BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF007J14

Length=496
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006351365.1|  PREDICTED: uncharacterized protein LOC102603072  89.7    2e-17   Solanum tuberosum [potatoes]
ref|XP_004249304.1|  PREDICTED: uncharacterized protein LOC101268442  88.6    5e-17   Solanum lycopersicum
ref|XP_009788026.1|  PREDICTED: uncharacterized protein LOC104235895  82.8    4e-15   Nicotiana sylvestris
ref|XP_011075041.1|  PREDICTED: uncharacterized protein LOC105159627  81.6    1e-14   Sesamum indicum [beniseed]
ref|XP_009771625.1|  PREDICTED: uncharacterized protein LOC104222130  75.1    2e-12   Nicotiana sylvestris
ref|XP_007030718.1|  Kinase family protein                            72.8    9e-12   Theobroma cacao [chocolate]
ref|XP_004157014.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  70.5    7e-11   
gb|KHG17118.1|  Casein kinase I isoform delta                         70.1    9e-11   Gossypium arboreum [tree cotton]
gb|KJB45108.1|  hypothetical protein B456_007G289500                  70.1    9e-11   Gossypium raimondii
gb|EYU20664.1|  hypothetical protein MIMGU_mgv1a002165mg              69.7    1e-10   Erythranthe guttata [common monkey flower]
gb|KJB80965.1|  hypothetical protein B456_013G123300                  69.3    1e-10   Gossypium raimondii
gb|KJB80963.1|  hypothetical protein B456_013G123300                  69.3    1e-10   Gossypium raimondii
ref|XP_006479104.1|  PREDICTED: uncharacterized protein LOC102619...  69.3    1e-10   Citrus sinensis [apfelsine]
ref|XP_006443418.1|  hypothetical protein CICLE_v10019090mg           69.3    1e-10   Citrus clementina [clementine]
ref|XP_004147533.1|  PREDICTED: uncharacterized protein LOC101221479  67.8    5e-10   Cucumis sativus [cucumbers]
ref|XP_008441978.1|  PREDICTED: uncharacterized protein LOC103485979  67.8    5e-10   Cucumis melo [Oriental melon]
ref|XP_009615719.1|  PREDICTED: uncharacterized protein LOC104108400  67.4    6e-10   Nicotiana tomentosiformis
gb|KJB82583.1|  hypothetical protein B456_013G203000                  67.4    7e-10   Gossypium raimondii
gb|KJB82579.1|  hypothetical protein B456_013G203000                  67.4    7e-10   Gossypium raimondii
gb|KJB82581.1|  hypothetical protein B456_013G203000                  67.0    7e-10   Gossypium raimondii
gb|KJB82582.1|  hypothetical protein B456_013G203000                  67.0    8e-10   Gossypium raimondii
ref|XP_009621585.1|  PREDICTED: uncharacterized protein LOC104113184  67.0    8e-10   Nicotiana tomentosiformis
gb|KJB82580.1|  hypothetical protein B456_013G203000                  66.6    9e-10   Gossypium raimondii
ref|XP_007161937.1|  hypothetical protein PHAVU_001G110300g           67.0    9e-10   Phaseolus vulgaris [French bean]
ref|XP_010036218.1|  PREDICTED: uncharacterized protein LOC104425268  66.2    2e-09   Eucalyptus grandis [rose gum]
ref|XP_011078778.1|  PREDICTED: uncharacterized protein LOC105162459  65.1    3e-09   Sesamum indicum [beniseed]
gb|KHG04306.1|  Casein kinase I-like protein                          65.1    4e-09   Gossypium arboreum [tree cotton]
gb|KDP39706.1|  hypothetical protein JCGZ_02726                       64.7    4e-09   Jatropha curcas
emb|CDP14324.1|  unnamed protein product                              63.9    8e-09   Coffea canephora [robusta coffee]
ref|XP_003624626.1|  Casein kinase I isoform alpha                    63.5    1e-08   Medicago truncatula
gb|ABN09797.1|  Protein kinase                                        63.2    1e-08   Medicago truncatula
ref|XP_010088042.1|  Casein kinase I isoform delta                    63.2    2e-08   
ref|XP_002525432.1|  casein kinase, putative                          62.8    2e-08   Ricinus communis
gb|KHG27523.1|  hypothetical protein F383_15264                       62.8    2e-08   Gossypium arboreum [tree cotton]
ref|XP_007204249.1|  hypothetical protein PRUPE_ppa002161mg           61.6    5e-08   Prunus persica
ref|XP_008240478.1|  PREDICTED: uncharacterized protein LOC103338977  60.5    1e-07   Prunus mume [ume]
ref|XP_004493152.1|  PREDICTED: uncharacterized protein LOC101504...  60.5    1e-07   Cicer arietinum [garbanzo]
ref|XP_009366444.1|  PREDICTED: uncharacterized protein LOC103956210  60.5    1e-07   Pyrus x bretschneideri [bai li]
ref|XP_002281952.1|  PREDICTED: uncharacterized protein LOC100267624  60.1    2e-07   Vitis vinifera
ref|XP_003548750.1|  PREDICTED: uncharacterized protein LOC100801...  59.3    2e-07   Glycine max [soybeans]
ref|XP_011021493.1|  PREDICTED: uncharacterized protein LOC105123555  58.2    6e-07   Populus euphratica
ref|XP_002325416.1|  kinase family protein                            58.2    6e-07   
gb|EPS68531.1|  hypothetical protein M569_06230                       57.4    1e-06   Genlisea aurea
ref|XP_010276388.1|  PREDICTED: uncharacterized protein LOC104611151  55.5    4e-06   
gb|EYU39997.1|  hypothetical protein MIMGU_mgv1a002328mg              55.1    5e-06   Erythranthe guttata [common monkey flower]
ref|XP_010257690.1|  PREDICTED: uncharacterized protein LOC104597684  53.5    2e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010558719.1|  PREDICTED: uncharacterized protein LOC104827...  53.1    3e-05   Tarenaya hassleriana [spider flower]
ref|XP_010558720.1|  PREDICTED: uncharacterized protein LOC104827...  53.1    3e-05   
ref|XP_010908708.1|  PREDICTED: uncharacterized protein LOC105035016  52.4    5e-05   Elaeis guineensis
ref|XP_010672056.1|  PREDICTED: uncharacterized protein LOC104888...  51.6    7e-05   
ref|XP_010672054.1|  PREDICTED: uncharacterized protein LOC104888...  51.6    7e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008805378.1|  PREDICTED: uncharacterized protein LOC103718369  50.8    1e-04   Phoenix dactylifera
ref|XP_006408240.1|  hypothetical protein EUTSA_v10020173mg           48.5    8e-04   Eutrema salsugineum [saltwater cress]



>ref|XP_006351365.1| PREDICTED: uncharacterized protein LOC102603072 [Solanum tuberosum]
Length=709

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 61/71 (86%), Gaps = 2/71 (3%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVAKGPS  463
            MPELRSGARRSKRLGDLQPAPQP GQEENLALPTQN   RR GGGGRGRGNA A+ KGPS
Sbjct  1    MPELRSGARRSKRLGDLQPAPQPVGQEENLALPTQNRTRRRGGGGGRGRGNATAIGKGPS  60

Query  464  TGVRGRPAAAG  496
             G RGRP+ AG
Sbjct  61   -GTRGRPSGAG  70



>ref|XP_004249304.1| PREDICTED: uncharacterized protein LOC101268442 [Solanum lycopersicum]
Length=709

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 60/71 (85%), Gaps = 2/71 (3%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVAKGPS  463
            MPELRSGARRSKRLGDLQPAPQP GQEENL LPTQN   RR GGGGRGRGNA A+ KGPS
Sbjct  1    MPELRSGARRSKRLGDLQPAPQPVGQEENLVLPTQNRTRRRGGGGGRGRGNATAIGKGPS  60

Query  464  TGVRGRPAAAG  496
             G RGRP+ AG
Sbjct  61   -GTRGRPSGAG  70



>ref|XP_009788026.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788027.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788028.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788029.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
Length=708

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPS  463
            MPELRSGARRSKRLGDLQPAP+P+GQEEN  LPTQNR RRRGGGGRGRGNA AVAKGPS
Sbjct  1    MPELRSGARRSKRLGDLQPAPEPSGQEENWVLPTQNRGRRRGGGGRGRGNATAVAKGPS  59



>ref|XP_011075041.1| PREDICTED: uncharacterized protein LOC105159627 [Sesamum indicum]
Length=705

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSKRLGDLQPAPQPT QEEN   P QN   R    GRGRGNAAAVAKGPS 
Sbjct  1    MPELRSGARRSKRLGDLQPAPQPTNQEENFLAPAQN---RTRRRGRGRGNAAAVAKGPSA  57

Query  467  GVRGRPAAAG  496
                RP AAG
Sbjct  58   ATPTRPTAAG  67



>ref|XP_009771625.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
 ref|XP_009771626.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
 ref|XP_009771627.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
Length=714

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 55/74 (74%), Gaps = 4/74 (5%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQP-APQPTGQEENLAL-PTQNrtrrrggggrgrgN--AAAVAK  454
            MPELRSGARRSKRLGDLQP APQP GQEENL L PTQNR RRRGGGG       A AV K
Sbjct  2    MPELRSGARRSKRLGDLQPAAPQPVGQEENLVLPPTQNRGRRRGGGGGRGRGNAATAVGK  61

Query  455  GPSTGVRGRPAAAG  496
            GPS   R RP+ AG
Sbjct  62   GPSGTTRARPSGAG  75



>ref|XP_007030718.1| Kinase family protein [Theobroma cacao]
 gb|EOY11220.1| Kinase family protein [Theobroma cacao]
Length=705

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSKRL DLQP PQP  Q EN  LP QN   RR  GGRGRGNAAAVAKGPS 
Sbjct  1    MPELRSGARRSKRLDDLQP-PQPVDQAENWVLPAQN-RTRRRVGGRGRGNAAAVAKGPSP  58

Query  467  GVRGRPAAAG  496
             V  RP AAG
Sbjct  59   AVPTRPTAAG  68



>ref|XP_004157014.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101221479 
[Cucumis sativus]
Length=742

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +2

Query  281  VTMPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVAKG  457
            +TMPELRSGARRS+RL DLQP  QP  Q ENLA+P  N   RR  GG    GNA AVAKG
Sbjct  33   LTMPELRSGARRSRRLDDLQPCTQPLDQGENLAVPAPNRTRRRVAGGRGRGGNAQAVAKG  92

Query  458  PSTGVRGRPAAA  493
            PS  +  RP AA
Sbjct  93   PSVAIPARPTAA  104



>gb|KHG17118.1| Casein kinase I isoform delta [Gossypium arboreum]
 gb|KHG17119.1| Casein kinase I isoform delta [Gossypium arboreum]
Length=706

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSKRLGDL+P  QP  Q EN  LP QN   RR  GGRGRGNA  VAKGPS 
Sbjct  1    MPELRSGARRSKRLGDLEPPSQPVVQAENWVLPAQN-RSRRRVGGRGRGNAVGVAKGPSP  59

Query  467  GVRGRPAAAG  496
             V  RP AAG
Sbjct  60   AVPTRPRAAG  69



>gb|KJB45108.1| hypothetical protein B456_007G289500 [Gossypium raimondii]
Length=706

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSKRLGDL+P  QP  Q EN  LP QN   RR  GGRGRGNA  VAKGPS 
Sbjct  1    MPELRSGARRSKRLGDLEPPSQPVVQAENWVLPAQN-RSRRRVGGRGRGNAVGVAKGPSP  59

Query  467  GVRGRPAAAG  496
             V  RP AAG
Sbjct  60   AVPTRPRAAG  69



>gb|EYU20664.1| hypothetical protein MIMGU_mgv1a002165mg [Erythranthe guttata]
Length=706

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 47/70 (67%), Gaps = 3/70 (4%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSKRLGDL P PQ   QEE    P Q    R    GRGRGNA+AVAKGPST
Sbjct  2    MPELRSGARRSKRLGDLHPTPQTANQEEEFLAPAQT---RTRRRGRGRGNASAVAKGPST  58

Query  467  GVRGRPAAAG  496
                RP AAG
Sbjct  59   ATPTRPTAAG  68



>gb|KJB80965.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
Length=707

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGAR+SKRLGDLQP  QP  Q EN  LP QN   RR  GGRGRG A AVAKGPS 
Sbjct  1    MPELRSGARKSKRLGDLQPPLQPVDQAENWVLPAQN-RTRRQVGGRGRGKATAVAKGPSP  59

Query  467  GVRGRPAAAG  496
             V  RP AAG
Sbjct  60   EVPNRPKAAG  69



>gb|KJB80963.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
 gb|KJB80964.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
 gb|KJB80966.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
Length=706

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGAR+SKRLGDLQP  QP  Q EN  LP QN   RR  GGRGRG A AVAKGPS 
Sbjct  1    MPELRSGARKSKRLGDLQPPLQPVDQAENWVLPAQN-RTRRQVGGRGRGKATAVAKGPSP  59

Query  467  GVRGRPAAAG  496
             V  RP AAG
Sbjct  60   EVPNRPKAAG  69



>ref|XP_006479104.1| PREDICTED: uncharacterized protein LOC102619111 isoform X1 [Citrus 
sinensis]
 gb|KDO55048.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=708

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSKRL DLQP PQP  Q EN  LP QNRTRRR GGGRGRGNA AVAK    
Sbjct  1    MPELRSGARRSKRLDDLQPPPQPVDQTENWLLPAQNRTRRRVGGGRGRGNATAVAK---P  57

Query  467  GVRGRPAAAG  496
            G+  RP AAG
Sbjct  58   GIPARPTAAG  67



>ref|XP_006443418.1| hypothetical protein CICLE_v10019090mg [Citrus clementina]
 ref|XP_006479105.1| PREDICTED: uncharacterized protein LOC102619111 isoform X2 [Citrus 
sinensis]
 gb|ESR56658.1| hypothetical protein CICLE_v10019090mg [Citrus clementina]
 gb|KDO55047.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=704

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSKRL DLQP PQP  Q EN  LP QNRTRRR GGGRGRGNA AVAK    
Sbjct  1    MPELRSGARRSKRLDDLQPPPQPVDQTENWLLPAQNRTRRRVGGGRGRGNATAVAK---P  57

Query  467  GVRGRPAAAG  496
            G+  RP AAG
Sbjct  58   GIPARPTAAG  67



>ref|XP_004147533.1| PREDICTED: uncharacterized protein LOC101221479 [Cucumis sativus]
 gb|KGN53942.1| Casein kinase [Cucumis sativus]
Length=708

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVAKGPS  463
            MPELRSGARRS+RL DLQP  QP  Q ENLA+P  N   RR  GG    GNA AVAKGPS
Sbjct  1    MPELRSGARRSRRLDDLQPCTQPLDQGENLAVPAPNRTRRRVAGGRGRGGNAQAVAKGPS  60

Query  464  TGVRGRPAAA  493
              +  RP AA
Sbjct  61   VAIPARPTAA  70



>ref|XP_008441978.1| PREDICTED: uncharacterized protein LOC103485979 [Cucumis melo]
 ref|XP_008441979.1| PREDICTED: uncharacterized protein LOC103485979 [Cucumis melo]
Length=708

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVAKGPS  463
            MPELRSGARRS+RL DLQP  QP  Q ENLA+P  N   RR  GG    GNA AVAKGPS
Sbjct  1    MPELRSGARRSRRLDDLQPCTQPLDQGENLAVPAPNRTRRRVAGGRGRGGNAQAVAKGPS  60

Query  464  TGVRGRPAAA  493
              +  RP AA
Sbjct  61   VAIPARPTAA  70



>ref|XP_009615719.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615725.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615727.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615731.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
Length=708

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPS  463
            MP+LR GARRSKRLGD QPAP+P+GQEEN  LPTQNR +RRGGGGRGRGNA AVAKGPS
Sbjct  1    MPDLRRGARRSKRLGDPQPAPEPSGQEENWVLPTQNRGQRRGGGGRGRGNATAVAKGPS  59



>gb|KJB82583.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=707

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSK L DLQP PQP  Q EN  LP QN   RR  GGRGRGNAA VAKGPS 
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQN-RTRRRAGGRGRGNAAGVAKGPSA  59

Query  467  GVRGRPAAAG  496
             V  RP AAG
Sbjct  60   AVPTRPTAAG  69



>gb|KJB82579.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=706

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSK L DLQP PQP  Q EN  LP QN   RR  GGRGRGNAA VAKGPS 
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQN-RTRRRAGGRGRGNAAGVAKGPSA  59

Query  467  GVRGRPAAAG  496
             V  RP AAG
Sbjct  60   AVPTRPTAAG  69



>gb|KJB82581.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=654

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSK L DLQP PQP  Q EN  LP QN   RR  GGRGRGNAA VAKGPS 
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQN-RTRRRAGGRGRGNAAGVAKGPSA  59

Query  467  GVRGRPAAAG  496
             V  RP AAG
Sbjct  60   AVPTRPTAAG  69



>gb|KJB82582.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=696

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSK L DLQP PQP  Q EN  LP QN   RR  GGRGRGNAA VAKGPS 
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQN-RTRRRAGGRGRGNAAGVAKGPSA  59

Query  467  GVRGRPAAAG  496
             V  RP AAG
Sbjct  60   AVPTRPTAAG  69



>ref|XP_009621585.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
 ref|XP_009621586.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
 ref|XP_009621587.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
Length=714

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 49/63 (78%), Gaps = 4/63 (6%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQP-APQPTGQEENLAL-PTQNrtrrrggggrgrgN--AAAVAK  454
            MPELRSGARRSKRLGDLQP APQP GQEENL L PTQNR RRRGGGG       A AV K
Sbjct  2    MPELRSGARRSKRLGDLQPAAPQPVGQEENLVLPPTQNRGRRRGGGGGRGRGNAATAVGK  61

Query  455  GPS  463
            GPS
Sbjct  62   GPS  64



>gb|KJB82580.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=587

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSK L DLQP PQP  Q EN  LP QN   RR  GGRGRGNAA VAKGPS 
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQN-RTRRRAGGRGRGNAAGVAKGPSA  59

Query  467  GVRGRPAAAG  496
             V  RP AAG
Sbjct  60   AVPTRPTAAG  69



>ref|XP_007161937.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris]
 gb|ESW33931.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris]
Length=708

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVAKGPS  463
            MPELRSGARRSKRLGDLQP P P  Q EN A P QN   RR GGG    GNA AV KGPS
Sbjct  1    MPELRSGARRSKRLGDLQPGPLPIDQGENWAQPAQNRTRRRVGGGRGRGGNATAVGKGPS  60

Query  464  TGVRGRPAAAG  496
              V  R  AAG
Sbjct  61   PAVPTRRTAAG  71



>ref|XP_010036218.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036219.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036220.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036222.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 gb|KCW47748.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
 gb|KCW47749.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
 gb|KCW47750.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
Length=702

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSKRL +LQP PQ   Q +N ALPTQN+TRRRGGGGRGRGNA AV +G +T
Sbjct  1    MPELRSGARRSKRLDNLQPNPQQIEQADNWALPTQNKTRRRGGGGRGRGNATAVGRGRAT  60

Query  467  GV-RGR  481
            G  RGR
Sbjct  61   GAGRGR  66



>ref|XP_011078778.1| PREDICTED: uncharacterized protein LOC105162459 [Sesamum indicum]
Length=705

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 43/59 (73%), Gaps = 3/59 (5%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPS  463
            MPELRSGARRSKRLGDLQPAPQ   QEE    P Q    R    GRGRGNAAAVAKGPS
Sbjct  1    MPELRSGARRSKRLGDLQPAPQTANQEEKFLAPAQT---RTRRRGRGRGNAAAVAKGPS  56



>gb|KHG04306.1| Casein kinase I-like protein [Gossypium arboreum]
Length=706

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSK L DLQP PQP  Q EN  LP QN   RR  GGRGRGNAA VAKGP  
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQN-RTRRRVGGRGRGNAAGVAKGPLA  59

Query  467  GVRGRPAAAG  496
             V  RP AAG
Sbjct  60   AVPTRPTAAG  69



>gb|KDP39706.1| hypothetical protein JCGZ_02726 [Jatropha curcas]
Length=705

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSKRL DLQ   QP    EN   PTQN+TRRR GG    GNA  VAKG S 
Sbjct  1    MPELRSGARRSKRLDDLQALQQPINPTENWIQPTQNKTRRRAGGRGRGGNATGVAKGASP  60

Query  467  GVRGRPAAAG  496
             +  RP AAG
Sbjct  61   AIPARPTAAG  70



>emb|CDP14324.1| unnamed protein product [Coffea canephora]
Length=709

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 48/59 (81%), Gaps = 3/59 (5%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLAL--PTQNrtrrrggggrgrgNAAAVAKG  457
            MPELRSGARRSKRLGDLQPA QP  QEEN  +  PTQN   RR GGGRGRGNAAAVAKG
Sbjct  1    MPELRSGARRSKRLGDLQPAAQPAFQEENWLVQQPTQN-RTRRRGGGRGRGNAAAVAKG  58



>ref|XP_003624626.1| Casein kinase I isoform alpha [Medicago truncatula]
 gb|AES80844.1| casein kinase I-like protein [Medicago truncatula]
Length=708

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVAKGPS  463
            MPELRSGARRSKRLGDLQP PQP  Q EN A P QN   RR GGG    GNA  + KG S
Sbjct  1    MPELRSGARRSKRLGDLQPGPQPVDQGENWAEPAQNRTRRRVGGGRGRGGNATGLGKGSS  60

Query  464  TGVRGRPAAAG  496
              V  R  AAG
Sbjct  61   PAVPTRRTAAG  71



>gb|ABN09797.1| Protein kinase [Medicago truncatula]
Length=573

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVAKGPS  463
            MPELRSGARRSKRLGDLQP PQP  Q EN A P QN   RR GGG    GNA  + KG S
Sbjct  1    MPELRSGARRSKRLGDLQPGPQPVDQGENWAEPAQNRTRRRVGGGRGRGGNATGLGKGSS  60

Query  464  TGVRGRPAAAG  496
              V  R  AAG
Sbjct  61   PAVPTRRTAAG  71



>ref|XP_010088042.1| Casein kinase I isoform delta [Morus notabilis]
 gb|EXB31261.1| Casein kinase I isoform delta [Morus notabilis]
Length=706

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSG RRSKRLGDLQP+PQP GQ EN  LPT N
Sbjct  1    MPELRSGVRRSKRLGDLQPSPQPIGQAENWPLPTPN  36



>ref|XP_002525432.1| casein kinase, putative [Ricinus communis]
 gb|EEF36922.1| casein kinase, putative [Ricinus communis]
Length=705

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSKRL DLQ   QP    +N   P QN+TRRR GG    GNA AVAKG S 
Sbjct  1    MPELRSGARRSKRLDDLQTLQQPVNPADNWIQPAQNKTRRRVGGRGRGGNATAVAKGASP  60

Query  467  GVRGRPAAAG  496
             +  RP AAG
Sbjct  61   AIPTRPTAAG  70



>gb|KHG27523.1| hypothetical protein F383_15264 [Gossypium arboreum]
Length=706

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGAR+SKRLGDLQP  QP  Q EN  LP QN   RR  GGRGRG A AVAK PS 
Sbjct  1    MPELRSGARKSKRLGDLQPPFQPVDQAENWVLPAQN-RTRRQVGGRGRGKATAVAKVPSP  59

Query  467  GVRGRPAAAG  496
             V  R  A+G
Sbjct  60   EVPNRTKASG  69



>ref|XP_007204249.1| hypothetical protein PRUPE_ppa002161mg [Prunus persica]
 gb|EMJ05448.1| hypothetical protein PRUPE_ppa002161mg [Prunus persica]
Length=707

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQ-PTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPS  463
            MPELRSG RRSKRL DLQP+ Q P GQ EN  LP QN   RR  GG       AVAKGPS
Sbjct  1    MPELRSGVRRSKRLDDLQPSSQPPIGQAENCVLPAQN-KTRRRAGGGRGRGGNAVAKGPS  59

Query  464  TGVRGRPAAAG  496
              +  R  AAG
Sbjct  60   PAIPTRATAAG  70



>ref|XP_008240478.1| PREDICTED: uncharacterized protein LOC103338977 [Prunus mume]
Length=707

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQ-PTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPS  463
            MPELRSG RRSKRL DLQP+ Q P GQ EN  LP QN   RR  GG       AVAKGPS
Sbjct  1    MPELRSGVRRSKRLDDLQPSSQPPIGQAENCVLPAQN-KPRRRAGGGRGRGGNAVAKGPS  59

Query  464  TGVRGRPAAAG  496
              +  R  AAG
Sbjct  60   PAIPTRATAAG  70



>ref|XP_004493152.1| PREDICTED: uncharacterized protein LOC101504885 isoform X1 [Cicer 
arietinum]
 ref|XP_004493153.1| PREDICTED: uncharacterized protein LOC101504885 isoform X2 [Cicer 
arietinum]
Length=708

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVAKGPS  463
            MPELRSGARRSKRLGDLQPAP P  Q EN   P QN   RR GGG    GNA  V K  S
Sbjct  1    MPELRSGARRSKRLGDLQPAPLPVDQGENWTQPAQNRTRRRVGGGRGRGGNATGVGKASS  60

Query  464  TGVRGRPAAAG  496
              V  R  AAG
Sbjct  61   PAVPTRRTAAG  71



>ref|XP_009366444.1| PREDICTED: uncharacterized protein LOC103956210 [Pyrus x bretschneideri]
Length=707

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQ-PTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPS  463
            MPELRSG RRSKRL DLQP+ Q P GQ EN  LP QN   RR  GG       AVAKGPS
Sbjct  1    MPELRSGVRRSKRLDDLQPSSQPPIGQAENCVLPAQN-KPRRRAGGGRGRGGNAVAKGPS  59

Query  464  TGVRGRPAAAG  496
              +  R  AAG
Sbjct  60   PAIPTRQTAAG  70



>ref|XP_002281952.1| PREDICTED: uncharacterized protein LOC100267624 [Vitis vinifera]
 emb|CAN59733.1| hypothetical protein VITISV_003914 [Vitis vinifera]
Length=708

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNr-trrrggggrgrgNAAAVAKGPS  463
            MPELRSG RRSKRL DLQP+PQP  Q EN  LP QNR  RR GGG     NA  +AKGPS
Sbjct  1    MPELRSGPRRSKRLDDLQPSPQPGDQAENWLLPAQNRPRRRVGGGRGRGCNATPLAKGPS  60



>ref|XP_003548750.1| PREDICTED: uncharacterized protein LOC100801967 isoform X1 [Glycine 
max]
 ref|XP_006598981.1| PREDICTED: uncharacterized protein LOC100801967 isoform X2 [Glycine 
max]
 gb|KHN46781.1| Casein kinase I like hhp1 [Glycine soja]
Length=709

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPT--QNrtrrrggggrgrgNAAAVAKGP  460
            MPELRSGARRSKRLGDLQP P P  Q EN   P       RR GGG    GNA AV KGP
Sbjct  1    MPELRSGARRSKRLGDLQPGPLPVDQGENWQQPAAPNRTRRRVGGGRGRGGNATAVGKGP  60

Query  461  STGVRGRPAAAG  496
            S  V  R  AAG
Sbjct  61   SPAVPTRRTAAG  72



>ref|XP_011021493.1| PREDICTED: uncharacterized protein LOC105123555 [Populus euphratica]
Length=707

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 49/71 (69%), Gaps = 3/71 (4%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrt-rrrggggrgrgNAAAVAKGPS  463
            MPELRSGARRSKRL DLQP  QP  Q ENL +P QN+T RR GGG    GNAA VAKG S
Sbjct  1    MPELRSGARRSKRLDDLQPPQQPNNQAENLTVPVQNKTRRRAGGGRGRGGNAAGVAKGAS  60

Query  464  TGVRGRPAAAG  496
                 RP AAG
Sbjct  61   PAT--RPTAAG  69



>ref|XP_002325416.1| kinase family protein [Populus trichocarpa]
 gb|EEE99797.1| kinase family protein [Populus trichocarpa]
Length=720

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 51/73 (70%), Gaps = 7/73 (10%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrt-rrrggggrgrgNAAAVAKG--  457
            MPELRSGARRSKRL DLQP  QP  Q ENL +P QN+T RR GGG    GNAA VAKG  
Sbjct  1    MPELRSGARRSKRLDDLQPPQQPNNQAENLTVPVQNKTRRRAGGGRGRGGNAAGVAKGAS  60

Query  458  PSTGVRGRPAAAG  496
            P+T    RP AAG
Sbjct  61   PTT----RPTAAG  69



>gb|EPS68531.1| hypothetical protein M569_06230 [Genlisea aurea]
Length=704

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRSKRLGDLQ APQP  QE++    TQN
Sbjct  1    MPELRSGARRSKRLGDLQSAPQPENQEQDFLPSTQN  36



>ref|XP_010276388.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276389.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276390.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276391.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
Length=714

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 43/75 (57%), Gaps = 5/75 (7%)
 Frame = +2

Query  287  MPELRSGAR----RSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVA  451
            MPELRSGAR    RSKRL +LQP+PQP  Q EN  LP  N   RR G G     NA AVA
Sbjct  1    MPELRSGARQARLRSKRLDELQPSPQPLDQAENCVLPAPNRTGRRVGAGRGRGCNATAVA  60

Query  452  KGPSTGVRGRPAAAG  496
            K P      RP  AG
Sbjct  61   KEPLGATPSRPVGAG  75



>gb|EYU39997.1| hypothetical protein MIMGU_mgv1a002328mg [Erythranthe guttata]
Length=687

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 47/70 (67%), Gaps = 12/70 (17%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELR GARRSKRLGDLQ A     QEEN+    QN   R  G GRGRGNAAAVAKGP+ 
Sbjct  1    MPELRRGARRSKRLGDLQAA----NQEENIVASAQN---RPRGRGRGRGNAAAVAKGPT-  52

Query  467  GVRGRPAAAG  496
                RP AAG
Sbjct  53   ----RPTAAG  58



>ref|XP_010257690.1| PREDICTED: uncharacterized protein LOC104597684 [Nelumbo nucifera]
Length=708

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 45/77 (58%), Gaps = 7/77 (9%)
 Frame = +2

Query  287  MPELRSGAR----RSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVA  451
            MPELRSGAR    RSKRL DLQP+ Q   Q EN ALP  N   RR G G     NA AVA
Sbjct  1    MPELRSGARQARLRSKRLDDLQPSSQHPDQAENCALPAPNRTGRRVGAGRGRGCNATAVA  60

Query  452  KGPS--TGVRGRPAAAG  496
            KGPS  T  R  PA  G
Sbjct  61   KGPSGATPARAIPAGRG  77



>ref|XP_010558719.1| PREDICTED: uncharacterized protein LOC104827271 isoform X1 [Tarenaya 
hassleriana]
Length=703

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQ  391
            MPELRSGARRS+RL DLQP PQ   Q EN  LP Q
Sbjct  1    MPELRSGARRSRRLDDLQPNPQLIDQTENCVLPPQ  35



>ref|XP_010558720.1| PREDICTED: uncharacterized protein LOC104827271 isoform X2 [Tarenaya 
hassleriana]
Length=704

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQ  391
            MPELRSGARRS+RL DLQP PQ   Q EN  LP Q
Sbjct  1    MPELRSGARRSRRLDDLQPNPQLIDQTENCVLPPQ  35



>ref|XP_010908708.1| PREDICTED: uncharacterized protein LOC105035016 [Elaeis guineensis]
Length=718

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 40/64 (63%), Gaps = 5/64 (8%)
 Frame = +2

Query  287  MPELRSGAR----RSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVA  451
            MPELRSGAR    +SK+L D+   PQP  Q EN  LPT N   RR G G     NAAAVA
Sbjct  1    MPELRSGARQARLKSKKLDDIPLPPQPIDQAENWVLPTTNRTGRRGGAGRGRGSNAAAVA  60

Query  452  KGPS  463
            KGPS
Sbjct  61   KGPS  64



>ref|XP_010672056.1| PREDICTED: uncharacterized protein LOC104888715 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=711

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDL-QPAPQPTGQEENLALPTQN  394
            MPELRSGARRSKRLGDL QP+P+   Q EN   PTQN
Sbjct  1    MPELRSGARRSKRLGDLQQPSPELNDQGENCHPPTQN  37



>ref|XP_010672054.1| PREDICTED: uncharacterized protein LOC104888715 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=713

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDL-QPAPQPTGQEENLALPTQN  394
            MPELRSGARRSKRLGDL QP+P+   Q EN   PTQN
Sbjct  1    MPELRSGARRSKRLGDLQQPSPELNDQGENCHPPTQN  37



>ref|XP_008805378.1| PREDICTED: uncharacterized protein LOC103718369 [Phoenix dactylifera]
 ref|XP_008805379.1| PREDICTED: uncharacterized protein LOC103718369 [Phoenix dactylifera]
Length=718

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 39/64 (61%), Gaps = 5/64 (8%)
 Frame = +2

Query  287  MPELRSGAR----RSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVA  451
            MPELRSGAR    +SK+L D+ P PQ   Q EN  LPT N   RR G G     NAAAV 
Sbjct  1    MPELRSGARQARLKSKKLDDIPPPPQRIDQAENWVLPTTNRTGRRGGAGRGRGSNAAAVV  60

Query  452  KGPS  463
            KGPS
Sbjct  61   KGPS  64



>ref|XP_006408240.1| hypothetical protein EUTSA_v10020173mg [Eutrema salsugineum]
 gb|ESQ49693.1| hypothetical protein EUTSA_v10020173mg [Eutrema salsugineum]
Length=701

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 46/70 (66%), Gaps = 6/70 (9%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRS+RL D QP PQ   Q EN+ALP Q  TRRRGGG       AA+AKG   
Sbjct  1    MPELRSGARRSRRLDD-QPNPQLVEQAENIALPPQTATRRRGGGRGRGN--AALAKG---  54

Query  467  GVRGRPAAAG  496
             V  RP AAG
Sbjct  55   AVPPRPTAAG  64



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552737873190