alpina]
Length=485

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 137/175 (78%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS      +KPHAVCVPYPAQ HIN MLK+AKLLH +GFH+TFVNT +NH RL RSRG 
Sbjct  1    MGSAAVSGAQKPHAVCVPYPAQGHINPMLKVAKLLHARGFHVTFVNTIYNHNRLLRSRGA  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSF+FE+IPDGLP +D +ATQDIP+LC ST   CL PFKDLL ++N   A  +V
Sbjct  61   NALDGLPSFQFESIPDGLPETDAEATQDIPALCESTMKNCLTPFKDLLQQIN---ARDDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG MSFTL AA+ELG+P+VLFW  SA GF+  +H+ + ++KG +PLK
Sbjct  118  PPVSCIVSDGCMSFTLDAADELGVPEVLFWTTSACGFLAYLHFYRFIEKGLSPLK  172



>gb|KJB79650.1| hypothetical protein B456_013G060700 [Gossypium raimondii]
Length=478

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 133/165 (81%), Gaps = 3/165 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+PYPAQ H+N ML +AKLLH KGFHITFVNTE+NH RL +SR P +L  LP FR
Sbjct  9    KPHAVCIPYPAQGHVNPMLMVAKLLHFKGFHITFVNTEYNHERLLKSRAPHALNSLPDFR  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FET+PDGLPP D++ATQDIP+LC ST+  CL PF+ LLARLN    ++ +PPV+CIVSDG
Sbjct  69   FETVPDGLPPPDINATQDIPTLCDSTSKHCLTPFRQLLARLN---VSSGIPPVTCIVSDG  125

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             MSFTL AA+E+GIPDVL W  SA GF+   HY +L++KG+TPLK
Sbjct  126  CMSFTLEAAQEVGIPDVLLWTPSACGFLAYCHYRRLIEKGFTPLK  170



>ref|XP_008219315.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 138/173 (80%), Gaps = 4/173 (2%)
 Frame = +1

Query  55   SNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPES  234
            S+NC  EK PHAVC+P+PAQ HIN +LKLAKLLH KGFHITFVNTEFNH+RL +SRGP S
Sbjct  2    SSNCLIEK-PHAVCIPFPAQGHINPLLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNS  60

Query  235  LRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPP  414
            L G PSFRFETIPDGLPP+D +ATQDIPSLC ST    L  F+DLL++LN   ++ + PP
Sbjct  61   LDGFPSFRFETIPDGLPPTDANATQDIPSLCDSTRKRSLPYFRDLLSKLN---SSPDCPP  117

Query  415  VSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            VSC+VSDG M FTL AA+E G+P+VLFW  SA GF+  +HY + ++KG TPLK
Sbjct  118  VSCVVSDGAMGFTLDAAQEFGLPEVLFWTTSACGFLAYVHYHRFIEKGLTPLK  170



>ref|XP_007141200.1| hypothetical protein PHAVU_008G175500g [Phaseolus vulgaris]
 gb|ESW13194.1| hypothetical protein PHAVU_008G175500g [Phaseolus vulgaris]
Length=484

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 132/166 (80%), Gaps = 4/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            KKPHAVC+PYPAQ HIN MLKLAKLLH KGFHITFVN+E+N +RL +SRG  SL  L SF
Sbjct  8    KKPHAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNSEYNQKRLLKSRGSSSLHALSSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLP SDVDATQDIPSLC ST  TCL  F+ LLA+LN++      PPVSCIVSD
Sbjct  68   RFETIPDGLPDSDVDATQDIPSLCESTRRTCLPHFRKLLAKLNNSDG----PPVSCIVSD  123

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+M+FTL AA+ELG+P+VLFW  SA GFM  + Y QL  KG TPLK
Sbjct  124  GVMTFTLDAAQELGLPEVLFWTTSACGFMCYLQYEQLFRKGITPLK  169



>ref|XP_010477496.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Camelina sativa]
Length=508

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 138/179 (77%), Gaps = 3/179 (2%)
 Frame = +1

Query  37   RKREMGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQR  216
             K++M S      +KPH VCVP+PAQ HIN MLK+AKLLH +GFH+TFVNT +NH+RL R
Sbjct  19   EKKKMASQTVSRGQKPHVVCVPFPAQGHINPMLKVAKLLHTRGFHVTFVNTIYNHKRLLR  78

Query  217  SRGPESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAA  396
            SRGP +L G+PSFR+E+IPDGLP ++ DATQD+P LC ST   CL PFK+LL R+N    
Sbjct  79   SRGPNALNGIPSFRYESIPDGLPETNKDATQDVPPLCASTKKNCLAPFKELLRRIN---T  135

Query  397  ATNVPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            A +VPPVS IVSDGIMSFTL AAEELG+PDV+FW  SA GF+  +++   ++KG +PLK
Sbjct  136  ADDVPPVSSIVSDGIMSFTLDAAEELGVPDVVFWTTSACGFLAYLYFYSFIEKGLSPLK  194



>gb|AID16084.1| flavonoid 3-O-glucosyltransferase, partial [Morus alba]
Length=333

 Score =   238 bits (606),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 132/165 (80%), Gaps = 1/165 (1%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPH VCVPYP+Q H+N M++LAKLLH++GFH+TFVNTEFNH RL RSRG +S++GLP FR
Sbjct  8    KPHVVCVPYPSQGHVNPMMQLAKLLHSRGFHVTFVNTEFNHNRLIRSRGADSVKGLPDFR  67

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FE IP+GLPPSD DATQD+P+LC ST   CL PFK+LL +LN + A   VPPV+CI+SDG
Sbjct  68   FEAIPEGLPPSDRDATQDVPALCDSTRKNCLAPFKELLLKLN-SLAPEKVPPVTCIISDG  126

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            +MSF + A EELGIP+V FW  SA  FMG +H+ +L+++G  P K
Sbjct  127  VMSFAIKAGEELGIPEVQFWTASACSFMGYLHFDELINRGIIPFK  171



>gb|KFK44329.1| hypothetical protein AALP_AA1G244100 [Arabis alpina]
Length=483

 Score =   242 bits (618),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 135/167 (81%), Gaps = 3/167 (2%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            E+KPH VCVPYPAQ HIN MLK+AKLLH KGFH+TFVNT +NH RL RSRGP +L GLPS
Sbjct  9    EQKPHVVCVPYPAQGHINPMLKVAKLLHAKGFHVTFVNTIYNHNRLLRSRGPHALDGLPS  68

Query  253  FRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            FRFE+IPDGLP +DVDAT+DIP+LC ST   CL PFK+LL R+N   A  +VPPVSCIVS
Sbjct  69   FRFESIPDGLPETDVDATRDIPALCESTVKNCLTPFKELLRRIN---AGDDVPPVSCIVS  125

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            DG M+FT+ AAEELGIP+VLF   SA GF+  +H+ + ++KG +PLK
Sbjct  126  DGCMTFTIDAAEELGIPEVLFRTTSACGFLAYLHFYRFIEKGLSPLK  172



>gb|EYU43443.1| hypothetical protein MIMGU_mgv1a018722mg [Erythranthe guttata]
Length=475

 Score =   242 bits (617),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 134/169 (79%), Gaps = 6/169 (4%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+P+PAQ HIN MLKLAKLLHN GFHITFVNTE+NH RL +SRGP+SL GLPSFR
Sbjct  9    KPHAVCIPFPAQGHINPMLKLAKLLHNNGFHITFVNTEYNHHRLLKSRGPDSLTGLPSFR  68

Query  259  FETIPDGLPP-----SDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSC  423
            FETIPDGLPP     +D DATQDIPSLC ST TTCL PF++LLA+LN T A++ VPPVSC
Sbjct  69   FETIPDGLPPPSEDDADADATQDIPSLCESTTTTCLAPFRNLLAKLNDT-ASSEVPPVSC  127

Query  424  IVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPL  570
            IVSDG+MSFT  AAEEL IP+VLFW  SA GF     Y  +  K Y PL
Sbjct  128  IVSDGVMSFTADAAEELAIPEVLFWTTSACGFYAYTQYEYVFQKEYAPL  176



>gb|KCW73112.1| hypothetical protein EUGRSUZ_E01563 [Eucalyptus grandis]
Length=230

 Score =   234 bits (597),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 132/173 (76%), Gaps = 2/173 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M SN  E  +KPH VC+P+PAQ HI  ML LAKLLH++GFHITFVNTE+NH+RL RSRGP
Sbjct  1    MSSN--EMTQKPHVVCIPFPAQGHIKPMLCLAKLLHHRGFHITFVNTEYNHKRLLRSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSFRF TIPDGLPPS+ DATQD+P+LC S+   CL  F+DLL  L+  +A +  
Sbjct  59   SALDGLPSFRFRTIPDGLPPSNADATQDVPTLCRSSRDLCLPYFRDLLQTLDEESATSGS  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTP  567
            P VSC+VSDG+MSFTL AAE  G+P VLFW  SA GFMG + Y  L+DKG +P
Sbjct  119  PLVSCVVSDGVMSFTLDAAEAAGVPLVLFWTTSACGFMGYVQYRSLIDKGLSP  171



>ref|XP_010477495.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Camelina sativa]
Length=484

 Score =   242 bits (617),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 137/175 (78%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+     +KPH VCVPYPAQ HIN M+K+AKLL  KGFH+TF NT +NH RL RSRGP
Sbjct  1    MGSHVVPNAQKPHVVCVPYPAQGHINPMMKMAKLLDAKGFHVTFCNTVYNHNRLLRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             ++ GLPSFRFE+IPDGLP +DVD TQDIPSLC ST+  CL PFK+LL ++N   A  +V
Sbjct  61   NAVDGLPSFRFESIPDGLPETDVDVTQDIPSLCESTSKHCLAPFKELLRQIN---AKDDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCI+SDG MSFTL AAEELG+P+VLFW  SA GF+  ++Y + ++KG +PLK
Sbjct  118  PPVSCILSDGCMSFTLDAAEELGVPEVLFWTTSACGFLAYLYYYRFIEKGLSPLK  172



>ref|XP_010056397.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 134/175 (77%), Gaps = 2/175 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M SN  E  +KPHAVC+P+PAQ HI  ML LAKLLH++GFHITFVNTE+NH+RL RSRGP
Sbjct  1    MSSN--EMTQKPHAVCIPFPAQGHIKPMLCLAKLLHHRGFHITFVNTEYNHKRLLRSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSFRF TIPDGLPP D D TQDIP+LC S+   CL  F+DLL  L+  +A +  
Sbjct  59   SALDGLPSFRFRTIPDGLPPPDADVTQDIPTLCRSSRDLCLPYFRDLLQTLDEESATSGS  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSC+VSDG+MSFTL AAE  G+P VLFW  SA GFMG + Y  LVDKG +PL+
Sbjct  119  PPVSCVVSDGVMSFTLDAAEAAGVPLVLFWTTSACGFMGYVQYRSLVDKGLSPLR  173



>gb|AFJ52992.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=491

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 138/176 (78%), Gaps = 4/176 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS     + KPHAVC+PYPAQ H   MLKLAKLLH++GFH+TFVNTE+NH RL++S   
Sbjct  1    MGSMGHSEKPKPHAVCIPYPAQGHKTPMLKLAKLLHHRGFHVTFVNTEYNHNRLRKS---  57

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN-  405
            +++  LPSFRF TIPDGLPP+D D TQDIPSLC ST  TCL  FK+LLA+LN  A+  + 
Sbjct  58   QAVSDLPSFRFATIPDGLPPTDSDVTQDIPSLCESTRRTCLPHFKELLAKLNDVASFEDG  117

Query  406  VPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            VPPVSC+VSDG+MSFTL AAEELG+P+VLFW  SA GF+G MHY  L+D+G  PLK
Sbjct  118  VPPVSCVVSDGVMSFTLDAAEELGVPEVLFWTTSACGFLGYMHYRDLIDRGIVPLK  173



>ref|XP_006373048.1| hypothetical protein POPTR_0017s079102g, partial [Populus trichocarpa]
 gb|ERP50845.1| hypothetical protein POPTR_0017s079102g, partial [Populus trichocarpa]
Length=182

 Score =   231 bits (589),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 131/170 (77%), Gaps = 4/170 (2%)
 Frame = +1

Query  67   EFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGL  246
            E   KPHAVC+P+PAQ HIN MLKLAKLLH KGFHITFVNTE+NHRRL +SRG  SL GL
Sbjct  5    ELANKPHAVCIPFPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHRRLLKSRGSSSLDGL  64

Query  247  PSFRFETIPDGLPPSDV-DATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSC  423
            P F+F TIPDGLPPSD+ DATQDIPSLC  T+T CL PF+DL+++LN   +++ VP V+C
Sbjct  65   PDFQFMTIPDGLPPSDIADATQDIPSLCDCTSTICLAPFRDLISKLN---SSSIVPQVTC  121

Query  424  IVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            I+SD  MSFTL AAEE GIP+ L W  SA G +G   Y  L+++G  PLK
Sbjct  122  IISDACMSFTLDAAEEFGIPEALLWTPSACGVLGYAQYRSLIERGLIPLK  171



>ref|XP_010459988.1| PREDICTED: UDP-glycosyltransferase 85A2 [Camelina sativa]
Length=484

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 137/175 (78%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+     +KPH VCVPYPAQ HIN M+K+AKLL+ KGFH+TF NT +NH RL+RSRGP
Sbjct  1    MGSHVVPNAQKPHVVCVPYPAQGHINPMMKMAKLLYAKGFHVTFCNTVYNHNRLRRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             ++ GLPSFRFE+IPDGLP +DVD TQDIPSLC STA  CL PFK+LL ++N      +V
Sbjct  61   NAVDGLPSFRFESIPDGLPETDVDVTQDIPSLCESTAKHCLAPFKELLRQIN---TNDDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCI+SDG MSFTL AA+ELGIP+VLFW  SA GF+  ++Y + ++KG  PLK
Sbjct  118  PPVSCILSDGCMSFTLDAAKELGIPEVLFWTTSACGFLAYLNYYRFIEKGLAPLK  172



>ref|XP_009145352.1| PREDICTED: UDP-glycosyltransferase 85A7 isoform X2 [Brassica 
rapa]
Length=434

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 130/166 (78%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPH VCVP+PAQ HIN MLK+AKLLH KGFH+TFVNT +NH+RL RSRGP +L G PSF
Sbjct  10   QKPHVVCVPHPAQGHINPMLKVAKLLHAKGFHVTFVNTVYNHKRLLRSRGPNALDGFPSF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE+IPDGLP +D + TQDIPSLCVST   CL PFKDLL ++N      +VPPVSCIVSD
Sbjct  70   RFESIPDGLPETDGNTTQDIPSLCVSTMNNCLSPFKDLLRKIN---TGDDVPPVSCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             +MSFTL AAEELG+PDV+FW  SA G M  + + + ++KG TP K
Sbjct  127  AVMSFTLDAAEELGVPDVVFWTASACGLMAFLQFQRFIEKGLTPFK  172



>gb|KEH28097.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=483

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 135/168 (80%), Gaps = 4/168 (2%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKG-FHITFVNTEFNHRRLQRSRGPESLRGLP  249
            E KPH VCVP+PAQ HIN MLKLAKLLH K  FH+TFVNTE+NH+RL ++RGP SL GLP
Sbjct  8    ENKPHVVCVPFPAQGHINPMLKLAKLLHFKSDFHVTFVNTEYNHKRLLKARGPNSLNGLP  67

Query  250  SFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            SFRFETIPDGLP SD+D+TQDIPSLC ST+ TCL  FK L+++LN+   A + PPV+CI+
Sbjct  68   SFRFETIPDGLPESDLDSTQDIPSLCESTSKTCLPHFKKLISKLNN---AIDTPPVTCII  124

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             DG+MSFT+ AAEEL IP VLFW  SA GFM  M + QL++KG TPLK
Sbjct  125  GDGVMSFTIDAAEELNIPAVLFWTTSACGFMCYMQFRQLIEKGLTPLK  172



>ref|XP_008808008.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Phoenix dactylifera]
Length=477

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 131/166 (79%), Gaps = 7/166 (4%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPH VC+PYPAQ H+  MLKLAKLLH+KGFHITFVNTEFNH RL +SRGP +L GLP F
Sbjct  7    EKPHVVCIPYPAQGHVTPMLKLAKLLHSKGFHITFVNTEFNHCRLLKSRGPSALDGLPDF  66

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RF TIPDGLPPSD DATQDIPSLC ST TTCL  F+ LL+ L+        PP++CI+SD
Sbjct  67   RFATIPDGLPPSDADATQDIPSLCYSTMTTCLPHFRRLLSMLDG-------PPLTCIISD  119

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+MSFTL AA+ELG+P+VLFW  SA GFM  +HY  L++KG  PLK
Sbjct  120  GVMSFTLDAAKELGVPEVLFWTTSACGFMSYLHYRHLIEKGLVPLK  165



>ref|XP_008219322.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 134/166 (81%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+P+PAQ HIN MLK+AKLLH KGFHITFVNTEFNH+RL +SRGP S  GLPSF
Sbjct  8    EKPHAVCIPFPAQGHINPMLKVAKLLHCKGFHITFVNTEFNHKRLLKSRGPNSHDGLPSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE IPDGLPP++   TQDIPSLC ST   CL  F++LL++LN + A+   PPVSCIVSD
Sbjct  68   RFENIPDGLPPTNASVTQDIPSLCYSTRRHCLPHFRELLSKLNSSPAS---PPVSCIVSD  124

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G MSFTL AAEELGIP+VLFW  SA GFM  + Y +L++KG TPLK
Sbjct  125  GAMSFTLDAAEELGIPEVLFWTTSACGFMSYVQYHRLIEKGLTPLK  170



>emb|CDP01079.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 133/167 (80%), Gaps = 1/167 (1%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            EKKPHAVC+P+PAQ HI  MLKLAKLLH KGFHITFVNTEFNHRRL +SRGP++L GLP 
Sbjct  8    EKKPHAVCIPFPAQGHIKPMLKLAKLLHQKGFHITFVNTEFNHRRLLKSRGPDALNGLPD  67

Query  253  FRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            F+F+ IPDGLPPSDVDATQDI SLC S    CLGPF++LLA LN T +++ V PVSCIVS
Sbjct  68   FQFKAIPDGLPPSDVDATQDILSLCESIDRNCLGPFRELLAELNDT-SSSEVAPVSCIVS  126

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            DG  +FTLAAA+ELGIP+VL W  SA  ++    + + ++KG  PLK
Sbjct  127  DGATTFTLAAAQELGIPEVLLWTSSAPSYLAFFQFDKFIEKGIIPLK  173



>ref|XP_009341756.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 137/166 (83%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+P+PAQ HIN ML +AKLLH KGFHITFVNTEFNH+RL +SRG  SL GLPSF
Sbjct  8    EKPHAVCIPFPAQGHINPMLNVAKLLHFKGFHITFVNTEFNHKRLLKSRGSNSLDGLPSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +FETIPDGLPP+  + TQDIPSLC ST  TCL  F++LL++LN   ++ + PPVSCIVSD
Sbjct  68   QFETIPDGLPPTKANVTQDIPSLCHSTKKTCLPHFRELLSKLN---SSPDSPPVSCIVSD  124

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+MSFTL AA+ELGIP+VLFW  SA GF+  M + +L++KG+TPLK
Sbjct  125  GVMSFTLDAAQELGIPEVLFWTTSACGFLAYMQFYRLIEKGHTPLK  170



>emb|CDP01087.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 134/168 (80%), Gaps = 1/168 (1%)
 Frame = +1

Query  70   FEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLP  249
             EKKPHAVC+P  AQ HIN MLKLAKLLH+ GFHITFVNTEFNHRR  +SRGP++L GLP
Sbjct  7    LEKKPHAVCIPAAAQGHINPMLKLAKLLHHNGFHITFVNTEFNHRRWLKSRGPDALNGLP  66

Query  250  SFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
             F+F+ IPDGLPPSD DATQD  +LC S   TCLGPF++LLA LN T +++ VPPVSCIV
Sbjct  67   DFQFKAIPDGLPPSDADATQDPAALCESVDRTCLGPFRELLAELNDT-SSSKVPPVSCIV  125

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            SD I +FTLAAAEEL IP+VLFW  SA  ++G   Y++L++KG  PLK
Sbjct  126  SDAITAFTLAAAEELCIPEVLFWTASACSYLGYFQYAKLMEKGIIPLK  173



>ref|XP_002285779.1| PREDICTED: 7-deoxyloganetin glucosyltransferase isoform X2 [Vitis 
vinifera]
Length=474

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 133/167 (80%), Gaps = 5/167 (3%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            EKKPHAVC+P+PAQ HI  ML LAKLLH +GFHITFVNTEFNHRRL ++RGP SL GLPS
Sbjct  5    EKKPHAVCIPFPAQGHIKPMLNLAKLLHFRGFHITFVNTEFNHRRLLKARGPNSLDGLPS  64

Query  253  FRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            F+FETIPDGL PSDV+ATQDIPSLCVST    L PF+ LL++LNH     N PPV+CIVS
Sbjct  65   FQFETIPDGLQPSDVNATQDIPSLCVSTKNNLLPPFRCLLSKLNH-----NGPPVTCIVS  119

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            D  ++ TL AA+ELGIP +LFW  SA GFMG  HY  LV+KG+ PLK
Sbjct  120  DSSLTSTLDAAQELGIPGLLFWTASACGFMGYAHYRTLVNKGFIPLK  166



>ref|XP_010498706.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Camelina sativa]
Length=484

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 134/166 (81%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPH VCVPYPAQ HIN M+K+AKLL+ KGFH+TFVNT +NH RL RSRGP+++ GL SF
Sbjct  10   QKPHVVCVPYPAQGHINPMMKMAKLLYAKGFHVTFVNTVYNHNRLLRSRGPKAVDGLASF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE+IPDGLP +DVD TQDIPSLC STA  CL PFK+LL ++N   A  +VPPVSCI+SD
Sbjct  70   RFESIPDGLPETDVDVTQDIPSLCESTAKHCLAPFKELLRQIN---ANDDVPPVSCILSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G MSFTL AAEELGIP+VLFW  SA GF+  ++Y + ++KG  PLK
Sbjct  127  GCMSFTLDAAEELGIPEVLFWTTSACGFLAYLNYYRFIEKGLAPLK  172



>ref|XP_002323758.2| hypothetical protein POPTR_0017s07930g [Populus trichocarpa]
 gb|EEF03891.2| hypothetical protein POPTR_0017s07930g [Populus trichocarpa]
Length=482

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 134/170 (79%), Gaps = 4/170 (2%)
 Frame = +1

Query  67   EFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGL  246
            E   KPHAVC+P+PAQ HIN MLKLAKLLH KGFHITFVNTE+NHRRL +SRG  SL GL
Sbjct  5    ELANKPHAVCIPFPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHRRLLKSRGSSSLDGL  64

Query  247  PSFRFETIPDGLPPSDV-DATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSC  423
            P F+F+TIPDGLPPSD+ DATQDIPSLC  T+TTCL PF+DL+A+LN ++    VP V+C
Sbjct  65   PEFQFKTIPDGLPPSDIADATQDIPSLCDCTSTTCLAPFRDLIAKLNSSSI---VPQVTC  121

Query  424  IVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            I+SD  MSFTL AAEE GIP+ LFW  SA G +G   Y  L+++G TPLK
Sbjct  122  IISDACMSFTLDAAEEFGIPEALFWTPSACGVLGYAQYRSLIERGLTPLK  171



>ref|XP_010676160.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=483

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 134/168 (80%), Gaps = 4/168 (2%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            ++KPHAVCVPYPAQ HIN ML+LAKLLH+KGFHITFVNTE+NH RL RSRGP ++   PS
Sbjct  7    QQKPHAVCVPYPAQGHINPMLQLAKLLHSKGFHITFVNTEYNHNRLVRSRGPGAVANRPS  66

Query  253  FRFETIPDGLPPS-DVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            FRFETI DG+PPS DVD+TQDIPSLC+ST   CLGPFK LLARLN    A +VPPVSC+V
Sbjct  67   FRFETITDGMPPSDDVDSTQDIPSLCISTEKHCLGPFKRLLARLNE---AGDVPPVSCVV  123

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            SDG M FT+ AA+ELGIP+VL W  SA GF+G   + +L++ G  P K
Sbjct  124  SDGAMFFTIDAAQELGIPEVLLWTASACGFLGYAQFGKLIELGLAPFK  171



>ref|XP_010060021.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X1 [Eucalyptus grandis]
Length=499

 Score =   240 bits (613),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 133/172 (77%), Gaps = 0/172 (0%)
 Frame = +1

Query  58   NNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESL  237
            ++ E  + PHAVC+PYPAQ HIN ML L KLLH++GFH+TFVNTE+NH RL RSR P SL
Sbjct  2    SSIEMTQMPHAVCIPYPAQGHINPMLNLPKLLHHRGFHVTFVNTEYNHSRLLRSRDPSSL  61

Query  238  RGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPV  417
             GLPSF+F TIPDGLPPSD DATQD+P+LC ST  +CL   +DLL RLN  +A +  P V
Sbjct  62   DGLPSFQFRTIPDGLPPSDADATQDVPALCQSTQKSCLPYLRDLLERLNEESATSGSPSV  121

Query  418  SCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            SC+VSDG+MSFTL AA+ + +P+VLFW +SA GFMG + Y  L+DKG  PLK
Sbjct  122  SCVVSDGVMSFTLDAAKAVSMPEVLFWTMSACGFMGYVQYRSLIDKGLAPLK  173



>emb|CDY46643.1| BnaA07g10530D [Brassica napus]
Length=491

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 137/175 (78%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+     +KPH VC+PYPAQ HIN MLK+AKLLH KGFH+TFVNT +NH+RL RSRGP
Sbjct  1    MGSHVVCNVQKPHVVCIPYPAQGHINPMLKVAKLLHAKGFHVTFVNTIYNHKRLLRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSF+FE IPDGLP ++VDATQDIP+LC ST   CL PFK+LL ++N   A  +V
Sbjct  61   NALDGLPSFQFEAIPDGLPETEVDATQDIPTLCESTMKNCLTPFKELLRQIN---ARKDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG+MSFTL AAEELG+P+VLFW  SASG M  +H+   ++KG  P +
Sbjct  118  PPVSCIVSDGVMSFTLDAAEELGLPEVLFWTPSASGVMAYLHFYLFIEKGLFPFE  172



>gb|KCW73111.1| hypothetical protein EUGRSUZ_E01562, partial [Eucalyptus grandis]
Length=428

 Score =   238 bits (608),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+P+PAQ HI  ML LAKLLH++GFHITFVNTE+NH+RL RSRGP +L GLPSF
Sbjct  3    QKPHAVCIPFPAQGHIKPMLCLAKLLHHRGFHITFVNTEYNHKRLLRSRGPSALDGLPSF  62

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RF TIPDGLPP D D TQDIP+LC S+   CL  F+DLL  L+  +A +  PPVSC+VSD
Sbjct  63   RFRTIPDGLPPPDADVTQDIPTLCRSSRDLCLPYFRDLLQTLDEESATSGSPPVSCVVSD  122

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+MSFTL AAE  G+P VLFW  SA GFMG + Y  LVDKG +PL+
Sbjct  123  GVMSFTLDAAEAAGVPLVLFWTTSACGFMGYVQYRSLVDKGLSPLR  168



>ref|XP_009103242.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Brassica rapa]
Length=491

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 137/175 (78%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+     +KPH VC+PYPAQ HIN MLK+AKLLH KGFH+TFVNT +NH+RL RSRGP
Sbjct  1    MGSHVVCNVQKPHVVCIPYPAQGHINPMLKVAKLLHAKGFHVTFVNTIYNHKRLLRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSF+FE IPDGLP ++VDATQDIP+LC ST   CL PFK+LL ++N   A  +V
Sbjct  61   NALDGLPSFQFEAIPDGLPETEVDATQDIPTLCESTMKNCLTPFKELLRQIN---ARKDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PP+SCIVSDG+MSFTL AAEELG+P+VLFW  SASG M  +H+   ++KG  P +
Sbjct  118  PPISCIVSDGVMSFTLDAAEELGLPEVLFWTPSASGVMAYLHFYLFIEKGLFPFE  172



>gb|KFK44331.1| hypothetical protein AALP_AA1G244300 [Arabis alpina]
Length=483

 Score =   239 bits (611),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 130/166 (78%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPH VCVP+PAQ HIN MLK+AKLLH KGFH+TFVNT +NH RL RSRGP++L GLPSF
Sbjct  10   RKPHVVCVPHPAQGHINPMLKVAKLLHAKGFHVTFVNTIYNHNRLLRSRGPDALDGLPSF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE+IPDGLP SD D TQDIP+LCVST   CL PF +LL R+N      +VPPVSCI+SD
Sbjct  70   RFESIPDGLPESDGDTTQDIPALCVSTTKNCLAPFMELLRRIN---TRDDVPPVSCIISD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+MSFTL AAEELG+PDV FW  SA GFM ++ +   ++KG  P K
Sbjct  127  GVMSFTLDAAEELGVPDVFFWTPSACGFMALLQFPHFIEKGVAPFK  172



>ref|XP_007047909.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOX92066.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=478

 Score =   239 bits (611),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 136/166 (82%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYP+Q H+  M++LAKLLH++GFHITFVNTEFNHRRL RS+GP+S++GLP F
Sbjct  7    RKPHAVCIPYPSQGHVTPMMQLAKLLHSRGFHITFVNTEFNHRRLIRSKGPDSVKGLPDF  66

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIP+GLPPSD DATQD+P+LC ST   CL PF +LL++LN +A    VPPV+CI+SD
Sbjct  67   RFETIPEGLPPSDRDATQDVPALCDSTRKNCLAPFLELLSKLNSSA---QVPPVTCIISD  123

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+MSF + AAE LGIP+V FW  SA  FMG + +S+L+++G  P K
Sbjct  124  GVMSFAIKAAEVLGIPEVQFWTASACSFMGYLQFSELLERGIIPFK  169



>ref|XP_002532877.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF29506.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=471

 Score =   239 bits (610),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 134/166 (81%), Gaps = 1/166 (1%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVCVPYP+Q H+  M++LAKLLH++GFHITFVNT+FNH RL RSRGP+S++GLP F
Sbjct  7    RKPHAVCVPYPSQGHVTPMMQLAKLLHSRGFHITFVNTDFNHTRLIRSRGPDSVKGLPDF  66

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLPPS  DATQD+PSLC ST   CL PFK+L+++LN ++ +T VPPVSCI+SD
Sbjct  67   RFETIPDGLPPSTFDATQDVPSLCDSTRKNCLAPFKELVSKLN-SSPSTEVPPVSCIISD  125

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+MSF + AAE+L IP V FW  SA  FM  +HY++L  +G  P K
Sbjct  126  GVMSFGIKAAEDLSIPQVQFWTASACSFMAYLHYNELERRGIMPYK  171



>ref|XP_010937416.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Elaeis 
guineensis]
Length=477

 Score =   239 bits (610),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 132/166 (80%), Gaps = 7/166 (4%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPH VCVPYPAQ H+  MLKLAKLLH+KGF+ITFVNTEFNHRRL +S+GP SL GLP F
Sbjct  7    EKPHVVCVPYPAQGHVTPMLKLAKLLHSKGFYITFVNTEFNHRRLLKSQGPSSLDGLPDF  66

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RF TIPDGLPPSD +ATQD+PSLC ST TTCL  F+ LL+ L+        PP++CI+SD
Sbjct  67   RFSTIPDGLPPSDANATQDVPSLCYSTMTTCLPHFRRLLSMLDG-------PPLTCIISD  119

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+MSFTL AA+ELG+P+VLFW  SA GFM  +HY  L+D+G  PLK
Sbjct  120  GVMSFTLDAAKELGVPEVLFWTTSACGFMAYLHYRHLMDRGLVPLK  165



>ref|XP_006307682.1| hypothetical protein CARUB_v10009316mg [Capsella rubella]
 gb|EOA40580.1| hypothetical protein CARUB_v10009316mg [Capsella rubella]
Length=406

 Score =   237 bits (605),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 134/175 (77%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS      +KPH VCVPYPAQ HIN MLK+AKLL+ KGFH+TFVNT +NH RL RSRGP
Sbjct  1    MGSPAVSSGQKPHVVCVPYPAQGHINPMLKVAKLLYAKGFHVTFVNTVYNHNRLLRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSFRFE+IPDGLP +D D TQD PS+CVST   CL PFK LL R+N+     +V
Sbjct  61   NALDGLPSFRFESIPDGLPETDGDRTQDTPSVCVSTEKNCLAPFKKLLRRINN---GDDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG+MSFTL AAEELG+P+V+FW  SA GF+  +H+   ++KG +P +
Sbjct  118  PPVSCIVSDGVMSFTLDAAEELGVPEVIFWTNSACGFITFLHFHLFIEKGLSPFR  172



>ref|XP_009145349.1| PREDICTED: UDP-glycosyltransferase 85A7 isoform X1 [Brassica 
rapa]
 ref|XP_009145350.1| PREDICTED: UDP-glycosyltransferase 85A7 isoform X1 [Brassica 
rapa]
Length=482

 Score =   239 bits (610),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 130/166 (78%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPH VCVP+PAQ HIN MLK+AKLLH KGFH+TFVNT +NH+RL RSRGP +L G PSF
Sbjct  10   QKPHVVCVPHPAQGHINPMLKVAKLLHAKGFHVTFVNTVYNHKRLLRSRGPNALDGFPSF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE+IPDGLP +D + TQDIPSLCVST   CL PFKDLL ++N      +VPPVSCIVSD
Sbjct  70   RFESIPDGLPETDGNTTQDIPSLCVSTMNNCLSPFKDLLRKIN---TGDDVPPVSCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             +MSFTL AAEELG+PDV+FW  SA G M  + + + ++KG TP K
Sbjct  127  AVMSFTLDAAEELGVPDVVFWTASACGLMAFLQFQRFIEKGLTPFK  172



>gb|ABK95289.1| unknown [Populus trichocarpa]
Length=479

 Score =   239 bits (610),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 133/168 (79%), Gaps = 5/168 (3%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVCVP+PAQ H+  M+ LAKLLH++GFHITFVNTEFNHRRL RSRGP+S+ GLP F
Sbjct  7    RKPHAVCVPFPAQGHVTPMMHLAKLLHSRGFHITFVNTEFNHRRLIRSRGPDSVEGLPDF  66

Query  256  RFETIPDG--LPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            RFETIPDG  LPPSD DATQD+PSLC ST T CL PFK+LL +LN   +++ VPPV+C++
Sbjct  67   RFETIPDGLPLPPSDFDATQDVPSLCDSTRTNCLAPFKELLTKLN---SSSEVPPVTCVI  123

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            SDG MSF + AAEE  IP V FW  SA  FMG +H+S+L  +G+ P K
Sbjct  124  SDGAMSFGIKAAEEFSIPQVQFWTASACSFMGYLHFSELTRRGFVPYK  171



>ref|XP_008234165.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
Length=480

 Score =   239 bits (610),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 140/175 (80%), Gaps = 4/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   E  KK HAVCVP+PAQ H+N M++LAKLLH++GFHITFVNTEFNHRRL RS+GP
Sbjct  1    MGSIG-EAPKKLHAVCVPFPAQGHVNPMMQLAKLLHSRGFHITFVNTEFNHRRLIRSKGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +S++GLP F+FETIPDGLPPSD DATQD+P+LC ST  TCLGPFK+L+ ++N   +++ V
Sbjct  60   DSVKGLPDFQFETIPDGLPPSDKDATQDVPALCDSTRKTCLGPFKELVTKIN---SSSQV  116

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            P V+CIV+DG+  F   AA+ELGIP+V FW  SA GF+G + YS+LV +G  P K
Sbjct  117  PQVTCIVADGVTGFGRQAAQELGIPEVQFWTASACGFVGYLQYSELVKRGVVPFK  171



>ref|XP_011009481.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=482

 Score =   239 bits (610),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 134/170 (79%), Gaps = 4/170 (2%)
 Frame = +1

Query  67   EFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGL  246
            +   KPHAVC+P+PAQ HIN MLKLAKLLH KGFHITFVNTE+NH+RL +SRG  SL GL
Sbjct  5    DLANKPHAVCIPFPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKSRGSSSLDGL  64

Query  247  PSFRFETIPDGLPPSDV-DATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSC  423
            P F F+TIPDGLPPSD+ DATQDIPSLC ST+TTCL PF+DL+A+LN ++    VP V+C
Sbjct  65   PDFEFKTIPDGLPPSDIADATQDIPSLCDSTSTTCLAPFRDLIAKLNSSSI---VPQVTC  121

Query  424  IVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            I+SD  MSFTL AAEE GIP+ LFW  SA G +G   Y  L+++G TPLK
Sbjct  122  IISDACMSFTLDAAEEFGIPEALFWTPSACGVLGYAQYRSLIERGLTPLK  171



>gb|KJB79645.1| hypothetical protein B456_013G060500 [Gossypium raimondii]
Length=482

 Score =   239 bits (610),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 129/164 (79%), Gaps = 3/164 (2%)
 Frame = +1

Query  82   PHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFRF  261
            PHAVC+PYPAQ H+N MLK+AKLLH KGFHITFVNTE+NH+RL  SRGP +L GLP FRF
Sbjct  10   PHAVCIPYPAQGHVNPMLKVAKLLHFKGFHITFVNTEYNHKRLLESRGPHALDGLPDFRF  69

Query  262  ETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDGI  441
             TIPDGLPP D+DATQDIP+LC ST+  CL PF+ LL  LN  A    VPPV+CIV+DG 
Sbjct  70   GTIPDGLPPPDIDATQDIPALCDSTSKHCLAPFRRLLVELNANAG---VPPVTCIVADGS  126

Query  442  MSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            MSFTL AA+ELGIP VL W  SA GF+   HY +L+D G+TPLK
Sbjct  127  MSFTLEAAKELGIPSVLLWTPSACGFLAYCHYRRLIDDGFTPLK  170



>gb|KFK44336.1| hypothetical protein AALP_AA1G244800 [Arabis alpina]
Length=491

 Score =   239 bits (610),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 135/175 (77%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+     +KPH VCVPYPAQ HIN M+K+AKL H +GFH+TFVNT +NH RL RSRG 
Sbjct  1    MGSHAVYNGQKPHVVCVPYPAQGHINPMMKVAKLFHIRGFHVTFVNTVYNHNRLLRSRGA  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             ++ GLPSFRFE+IPDGLP +DVD TQDI +LC ST   CL PFK+LL ++N   A  +V
Sbjct  61   HAVNGLPSFRFESIPDGLPETDVDVTQDITALCASTMKNCLTPFKELLRQIN---AGDDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCI+SDG MSFTL AAEELG+P+VLFW +SA GFM  +H+ + V+ G +PLK
Sbjct  118  PPVSCILSDGCMSFTLDAAEELGVPEVLFWTVSACGFMAYLHFYRFVEMGLSPLK  172



>ref|XP_002885822.1| hypothetical protein ARALYDRAFT_319356 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62081.1| hypothetical protein ARALYDRAFT_319356 [Arabidopsis lyrata subsp. 
lyrata]
Length=507

 Score =   239 bits (611),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 132/167 (79%), Gaps = 3/167 (2%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            E+KPH VCVPYPAQ HIN MLKLAK+L+ +GFH+TFVNT +NH RL RSRGP +L GLPS
Sbjct  9    EQKPHVVCVPYPAQGHINPMLKLAKILYVRGFHVTFVNTIYNHNRLLRSRGPNALDGLPS  68

Query  253  FRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            FRFE+IPDGLP ++VDATQDI +LC +    CL PFK+LL R+N   +  NVPPVSCIVS
Sbjct  69   FRFESIPDGLPETNVDATQDISALCDAVKKNCLTPFKELLRRIN---SQQNVPPVSCIVS  125

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            DG MSFTL AAEELG+P+VLFW  SA GFM  +H+   ++KG  PLK
Sbjct  126  DGTMSFTLDAAEELGVPEVLFWTTSACGFMAYLHFHLFIEKGLCPLK  172



>gb|KFK44333.1| hypothetical protein AALP_AA1G244500 [Arabis alpina]
Length=483

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 134/175 (77%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S+    E+KPH VCVPYPAQ HIN MLK+AKLLH KG H+TFVNT +NH RL RSRGP
Sbjct  1    MESHGVCSEQKPHVVCVPYPAQGHINPMLKVAKLLHAKGLHVTFVNTVYNHNRLLRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            ++L GLPSF+FE+IPDGLP +D D TQDIP+LCVST   CL PF +L+ R+N   +  +V
Sbjct  61   DALHGLPSFQFESIPDGLPETDGDTTQDIPALCVSTKKNCLAPFMELIRRIN---SGGDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PP+SCIVSDGIMSFTL AAEELG+P VLFW +SA G MG + +   ++KG  P +
Sbjct  118  PPISCIVSDGIMSFTLDAAEELGVPIVLFWTLSACGLMGFLQFHVFIEKGLAPFQ  172



>dbj|BAH56949.1| AT1G22360 [Arabidopsis thaliana]
Length=427

 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 137/175 (78%), Gaps = 6/175 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+     +K H VCVPYPAQ HIN M+K+AKLL+ KGFHITFVNT +NH RL RSRGP
Sbjct  1    MGSH---VAQKQHVVCVPYPAQGHINPMMKVAKLLYAKGFHITFVNTVYNHNRLLRSRGP  57

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             ++ GLPSFRFE+IPDGLP +DVD TQDIP+LC ST   CL PFK+LL ++N   A  +V
Sbjct  58   NAVDGLPSFRFESIPDGLPETDVDVTQDIPTLCESTMKHCLAPFKELLRQIN---ARDDV  114

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG MSFTL AAEELG+P+VLFW  SA GF+  ++Y + ++KG +P+K
Sbjct  115  PPVSCIVSDGCMSFTLDAAEELGVPEVLFWTTSACGFLAYLYYYRFIEKGLSPIK  169



>ref|NP_973885.1| UDP-glucosyl transferase 85A5 [Arabidopsis thaliana]
 sp|Q9LMF0.1|U85A5_ARATH RecName: Full=UDP-glycosyltransferase 85A5 [Arabidopsis thaliana]
 gb|AAF87255.1|AC068562_2 Strong similarity to UDP-glucose glucosyltransferase from Arabidopsis 
thaliana gb|AB016819 and contains a UDP-glucosyl transferase 
PF|00201 domain. ESTs gb|U74128, gb|AA713257 come 
from this gene [Arabidopsis thaliana]
 gb|AEE30235.1| UDP-glucosyl transferase 85A5 [Arabidopsis thaliana]
Length=479

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 135/175 (77%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S+     +KPH VC+P+PAQ HIN MLK+AKLL+ +GFH+TFVNT +NH RL RSRGP
Sbjct  1    MASHAVTSGQKPHVVCIPFPAQGHINPMLKVAKLLYARGFHVTFVNTNYNHNRLIRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSFRFE+IPDGLP  + D  QD+P+LC ST   CL PFK+LL R+N T    +V
Sbjct  61   NSLDGLPSFRFESIPDGLPEENKDVMQDVPTLCESTMKNCLAPFKELLRRINTTK---DV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG+MSFTL AAEELG+PDVLFW  SA GF+  +H+ + ++KG +P+K
Sbjct  118  PPVSCIVSDGVMSFTLDAAEELGVPDVLFWTPSACGFLAYLHFYRFIEKGLSPIK  172



>ref|XP_006433960.1| hypothetical protein CICLE_v10000925mg [Citrus clementina]
 gb|ESR47200.1| hypothetical protein CICLE_v10000925mg [Citrus clementina]
Length=504

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 134/166 (81%), Gaps = 0/166 (0%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            ++PHAVCVPYPAQ HIN M +LAKLLH+KGFHITFVNTEFN RRL +S+GP+SL  +P+F
Sbjct  11   RRPHAVCVPYPAQGHINPMFQLAKLLHHKGFHITFVNTEFNQRRLLKSQGPDSLNAVPTF  70

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLPPSD DATQDIPSLC ST  TC  PF++LL RLN++A +   PPV+CIVSD
Sbjct  71   RFETIPDGLPPSDSDATQDIPSLCDSTRRTCSAPFQELLTRLNNSALSNVNPPVTCIVSD  130

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
              M FTL A+++L IP+VLF+  SA GFMG +HY  LV+K   PLK
Sbjct  131  WSMGFTLKASKQLNIPNVLFFTASACGFMGYVHYRHLVEKCIFPLK  176



>gb|AHL38933.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=481

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 137/175 (78%), Gaps = 6/175 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+     +K H VCVPYPAQ HIN M+K+AKLL+ KGFHITFVNT +NH RL RSRGP
Sbjct  1    MGSH---VAQKQHVVCVPYPAQGHINPMMKVAKLLYAKGFHITFVNTVYNHNRLLRSRGP  57

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             ++ GLPSFRFE+IPDGLP +DVD TQDIP+LC ST   CL PFK+LL ++N   A  +V
Sbjct  58   NAVDGLPSFRFESIPDGLPETDVDVTQDIPTLCESTMKHCLAPFKELLRQIN---ARDDV  114

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG MSFTL AAEELG+P+VLFW  SA GF+  ++Y + ++KG +P+K
Sbjct  115  PPVSCIVSDGCMSFTLDAAEELGVPEVLFWTTSACGFLAYLYYYRFIEKGLSPIK  169



>dbj|BAO51839.1| UDP-glycosyltransferase 85A34 [Humulus lupulus]
Length=487

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 130/171 (76%), Gaps = 4/171 (2%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            E KPHAVC+PYPAQ HIN MLKLAKLLH +GFHITFVNT FNH RL +SRGP SL GLP 
Sbjct  4    ETKPHAVCIPYPAQGHINPMLKLAKLLHQRGFHITFVNTHFNHNRLLKSRGPNSLDGLPD  63

Query  253  FRFETIPDGLPPSD--VDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN--VPPVS  420
            FRFE+IPDGLPP++   DATQDIPSLC ST  TCL PF+ LL +LN  ++++   VPPVS
Sbjct  64   FRFESIPDGLPPTENKADATQDIPSLCESTEKTCLDPFRKLLFQLNDASSSSGGAVPPVS  123

Query  421  CIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            C+VSD  M FTL A EE GIP  LFW ISA G +G   Y  LV+KG+TP K
Sbjct  124  CVVSDPAMPFTLTAGEEFGIPVALFWTISACGLLGYTQYENLVNKGFTPFK  174



>ref|NP_173653.1| UDP-glucosyl transferase 85A2 [Arabidopsis thaliana]
 sp|Q9ZWJ3.1|U85A2_ARATH RecName: Full=UDP-glycosyltransferase 85A2 [Arabidopsis thaliana]
 gb|AAF87256.1|AC068562_3 Identical to UDP-glucose glucosyltransferase from Arabidopsis 
thaliana gb|AB016819 and contains a UDP-glucosyl transferase 
PF|00201 domain. ESTs gb|T46254, gb|R83990, gb|H37246, gb|W43072, 
gb|R90721, gb|R90712, gb|AA712612, gb|AA404770 come 
from this gene [Arabidopsis thaliana]
 gb|AAG48781.1|AF332418_1 putative UDP-glucose glucosyltransferase [Arabidopsis thaliana]
 dbj|BAA34687.1| UDP-glucose glucosyltransferase [Arabidopsis thaliana]
 gb|AEE30232.1| UDP-glucosyl transferase 85A2 [Arabidopsis thaliana]
Length=481

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 137/175 (78%), Gaps = 6/175 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+     +K H VCVPYPAQ HIN M+K+AKLL+ KGFHITFVNT +NH RL RSRGP
Sbjct  1    MGSH---VAQKQHVVCVPYPAQGHINPMMKVAKLLYAKGFHITFVNTVYNHNRLLRSRGP  57

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             ++ GLPSFRFE+IPDGLP +DVD TQDIP+LC ST   CL PFK+LL ++N   A  +V
Sbjct  58   NAVDGLPSFRFESIPDGLPETDVDVTQDIPTLCESTMKHCLAPFKELLRQIN---ARDDV  114

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG MSFTL AAEELG+P+VLFW  SA GF+  ++Y + ++KG +P+K
Sbjct  115  PPVSCIVSDGCMSFTLDAAEELGVPEVLFWTTSACGFLAYLYYYRFIEKGLSPIK  169



>gb|AAL32657.1| UDP-glucose glucosyltransferase [Arabidopsis thaliana]
 gb|AAM13356.1| UDP-glucose glucosyltransferase [Arabidopsis thaliana]
Length=481

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 137/175 (78%), Gaps = 6/175 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+     +K H VCVPYPAQ HIN M+K+AKLL+ KGFHITFVNT +NH RL RSRGP
Sbjct  1    MGSH---VAQKQHVVCVPYPAQGHINPMMKVAKLLYAKGFHITFVNTVYNHNRLLRSRGP  57

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             ++ GLPSFRFE+IPDGLP +DVD TQDIP+LC ST   CL PFK+LL ++N   A  +V
Sbjct  58   NAVDGLPSFRFESIPDGLPETDVDVTQDIPTLCESTMKHCLAPFKELLRQIN---ARDDV  114

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG MSFTL AAEELG+P+VLFW  SA GF+  ++Y + ++KG +P+K
Sbjct  115  PPVSCIVSDGCMSFTLDAAEELGVPEVLFWTTSACGFLAYLYYYRFIEKGLSPIK  169



>ref|NP_001277168.1| UDP-glycosyltransferase 85A2-like [Vitis vinifera]
 dbj|BAO51843.1| UDP-glycosyltransferase 85A33 [Vitis vinifera]
Length=482

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 129/165 (78%), Gaps = 1/165 (1%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPH V +PYPAQ H+N MLKLAKLLHNKGF ++FVNTE+NH+RL RSRGP SL GL  FR
Sbjct  9    KPHVVLIPYPAQGHVNPMLKLAKLLHNKGFFVSFVNTEYNHKRLLRSRGPNSLDGLSDFR  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLPPSD DATQDIPSLCVST   CL PF  L+ +LN  + +   PPVSCIVSDG
Sbjct  69   FETIPDGLPPSDADATQDIPSLCVSTTKNCLAPFCALITKLNDPSYSPG-PPVSCIVSDG  127

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            +MSFTL AAE+ G+P+V+FW  SA GF+G  HY  L+ +G  PL+
Sbjct  128  VMSFTLDAAEKFGVPEVVFWTTSACGFLGYRHYRNLIRRGLIPLQ  172



>gb|AAV32497.1| UDP-glucuronosyltransferase [Arabidopsis thaliana]
Length=483

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 135/175 (77%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S+     +KPH VC+P+PAQ HIN MLK+AKLL+ +GFH+TFVNT +NH RL RSRGP
Sbjct  1    MASHAVTSGQKPHVVCIPFPAQGHINPMLKVAKLLYARGFHVTFVNTNYNHNRLIRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSFRFE+IPDGLP  + D  QD+P+LC ST   CL PFK+LL R+N T    +V
Sbjct  61   NSLDGLPSFRFESIPDGLPEENKDVMQDVPTLCESTMKNCLAPFKELLRRINTTK---DV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG+MSFTL AAEELG+PDVLFW  SA GF+  +H+ + ++KG +P+K
Sbjct  118  PPVSCIVSDGVMSFTLDAAEELGVPDVLFWTPSACGFLAYLHFYRFIEKGLSPIK  172



>dbj|BAO51841.1| UDP-glycosyltransferase 85A35 [Humulus lupulus]
Length=487

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 130/171 (76%), Gaps = 4/171 (2%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            E KPHAVC+PYPAQ HIN MLKLAKLLH +GFHITFVNT FNH R+ +SRGP SL GLP 
Sbjct  4    ETKPHAVCIPYPAQGHINPMLKLAKLLHQRGFHITFVNTHFNHNRILKSRGPNSLDGLPD  63

Query  253  FRFETIPDGLPPSD--VDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN--VPPVS  420
            FRFE+IPDGLPP++   DATQDIPSLC ST  TCL PF+ LL +LN  ++++   VPPVS
Sbjct  64   FRFESIPDGLPPTENKADATQDIPSLCESTEKTCLDPFRKLLFQLNDASSSSGGAVPPVS  123

Query  421  CIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            C+VSD  M FTL A EE GIP  LFW ISA G +G   Y  LV+KG+TP K
Sbjct  124  CVVSDAAMPFTLKAGEEFGIPVALFWTISACGLLGYTQYENLVNKGFTPFK  174



>ref|XP_010039826.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like, partial 
[Eucalyptus grandis]
Length=173

 Score =   228 bits (582),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLKLAKLLH+KGFHITFVNTE NH+RL RS+GP SL GLP F
Sbjct  8    EKPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEHNHKRLLRSQGPHSLDGLPHF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RF+ IPDGLPPSD D+TQDIPSLC S +   L  F+ LL +L   +    VPPV+ IVSD
Sbjct  68   RFDMIPDGLPPSDADSTQDIPSLCASLSEHGLSAFRSLLLKLQDQSQDGVVPPVTRIVSD  127

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+M+FT+ AAEEL IP+V+FWP SA G  G   Y +LV+ G+TPLK
Sbjct  128  GLMTFTVDAAEELKIPEVVFWPPSACGLFGCTKYRRLVEDGFTPLK  173



>ref|NP_001031078.1| UDP-glucosyl transferase 85A2 [Arabidopsis thaliana]
 gb|AEE30233.1| UDP-glucosyl transferase 85A2 [Arabidopsis thaliana]
Length=469

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 137/175 (78%), Gaps = 6/175 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+     +K H VCVPYPAQ HIN M+K+AKLL+ KGFHITFVNT +NH RL RSRGP
Sbjct  1    MGSH---VAQKQHVVCVPYPAQGHINPMMKVAKLLYAKGFHITFVNTVYNHNRLLRSRGP  57

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             ++ GLPSFRFE+IPDGLP +DVD TQDIP+LC ST   CL PFK+LL ++N   A  +V
Sbjct  58   NAVDGLPSFRFESIPDGLPETDVDVTQDIPTLCESTMKHCLAPFKELLRQIN---ARDDV  114

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG MSFTL AAEELG+P+VLFW  SA GF+  ++Y + ++KG +P+K
Sbjct  115  PPVSCIVSDGCMSFTLDAAEELGVPEVLFWTTSACGFLAYLYYYRFIEKGLSPIK  169



>gb|KCW45697.1| hypothetical protein EUGRSUZ_L00500 [Eucalyptus grandis]
Length=185

 Score =   228 bits (582),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLKLAKLLH+KGFHITFVNTE NH+RL RS+GP SL GLP F
Sbjct  8    EKPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEHNHKRLLRSQGPHSLDGLPHF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RF+ IPDGLPPSD D+TQDIPSLC S +   L  F+ LL +L   +    VPPV+ IVSD
Sbjct  68   RFDMIPDGLPPSDADSTQDIPSLCASLSEHGLSAFRSLLLKLQDQSQDGVVPPVTRIVSD  127

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+M+FT+ AAEEL IP+V+FWP SA G  G   Y +LV+ G+TPLK
Sbjct  128  GLMTFTVDAAEELKIPEVVFWPPSACGLFGCTKYRRLVEDGFTPLK  173



>ref|XP_003544213.2| PREDICTED: UDP-glycosyltransferase 85A2-like [Glycine max]
Length=488

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 139/183 (76%), Gaps = 6/183 (3%)
 Frame = +1

Query  25   RSRERKREMGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHR  204
            +S+E  R M S       KPHAVCVP+P Q HIN MLKLAKLLH KGFHITFVNTE+ H+
Sbjct  2    QSKEETRNMSSLGTIL--KPHAVCVPHPTQGHINPMLKLAKLLHFKGFHITFVNTEYTHK  59

Query  205  RLQRSRGPESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLN  384
            RL +SRGP+S++GLPSFRFETIPDGLP   VDATQ IPSLC ST  TCL  F++LL ++N
Sbjct  60   RLLKSRGPDSIKGLPSFRFETIPDGLPEPLVDATQHIPSLCDSTRRTCLPHFRNLLTKIN  119

Query  385  HTAAATNVPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYT  564
             + A    PPVSCIVSDG+MSFTL AAEELG+P +LFW  SA GFM  + + QLV+KG  
Sbjct  120  DSDA----PPVSCIVSDGVMSFTLDAAEELGVPQLLFWTPSACGFMCYVQFGQLVEKGLV  175

Query  565  PLK  573
            PLK
Sbjct  176  PLK  178



>ref|XP_003544799.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Glycine max]
Length=472

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 138/174 (79%), Gaps = 6/174 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+  E    PHAVC+PYPAQ HIN MLKLAKLLH KGFHITFVNTE+NH+R+ ++RGP
Sbjct  1    MGSS--ETINMPHAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRILKARGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSFRFETIPDGLP   V+ATQDIPSLC ST  TCL  F++LLA++N+    ++V
Sbjct  59   YSLNGLPSFRFETIPDGLPEPVVEATQDIPSLCDSTRRTCLPHFRNLLAKINN----SDV  114

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPL  570
            PPV+CIVSDG MSFTL AAEELG+P VLFW  SA GFM  + Y +L++KG  PL
Sbjct  115  PPVTCIVSDGGMSFTLDAAEELGVPQVLFWTPSACGFMCYLQYEKLIEKGLMPL  168



>ref|XP_007208223.1| hypothetical protein PRUPE_ppa018343mg [Prunus persica]
 gb|EMJ09422.1| hypothetical protein PRUPE_ppa018343mg [Prunus persica]
Length=480

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 140/175 (80%), Gaps = 4/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   E  KK HAVCVP+PAQ H++ +++LAKLLH++GFHITFVNTEFNHRRL RS+GP
Sbjct  1    MGSVR-EATKKLHAVCVPFPAQGHVSPVMQLAKLLHSRGFHITFVNTEFNHRRLIRSKGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +S++GLP F+FETIPDGLPPSD DATQD+P+LC ST  TCLGPFK+L+ ++N   +++ V
Sbjct  60   DSVKGLPDFQFETIPDGLPPSDKDATQDVPALCDSTRKTCLGPFKELVTKIN---SSSQV  116

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            P V+CIV+DGI  F   AA+ELGIP+V FW  SA GF+G + YS+LV +G  P K
Sbjct  117  PQVTCIVADGITGFGRQAAQELGIPEVQFWTASACGFLGYLQYSELVKRGIVPFK  171



>emb|CDY21359.1| BnaA09g30680D [Brassica napus]
Length=418

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 131/166 (79%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +K H VCVPYPAQ HIN M+K+AKLLH KGF++TFVNT +NH+RL RSRG  +L GLPSF
Sbjct  10   RKQHVVCVPYPAQGHINPMMKVAKLLHAKGFYVTFVNTIYNHKRLLRSRGSNALDGLPSF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE+IPDGLP +DVD TQDIPSLC ST    L PFK+LL R+N   A   VPPV+CIVSD
Sbjct  70   RFESIPDGLPETDVDVTQDIPSLCESTPKYSLAPFKELLRRIN---AQDEVPPVNCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G MSFTL AAEELG+P+VLFW  SA GF+  +HY + ++KG +PLK
Sbjct  127  GCMSFTLDAAEELGVPEVLFWTTSACGFLAYLHYHKFIEKGLSPLK  172



>ref|XP_009341754.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 139/175 (79%), Gaps = 5/175 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS    F +KPHAVC+P+PAQ HIN ML +AKLLH KGFHITFVNTEFNH+RL +SRG 
Sbjct  1    MGS--ISFAEKPHAVCIPFPAQGHINPMLNVAKLLHFKGFHITFVNTEFNHKRLLKSRGS  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSF+FETIPDGLPP++ + TQDIPSLC ST  TCL  F++LL++LN   ++ + 
Sbjct  59   NSLDGLPSFQFETIPDGLPPTNANVTQDIPSLCHSTKKTCLPHFRELLSKLN---SSPDS  115

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG+MSFTL AA+ELGIP+VLFW  SA G +  M + +L++KG TP K
Sbjct  116  PPVSCIVSDGVMSFTLDAAQELGIPEVLFWTTSACGLLAYMQFYRLIEKGLTPHK  170



>ref|XP_010498707.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Camelina sativa]
Length=486

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 133/166 (80%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPH VCVP+ AQ HIN MLK+AK+LH KGFH+TFVNT +NHRRL RSRGP++L GLPSF
Sbjct  10   QKPHVVCVPFAAQGHINPMLKVAKILHAKGFHVTFVNTNYNHRRLLRSRGPKALNGLPSF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            ++E+IPDGLP ++ DATQDIP LC ST   CL PFK+LL R+N    A +VPPVSCIVSD
Sbjct  70   QYESIPDGLPETNEDATQDIPLLCASTKKNCLAPFKELLRRIN---TAEDVPPVSCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G MSFTL AAEELG+P+V  W  SA GF+  +H+ ++++KG +PLK
Sbjct  127  GTMSFTLDAAEELGVPNVALWTTSACGFLAYLHFHRIIEKGLSPLK  172



>dbj|BAO51840.1| UDP-glycosyltransferase 85K12 [Humulus lupulus]
Length=484

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 133/165 (81%), Gaps = 3/165 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVCVP+PAQ H+N M++LAKLLH++GFHIT+VNTEFNHRRL RSRGP+S++GLP F+
Sbjct  9    KPHAVCVPFPAQGHVNPMMQLAKLLHSRGFHITYVNTEFNHRRLIRSRGPDSVKGLPDFQ  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLPPSD DATQ++P LC +T   CLGPFK+LL +L    + + VPPV+CI++DG
Sbjct  69   FETIPDGLPPSDRDATQEVPPLCDATRKNCLGPFKELLHKLR---SCSEVPPVTCIITDG  125

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            IM+F + AA E GIP+V+FW  SA  FMG + Y +LV +G  P K
Sbjct  126  IMTFGIKAAREFGIPEVVFWTASACSFMGYLQYDELVRRGIVPFK  170



>ref|XP_010060022.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X2 [Eucalyptus grandis]
Length=500

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 134/176 (76%), Gaps = 3/176 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   +  +KPHAVC+PYPAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL  SRGP
Sbjct  1    MGS--IDMIQKPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLHSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDV-DATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN  405
             SL GLPSFRF TIP+GLPPSDV DATQDIP+LC ST+  CL  F+D L RLN  +    
Sbjct  59   SSLDGLPSFRFRTIPNGLPPSDVADATQDIPALCQSTSKFCLPYFRDQLERLNEESTTLG  118

Query  406  VPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             PPVSC+VSDG+MSFTL AA+ +G+ +VLFW  S  GFMG + Y  LVDKG  PLK
Sbjct  119  SPPVSCVVSDGMMSFTLDAAKVIGVSEVLFWTTSVCGFMGYVQYCNLVDKGLAPLK  174



>ref|XP_009145346.1| PREDICTED: UDP-glycosyltransferase 85A2 isoform X2 [Brassica 
rapa]
Length=484

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 131/166 (79%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +K H VCVPYPAQ HIN M+K+AKLLH KGF++TFVNT +NH+RL RSRG  +L GLPSF
Sbjct  10   RKQHVVCVPYPAQGHINPMMKVAKLLHAKGFYVTFVNTIYNHKRLLRSRGSNALDGLPSF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE+IPDGLP +DVD TQDIPSLC ST    L PFK+LL R+N   A   VPPV+CIVSD
Sbjct  70   RFESIPDGLPETDVDVTQDIPSLCESTPKYSLAPFKELLRRIN---AQDEVPPVNCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G MSFTL AAEELG+P+VLFW  SA GF+  +HY + ++KG +PLK
Sbjct  127  GCMSFTLDAAEELGVPEVLFWTTSACGFLAYLHYHKFIEKGLSPLK  172



>ref|XP_009145347.1| PREDICTED: UDP-glycosyltransferase 85A2 isoform X3 [Brassica 
rapa]
Length=483

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 131/166 (79%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +K H VCVPYPAQ HIN M+K+AKLLH KGF++TFVNT +NH+RL RSRG  +L GLPSF
Sbjct  10   RKQHVVCVPYPAQGHINPMMKVAKLLHAKGFYVTFVNTIYNHKRLLRSRGSNALDGLPSF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE+IPDGLP +DVD TQDIPSLC ST    L PFK+LL R+N   A   VPPV+CIVSD
Sbjct  70   RFESIPDGLPETDVDVTQDIPSLCESTPKYSLAPFKELLRRIN---AQDEVPPVNCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G MSFTL AAEELG+P+VLFW  SA GF+  +HY + ++KG +PLK
Sbjct  127  GCMSFTLDAAEELGVPEVLFWTTSACGFLAYLHYHKFIEKGLSPLK  172



>gb|KHN24339.1| UDP-glycosyltransferase 85A2 [Glycine soja]
Length=488

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 139/183 (76%), Gaps = 6/183 (3%)
 Frame = +1

Query  25   RSRERKREMGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHR  204
            +S+E  R M S       KPHAVCVP+P Q HIN MLKLAKLLH KGFHITFVNTE+ H+
Sbjct  2    QSKEETRNMSSLGTI--HKPHAVCVPHPTQGHINPMLKLAKLLHFKGFHITFVNTEYTHK  59

Query  205  RLQRSRGPESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLN  384
            RL +SRGP+S++GLPSFRFETIPDGLP   VDATQ IPSLC ST  TCL  F++LL ++N
Sbjct  60   RLLKSRGPDSIKGLPSFRFETIPDGLPEPLVDATQHIPSLCDSTRRTCLPHFRNLLTKIN  119

Query  385  HTAAATNVPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYT  564
             + A    PPVSCIVSDG+MSFTL AAEELG+P +LFW  SA GFM  + + QLV+KG  
Sbjct  120  DSDA----PPVSCIVSDGVMSFTLDAAEELGVPQLLFWTPSACGFMCYVQFGQLVEKGLV  175

Query  565  PLK  573
            PLK
Sbjct  176  PLK  178



>gb|KCW44218.1| hypothetical protein EUGRSUZ_L023572, partial [Eucalyptus grandis]
Length=173

 Score =   227 bits (579),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN MLKLAKLLH+KGFHITFVNTE  H+RL RS+GP SL GLP F
Sbjct  8    EKPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEHIHKRLLRSQGPHSLDGLPHF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RF+ IPDGLPPSD D+TQDIPSLC S +   L  F+ LL +L   +    +PPV+CIVSD
Sbjct  68   RFDMIPDGLPPSDADSTQDIPSLCASLSEHGLSAFRSLLLKLQEQSQDGVMPPVTCIVSD  127

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+M+FT+ AAEEL IP+V+FW  SA G +G   Y +LV+ G+TPLK
Sbjct  128  GVMAFTVDAAEELKIPEVVFWTPSACGMLGYTKYRRLVEDGFTPLK  173



>ref|XP_009145345.1| PREDICTED: UDP-glycosyltransferase 85A2 isoform X1 [Brassica 
rapa]
Length=487

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 131/166 (79%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +K H VCVPYPAQ HIN M+K+AKLLH KGF++TFVNT +NH+RL RSRG  +L GLPSF
Sbjct  10   RKQHVVCVPYPAQGHINPMMKVAKLLHAKGFYVTFVNTIYNHKRLLRSRGSNALDGLPSF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE+IPDGLP +DVD TQDIPSLC ST    L PFK+LL R+N   A   VPPV+CIVSD
Sbjct  70   RFESIPDGLPETDVDVTQDIPSLCESTPKYSLAPFKELLRRIN---AQDEVPPVNCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G MSFTL AAEELG+P+VLFW  SA GF+  +HY + ++KG +PLK
Sbjct  127  GCMSFTLDAAEELGVPEVLFWTTSACGFLAYLHYHKFIEKGLSPLK  172



>ref|XP_004299646.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=486

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 135/167 (81%), Gaps = 4/167 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+P+PAQ HIN MLK+AKLLH KGF+ITFVNTEF H+RL +SRGP SL G PSF
Sbjct  9    EKPHAVCIPFPAQGHINPMLKVAKLLHYKGFYITFVNTEFIHKRLLKSRGPNSLDGFPSF  68

Query  256  RFETIPDGLPPSDVD-ATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            RFETIPDGLPP+D + ATQ +PSLC ST   CL PF+DLL +LN   ++ N PPV+CIV+
Sbjct  69   RFETIPDGLPPTDANVATQHMPSLCESTRKNCLAPFRDLLLKLN---SSPNSPPVTCIVA  125

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            DGIM+FTL AA+ELG+P+V+FW  SA GFMG + Y  L++KG  PLK
Sbjct  126  DGIMNFTLDAAQELGLPEVIFWTTSACGFMGYLQYYNLIEKGLVPLK  172



>ref|XP_002306303.2| hypothetical protein POPTR_0005s07500g [Populus trichocarpa]
 gb|EEE93299.2| hypothetical protein POPTR_0005s07500g [Populus trichocarpa]
Length=479

 Score =   237 bits (604),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 133/168 (79%), Gaps = 5/168 (3%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVCVP+PAQ H+  M+ LAKLLH++GFHITFVNTEFNHRRL RSRGP+S+ GLP F
Sbjct  7    RKPHAVCVPFPAQGHVTPMMHLAKLLHSRGFHITFVNTEFNHRRLIRSRGPDSVEGLPDF  66

Query  256  RFETIPDG--LPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            RFETIPDG  LPPSD +ATQD+PSLC ST T CL PFK+LL +LN   +++ VPPV+C++
Sbjct  67   RFETIPDGLPLPPSDFEATQDVPSLCDSTRTNCLAPFKELLTKLN---SSSEVPPVTCVI  123

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            SDG MSF + AAEE  IP V FW  SA  FMG +H+S+L  +G+ P K
Sbjct  124  SDGGMSFGIKAAEEFNIPQVQFWTASACSFMGYLHFSELTRRGFVPYK  171



>dbj|BAO51838.1| UDP-glycosyltransferase 85A36 [Humulus lupulus]
Length=487

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 130/172 (76%), Gaps = 4/172 (2%)
 Frame = +1

Query  70   FEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLP  249
             E KPHAVC+PYPAQ HI+ MLKLAKLLH +GFHITFVNT FNH RL +SRGP SL GLP
Sbjct  3    METKPHAVCIPYPAQGHISPMLKLAKLLHQRGFHITFVNTHFNHNRLLKSRGPNSLDGLP  62

Query  250  SFRFETIPDGLPPSD--VDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN--VPPV  417
             FRFE+IPDGLPP++   DATQDIPSLC ST  TCL PF+ LL +LN  ++++   VPPV
Sbjct  63   DFRFESIPDGLPPTENKADATQDIPSLCESTEKTCLDPFRKLLFQLNDASSSSGGAVPPV  122

Query  418  SCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            SC+VSD  M FTL A EE GIP  LFW ISA G +G   Y  LV+KG+TP K
Sbjct  123  SCVVSDASMPFTLKAGEEFGIPVALFWTISACGLLGYTQYENLVNKGFTPFK  174



>ref|XP_002893224.1| UDP-glucosyl transferase 85A1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69483.1| UDP-glucosyl transferase 85A1 [Arabidopsis lyrata subsp. lyrata]
Length=486

 Score =   237 bits (604),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 131/175 (75%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS      +KPH VCVPYPAQ HIN M+K+AKLLH +GFH+TFVNT +NH R  RSRG 
Sbjct  1    MGSQIVHNSQKPHVVCVPYPAQGHINPMMKVAKLLHARGFHVTFVNTVYNHNRFLRSRGS  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSFRFE+IPDGLP +D+DATQDI +LC ST   CL PF++LL ++N   A  NV
Sbjct  61   NALEGLPSFRFESIPDGLPETDMDATQDITALCESTMKNCLAPFRELLQQIN---AGDNV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG MSFTL  AEELG+P+VLFW  S   F+  +H+   ++KG +PLK
Sbjct  118  PPVSCIVSDGCMSFTLDVAEELGVPEVLFWTTSGCAFLAYLHFYLFIEKGLSPLK  172



>gb|ADV71371.1| glycosyltransferase GT14M03 [Pueraria montana var. lobata]
Length=485

 Score =   236 bits (603),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 138/175 (79%), Gaps = 5/175 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   E   KPHAVCVP+PAQ HIN MLKLAKLLH KGFHITFVNTE+NH+RL +SRGP
Sbjct  1    MGS--LEAISKPHAVCVPFPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL+GL SFRFETIPDGLP  DV+ TQ +PSLC  T  TCL  F+++L++L  + +   V
Sbjct  59   DSLKGLSSFRFETIPDGLPEPDVEVTQHVPSLCDYTRRTCLPHFRNVLSKLRDSPS---V  115

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDGIMSFTL AA+E G+P+VLFW  SA GFM  + Y QL+++G TPLK
Sbjct  116  PPVSCIVSDGIMSFTLDAAQEFGVPNVLFWTTSACGFMCYVQYQQLIERGLTPLK  170



>ref|XP_008359320.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=484

 Score =   236 bits (603),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 139/175 (79%), Gaps = 5/175 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS      +KPHAVC+P+PAQ HIN ML +AKLLH KGFHITFVNT+FNH+RL +SRG 
Sbjct  1    MGS--ISLAEKPHAVCIPFPAQGHINPMLNVAKLLHFKGFHITFVNTQFNHKRLLKSRGS  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSF+FETIPDGLPP++ + TQDIPSLC ST  TCL  F++LL++LN   ++ + 
Sbjct  59   NSLDGLPSFQFETIPDGLPPTNANVTQDIPSLCHSTKKTCLPHFRELLSKLN---SSRDS  115

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            P VSCIVSDG+MSFTL AA+ELGIP+VLFW  SA GF+  M + +L++KG TPLK
Sbjct  116  PSVSCIVSDGVMSFTLDAAQELGIPEVLFWTTSACGFLAYMQFYRLIEKGLTPLK  170



>ref|XP_008219314.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
Length=189

 Score =   227 bits (579),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 133/175 (76%), Gaps = 5/175 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS      +KPHAVC+PYPAQ HI  ML+L KLLH KGFHITFVNTEFNHRRL +SRGP
Sbjct  1    MGSTG--LTEKPHAVCIPYPAQGHITPMLQLTKLLHYKGFHITFVNTEFNHRRLLKSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSFRFETIPDGLPP+D +ATQD+ +LCVST   CL PF+DLL++LN   +  + 
Sbjct  59   NSLDGLPSFRFETIPDGLPPTDTNATQDVTALCVSTRKNCLAPFRDLLSKLN---SLPDS  115

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPV+CIVSDG M FTL AA+ELGIP+V+F   SA G M  +    L+++G  PL+
Sbjct  116  PPVTCIVSDGGMIFTLDAAQELGIPEVIFQTPSACGLMCYLQCRPLIERGLIPLR  170



>ref|XP_007207648.1| hypothetical protein PRUPE_ppa021414mg [Prunus persica]
 gb|EMJ08847.1| hypothetical protein PRUPE_ppa021414mg [Prunus persica]
Length=480

 Score =   236 bits (603),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 140/175 (80%), Gaps = 4/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   E  KK HAVCVP+PAQ H++ +++LAKLLH++GFHITFVNTEFNHRRL RS+GP
Sbjct  1    MGSVR-EATKKLHAVCVPFPAQGHVSPVMQLAKLLHSRGFHITFVNTEFNHRRLIRSKGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +S++GLP F+FETIPDGLPPSD DATQD+P+LC ST  TCLGPFK+L+ ++N   +++ V
Sbjct  60   DSVKGLPDFQFETIPDGLPPSDKDATQDVPALCDSTRKTCLGPFKELVTKIN---SSSQV  116

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            P V+CIV+DGI  F   AA+ELGIP+V FW  SA GF+G + YS+LV +G  P +
Sbjct  117  PQVTCIVADGITGFGRQAAQELGIPEVQFWTASACGFLGYLQYSELVKRGIVPFQ  171



>gb|KFK44334.1| hypothetical protein AALP_AA1G244600 [Arabis alpina]
Length=482

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 137/175 (78%), Gaps = 4/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S+    ++KPHAVCVPYPAQ HIN MLK+AKLLH+KGFH++FVNT +NH RL RSRGP
Sbjct  1    MESHAVGSKQKPHAVCVPYPAQGHINPMLKVAKLLHSKGFHVSFVNTIYNHNRLLRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSF+FE+IPDGLP +DV+ATQ IP+LC ST  TCL PFKDLL R+N   A  +V
Sbjct  61   NALDGLPSFQFESIPDGLPETDVEATQHIPTLCESTMKTCLAPFKDLLGRIN---ARDDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG MSFTL AAEE  +P+VLFW  SA GF   +H  + ++KG +PLK
Sbjct  118  PPVSCIVSDGCMSFTLDAAEEFEVPEVLFWTTSACGFSTYLHLYRFIEKG-SPLK  171



>ref|XP_008219319.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=490

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 133/166 (80%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+P+PAQ HI+ MLKLAKLLH KGFHITFVNTEFNH+RL +SRGP SL G PSF
Sbjct  8    EKPHAVCIPFPAQGHIDPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGFPSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLPP+D  ATQDIPSLC ST    L  F++LL++LN   ++ + PPVSC+VSD
Sbjct  68   RFETIPDGLPPTDAIATQDIPSLCDSTRKHSLPYFRELLSKLN---SSPDCPPVSCVVSD  124

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G M FTL AA+E G+P+VLFW  SA GF+  +HY + ++KG TPLK
Sbjct  125  GAMGFTLDAAQEFGLPEVLFWTTSACGFLAYVHYHRFIEKGLTPLK  170



>ref|XP_006351765.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Solanum tuberosum]
Length=499

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 131/168 (78%), Gaps = 3/168 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            K  H VCVPYPAQ HI+ MLKLAKL+H+ GF+ITFVNTEFNH+RL RS GP+SL GLP F
Sbjct  23   KSGHVVCVPYPAQGHISPMLKLAKLVHHNGFYITFVNTEFNHKRLLRSNGPQSLDGLPGF  82

Query  256  RFETIPDGLPPS--DVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            RFETIPDGLP +  DVDATQ +PSLC ST+  CL PF++L+ ++N       VPPV+CIV
Sbjct  83   RFETIPDGLPSTDHDVDATQHVPSLCASTSKNCLVPFRNLINKINAEGNGV-VPPVTCIV  141

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            SD IMSFTL AAEELGIP+VLFW  SA GFM  +HY  LV +GY PLK
Sbjct  142  SDVIMSFTLDAAEELGIPEVLFWTASACGFMCYLHYHHLVQRGYIPLK  189



>gb|AAV32498.1| UDP-glucuronosyltransferase [Arabidopsis thaliana]
Length=430

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 133/175 (76%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S     ++KPH VCVP+PAQ HIN MLK+AKLLH +GFH+TFVNT +NH RL RSRGP
Sbjct  1    MASPAVHSKQKPHVVCVPHPAQGHINPMLKVAKLLHARGFHVTFVNTVYNHNRLLRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSFRFE+I DGLP +D D TQDIP+LCVST   CL PFK+LL R+N      +V
Sbjct  61   YALDGLPSFRFESIADGLPDTDGDKTQDIPALCVSTMKNCLAPFKELLRRIND---VDDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG+MSFTL AAEEL +P+V+FW  SA GFM  +H+   ++KG +P K
Sbjct  118  PPVSCIVSDGVMSFTLDAAEELNLPEVIFWTNSACGFMTFLHFYLFIEKGLSPFK  172



>ref|XP_006307366.1| hypothetical protein CARUB_v10008992mg [Capsella rubella]
 gb|EOA40264.1| hypothetical protein CARUB_v10008992mg [Capsella rubella]
Length=484

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 134/175 (77%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS      +KPH VCVPYPAQ HIN M+K+AKLL+ KGFH+TFVNT +NH RL +SRGP
Sbjct  1    MGSQAIPSVQKPHVVCVPYPAQGHINPMMKVAKLLYAKGFHVTFVNTIYNHNRLLKSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             ++ GLPSFRFE+IPDGLP +DVD TQDIPSLC ST    L PFK LL  +N   A  +V
Sbjct  61   NAVDGLPSFRFESIPDGLPETDVDVTQDIPSLCESTVKHSLAPFKKLLREIN---AKDDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG MSFTL AAEELG+P+VLFW  SA GF+  +++ + ++KG +P+K
Sbjct  118  PPVSCIVSDGCMSFTLDAAEELGVPEVLFWTTSACGFLAYLYFYRFIEKGLSPVK  172



>emb|CDP01073.1| unnamed protein product [Coffea canephora]
Length=486

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 133/175 (76%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS     + KPHA+ +P+PAQ  IN M KLAK+LH+KGFHITFV++EFN RRL +SRG 
Sbjct  1    MGSTETATKPKPHAIFIPFPAQGRINPMFKLAKILHHKGFHITFVHSEFNQRRLLKSRGK  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSF+FETIPDGLP SD DATQD+PSLC ST+  CL PF+ L+ RLN   ++  V
Sbjct  61   NALDGLPSFQFETIPDGLPFSDADATQDVPSLCDSTSKNCLAPFRQLVTRLN---SSPGV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDGIMSFTL  A ELGIPDV FW   A G M  ++Y  LV+KGYTPLK
Sbjct  118  PPVSCIVSDGIMSFTLEVARELGIPDVFFWTNGAGGVMAYLNYRNLVEKGYTPLK  172



>ref|XP_009598263.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like, partial 
[Nicotiana tomentosiformis]
Length=174

 Score =   226 bits (575),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 126/165 (76%), Gaps = 3/165 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+P+PAQ HIN MLKLAKLLH +GFHI+FVNTEFNHRRL +SRGP +L GLPSF 
Sbjct  13   KPHAVCIPFPAQGHINPMLKLAKLLHLRGFHISFVNTEFNHRRLLKSRGPSALSGLPSFH  72

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FE+IPDGLPPS+ DATQD+PSLC S    CL PF+ L+ RLN++    N PPVSCIVSD 
Sbjct  73   FESIPDGLPPSNEDATQDVPSLCESCKKLCLAPFRKLVTRLNNS---LNFPPVSCIVSDA  129

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             MSFT   ++ELGIP+V FW  S       + Y +LV++GY PLK
Sbjct  130  GMSFTHEVSKELGIPNVAFWTASGCALWAFLQYPKLVEEGYCPLK  174



>ref|XP_010040275.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 132/173 (76%), Gaps = 1/173 (1%)
 Frame = +1

Query  58   NNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESL  237
            ++ +  +KPH VC+PYPAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL RSRGP SL
Sbjct  2    DSIDMIQKPHVVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHGRLLRSRGPSSL  61

Query  238  RGLPSFRFETIPDGLPPSD-VDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPP  414
             GLPSF+F TIPDGLPPSD  DATQDIP+LC ST+  CL  F+DLL RLN  +     P 
Sbjct  62   DGLPSFQFRTIPDGLPPSDATDATQDIPALCQSTSKFCLPYFRDLLQRLNEESTTLGSPL  121

Query  415  VSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            VSC+VSDG M+FTL AAE +G+P+VL W  SA  FMG + Y  L+DKG TPLK
Sbjct  122  VSCVVSDGGMTFTLDAAEAIGVPEVLIWTASACSFMGYVQYRSLIDKGLTPLK  174



>ref|XP_007207189.1| hypothetical protein PRUPE_ppa017055mg [Prunus persica]
 gb|EMJ08388.1| hypothetical protein PRUPE_ppa017055mg [Prunus persica]
Length=482

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 134/166 (81%), Gaps = 2/166 (1%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            KK HAV VPYPAQ H++ M++LAKLLH++ FHITFVNTEFNH RL RS+GP+S++GLP F
Sbjct  9    KKLHAVFVPYPAQGHVSPMMQLAKLLHSRDFHITFVNTEFNHMRLVRSKGPDSIKGLPDF  68

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLPPSD DATQDIP+LC ST  TCLGPFK+L+ +LN++++ T  PPV+C+V+D
Sbjct  69   RFETIPDGLPPSDKDATQDIPALCDSTRKTCLGPFKELVIKLNNSSSET--PPVTCVVTD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+M F   AA+ELGIP+V FW  SA GFM  + Y +LV +G  P K
Sbjct  127  GLMGFGSKAAKELGIPEVQFWTASACGFMAYLQYGELVKRGIVPFK  172



>ref|XP_006472584.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
Length=503

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 133/166 (80%), Gaps = 0/166 (0%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            ++PHAVCVP+PAQ HIN M +LAKLLH+KGFHITFVNTEFN RRL +S+GP+SL  +P+F
Sbjct  11   RRPHAVCVPHPAQGHINPMFQLAKLLHHKGFHITFVNTEFNQRRLLKSQGPDSLNAVPTF  70

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLPPSD DATQDIPSLC ST  TC  PF++LL RLN++A +   PPV+CIVSD
Sbjct  71   RFETIPDGLPPSDADATQDIPSLCDSTKRTCSAPFQELLTRLNNSALSNVNPPVTCIVSD  130

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
              M FTL A+++L IP+VLF+  SA GF G +HY  LV+K   PLK
Sbjct  131  WAMGFTLKASKQLNIPNVLFFTASACGFTGYVHYRHLVEKCIFPLK  176



>ref|XP_011465456.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=479

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 130/166 (78%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            KK HAVCVP+PAQ H+N M++LAKLLH++GFHITFVNTEFNHRRL RSRGP+S++GLP F
Sbjct  9    KKLHAVCVPFPAQGHVNPMMQLAKLLHSRGFHITFVNTEFNHRRLIRSRGPDSIKGLPDF  68

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +F TIPDGLPPSD DATQD+P LC ST  TC GPFK+L+  LN    ++ VP ++CIVSD
Sbjct  69   QFATIPDGLPPSDKDATQDVPPLCDSTRKTCRGPFKELVTNLN---CSSEVPQITCIVSD  125

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            GIM F    A+ELGIP+V FW  SA GFM  + YS+LV +G  P K
Sbjct  126  GIMGFGREVAKELGIPEVQFWTASACGFMAYLQYSELVKRGIVPFK  171



>gb|AAF87258.1|AC068562_5 Strong similarity to UDP-glucose glucosyltransferase from Arabidopsis 
thaliana gb|AB016819 and contains a UDP-glucosyl transferase 
PF|00201 domain [Arabidopsis thaliana]
Length=450

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 133/175 (76%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S     ++KPH VCVP+PAQ HIN MLK+AKLLH +GFH+TFVNT +NH RL RSRGP
Sbjct  1    MASPAVHSKQKPHVVCVPHPAQGHINPMLKVAKLLHARGFHVTFVNTVYNHNRLLRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSFRFE+I DGLP +D D TQDIP+LCVST   CL PFK+LL R+N      +V
Sbjct  61   YALDGLPSFRFESIADGLPDTDGDKTQDIPALCVSTMKNCLAPFKELLRRIND---VDDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG+MSFTL AAEEL +P+V+FW  SA GFM  +H+   ++KG +P K
Sbjct  118  PPVSCIVSDGVMSFTLDAAEELNLPEVIFWTNSACGFMTFLHFYLFIEKGLSPFK  172



>ref|XP_010087621.1| UDP-glycosyltransferase 85A1 [Morus notabilis]
 gb|EXB29476.1| UDP-glycosyltransferase 85A1 [Morus notabilis]
Length=497

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 131/165 (79%), Gaps = 1/165 (1%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPH VCVPYP+Q H+N M++LAKLLH++GFH+TFVNTEFNH RL RSRG +S++GLP FR
Sbjct  8    KPHVVCVPYPSQGHVNPMMQLAKLLHSRGFHVTFVNTEFNHNRLIRSRGADSVKGLPDFR  67

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FE IP+GLP SD DATQD+P+LC ST   CL PFK+LL +LN + A   VPPV+CI+SDG
Sbjct  68   FEAIPEGLPRSDRDATQDVPALCDSTRKNCLAPFKELLLKLN-SLAPEKVPPVTCIISDG  126

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            +MSF + A EELGIP+V FW  SA  FMG +H+ +L+++G  P K
Sbjct  127  VMSFAIKAGEELGIPEVQFWTASACSFMGYLHFDELINRGIIPFK  171



>ref|XP_006303659.1| hypothetical protein CARUB_v10011698mg [Capsella rubella]
 gb|EOA36557.1| hypothetical protein CARUB_v10011698mg [Capsella rubella]
Length=483

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 132/175 (75%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S      +KPH VCVP+PAQ HIN ML++AKLLH KGFH+TF NT +NH+RL RSRG 
Sbjct  1    MASQTVSSGQKPHVVCVPFPAQGHINPMLQVAKLLHAKGFHVTFANTIYNHKRLLRSRGS  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L  LPSFR+E+IPDGLP ++ DATQD+P LC ST   CL PFK+LL R+N    A +V
Sbjct  61   NALNVLPSFRYESIPDGLPETNKDATQDVPPLCASTKKNCLAPFKELLTRIN---TADDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDGIMSFTL AAEELG+PDV+FW  SA GF+  +H+   V+KG +P K
Sbjct  118  PPVSCIVSDGIMSFTLDAAEELGVPDVVFWTTSACGFLAYLHFYCFVEKGLSPQK  172



>ref|XP_007222658.1| hypothetical protein PRUPE_ppa004956mg [Prunus persica]
 gb|EMJ23857.1| hypothetical protein PRUPE_ppa004956mg [Prunus persica]
Length=483

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 134/166 (81%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            KKPHAVC+PYPAQ HI  ML+L KLLH KGFHITFVNTEFNHRRL +SRGP SL GLPSF
Sbjct  8    KKPHAVCIPYPAQGHITPMLQLTKLLHYKGFHITFVNTEFNHRRLLKSRGPNSLDGLPSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLPP+D++ATQD+ +LCVST+  CL PF+DLL++LN   +  + PPV+CIVSD
Sbjct  68   RFETIPDGLPPTDINATQDVTALCVSTSKNCLAPFRDLLSKLN---SLPDSPPVTCIVSD  124

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G M+FTL AA+ELGIP+V+   +SA GFM  +    L++KG  PL+
Sbjct  125  GGMTFTLDAAQELGIPEVILQTLSACGFMCYLQCRPLIEKGLIPLR  170



>ref|XP_006304665.1| hypothetical protein CARUB_v10011877mg [Capsella rubella]
 gb|EOA37563.1| hypothetical protein CARUB_v10011877mg [Capsella rubella]
Length=486

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 134/175 (77%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+    ++KPH VCVPYPAQ HIN MLK+AKLLHN+GFH+TFVNT +NH+RL RSRG 
Sbjct  1    MGSHVVCNQQKPHVVCVPYPAQGHINPMLKVAKLLHNRGFHVTFVNTVYNHKRLIRSRGT  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            ++L  +PSFRFE IPDGLP +DVDATQDIP+L  ST   CL PFK+L+ R+N      +V
Sbjct  61   DALGRVPSFRFEAIPDGLPETDVDATQDIPTLSESTEKNCLAPFKELIGRIN---TREDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIV+DG MSFTL  AEELG+P+VLFW  S  GFM  +HY   ++KG  P++
Sbjct  118  PPVSCIVADGAMSFTLDVAEELGVPEVLFWTPSGCGFMAYLHYYLFIEKGLCPVQ  172



>ref|XP_010098615.1| UDP-glycosyltransferase 85A1 [Morus notabilis]
 gb|EXB75354.1| UDP-glycosyltransferase 85A1 [Morus notabilis]
Length=481

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 132/164 (80%), Gaps = 3/164 (2%)
 Frame = +1

Query  82   PHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFRF  261
            PH VC+PYPAQ H+N M  LAKLLH+KGF++TFV TEFN++RL RSRGP SL GLPSFRF
Sbjct  12   PHVVCIPYPAQGHVNPMTNLAKLLHHKGFYVTFVYTEFNYKRLLRSRGPNSLDGLPSFRF  71

Query  262  ETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDGI  441
            E+IPDGLP SD DATQDIPSLC ST+  CL PF+ LL++LN   ++ ++PPVS IVSDG 
Sbjct  72   ESIPDGLPESDADATQDIPSLCESTSKNCLAPFRQLLSKLN---SSPDIPPVSSIVSDGA  128

Query  442  MSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            M+FTL AA ELG+P+V+ W  SA GF+  ++Y QL++KG TPLK
Sbjct  129  MTFTLEAARELGVPEVVLWTTSACGFLAYLNYRQLIEKGVTPLK  172



>ref|XP_010039907.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW45644.1| hypothetical protein EUGRSUZ_L00599 [Eucalyptus grandis]
Length=487

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 129/168 (77%), Gaps = 2/168 (1%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL RSRGP SL GLPSF
Sbjct  8    QKPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPSSLDGLPSF  67

Query  256  RFETIPDGLPPSD--VDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            +F TIPDGLPPSD   D TQD  +LC ST+  CL  F+DLL RLN  +A +  PPVSC+V
Sbjct  68   QFRTIPDGLPPSDAAADTTQDTLALCQSTSKFCLPYFRDLLHRLNEESATSGSPPVSCVV  127

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            SDG M+FTL AAE +G+P+VL W  SA  FMG + Y  L+DKG  PLK
Sbjct  128  SDGAMTFTLDAAEAIGVPEVLLWTASACSFMGYVQYRSLIDKGLAPLK  175



>gb|KHN24338.1| UDP-glycosyltransferase 85A3 [Glycine soja]
Length=456

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 132/163 (81%), Gaps = 4/163 (2%)
 Frame = +1

Query  82   PHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFRF  261
            PHAVC+PYPAQ HIN MLKLAKLLH KGFHITFVNTE+NH+R+ ++RGP SL GLPSFRF
Sbjct  2    PHAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRILKARGPYSLNGLPSFRF  61

Query  262  ETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDGI  441
            ETIPDGLP   V+ATQDIPSLC ST  TCL  F++LLA++N+    ++V PV+CIVSDG 
Sbjct  62   ETIPDGLPEPVVEATQDIPSLCDSTRRTCLPHFRNLLAKINN----SDVSPVTCIVSDGG  117

Query  442  MSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPL  570
            MSFTL AAEELG+P VLFW  SA GFM  + Y +L++KG  PL
Sbjct  118  MSFTLDAAEELGVPQVLFWTPSACGFMCYLQYEKLIEKGLMPL  160



>ref|XP_007222427.1| hypothetical protein PRUPE_ppa004909mg [Prunus persica]
 gb|EMJ23626.1| hypothetical protein PRUPE_ppa004909mg [Prunus persica]
Length=486

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 137/175 (78%), Gaps = 5/175 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS      KKPHAVC+PYPAQ HI  MLKLAKLLH KGFHITFVNTEFNH+RL +SRGP
Sbjct  1    MGS--VALTKKPHAVCIPYPAQGHITPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSF+FETIPDGLPPSD +ATQDIPSLC+ST+  CL PF+DLL++LN   +  + 
Sbjct  59   NSLDGLPSFQFETIPDGLPPSDDNATQDIPSLCLSTSKNCLAPFRDLLSKLN---SLPHS  115

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPV+C+VSDG M+F+L AA+E GIP VLF   SA G +G + Y  L++KG  PLK
Sbjct  116  PPVTCLVSDGGMTFSLDAAQEFGIPCVLFETTSACGSLGYLQYLPLMEKGLIPLK  170



>gb|KCW73113.1| hypothetical protein EUGRSUZ_E01564, partial [Eucalyptus grandis]
Length=433

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 133/181 (73%), Gaps = 8/181 (4%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYP------AQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRL  210
            M SN  E  +KPHAVC+P+P       Q HI  ML LAKLLH++GFHITFVNTE+NH+RL
Sbjct  1    MSSN--EMTQKPHAVCMPFPDSKAACTQGHIKPMLSLAKLLHHRGFHITFVNTEYNHKRL  58

Query  211  QRSRGPESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHT  390
             RSRGP +L GLPSFRF TIPDGLPP D D TQDIP+LC S+   CL  F+DLL  L+  
Sbjct  59   LRSRGPSALDGLPSFRFRTIPDGLPPPDADVTQDIPTLCRSSRDLCLPYFRDLLQTLDEE  118

Query  391  AAATNVPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPL  570
            +A +  PPVSC+VSDG+MSFTL AAE  G+P VLFW  SA GFMG + Y  LVDKG +PL
Sbjct  119  SATSGSPPVSCVVSDGVMSFTLDAAEAAGVPLVLFWTTSACGFMGYVQYRSLVDKGLSPL  178

Query  571  K  573
            +
Sbjct  179  R  179



>ref|XP_002268845.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=483

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 129/166 (78%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVCVPYP Q H+  ML+L KLLH +GFHITFVNTE+NHRRL RSRGP +++GLP F
Sbjct  8    RKPHAVCVPYPTQGHVTPMLQLTKLLHTRGFHITFVNTEYNHRRLLRSRGPNAVKGLPDF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLP SD DA+QDIPSLC ST   CL PFKDLLA++    +++ VPPV+CI+SD
Sbjct  68   RFETIPDGLPQSDRDASQDIPSLCDSTRKNCLPPFKDLLAKI---GSSSEVPPVTCIISD  124

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+MSF + AA+ELGIP    W  SA GFMG + Y +L+ +G  P K
Sbjct  125  GVMSFAIKAAKELGIPGFQLWTASACGFMGYLSYRELIRRGIVPFK  170



>gb|KEH17174.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=479

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 132/165 (80%), Gaps = 4/165 (2%)
 Frame = +1

Query  82   PHAVCVPYPAQSHINAMLKLAKLLHNKG-FHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            PH VCVPYPAQ HIN ML +AKLLH KG FH+TFVNTE+NH+R  ++RGP+SL GLP+FR
Sbjct  11   PHVVCVPYPAQGHINPMLNIAKLLHFKGGFHVTFVNTEYNHKRHLKARGPDSLNGLPTFR  70

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLP S+VD+TQDIPSLC ST  TCL  FK+LL++LN    A + PPV+CIVSDG
Sbjct  71   FETIPDGLPESNVDSTQDIPSLCESTRKTCLPHFKNLLSKLND---ALDTPPVTCIVSDG  127

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            +MSFTL AA+EL IP VLFW  SA GFM    Y QL++KG TPLK
Sbjct  128  VMSFTLDAAQELNIPQVLFWTTSACGFMCYAQYRQLMEKGLTPLK  172



>gb|ACJ84649.1| unknown [Medicago truncatula]
Length=480

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 137/177 (77%), Gaps = 7/177 (4%)
 Frame = +1

Query  49   MGSNNCEFEKKP-HAVCVPYPAQSHINAMLKLAKLLHNKG-FHITFVNTEFNHRRLQRSR  222
            MGS   +  K P H VC+P+PAQ HIN MLKLAKLLH KG FH+TFVNTE+NH+RL ++R
Sbjct  1    MGS--LDITKNPSHVVCIPFPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKAR  58

Query  223  GPESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAAT  402
            GP SL GLPSFRFETIPDGLP SDVD TQDIPSLC ST  TC   FK LL++LN+   A 
Sbjct  59   GPNSLNGLPSFRFETIPDGLPESDVDVTQDIPSLCESTRATCSPHFKKLLSKLNN---AI  115

Query  403  NVPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            + PPV+CIVSDG MSFTL AA+EL IP+VLFW  SA GFM  M Y +L+++G TPLK
Sbjct  116  DTPPVTCIVSDGCMSFTLDAAQELNIPEVLFWTTSACGFMCYMQYRKLIEEGLTPLK  172



>gb|AFK33787.1| unknown [Medicago truncatula]
Length=480

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 131/164 (80%), Gaps = 4/164 (2%)
 Frame = +1

Query  85   HAVCVPYPAQSHINAMLKLAKLLHNKG-FHITFVNTEFNHRRLQRSRGPESLRGLPSFRF  261
            H VC+P+PAQ HIN MLKLAKLLH KG FH+TFVNTE+NH+RL ++RGP SL GLPSFRF
Sbjct  12   HVVCIPFPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKARGPNSLNGLPSFRF  71

Query  262  ETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDGI  441
            ETIPDGLP SDVD TQDIPSLC ST  TC   FK LL++LN+   A + PPV+CIVSDG 
Sbjct  72   ETIPDGLPESDVDVTQDIPSLCESTRATCSPHFKKLLSKLNN---AIDTPPVTCIVSDGC  128

Query  442  MSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            MSFTL AA+EL IP+VLFW  SA GFM  M Y +L+++G TPLK
Sbjct  129  MSFTLDAAQELNIPEVLFWTTSACGFMCYMQYRKLIEEGLTPLK  172



>ref|XP_003615138.1| Cytokinin-O-glucosyltransferase [Medicago truncatula]
 gb|AES98096.1| UDP-glucosyltransferase family protein [Medicago truncatula]
 gb|KEH28099.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=480

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 131/164 (80%), Gaps = 4/164 (2%)
 Frame = +1

Query  85   HAVCVPYPAQSHINAMLKLAKLLHNKG-FHITFVNTEFNHRRLQRSRGPESLRGLPSFRF  261
            H VC+P+PAQ HIN MLKLAKLLH KG FH+TFVNTE+NH+RL ++RGP SL GLPSFRF
Sbjct  12   HVVCIPFPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKARGPNSLNGLPSFRF  71

Query  262  ETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDGI  441
            ETIPDGLP SDVD TQDIPSLC ST  TC   FK LL++LN+   A + PPV+CIVSDG 
Sbjct  72   ETIPDGLPESDVDVTQDIPSLCESTRATCSPHFKKLLSKLNN---AIDTPPVTCIVSDGC  128

Query  442  MSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            MSFTL AA+EL IP+VLFW  SA GFM  M Y +L+++G TPLK
Sbjct  129  MSFTLDAAQELNIPEVLFWTTSACGFMCYMQYRKLIEEGLTPLK  172



>emb|CDP01072.1| unnamed protein product [Coffea canephora]
Length=412

 Score =   232 bits (592),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 129/165 (78%), Gaps = 3/165 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHA+ +P+PAQ  IN M KLAK+LH+KGFHITFV++EFN RRL +SRG  +L GLP+F+
Sbjct  11   KPHAIFIPFPAQGRINPMFKLAKILHHKGFHITFVHSEFNQRRLLKSRGKNALDGLPAFQ  70

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLP SD DATQD+PSLC ST+  CL PF+ L+ RLN   ++  VPPVSCIVSDG
Sbjct  71   FETIPDGLPFSDADATQDVPSLCDSTSKNCLAPFRQLVTRLN---SSPGVPPVSCIVSDG  127

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            IMSFTL  A ELGIPDV FW   A G M  ++Y  LV+KGYTPLK
Sbjct  128  IMSFTLEVARELGIPDVFFWTNGAGGVMAYLNYRNLVEKGYTPLK  172



>emb|CDY46645.1| BnaA07g10510D [Brassica napus]
Length=458

 Score =   234 bits (596),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 129/166 (78%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPH +CVPYPAQ HIN MLK+AKLLH +GFH+TFVNT +NH RL RSRGP ++ GLPSF
Sbjct  10   EKPHVICVPYPAQGHINPMLKVAKLLHARGFHVTFVNTVYNHNRLIRSRGPHAVEGLPSF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE+IPDGLP +DVD TQDI +LC ST   CL PFK+LL R+N   A  +VPPVSCIV+D
Sbjct  70   RFESIPDGLPETDVDVTQDITALCDSTMKNCLTPFKELLQRIN---AGDDVPPVSCIVAD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G MSFTL  AEELG+P+VLFW   AS FM  +H+   ++KG  P+K
Sbjct  127  GCMSFTLEPAEELGVPEVLFWTTGASAFMIYLHFYLFIEKGLAPIK  172



>emb|CDY46644.1| BnaA07g10520D [Brassica napus]
Length=301

 Score =   229 bits (583),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 129/175 (74%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S+  +  +KPH   VPYPAQ HIN MLKLAKLLH KG H+TFVNT +NH RL RSRGP
Sbjct  1    MESHAIDNRQKPHVAFVPYPAQGHINPMLKLAKLLHAKGIHVTFVNTVYNHNRLLRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSFRFETIPDGLP +DVDATQDI +LC ST   CL PF++LL R+N   A  +V
Sbjct  61   NALDGLPSFRFETIPDGLPETDVDATQDITALCESTMKNCLAPFEELLWRIN---ARDDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCI+SD  MSFTL AAE+L IP VLFW  SA G M  +H+   ++KG  P+K
Sbjct  118  PPVSCIISDDCMSFTLDAAEKLCIPHVLFWSTSACGLMAYLHFYHFIEKGLCPVK  172



>emb|CDY38225.1| BnaC05g17420D [Brassica napus]
Length=482

 Score =   234 bits (597),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 129/166 (78%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +K H VCVPYPAQ HIN M+K+AKLLH KGF++TFVNT +NH+RL RSRG  +L GLPSF
Sbjct  10   RKQHVVCVPYPAQGHINPMMKVAKLLHAKGFYVTFVNTIYNHKRLLRSRGSNALDGLPSF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE+IPDGLP +DVD TQDIP+LC ST    L PFK+LL R+N   A    PPVSCIVSD
Sbjct  70   RFESIPDGLPETDVDVTQDIPALCESTVKNSLAPFKELLRRIN---AQDESPPVSCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G MSFTL AAEELG+P+VLFW  SA G +  +HY + ++KG +PLK
Sbjct  127  GCMSFTLDAAEELGVPEVLFWTTSACGLLAYLHYHKFIEKGLSPLK  172



>ref|XP_006416205.1| hypothetical protein EUTSA_v10007502mg [Eutrema salsugineum]
 gb|ESQ34558.1| hypothetical protein EUTSA_v10007502mg [Eutrema salsugineum]
Length=483

 Score =   234 bits (597),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 130/166 (78%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVCVP+PAQ HI+ M K+AKLLH KGFH+TFVNT +NH RL RSRG  +L G PSF
Sbjct  10   QKPHAVCVPFPAQGHIDPMQKVAKLLHAKGFHVTFVNTVYNHNRLLRSRGTNALDGFPSF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE+IPDGLP  D DATQD PSLC +T   CL PFK+L+ R+N   A  +VPPVSCIVSD
Sbjct  70   RFESIPDGLPEIDGDATQDPPSLCEATMKNCLAPFKELVRRIN---AEDDVPPVSCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+MSFTL  AEELG+P+VLFW  SA GFM  +H+ + ++KG +PLK
Sbjct  127  GVMSFTLDVAEELGVPEVLFWTTSACGFMAYLHFYRFIEKGLSPLK  172



>gb|AFK37311.1| unknown [Medicago truncatula]
Length=480

 Score =   234 bits (597),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 137/177 (77%), Gaps = 7/177 (4%)
 Frame = +1

Query  49   MGSNNCEFEKKP-HAVCVPYPAQSHINAMLKLAKLLHNKG-FHITFVNTEFNHRRLQRSR  222
            MGS   +  K P H VC+P+PAQ HIN MLKLAKLLH KG FH+TFVNTE+NH+RL ++R
Sbjct  1    MGS--LDITKNPSHVVCIPFPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKAR  58

Query  223  GPESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAAT  402
            GP SL GLPSFRFETIPDGLP SDVD TQDIPSLC ST  TC   FK LL++LN+   A 
Sbjct  59   GPNSLNGLPSFRFETIPDGLPESDVDVTQDIPSLCESTRATCSPHFKKLLSKLNN---AI  115

Query  403  NVPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            + PPV+CIVSDG MSFTL AA+EL IP+VLFW  SA GFM  M Y +L+++G TPLK
Sbjct  116  DTPPVTCIVSDGCMSFTLDAAQELNIPEVLFWTTSACGFMCYMQYRKLIEEGLTPLK  172



>ref|XP_008219456.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=486

 Score =   234 bits (597),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 134/166 (81%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            KKPHAVC+PYPAQ HI  MLKLAKLLH KGFHITFVNTEFNH+RL +SRGP SL GLPSF
Sbjct  8    KKPHAVCIPYPAQGHITPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGLPSF  67

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            +FETIPDGLPPSD +ATQDIPSLC+ST+  CL PF DLL++LN   +  + PPV+C+VSD
Sbjct  68   QFETIPDGLPPSDDNATQDIPSLCLSTSKNCLAPFGDLLSKLN---SLPHSPPVTCLVSD  124

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G M+F+L AA+E GIP VLF  +SA G +G + Y  L++KG  PLK
Sbjct  125  GGMTFSLDAAQEFGIPCVLFETMSACGSLGYLQYLPLMEKGLIPLK  170



>ref|XP_006472583.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
Length=503

 Score =   234 bits (598),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            ++PHAVCVPYPAQ HIN M +LAKLLH+KGFHITFVNTEFN RRL +S+GP+SL  +P+F
Sbjct  11   RRPHAVCVPYPAQGHINPMFQLAKLLHHKGFHITFVNTEFNQRRLLKSQGPDSLNAVPTF  70

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLPPSD DATQDIPSLC ST  TC  PF+ LL  LN++A +   PPV+CIVSD
Sbjct  71   RFETIPDGLPPSDADATQDIPSLCDSTRRTCSAPFQALLTTLNNSALSNANPPVTCIVSD  130

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
              M FTL A+++L IP+VLF+  SA GFMG +HY  L +K   PLK
Sbjct  131  WSMGFTLKASKQLNIPNVLFFTASACGFMGYVHYRHLAEKCIFPLK  176



>ref|XP_002893221.1| UDP-glycosyltransferase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69480.1| UDP-glycosyltransferase [Arabidopsis lyrata subsp. lyrata]
Length=469

 Score =   234 bits (596),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 135/175 (77%), Gaps = 6/175 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+     +KPH VCVPYPAQ HIN M+K+AKLL+ KGFH+TFVNT +NH RL RSRG 
Sbjct  1    MGSH---VAQKPHVVCVPYPAQGHINPMMKVAKLLYAKGFHVTFVNTVYNHNRLLRSRGS  57

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             ++ GLPSFRFE+IPDGL  +DVD TQDIP+LC ST   CL PFK+LL ++N   A  +V
Sbjct  58   NAVDGLPSFRFESIPDGLSETDVDVTQDIPTLCESTMKHCLAPFKELLRQIN---AGDDV  114

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG MSFTL AAEELG+P+VLFW  SA GF+  + Y + ++KG +P+K
Sbjct  115  PPVSCIVSDGCMSFTLDAAEELGVPEVLFWTTSACGFLAYLFYYRFIEKGLSPIK  169



>ref|XP_009387949.1| PREDICTED: UDP-glycosyltransferase 85A2-like, partial [Musa acuminata 
subsp. malaccensis]
Length=249

 Score =   227 bits (578),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 127/170 (75%), Gaps = 5/170 (3%)
 Frame = +1

Query  64   CEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRG  243
            C   +KPH VC+PYPAQ H+  M+ LAKLLH+ GFHITFVNT++NHRRL RS+   S   
Sbjct  3    CMTTRKPHVVCIPYPAQGHVTPMMMLAKLLHSHGFHITFVNTQYNHRRLLRSKALSSDDV  62

Query  244  LPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSC  423
            LP FRFE+IPDGLPPSD DATQDIPSLC S     L PF DLL +LN  +     PPVSC
Sbjct  63   LPDFRFESIPDGLPPSDKDATQDIPSLCESIQNNALPPFLDLLRQLNEGS-----PPVSC  117

Query  424  IVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            +VSDGIMSFTL AA+EL IP+V+FW  SA GFMG +HY  L+++G TPLK
Sbjct  118  VVSDGIMSFTLDAAKELSIPEVMFWTPSACGFMGYLHYKHLLERGLTPLK  167



>ref|XP_011031049.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X2 [Populus euphratica]
Length=491

 Score =   234 bits (597),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 132/168 (79%), Gaps = 5/168 (3%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVCVPYP+Q H+  M+ LAKLLH++GFHITFVNTEFNH RL RSRGP+S+ GLP F
Sbjct  7    RKPHAVCVPYPSQGHVTPMMHLAKLLHSRGFHITFVNTEFNHGRLIRSRGPDSVEGLPDF  66

Query  256  RFETIPDG--LPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            RFETIPDG  LPPSD DATQD+PSLC ST   C+ PFK+LL +LN   +++ VPPV+C++
Sbjct  67   RFETIPDGLPLPPSDFDATQDVPSLCDSTRKNCMAPFKELLTKLN---SSSEVPPVTCVI  123

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            SDG+MSF + AAEE  IP V FW  SA  FMG +H+++L  +G+ P K
Sbjct  124  SDGVMSFGIKAAEEFNIPQVQFWTASACSFMGYLHFNELTRRGFVPYK  171



>ref|XP_011031048.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X1 [Populus euphratica]
Length=492

 Score =   234 bits (597),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 132/168 (79%), Gaps = 5/168 (3%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVCVPYP+Q H+  M+ LAKLLH++GFHITFVNTEFNH RL RSRGP+S+ GLP F
Sbjct  7    RKPHAVCVPYPSQGHVTPMMHLAKLLHSRGFHITFVNTEFNHGRLIRSRGPDSVEGLPDF  66

Query  256  RFETIPDG--LPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
            RFETIPDG  LPPSD DATQD+PSLC ST   C+ PFK+LL +LN   +++ VPPV+C++
Sbjct  67   RFETIPDGLPLPPSDFDATQDVPSLCDSTRKNCMAPFKELLTKLN---SSSEVPPVTCVI  123

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            SDG+MSF + AAEE  IP V FW  SA  FMG +H+++L  +G+ P K
Sbjct  124  SDGVMSFGIKAAEEFNIPQVQFWTASACSFMGYLHFNELTRRGFVPYK  171



>ref|XP_006433964.1| hypothetical protein CICLE_v10004031mg [Citrus clementina]
 gb|ESR47204.1| hypothetical protein CICLE_v10004031mg [Citrus clementina]
Length=561

 Score =   236 bits (601),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 141/181 (78%), Gaps = 1/181 (1%)
 Frame = +1

Query  34   ERKREMGS-NNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRL  210
            +++ EM S  + +  ++PHAVCVP+PAQ HIN M +LAKLLH+KGFHITFVNTEFN RRL
Sbjct  53   KQRAEMASLIDTQHPRRPHAVCVPHPAQGHINPMFQLAKLLHHKGFHITFVNTEFNQRRL  112

Query  211  QRSRGPESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHT  390
             +S+GP+SL  +P+FRFETIPDGLPPSD DATQDIPSLC ST  TC  PF++LL RLN++
Sbjct  113  LKSQGPDSLNAVPTFRFETIPDGLPPSDADATQDIPSLCDSTRRTCSAPFQELLTRLNNS  172

Query  391  AAATNVPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPL  570
            A +   PPV+CIVSD  M FTL A+++L IP+VLF+  SA GF G +HY  LV+K   PL
Sbjct  173  ALSNVNPPVTCIVSDWAMGFTLKASKQLNIPNVLFFTASACGFTGYVHYRHLVEKCIFPL  232

Query  571  K  573
            K
Sbjct  233  K  233



>emb|CDP01082.1| unnamed protein product [Coffea canephora]
Length=652

 Score =   238 bits (606),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 133/168 (79%), Gaps = 1/168 (1%)
 Frame = +1

Query  70   FEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLP  249
             EKKPHAVC+P  AQ HI  ML LAKLLH+ GFHITFVNTEFNHRRL +SRGP++L GLP
Sbjct  7    LEKKPHAVCIPAAAQGHIGPMLNLAKLLHHNGFHITFVNTEFNHRRLLKSRGPDALNGLP  66

Query  250  SFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIV  429
             F+F+ IPDGLPPSDVDATQDIP+L  S   TCLGPF++LLA LN T +++ VPPVSCIV
Sbjct  67   DFQFKAIPDGLPPSDVDATQDIPTLFESMDRTCLGPFRELLAELNDT-SSSKVPPVSCIV  125

Query  430  SDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            SD    FTLAAAEEL IP+VLFW  SA  ++G   Y++L++KG  PLK
Sbjct  126  SDAATGFTLAAAEELSIPEVLFWTSSACSYLGYFQYAKLMEKGIIPLK  173



>ref|XP_006304493.1| hypothetical protein CARUB_v10011262mg [Capsella rubella]
 gb|EOA37391.1| hypothetical protein CARUB_v10011262mg [Capsella rubella]
Length=488

 Score =   234 bits (596),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 132/175 (75%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS+     +KPH VCVPYPAQ HIN M+K+AKLLH +GFH+TFVNT +NH+R  RSRG 
Sbjct  1    MGSHVVGNTQKPHVVCVPYPAQGHINPMMKVAKLLHARGFHVTFVNTIYNHKRFLRSRGS  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSFRFE+IPDGLP +D+D TQDI +LC ST   CL PF++L+ R+N   A  NV
Sbjct  61   NALDGLPSFRFESIPDGLPETDMDTTQDITALCESTMKNCLAPFQELIQRIN---AGDNV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG MSFTL  AEELG+P+VLFW  S   F+  +H+   ++KG +P+K
Sbjct  118  PPVSCIVSDGCMSFTLDVAEELGVPEVLFWTTSGCAFLAYLHFYLFIEKGISPMK  172



>ref|XP_006388803.1| hypothetical protein POPTR_0098s003001g, partial [Populus trichocarpa]
 gb|ERP47717.1| hypothetical protein POPTR_0098s003001g, partial [Populus trichocarpa]
Length=173

 Score =   224 bits (570),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 129/167 (77%), Gaps = 1/167 (1%)
 Frame = +1

Query  73   EKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPS  252
            + KPHAVC+P P QSHI +MLKLAKLLH+KGFHITFVNTEFNH+RL +SRGP+SL+GLP 
Sbjct  8    DHKPHAVCLPSPYQSHIKSMLKLAKLLHHKGFHITFVNTEFNHKRLLKSRGPDSLKGLPD  67

Query  253  FRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVS  432
            FRFE++PDGLPPSD +ATQD+P LC + +   L PF DLL +LN TA+  +VPPV+CIVS
Sbjct  68   FRFESVPDGLPPSDENATQDLPGLCEAASKNLLAPFHDLLDKLNDTASP-DVPPVTCIVS  126

Query  433  DGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            DG M   + AAE LGIP  LF  ISA  FMG   +  L +KG TPLK
Sbjct  127  DGFMPVAITAAEMLGIPIDLFITISACSFMGFKQFQALKEKGLTPLK  173



>ref|XP_007226586.1| hypothetical protein PRUPE_ppa023851mg [Prunus persica]
 gb|EMJ27785.1| hypothetical protein PRUPE_ppa023851mg [Prunus persica]
Length=474

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = +1

Query  55   SNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPES  234
            S+NC  EK PHAVC+PYPAQ HIN MLKLAKLLH KGFHIT+VN+EFN +RL +SRGP S
Sbjct  2    SSNCLIEK-PHAVCIPYPAQGHINPMLKLAKLLHYKGFHITYVNSEFNLKRLLKSRGPNS  60

Query  235  LRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPP  414
            L GLPSFRFETIPDGLPP+D +ATQDIPSLC ST    L  F+DLL++LN   ++ + PP
Sbjct  61   LDGLPSFRFETIPDGLPPTDANATQDIPSLCDSTRKRSLPYFRDLLSKLN---SSPDCPP  117

Query  415  VSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDK  555
            VSCIVSDG M FTL AA+E G+P+VLFW  SA GF+  +HY +L++K
Sbjct  118  VSCIVSDGAMGFTLDAAQEFGLPEVLFWTTSACGFLAYVHYHRLIEK  164



>ref|XP_010035387.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW84253.1| hypothetical protein EUGRSUZ_B01109 [Eucalyptus grandis]
Length=488

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 131/169 (78%), Gaps = 3/169 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVC+PYPAQ HIN ML LAKLLH++GFH+TFVNTE+NH RL RSRGP SL GLPSF
Sbjct  8    QKPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPSSLDGLPSF  67

Query  256  RFETIPDGLPPSDV--DATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN-VPPVSCI  426
            +F TIPDGLPPSD   DATQD  +LC ST+  CL  F+DLL RLN  +A T+  PPVSC+
Sbjct  68   QFRTIPDGLPPSDAASDATQDTLALCQSTSKFCLPYFRDLLQRLNEESATTSGSPPVSCV  127

Query  427  VSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            VSDG M+FTL AAE + +P+VL W  SA  FMG + Y  L+DKG TPLK
Sbjct  128  VSDGAMTFTLDAAEAINVPEVLLWTASACSFMGYVQYRSLIDKGLTPLK  176



>ref|XP_002298702.2| hypothetical protein POPTR_0001s32000g [Populus trichocarpa]
 gb|EEE83507.2| hypothetical protein POPTR_0001s32000g [Populus trichocarpa]
Length=474

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 129/165 (78%), Gaps = 3/165 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVCVP+PAQ HIN MLKLAK+LH  GFHITFVNTE+NHRRL RSRG  SL GLP F+
Sbjct  4    KPHAVCVPFPAQGHINPMLKLAKILHFNGFHITFVNTEYNHRRLLRSRGASSLDGLPDFQ  63

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLPPSD D+TQDI +LC ST+ TCL PF+DL+A+LN ++    +P V+CIVSD 
Sbjct  64   FETIPDGLPPSDADSTQDILTLCYSTSKTCLAPFRDLIAKLNSSSV---IPQVTCIVSDA  120

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            IM+FTL AAEE GIPD LFW  SA G +G      L ++G TP+K
Sbjct  121  IMNFTLDAAEEFGIPDALFWTPSACGVLGYSKCRLLFERGLTPVK  165



>ref|XP_010267412.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nelumbo 
nucifera]
Length=492

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 135/165 (82%), Gaps = 1/165 (1%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+PYPAQ HIN MLKLAKLL+++GFHITFVNT +N+RRL +SRGP SL GL  FR
Sbjct  9    KPHAVCIPYPAQGHINPMLKLAKLLNSRGFHITFVNTXYNYRRLLKSRGPNSLSGLVDFR  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLPPSD DATQDIP+LC ST  +CL PF+  L    + ++++N+PP++CI+SDG
Sbjct  69   FETIPDGLPPSDTDATQDIPTLCNSTKNSCLLPFRT-LLSKLNNSSSSNIPPITCIISDG  127

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            +MSFTL AAEELGIP+VLFW  SA GFM  +HY  L+++  TPLK
Sbjct  128  VMSFTLDAAEELGIPEVLFWTTSACGFMSYVHYPYLIERCLTPLK  172



>ref|XP_006416203.1| hypothetical protein EUTSA_v10009957mg, partial [Eutrema salsugineum]
 gb|ESQ34556.1| hypothetical protein EUTSA_v10009957mg, partial [Eutrema salsugineum]
Length=759

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 134/174 (77%), Gaps = 3/174 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS++    +KPH VCVPYPAQ HIN MLK+AKLLH KGFH+TFVNT +NH RL RSRGP
Sbjct  1    MGSHDDFNPQKPHVVCVPYPAQGHINPMLKVAKLLHAKGFHVTFVNTVYNHNRLLRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSF+FE IPDGLP +DVDATQDIP+LC ST   CL PFK+LL ++N   A  +V
Sbjct  61   NALDGLPSFQFEAIPDGLPETDVDATQDIPALCESTMKNCLAPFKELLRQIN---ARDDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPL  570
            PPVSCIVSDG MSFTL AAEELGIP+VLFW  SA   M  +H+   ++KG +P 
Sbjct  118  PPVSCIVSDGCMSFTLDAAEELGIPEVLFWTPSACATMAYLHFYLFIEKGLSPF  171



>ref|XP_003544801.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Glycine max]
Length=479

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 137/175 (78%), Gaps = 5/175 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   E  KKPHAVCVP+PAQ HIN MLKLAKLLH KGFHITFVNTE+NH+RL ++RGP
Sbjct  1    MGS--LEAIKKPHAVCVPFPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +SL GL SFRFET+ DGLP  D++ TQ +PSLC  T  TCL  F++LL++LN +    +V
Sbjct  59   DSLNGLSSFRFETLADGLPQPDIEGTQHVPSLCDYTKRTCLPHFRNLLSKLNDSP---DV  115

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            P VSC+VSDGIMSFTL AA+ELG+P+VLFW  SA GFM  + Y QLV++  TPLK
Sbjct  116  PSVSCVVSDGIMSFTLDAAQELGVPNVLFWTTSACGFMCYVQYQQLVERDLTPLK  170



>ref|XP_010459992.1| PREDICTED: UDP-glycosyltransferase 85A5 [Camelina sativa]
Length=483

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 134/176 (76%), Gaps = 4/176 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S+     +KPH VCVP+PAQ HIN MLK+AKLL+ +GFH+TFVNT +NH RL RSRGP
Sbjct  1    MASHAVSSRQKPHVVCVPFPAQGHINPMLKVAKLLYARGFHVTFVNTVYNHNRLIRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPS-DVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN  405
             +L GLPSFRFE+IPDGLP   + D  QD+P LC ST   CL PFK+LL R+N      +
Sbjct  61   NALDGLPSFRFESIPDGLPEEPNKDVMQDVPPLCESTMKNCLAPFKELLRRIN---TGDD  117

Query  406  VPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            VPPVSCIVSDG+MSFTL AAEELG+P+V+FW  SA GF+  +H+ +L++KG +PLK
Sbjct  118  VPPVSCIVSDGVMSFTLDAAEELGVPEVIFWTTSACGFLAYLHFYRLIEKGLSPLK  173



>ref|XP_009103240.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Brassica rapa]
Length=490

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 129/166 (78%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPH +CVPYPAQ HIN MLK+AKLLH +GFH+TFVNT +NH RL RSRGP ++ GLPSF
Sbjct  10   EKPHVICVPYPAQGHINPMLKVAKLLHARGFHVTFVNTVYNHNRLLRSRGPHAVEGLPSF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE+IPDGLP +DVD TQ+I +LC ST   CL PF +LL R+N   A  +VPPVSCIV+D
Sbjct  70   RFESIPDGLPETDVDVTQNITALCDSTMKNCLTPFNELLQRIN---AGDDVPPVSCIVAD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G MSFTL AAEELG+P+VLFW   AS FM  +H+   ++KG  P+K
Sbjct  127  GCMSFTLDAAEELGVPEVLFWTTGASAFMIYLHFYLFIEKGLAPIK  172



>ref|XP_010535401.1| PREDICTED: UDP-glycosyltransferase 85A1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010535409.1| PREDICTED: UDP-glycosyltransferase 85A1-like isoform X2 [Tarenaya 
hassleriana]
Length=487

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 129/175 (74%), Gaps = 2/175 (1%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MG +     +KPHAVC+PYPAQ HIN M+K+AKLLH +GFH+TFVNTEFNHRR  RSRGP
Sbjct  1    MGKHADSGSQKPHAVCIPYPAQGHINPMMKVAKLLHARGFHVTFVNTEFNHRRFLRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GL SFRFETIPDGLP SD+DATQDIP+LC ST   CL PF++LL RLN T    ++
Sbjct  61   HALDGLRSFRFETIPDGLPESDLDATQDIPALCQSTMKNCLSPFRELLQRLNATGG--DI  118

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            P VSC+V DG MSF + AA E GIP V+ W  SAS  M   +Y QL+ KG  PLK
Sbjct  119  PSVSCVVYDGAMSFAVDAAAEFGIPAVMLWTFSASVSMLYFYYRQLIQKGLIPLK  173



>emb|CDP01479.1| unnamed protein product [Coffea canephora]
Length=459

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 135/175 (77%), Gaps = 5/175 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   E  KKPHAV VPYP+Q H+  +++LAKLLH KGFH+TFVNTEFNH+RL RS+GP
Sbjct  1    MGS--VETTKKPHAVLVPYPSQGHVTPLMRLAKLLHAKGFHVTFVNTEFNHKRLIRSKGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            ES++G   FRFETIPDG+PPSD DATQD+P LC S    CL PFK+LL +L    +++ V
Sbjct  59   ESVKGFDDFRFETIPDGMPPSDKDATQDVPRLCDSVRKNCLVPFKELLIKL---ISSSEV  115

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSC++SDG+MSF++ AAE+LGIP+V FW  SA  F+G +HY +L+ +G  P K
Sbjct  116  PPVSCVISDGVMSFSIKAAEDLGIPEVQFWTASACSFIGYLHYRELIRRGIFPFK  170



>ref|XP_009413654.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like, partial 
[Musa acuminata subsp. malaccensis]
Length=250

 Score =   225 bits (574),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 126/170 (74%), Gaps = 5/170 (3%)
 Frame = +1

Query  64   CEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRG  243
            C   +KPHAVC+PYPAQ H+  M+ LAKLLH+ GFHITFVNT++NHRRL RS+   S   
Sbjct  3    CMSTRKPHAVCIPYPAQGHVTPMMMLAKLLHSHGFHITFVNTQYNHRRLLRSKALSSADV  62

Query  244  LPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSC  423
            LP FRFETIPDGLPPSD DATQDIPSLC S     L PF DLL +LN  +     PPVSC
Sbjct  63   LPDFRFETIPDGLPPSDEDATQDIPSLCESIQNNALPPFLDLLRQLNEGS-----PPVSC  117

Query  424  IVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            +VSDG+MSFT+ AA EL IP+V+FW  SA GFMG + Y  L+++G TPLK
Sbjct  118  VVSDGVMSFTVDAATELSIPEVMFWTPSACGFMGYLQYKHLLERGLTPLK  167



>emb|CDY41486.1| BnaA08g20880D [Brassica napus]
Length=480

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 134/175 (77%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S+     +KPH +CVP+PAQ HIN MLK+AKLLH KGFH+TFVN  +NH RL RSRGP
Sbjct  1    MASHAVSNGQKPHVICVPFPAQGHINPMLKVAKLLHAKGFHVTFVNNVYNHNRLLRSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L G+PSFRFE+IPDGLP +D D TQD+P LC ST   CL PFK+LL R+N   A  ++
Sbjct  61   NALDGVPSFRFESIPDGLPETDGDRTQDVPFLCESTMKNCLAPFKELLQRIN---ARDDI  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG+M+FTL AAEEL +P+++FW  SA GF+  +++ +LV+KG  P+K
Sbjct  118  PPVSCIVSDGLMTFTLDAAEELSVPNIIFWTTSACGFLAYLYFDRLVEKGLCPIK  172



>emb|CDX91674.1| BnaC08g05930D [Brassica napus]
Length=480

 Score =   231 bits (590),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 134/175 (77%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M S+     +KPH VCVP+PAQ HIN M+K AKLLH KGFH+TFVN  +NH RL RSRG 
Sbjct  1    MASHAVSNGQKPHVVCVPFPAQGHINPMMKAAKLLHAKGFHVTFVNNVYNHNRLLRSRGA  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            ++L G+PSFRFE+IPDGL  +D D  QD+PSLC ST T CL PFK+LL R+N   A  +V
Sbjct  61   KALDGVPSFRFESIPDGLAETDGDRMQDVPSLCESTMTNCLAPFKELLQRIN---ARDDV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPV+CIVSDG+M+FTL AAEELG+P+VLFW  SA GF+  +++ +LV+KG  P+K
Sbjct  118  PPVTCIVSDGLMTFTLDAAEELGVPNVLFWTTSACGFLAYLYFDRLVEKGLCPIK  172



>ref|XP_008234175.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
Length=480

 Score =   231 bits (590),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 138/175 (79%), Gaps = 4/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   E  KK HAVCVP+PAQ H++  ++LAKLLH++GFHITFVNTEFNHRRL RS+GP
Sbjct  1    MGSVR-EATKKLHAVCVPFPAQGHVSPAMQLAKLLHSRGFHITFVNTEFNHRRLIRSKGP  59

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
            +S++GLP F+FETIPDGLPPSD DATQD+P++C ST  TCLGPFK+L+ ++N   +++ V
Sbjct  60   DSVKGLPDFQFETIPDGLPPSDKDATQDVPAICDSTRKTCLGPFKELVTKIN---SSSQV  116

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            P V+CIV+DG+  F   AA+ELGIP+V FW  SA  F+G + YS+LV +G  P K
Sbjct  117  PQVTCIVADGLTGFGRQAAQELGIPEVQFWTSSACSFLGYLQYSELVKRGIVPFK  171



>ref|XP_008386313.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Malus domestica]
Length=493

 Score =   231 bits (590),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 131/166 (79%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            KK HAV VPYPAQ H+N M++LAKLLH++GFHITFVNTEFNH RL RS GP+S++GLP F
Sbjct  23   KKGHAVFVPYPAQGHVNPMMQLAKLLHSRGFHITFVNTEFNHNRLIRSNGPDSVKGLPDF  82

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
             FETIPDGLPPSD D TQDIP+LC S   TC GPFK+L+A++N   +++ VP V+CIV+D
Sbjct  83   VFETIPDGLPPSDKDGTQDIPALCDSIKKTCFGPFKELVAKIN---SSSQVPQVTCIVAD  139

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            GIM+F   AA ELGIP+V+ W  SA GFMG + Y++LV +G  P K
Sbjct  140  GIMTFGCKAARELGIPEVVLWTASACGFMGYLQYNELVKRGXIPFK  185



>ref|XP_002263158.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=475

 Score =   231 bits (589),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 128/165 (78%), Gaps = 1/165 (1%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPH VC+P+PAQ HI  MLKLAKLLH +GFHITFVNTEFNH+RL RSRGP +L G+P F 
Sbjct  4    KPHVVCIPFPAQGHIKPMLKLAKLLHYRGFHITFVNTEFNHKRLLRSRGPHALDGMPGFC  63

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FE+IPDGLPP D DATQ IPSLC ST  +CL PF+ L+A+LN  A ++NVPPV+CIVSDG
Sbjct  64   FESIPDGLPPVDADATQHIPSLCESTPKSCLIPFQQLIAKLND-APSSNVPPVTCIVSDG  122

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             M FTL A+EELGIP+VLFW  SA GFM    +  L+D    PLK
Sbjct  123  SMCFTLKASEELGIPNVLFWTTSACGFMAYKQFRPLIDGVLVPLK  167



>emb|CDO97432.1| unnamed protein product [Coffea canephora]
Length=477

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 134/165 (81%), Gaps = 3/165 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHA+ +PYPAQ HI  +LKLAK+LH++GF+ITFVNTEFNHRRL R+ GP+S++GL  F+
Sbjct  2    KPHALVIPYPAQGHIRPILKLAKILHSQGFYITFVNTEFNHRRLIRAHGPDSVKGLDDFQ  61

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            F+TIPDGL PSD +ATQDIPSLC S   TCL PF +L+  LN ++ +   P VSCIVSDG
Sbjct  62   FKTIPDGLSPSDTNATQDIPSLCNSIQNTCLVPFLNLVKNLNESSDS---PRVSCIVSDG  118

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            +MSFTL AAEEL IP+V+F+ ISA GFMG +HY++LV +GY PLK
Sbjct  119  VMSFTLQAAEELNIPEVVFFTISACGFMGYLHYAELVARGYVPLK  163



>ref|XP_007199087.1| hypothetical protein PRUPE_ppa018904mg [Prunus persica]
 ref|XP_007201558.1| hypothetical protein PRUPE_ppa017826mg [Prunus persica]
 gb|EMJ00286.1| hypothetical protein PRUPE_ppa018904mg [Prunus persica]
 gb|EMJ02757.1| hypothetical protein PRUPE_ppa017826mg [Prunus persica]
Length=178

 Score =   221 bits (564),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 131/175 (75%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            M     E  K+PHAVC+P+PAQ HI+ M+KLAKLLH++GFHITFVN+E NH+R+ +SRGP
Sbjct  1    MDGVGVEVSKRPHAVCLPFPAQGHISPMMKLAKLLHHRGFHITFVNSEDNHKRILKSRGP  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
              L     F FE IPDGLPP+D +ATQDIPSLC ST+ TCLGPF++LLA L+   A   +
Sbjct  61   SPLHVSQDFSFEAIPDGLPPTDANATQDIPSLCDSTSKTCLGPFRNLLANLSLHKA---L  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            P V+CIVS+G+MSF + A E+LGIP  LFW  S+ GFMG   Y QL+DKG TPL+
Sbjct  118  PTVTCIVSNGVMSFAMKADEDLGIPVALFWTASSCGFMGYTQYRQLIDKGLTPLR  172



>ref|NP_173656.1| UDP-glycosyltransferase 85A1 [Arabidopsis thaliana]
 sp|Q9SK82.1|U85A1_ARATH RecName: Full=UDP-glycosyltransferase 85A1; AltName: Full=Cytokinin-O-glucosyltransferase 
2; AltName: Full=Zeatin O-glucosyltransferase 
2; Short=AtZOG2 [Arabidopsis thaliana]
 gb|AAF18537.1|AC006551_23 Putative UDP-glucose glucosyltransferase [Arabidopsis thaliana]
 gb|AAL91228.1| putative UDP-glucose glucosyltransferase [Arabidopsis thaliana]
 gb|AAP49527.1| At1g22400 [Arabidopsis thaliana]
 gb|AEE30237.1| UDP-glycosyltransferase 85A1 [Arabidopsis thaliana]
 gb|AHL38930.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=489

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 129/175 (74%), Gaps = 3/175 (2%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS      +KPH VCVPYPAQ HIN M+++AKLLH +GF++TFVNT +NH R  RSRG 
Sbjct  1    MGSQIIHNSQKPHVVCVPYPAQGHINPMMRVAKLLHARGFYVTFVNTVYNHNRFLRSRGS  60

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             +L GLPSFRFE+I DGLP +D+DATQDI +LC ST   CL PF++LL R+N   A  NV
Sbjct  61   NALDGLPSFRFESIADGLPETDMDATQDITALCESTMKNCLAPFRELLQRIN---AGDNV  117

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPVSCIVSDG MSFTL  AEELG+P+VLFW  S   F+  +H+   ++KG  PLK
Sbjct  118  PPVSCIVSDGCMSFTLDVAEELGVPEVLFWTTSGCAFLAYLHFYLFIEKGLCPLK  172



>ref|XP_009380209.1| PREDICTED: LOW QUALITY PROTEIN: 7-deoxyloganetin glucosyltransferase-like 
[Musa acuminata subsp. malaccensis]
Length=485

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 129/166 (78%), Gaps = 5/166 (3%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPHAVCVPYPAQ HI  MLKLAKLLH+ GFH+TFVNT FNH+RL RSR   +L  LPSF
Sbjct  7    EKPHAVCVPYPAQGHITPMLKLAKLLHSHGFHVTFVNTLFNHKRLIRSRAISALHALPSF  66

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RF +IPDGLPPSD DATQDIPSLC +   T L PF+ +L +LN  +     PPVSCIVSD
Sbjct  67   RFASIPDGLPPSDEDATQDIPSLCEAIPRTALPPFRHVLRQLNEES-----PPVSCIVSD  121

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+M+FTL AA+ELG+P+V+FW  SA GFMG +HY  L ++G TPLK
Sbjct  122  GVMTFTLDAAQELGVPEVVFWTTSACGFMGYLHYQHLRERGLTPLK  167



>ref|XP_007141201.1| hypothetical protein PHAVU_008G175600g [Phaseolus vulgaris]
 gb|ESW13195.1| hypothetical protein PHAVU_008G175600g [Phaseolus vulgaris]
Length=479

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVCVP+PAQ HIN MLKLAKLLH+ GFHITFVNTE NH+RL +SRG +SL GLPSFR
Sbjct  9    KPHAVCVPFPAQGHINPMLKLAKLLHSNGFHITFVNTECNHKRLLKSRGLDSLNGLPSFR  68

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            F+TIPDGLP  D + T  +PSLC ST  TCL  F++LL++LN+      VP VSCIVSDG
Sbjct  69   FQTIPDGLPEPDDEGTHQVPSLCDSTRATCLPHFRNLLSKLNNDCPG--VPAVSCIVSDG  126

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            +MSFTL A++ELGIP+VLFW  SA GFM  +HY+QLV +G  PLK
Sbjct  127  VMSFTLDASQELGIPNVLFWTSSACGFMCYVHYNQLVQRGIVPLK  171



>ref|NP_173652.1| UDP-glucosyl transferase 85A7 [Arabidopsis thaliana]
 sp|Q9LME8.1|U85A7_ARATH RecName: Full=UDP-glycosyltransferase 85A7 [Arabidopsis thaliana]
 gb|AAF87257.1|AC068562_4 Strong similarity to UDP-glucose glucosyltransferase from Arabidopsis 
thaliana gb|AB016819 and contains a UDP-glucosyl transferase 
PF|00201 domain [Arabidopsis thaliana]
 gb|ABE65644.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
thaliana]
 gb|AEE30231.1| UDP-glucosyl transferase 85A7 [Arabidopsis thaliana]
 gb|AHL38934.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=487

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 129/166 (78%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPH VCVPYPAQ HIN MLK+AKLL+ KGFH+TFVNT +NH RL RSRGP +L G PSF
Sbjct  10   QKPHVVCVPYPAQGHINPMLKVAKLLYAKGFHVTFVNTLYNHNRLLRSRGPNALDGFPSF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE+IPDGLP +D D TQ  P++C+S    CL PFK++L R+N      +VPPVSCIVSD
Sbjct  70   RFESIPDGLPETDGDRTQHTPTVCMSIEKNCLAPFKEILRRIND---KDDVPPVSCIVSD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+MSFTL AAEELG+P+V+FW  SA GFM ++H+   ++KG +P K
Sbjct  127  GVMSFTLDAAEELGVPEVIFWTNSACGFMTILHFYLFIEKGLSPFK  172



>emb|CDY62991.1| BnaC07g48390D [Brassica napus]
Length=458

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 128/166 (77%), Gaps = 3/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            +KPH VCVPYPAQ HIN MLK+AKLL+ +GFH+TFVNT +NH RL RSRGP +++GLP F
Sbjct  10   EKPHVVCVPYPAQGHINPMLKVAKLLYARGFHVTFVNTIYNHNRLIRSRGPHAVKGLPFF  69

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFE+IPDGLP +DVD TQDI +LC ST   CL PFK+LL R+N   A  +VPPVSCIV+D
Sbjct  70   RFESIPDGLPETDVDVTQDITALCDSTMKNCLTPFKELLQRIN---AGDDVPPVSCIVAD  126

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G MSFTL AAEELGIP+VLFW      FM  +H+   ++KG  P+K
Sbjct  127  GCMSFTLDAAEELGIPEVLFWTTGVCAFMVYLHFYLFIEKGLAPIK  172



>ref|XP_011045673.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=474

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 128/165 (78%), Gaps = 3/165 (2%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVCVP+PAQ HIN MLKLAK+LH  GFHITFVNTE+NHRRL RSRG  SL GLP F+
Sbjct  4    KPHAVCVPFPAQGHINPMLKLAKILHFNGFHITFVNTEYNHRRLLRSRGVSSLDGLPDFQ  63

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            FETIPDGLPPSD D+TQDI +LC ST+ TCL PF+DL+++LN ++    +P V+CIVSD 
Sbjct  64   FETIPDGLPPSDADSTQDILTLCYSTSKTCLAPFRDLISKLNSSSV---IPQVTCIVSDA  120

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            +M+FTL AAEE GIPD LFW  SA G +G      L ++G  P+K
Sbjct  121  VMNFTLDAAEEFGIPDALFWTPSACGVLGYSKCRSLFERGLIPVK  165



>ref|XP_010459994.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Camelina sativa]
Length=513

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 135/180 (75%), Gaps = 3/180 (2%)
 Frame = +1

Query  34   ERKREMGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQ  213
            E +++MGS+     +KPH VCVPYPAQ HIN M+K+AKLLH +GFH+TFVNT +NH R  
Sbjct  21   EVRKKMGSHVALNAQKPHVVCVPYPAQGHINPMMKVAKLLHARGFHVTFVNTVYNHNRFL  80

Query  214  RSRGPESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTA  393
            RS G  +L GL SFRFE+IPDGLP +D+D TQDI +LC ST   CL PF++LL R+N   
Sbjct  81   RSHGSIALDGLHSFRFESIPDGLPETDMDTTQDITALCESTMKNCLVPFQELLQRIN---  137

Query  394  AATNVPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            A  +VPPVSCIVSDG+MSFTL AAEELG+P+VLFW  S   F+  +H+   ++KG TPLK
Sbjct  138  ARDDVPPVSCIVSDGVMSFTLDAAEELGVPEVLFWTTSGCAFLTYLHFYLFIEKGITPLK  197



>ref|XP_007141191.1| hypothetical protein PHAVU_008G174700g [Phaseolus vulgaris]
 gb|ESW13185.1| hypothetical protein PHAVU_008G174700g [Phaseolus vulgaris]
Length=491

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 130/166 (78%), Gaps = 4/166 (2%)
 Frame = +1

Query  76   KKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSF  255
            KKPHAVC+P+P Q HIN MLKLAKLLH KGFHITFVNTE+ H+RL +SRGP+SL+GL SF
Sbjct  17   KKPHAVCIPHPTQGHINPMLKLAKLLHFKGFHITFVNTEYTHKRLLKSRGPDSLKGLSSF  76

Query  256  RFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSD  435
            RFETIPDGLP   VDATQDIPSLC ST  TCL    +LL ++N    +++VPPV+C+V+D
Sbjct  77   RFETIPDGLPEPAVDATQDIPSLCDSTRRTCLPHLNNLLTKIN----SSDVPPVTCLVAD  132

Query  436  GIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            G+MSFTL AAEELG+P  LFW  SA GFM  +   QL+ KG  PLK
Sbjct  133  GVMSFTLDAAEELGVPLALFWTPSACGFMCYVQLEQLIQKGLIPLK  178



>ref|XP_003579871.2| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Brachypodium 
distachyon]
Length=560

 Score =   232 bits (591),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 135/176 (77%), Gaps = 4/176 (2%)
 Frame = +1

Query  46   EMGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRG  225
            EMGS   + +K PHAVCVP+PAQ H+  MLKLAK+LH +GFH+TFVN+EFNHRRL RS+G
Sbjct  69   EMGSVQADADK-PHAVCVPFPAQGHVTPMLKLAKILHCRGFHVTFVNSEFNHRRLLRSQG  127

Query  226  PESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATN  405
              +L GL  FRF TIP+GLPPSDVDATQD+PSLC ST  TCL  F+ LLA LN   A+ +
Sbjct  128  AGALDGLEGFRFATIPEGLPPSDVDATQDVPSLCRSTKDTCLPHFRSLLADLN---ASAD  184

Query  406  VPPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             PPV+C+V+D +MSFTL AA ++G+P  LFW  SA G+MG  HY  L+DKG+ PLK
Sbjct  185  SPPVTCVVADNVMSFTLDAARDIGVPCALFWTASACGYMGYRHYRTLIDKGFFPLK  240



>ref|XP_010040276.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=554

 Score =   232 bits (591),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+P+PAQSHI+AML LAKLLH++GFH+TFVNTE+NH RL RSRGP SL GLPSFR
Sbjct  4    KPHAVCIPFPAQSHISAMLNLAKLLHHRGFHVTFVNTEYNHNRLMRSRGPSSLDGLPSFR  63

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            F TIPDGLPPS+ D TQDI SLC ST   CL  F+DL+ RLN  +  +  PPVSC+VSD 
Sbjct  64   FRTIPDGLPPSNGDVTQDILSLCQSTQKCCLPHFQDLIERLNEESVMSGSPPVSCVVSDS  123

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
             M+FTL  AE + +P+VLFWP+S   FM    +  L+DKG  PLK
Sbjct  124  SMTFTLDTAEAVSVPEVLFWPMSVCAFMAYAQFRSLIDKGLAPLK  168



>ref|XP_008219468.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=577

 Score =   232 bits (592),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 134/175 (77%), Gaps = 5/175 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS      +KPHAVC+PYPAQ HI  ML+L KLLH KGFHITFVNTEFNHRRL +SRGP
Sbjct  1    MGSTG--LTEKPHAVCIPYPAQGHITPMLQLTKLLHYKGFHITFVNTEFNHRRLLKSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSFRFETIPDGLPP+D +ATQD+ +LCVST   CL PF+DLL++LN   +  + 
Sbjct  59   NSLDGLPSFRFETIPDGLPPTDTNATQDVTALCVSTRKNCLAPFRDLLSKLN---SLPDS  115

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPV+CIVS+G M+FT  AA+ELGIP+V+F   SA G M  + Y  L++KG  PLK
Sbjct  116  PPVTCIVSNGGMAFTFYAAQELGIPEVIFETPSACGLMCYLQYRPLIEKGLVPLK  170



>ref|XP_010039828.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=490

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 128/165 (78%), Gaps = 0/165 (0%)
 Frame = +1

Query  79   KPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGPESLRGLPSFR  258
            KPHAVC+PYPAQ HIN MLKLAKLLH+KGFHITFVNTE NH+RL RS+GP SL GLP FR
Sbjct  16   KPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEHNHKRLLRSQGPHSLDGLPHFR  75

Query  259  FETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNVPPVSCIVSDG  438
            F+ IPDGLPPSD D+TQDIPSLC S +   L  F+ LL +L   +    VPPV+ IVSDG
Sbjct  76   FDMIPDGLPPSDADSTQDIPSLCASLSEHGLSAFRSLLLKLQDQSQDGVVPPVTRIVSDG  135

Query  439  IMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            +M+FT+ AAEEL IP+V+FWP SA G  G   Y +LV+ G+TPLK
Sbjct  136  LMAFTVDAAEELKIPEVVFWPPSACGLFGCTKYRRLVEDGFTPLK  180



>ref|XP_007222664.1| hypothetical protein PRUPE_ppa004979mg [Prunus persica]
 gb|EMJ23863.1| hypothetical protein PRUPE_ppa004979mg [Prunus persica]
Length=483

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 138/175 (79%), Gaps = 5/175 (3%)
 Frame = +1

Query  49   MGSNNCEFEKKPHAVCVPYPAQSHINAMLKLAKLLHNKGFHITFVNTEFNHRRLQRSRGP  228
            MGS   +  +KPHAVC+PYPAQ HI  ML+LAKLLH KGFHITFV+TEFNHRRL +SRGP
Sbjct  1    MGS--IDLTEKPHAVCIPYPAQGHITPMLQLAKLLHYKGFHITFVHTEFNHRRLLKSRGP  58

Query  229  ESLRGLPSFRFETIPDGLPPSDVDATQDIPSLCVSTATTCLGPFKDLLARLNHTAAATNV  408
             SL GLPSF+FETIPDGLPP+D +ATQDI +LC+ST+  CL PF+DLL+++N   +  + 
Sbjct  59   NSLDGLPSFQFETIPDGLPPTDPNATQDITALCLSTSKNCLAPFRDLLSKVN---SVPDS  115

Query  409  PPVSCIVSDGIMSFTLAAAEELGIPDVLFWPISASGFMGVMHYSQLVDKGYTPLK  573
            PPV+CIVSDG M+FTL AA+ELGIP+V+F  +SA G M  + Y  L++KG  P K
Sbjct  116  PPVTCIVSDGGMTFTLDAAQELGIPEVIFETLSACGLMCYLQYRPLIEKGLMPPK  170



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750