BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF007H18

Length=511
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002272165.1|  PREDICTED: probable CCR4-associated factor 1...    207   3e-63   Vitis vinifera
gb|KJB66334.1|  hypothetical protein B456_010G136400                    206   9e-63   Gossypium raimondii
gb|EYU24608.1|  hypothetical protein MIMGU_mgv1a011718mg                205   2e-62   Erythranthe guttata [common monkey flower]
ref|XP_011082241.1|  PREDICTED: probable CCR4-associated factor 1...    205   3e-62   Sesamum indicum [beniseed]
gb|KJB68026.1|  hypothetical protein B456_010G222500                    204   5e-62   Gossypium raimondii
ref|XP_011020623.1|  PREDICTED: probable CCR4-associated factor 1...    204   6e-62   Populus euphratica
ref|XP_002303842.1|  hypothetical protein POPTR_0003s17950g             204   6e-62   
ref|XP_011073341.1|  PREDICTED: probable CCR4-associated factor 1...    203   1e-61   Sesamum indicum [beniseed]
ref|XP_006356242.1|  PREDICTED: probable CCR4-associated factor 1...    203   1e-61   Solanum tuberosum [potatoes]
ref|XP_004241682.1|  PREDICTED: probable CCR4-associated factor 1...    203   1e-61   Solanum lycopersicum
ref|XP_010275748.1|  PREDICTED: probable CCR4-associated factor 1...    203   2e-61   Nelumbo nucifera [Indian lotus]
ref|XP_007023407.1|  CCR4-associated factor 1                           205   3e-61   
ref|XP_002527306.1|  ccr4-associated factor, putative                   202   3e-61   Ricinus communis
ref|XP_007023408.1|  Polynucleotidyl transferase, ribonuclease H-...    202   3e-61   Theobroma cacao [chocolate]
gb|KDP41983.1|  hypothetical protein JCGZ_27001                         201   5e-61   Jatropha curcas
ref|XP_007215794.1|  hypothetical protein PRUPE_ppa009874mg             201   9e-61   Prunus persica
gb|KHG18085.1|  putative CCR4-associated factor 1 -like protein         202   9e-61   Gossypium arboreum [tree cotton]
ref|XP_006368924.1|  hypothetical protein POPTR_0001s14860g             200   1e-60   
ref|XP_006341359.1|  PREDICTED: probable CCR4-associated factor 1...    201   1e-60   Solanum tuberosum [potatoes]
ref|XP_004235935.1|  PREDICTED: probable CCR4-associated factor 1...    200   2e-60   Solanum lycopersicum
ref|XP_011034532.1|  PREDICTED: probable CCR4-associated factor 1...    200   2e-60   Populus euphratica
ref|XP_009605547.1|  PREDICTED: probable CCR4-associated factor 1...    200   2e-60   Nicotiana tomentosiformis
ref|XP_007023405.1|  Polynucleotidyl transferase, ribonuclease H-...    197   2e-60   
ref|XP_009760590.1|  PREDICTED: probable CCR4-associated factor 1...    199   3e-60   Nicotiana sylvestris
ref|XP_010265638.1|  PREDICTED: probable CCR4-associated factor 1...    199   5e-60   Nelumbo nucifera [Indian lotus]
ref|XP_007023403.1|  Polynucleotidyl transferase, ribonuclease H-...    199   5e-60   
ref|XP_008228784.1|  PREDICTED: probable CCR4-associated factor 1...    199   5e-60   Prunus mume [ume]
ref|XP_006427595.1|  hypothetical protein CICLE_v10026260mg             198   8e-60   
gb|KDO42998.1|  hypothetical protein CISIN_1g023991mg                   198   9e-60   Citrus sinensis [apfelsine]
ref|XP_006465196.1|  PREDICTED: probable CCR4-associated factor 1...    198   1e-59   Citrus sinensis [apfelsine]
ref|XP_009801027.1|  PREDICTED: probable CCR4-associated factor 1...    197   2e-59   Nicotiana sylvestris
ref|XP_009793121.1|  PREDICTED: probable CCR4-associated factor 1...    197   3e-59   Nicotiana sylvestris
gb|EPS59819.1|  hypothetical protein M569_14984                         197   3e-59   Genlisea aurea
gb|KJB07590.1|  hypothetical protein B456_001G031500                    197   3e-59   Gossypium raimondii
ref|XP_011082251.1|  PREDICTED: probable CCR4-associated factor 1...    195   2e-58   Sesamum indicum [beniseed]
gb|EPS71126.1|  hypothetical protein M569_03633                         195   2e-58   Genlisea aurea
gb|KHG00404.1|  putative CCR4-associated factor 1 -like protein         195   2e-58   Gossypium arboreum [tree cotton]
ref|XP_009594641.1|  PREDICTED: probable CCR4-associated factor 1...    195   2e-58   Nicotiana tomentosiformis
ref|XP_009354185.1|  PREDICTED: probable CCR4-associated factor 1...    195   2e-58   Pyrus x bretschneideri [bai li]
ref|XP_009620266.1|  PREDICTED: probable CCR4-associated factor 1...    194   6e-58   Nicotiana tomentosiformis
ref|XP_008375521.1|  PREDICTED: probable CCR4-associated factor 1...    193   1e-57   Malus domestica [apple tree]
ref|XP_004305482.1|  PREDICTED: probable CCR4-associated factor 1...    193   1e-57   Fragaria vesca subsp. vesca
emb|CDO98220.1|  unnamed protein product                                193   1e-57   Coffea canephora [robusta coffee]
ref|XP_010048831.1|  PREDICTED: probable CCR4-associated factor 1...    192   3e-57   Eucalyptus grandis [rose gum]
ref|XP_003526204.1|  PREDICTED: probable CCR4-associated factor 1...    191   5e-57   Glycine max [soybeans]
ref|XP_002515442.1|  ccr4-associated factor, putative                   191   5e-57   
ref|XP_010063560.1|  PREDICTED: probable CCR4-associated factor 1...    191   5e-57   Eucalyptus grandis [rose gum]
gb|KHN07034.1|  Putative CCR4-associated factor 1 like 7                191   5e-57   Glycine soja [wild soybean]
gb|KHN29617.1|  Putative CCR4-associated factor 1 like 7                190   1e-56   Glycine soja [wild soybean]
ref|XP_003522433.1|  PREDICTED: probable CCR4-associated factor 1...    190   2e-56   Glycine max [soybeans]
ref|XP_010532089.1|  PREDICTED: probable CCR4-associated factor 1...    189   3e-56   Tarenaya hassleriana [spider flower]
ref|XP_010532091.1|  PREDICTED: probable CCR4-associated factor 1...    189   3e-56   Tarenaya hassleriana [spider flower]
gb|EYU21723.1|  hypothetical protein MIMGU_mgv1a019889mg                189   4e-56   Erythranthe guttata [common monkey flower]
ref|XP_006857184.1|  hypothetical protein AMTR_s00065p00182000          189   4e-56   Amborella trichopoda
gb|KDP33530.1|  hypothetical protein JCGZ_07101                         188   7e-56   Jatropha curcas
ref|XP_010532085.1|  PREDICTED: probable CCR4-associated factor 1...    188   7e-56   Tarenaya hassleriana [spider flower]
ref|XP_006356929.1|  PREDICTED: probable CCR4-associated factor 1...    188   8e-56   Solanum tuberosum [potatoes]
ref|XP_008336906.1|  PREDICTED: probable CCR4-associated factor 1...    189   1e-55   
ref|XP_010665982.1|  PREDICTED: probable CCR4-associated factor 1...    187   1e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003530297.1|  PREDICTED: probable CCR4-associated factor 1...    187   1e-55   Glycine max [soybeans]
gb|ACU24625.1|  unknown                                                 187   2e-55   Glycine max [soybeans]
ref|XP_010089956.1|  putative CCR4-associated factor 1-7-like pro...    187   2e-55   Morus notabilis
ref|XP_009358471.1|  PREDICTED: probable CCR4-associated factor 1...    188   2e-55   Pyrus x bretschneideri [bai li]
ref|XP_010648684.1|  PREDICTED: probable CCR4-associated factor 1...    187   3e-55   Vitis vinifera
ref|XP_002309667.1|  hypothetical protein POPTR_0006s27840g             187   4e-55   Populus trichocarpa [western balsam poplar]
ref|XP_007202386.1|  hypothetical protein PRUPE_ppa009376mg             187   5e-55   Prunus persica
ref|XP_006483458.1|  PREDICTED: probable CCR4-associated factor 1...    186   5e-55   Citrus sinensis [apfelsine]
gb|KHG16599.1|  putative CCR4-associated factor 1 -like protein         186   5e-55   Gossypium arboreum [tree cotton]
ref|XP_007136961.1|  hypothetical protein PHAVU_009G088600g             186   5e-55   Phaseolus vulgaris [French bean]
gb|AFK45143.1|  unknown                                                 186   6e-55   Lotus japonicus
ref|XP_008242960.1|  PREDICTED: probable CCR4-associated factor 1...    186   7e-55   Prunus mume [ume]
gb|KJB68416.1|  hypothetical protein B456_010G244300                    186   7e-55   Gossypium raimondii
ref|XP_011036659.1|  PREDICTED: probable CCR4-associated factor 1...    186   8e-55   Populus euphratica
ref|XP_008242959.1|  PREDICTED: probable CCR4-associated factor 1...    186   9e-55   
ref|XP_002324905.2|  hypothetical protein POPTR_0018s02370g             186   9e-55   Populus trichocarpa [western balsam poplar]
ref|NP_178193.1|  putative CCR4-associated factor 1-like 6              185   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004138704.1|  PREDICTED: probable CCR4-associated factor 1...    185   1e-54   Cucumis sativus [cucumbers]
ref|XP_007135810.1|  hypothetical protein PHAVU_010G160400g             186   1e-54   Phaseolus vulgaris [French bean]
ref|XP_008445259.1|  PREDICTED: probable CCR4-associated factor 1...    185   1e-54   Cucumis melo [Oriental melon]
ref|NP_001185452.1|  putative CCR4-associated factor 1-like 6           186   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007011965.1|  Polynucleotidyl transferase, ribonuclease H-...    185   1e-54   
ref|XP_010556071.1|  PREDICTED: probable CCR4-associated factor 1...    184   2e-54   Tarenaya hassleriana [spider flower]
ref|XP_010472873.1|  PREDICTED: probable CCR4-associated factor 1...    184   2e-54   Camelina sativa [gold-of-pleasure]
emb|CDP10211.1|  unnamed protein product                                184   2e-54   Coffea canephora [robusta coffee]
gb|KJB06630.1|  hypothetical protein B456_001G037000                    184   3e-54   Gossypium raimondii
emb|CAN79806.1|  hypothetical protein VITISV_031504                     184   4e-54   Vitis vinifera
gb|KJB55043.1|  hypothetical protein B456_009G061200                    184   4e-54   Gossypium raimondii
ref|XP_006302671.1|  hypothetical protein CARUB_v10020778mg             184   4e-54   Capsella rubella
gb|AFK43307.1|  unknown                                                 184   5e-54   Lotus japonicus
ref|XP_003604226.1|  Ribonuclease CAF1                                  184   5e-54   
ref|XP_010092187.1|  putative CCR4-associated factor 1-7-like pro...    184   5e-54   Morus notabilis
gb|ACN40154.1|  unknown                                                 183   6e-54   Picea sitchensis
ref|XP_004507083.1|  PREDICTED: probable CCR4-associated factor 1...    183   6e-54   Cicer arietinum [garbanzo]
ref|XP_003531734.1|  PREDICTED: probable CCR4-associated factor 1...    184   6e-54   
ref|XP_006450304.1|  hypothetical protein CICLE_v10008276mg             188   6e-54   
ref|XP_008354337.1|  PREDICTED: probable CCR4-associated factor 1...    184   6e-54   
ref|XP_006473977.1|  PREDICTED: probable CCR4-associated factor 1...    183   9e-54   Citrus sinensis [apfelsine]
emb|CDY63973.1|  BnaC02g46620D                                          183   1e-53   Brassica napus [oilseed rape]
gb|ABK24400.1|  unknown                                                 183   1e-53   Picea sitchensis
ref|XP_004501372.1|  PREDICTED: probable CCR4-associated factor 1...    182   1e-53   
ref|XP_011039582.1|  PREDICTED: probable CCR4-associated factor 1...    183   1e-53   Populus euphratica
ref|XP_002881215.1|  hypothetical protein ARALYDRAFT_902256             182   1e-53   Arabidopsis lyrata subsp. lyrata
ref|XP_008344039.1|  PREDICTED: probable CCR4-associated factor 1...    182   1e-53   
gb|KHF99352.1|  putative CCR4-associated factor 1 -like protein         184   2e-53   Gossypium arboreum [tree cotton]
ref|XP_006294779.1|  hypothetical protein CARUB_v10023830mg             182   2e-53   Capsella rubella
ref|XP_009366159.1|  PREDICTED: probable CCR4-associated factor 1...    182   3e-53   Pyrus x bretschneideri [bai li]
ref|NP_565735.1|  polynucleotidyl transferase, ribonuclease H-lik...    181   3e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009128391.1|  PREDICTED: probable CCR4-associated factor 1...    181   4e-53   Brassica rapa
ref|XP_006389834.1|  hypothetical protein EUTSA_v10018990mg             181   4e-53   Eutrema salsugineum [saltwater cress]
ref|XP_010537879.1|  PREDICTED: probable CCR4-associated factor 1...    181   5e-53   Tarenaya hassleriana [spider flower]
ref|XP_010942117.1|  PREDICTED: probable CCR4-associated factor 1...    181   5e-53   Elaeis guineensis
gb|ABK22659.1|  unknown                                                 181   5e-53   Picea sitchensis
ref|XP_010414034.1|  PREDICTED: probable CCR4-associated factor 1...    180   9e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010469632.1|  PREDICTED: probable CCR4-associated factor 1...    180   9e-53   Camelina sativa [gold-of-pleasure]
ref|XP_009417447.1|  PREDICTED: probable CCR4-associated factor 1...    180   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACU20942.1|  unknown                                                 181   1e-52   Glycine max [soybeans]
ref|XP_004504674.1|  PREDICTED: probable CCR4-associated factor 1...    180   1e-52   Cicer arietinum [garbanzo]
ref|XP_004250764.1|  PREDICTED: probable CCR4-associated factor 1...    180   2e-52   Solanum lycopersicum
ref|XP_010429900.1|  PREDICTED: probable CCR4-associated factor 1...    180   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_004291948.1|  PREDICTED: probable CCR4-associated factor 1...    179   2e-52   Fragaria vesca subsp. vesca
emb|CDY39943.1|  BnaC06g40210D                                          179   2e-52   Brassica napus [oilseed rape]
ref|XP_009106716.1|  PREDICTED: probable CCR4-associated factor 1...    179   3e-52   Brassica rapa
ref|XP_009363839.1|  PREDICTED: probable CCR4-associated factor 1...    179   4e-52   Pyrus x bretschneideri [bai li]
ref|XP_008799630.1|  PREDICTED: probable CCR4-associated factor 1...    179   4e-52   Phoenix dactylifera
ref|XP_011073532.1|  PREDICTED: probable CCR4-associated factor 1...    178   5e-52   Sesamum indicum [beniseed]
ref|XP_010417661.1|  PREDICTED: probable CCR4-associated factor 1...    178   5e-52   Camelina sativa [gold-of-pleasure]
ref|XP_006453661.1|  hypothetical protein CICLE_v10009159mg             178   5e-52   Citrus clementina [clementine]
ref|XP_004160761.1|  PREDICTED: LOW QUALITY PROTEIN: probable CCR...    178   6e-52   
ref|XP_004138706.1|  PREDICTED: probable CCR4-associated factor 1...    178   6e-52   Cucumis sativus [cucumbers]
ref|XP_003603309.1|  Ribonuclease CAF1                                  178   7e-52   
ref|XP_010691601.1|  PREDICTED: probable CCR4-associated factor 1...    178   7e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009399558.1|  PREDICTED: probable CCR4-associated factor 1...    178   7e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008445257.1|  PREDICTED: LOW QUALITY PROTEIN: probable CCR...    178   7e-52   Cucumis melo [Oriental melon]
ref|XP_010048142.1|  PREDICTED: probable CCR4-associated factor 1...    177   1e-51   Eucalyptus grandis [rose gum]
ref|XP_010911571.1|  PREDICTED: probable CCR4-associated factor 1...    173   1e-51   Elaeis guineensis
ref|XP_010510101.1|  PREDICTED: probable CCR4-associated factor 1...    177   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010929136.1|  PREDICTED: probable CCR4-associated factor 1...    177   2e-51   Elaeis guineensis
ref|XP_009390565.1|  PREDICTED: probable CCR4-associated factor 1...    176   4e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008794330.1|  PREDICTED: probable CCR4-associated factor 1...    176   5e-51   Phoenix dactylifera
emb|CDY12234.1|  BnaC04g12640D                                          176   8e-51   Brassica napus [oilseed rape]
gb|ACJ84891.1|  unknown                                                 175   1e-50   Medicago truncatula
ref|XP_006410344.1|  hypothetical protein EUTSA_v10017059mg             174   2e-50   Eutrema salsugineum [saltwater cress]
ref|XP_009144015.1|  PREDICTED: probable CCR4-associated factor 1...    174   3e-50   Brassica rapa
ref|XP_008378874.1|  PREDICTED: probable CCR4-associated factor 1...    174   4e-50   Malus domestica [apple tree]
ref|NP_196657.1|  polynucleotidyl transferase, ribonuclease H-lik...    171   5e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871445.1|  hypothetical protein ARALYDRAFT_487926             171   5e-49   
ref|XP_009122009.1|  PREDICTED: probable CCR4-associated factor 1...    171   6e-49   Brassica rapa
gb|AAK92792.1|  putative CCR4-associated factor                         171   7e-49   Arabidopsis thaliana [mouse-ear cress]
emb|CDX69796.1|  BnaA10g21450D                                          170   7e-49   
ref|XP_010453129.1|  PREDICTED: probable CCR4-associated factor 1...    170   8e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010491786.1|  PREDICTED: probable CCR4-associated factor 1...    170   8e-49   Camelina sativa [gold-of-pleasure]
ref|XP_006286536.1|  hypothetical protein CARUB_v10001652mg             170   8e-49   Capsella rubella
ref|XP_002309331.1|  hypothetical protein POPTR_0006s20130g             170   8e-49   Populus trichocarpa [western balsam poplar]
ref|XP_011033459.1|  PREDICTED: probable CCR4-associated factor 1...    169   1e-48   Populus euphratica
ref|XP_001766532.1|  predicted protein                                  169   3e-48   
gb|EYU32376.1|  hypothetical protein MIMGU_mgv1a026872mg                169   3e-48   Erythranthe guttata [common monkey flower]
ref|XP_001755261.1|  predicted protein                                  168   3e-48   
ref|XP_004287117.1|  PREDICTED: probable CCR4-associated factor 1...    168   4e-48   Fragaria vesca subsp. vesca
ref|XP_010541576.1|  PREDICTED: probable CCR4-associated factor 1...    168   4e-48   Tarenaya hassleriana [spider flower]
ref|XP_010419649.1|  PREDICTED: probable CCR4-associated factor 1...    168   4e-48   Camelina sativa [gold-of-pleasure]
ref|XP_006399590.1|  hypothetical protein EUTSA_v10014350mg             167   8e-48   Eutrema salsugineum [saltwater cress]
ref|XP_002279241.1|  PREDICTED: probable CCR4-associated factor 1...    167   1e-47   Vitis vinifera
emb|CAN68032.1|  hypothetical protein VITISV_022019                     167   1e-47   Vitis vinifera
emb|CDX97069.1|  BnaC09g45560D                                          166   3e-47   
ref|XP_008377668.1|  PREDICTED: probable CCR4-associated factor 1...    165   6e-47   Malus domestica [apple tree]
ref|XP_008220692.1|  PREDICTED: probable CCR4-associated factor 1...    165   7e-47   Prunus mume [ume]
ref|XP_007222518.1|  hypothetical protein PRUPE_ppa009848mg             164   2e-46   Prunus persica
emb|CDY12236.1|  BnaC04g12660D                                          167   2e-46   Brassica napus [oilseed rape]
emb|CDX70376.1|  BnaC03g04600D                                          163   6e-46   
ref|XP_002981023.1|  hypothetical protein SELMODRAFT_444748             160   6e-45   Selaginella moellendorffii
ref|XP_002982500.1|  hypothetical protein SELMODRAFT_179583             160   7e-45   Selaginella moellendorffii
ref|XP_009131188.1|  PREDICTED: probable CCR4-associated factor 1...    156   2e-43   Brassica rapa
ref|XP_005843563.1|  hypothetical protein CHLNCDRAFT_59811              156   2e-43   Chlorella variabilis
dbj|BAK01540.1|  predicted protein                                      154   2e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACL53982.1|  unknown                                                 153   5e-42   Zea mays [maize]
ref|XP_004954218.1|  PREDICTED: probable CCR4-associated factor 1...    153   6e-42   Setaria italica
ref|XP_002452981.1|  hypothetical protein SORBIDRAFT_04g035960          151   2e-41   Sorghum bicolor [broomcorn]
ref|XP_002862886.1|  hypothetical protein ARALYDRAFT_920160             150   2e-41   
ref|NP_001063181.1|  Os09g0416800                                       150   3e-41   
ref|XP_008676671.1|  PREDICTED: uncharacterized protein LOC100216...    151   5e-41   
ref|NP_001136747.1|  uncharacterized protein LOC100216888               150   6e-41   Zea mays [maize]
ref|XP_010048148.1|  PREDICTED: probable CCR4-associated factor 1...    149   1e-40   Eucalyptus grandis [rose gum]
ref|XP_011395961.1|  putative CCR4-associated factor 1-like prote...    149   2e-40   Auxenochlorella protothecoides
ref|XP_002460215.1|  hypothetical protein SORBIDRAFT_02g024730          149   2e-40   Sorghum bicolor [broomcorn]
ref|XP_005649974.1|  CCR4-associated factor                             149   2e-40   Coccomyxa subellipsoidea C-169
gb|KIY93169.1|  CCR4-NOT transcription complex subunit 7/8              146   3e-40   Monoraphidium neglectum
ref|XP_006660627.1|  PREDICTED: probable CCR4-associated factor 1...    147   5e-40   Oryza brachyantha
ref|NP_001048387.1|  Os02g0796300                                       147   1e-39   
dbj|BAD19081.1|  putative CCR4-NOT transcription complex subunit 7      147   1e-39   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74173.1|  hypothetical protein OsI_09281                          147   1e-39   Oryza sativa Indica Group [Indian rice]
ref|NP_001132298.1|  CCR4-NOT transcription complex subunit 7 iso...    146   2e-39   
gb|EMS59499.1|  putative CCR4-associated factor 1-like protein 7        146   3e-39   Triticum urartu
ref|XP_002890137.1|  hypothetical protein ARALYDRAFT_312582             145   3e-39   Arabidopsis lyrata subsp. lyrata
ref|NP_173044.1|  polynucleotidyl transferase, ribonuclease H-lik...    145   5e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003056015.1|  predicted protein                                  144   6e-39   Micromonas pusilla CCMP1545
gb|KCW53891.1|  hypothetical protein EUGRSUZ_J03104                     143   8e-39   Eucalyptus grandis [rose gum]
dbj|BAJ92910.1|  predicted protein                                      144   8e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003570299.1|  PREDICTED: probable CCR4-associated factor 1...    144   1e-38   Brachypodium distachyon [annual false brome]
ref|XP_006304066.1|  hypothetical protein CARUB_v10009915mg             144   1e-38   Capsella rubella
dbj|GAC74710.1|  mRNA deadenylase subunit                               141   2e-38   Moesziomyces antarcticus T-34
ref|XP_010932239.1|  PREDICTED: probable CCR4-associated factor 1...    142   4e-38   Elaeis guineensis
ref|XP_001697447.1|  CCR4-associated factor                             143   4e-38   Chlamydomonas reinhardtii
ref|XP_002965900.1|  hypothetical protein SELMODRAFT_84624              140   2e-37   Selaginella moellendorffii
ref|XP_003074753.1|  Caf1 CCR4-associated (transcription) factor,...    140   3e-37   
ref|XP_001416204.1|  polyA tail-shortening ribonuclease, probable       140   4e-37   Ostreococcus lucimarinus CCE9901
ref|XP_003578122.1|  PREDICTED: probable CCR4-associated factor 1...    140   5e-37   Brachypodium distachyon [annual false brome]
emb|CEI90475.1|  Putative CCR4-NOT transcription complex subunit 7      134   8e-37   Rhizopus microsporus
ref|XP_010497514.1|  PREDICTED: probable CCR4-associated factor 1...    138   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010476692.1|  PREDICTED: probable CCR4-associated factor 1...    138   3e-36   Camelina sativa [gold-of-pleasure]
ref|XP_009395283.1|  PREDICTED: probable CCR4-associated factor 1...    137   4e-36   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAD09890.1|  putative CCR4-NOT transcription complex, subunit 7     137   9e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006648046.1|  PREDICTED: probable CCR4-associated factor 1...    137   1e-35   
emb|CAN81811.1|  hypothetical protein VITISV_020892                     133   1e-35   Vitis vinifera
emb|CDS05253.1|  Putative CCR4-NOT transcription complex subunit7       135   1e-35   Lichtheimia ramosa
ref|XP_009418496.1|  PREDICTED: probable CCR4-associated factor 1...    136   1e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002950174.1|  hypothetical protein VOLCADRAFT_80930              137   1e-35   Volvox carteri f. nagariensis
ref|XP_009395282.1|  PREDICTED: probable CCR4-associated factor 1...    135   1e-35   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU24605.1|  hypothetical protein MIMGU_mgv1a011876mg                135   2e-35   Erythranthe guttata [common monkey flower]
ref|XP_009396102.1|  PREDICTED: probable CCR4-associated factor 1...    135   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007877414.1|  hypothetical protein PFL1_01713                    136   2e-35   Anthracocystis flocculosa PF-1
ref|XP_006659446.1|  PREDICTED: probable CCR4-associated factor 1...    135   3e-35   
emb|CEI89573.1|  Putative CCR4-NOT transcription complex subunit 7      134   5e-35   Rhizopus microsporus
emb|CEG62914.1|  Putative CCR4-NOT transcription complex subunit 7      134   5e-35   Rhizopus microsporus
emb|CDH53595.1|  caf1 family protein                                    135   6e-35   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_004956826.1|  PREDICTED: probable CCR4-associated factor 1...    134   7e-35   Setaria italica
ref|XP_008779663.1|  PREDICTED: probable CCR4-associated factor 1...    134   8e-35   Phoenix dactylifera
gb|ACQ77596.1|  CCR4-NOT                                                132   9e-35   Dimocarpus longan [longan]
ref|XP_004354599.1|  CAF1 family protein                                136   1e-34   Cavenderia fasciculata
ref|XP_008796886.1|  PREDICTED: probable CCR4-associated factor 1...    133   1e-34   Phoenix dactylifera
gb|KDP38660.1|  hypothetical protein JCGZ_04013                         133   1e-34   Jatropha curcas
ref|XP_007023404.1|  Polynucleotidyl transferase, ribonuclease H-...    132   1e-34   
emb|CDS11386.1|  Putative CCR4-NOT transcription complex subunit7       133   1e-34   Lichtheimia ramosa
gb|ETS62597.1|  hypothetical protein PaG_03234                          134   1e-34   Moesziomyces aphidis DSM 70725
emb|CEP13830.1|  hypothetical protein                                   134   1e-34   Parasitella parasitica
ref|XP_002507260.1|  predicted protein                                  133   1e-34   Micromonas commoda
dbj|GAK65069.1|  ribonuclease CAF1                                      134   2e-34   Moesziomyces antarcticus
gb|EPB85653.1|  CCR4-NOT transcription complex subunit 7                132   2e-34   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_003574542.1|  PREDICTED: probable CCR4-associated factor 1...    133   2e-34   Brachypodium distachyon [annual false brome]
ref|XP_007509231.1|  Caf1 CCR4-associated (transcription) factor 1      132   2e-34   Bathycoccus prasinos
dbj|GAN07390.1|  CCR4 associated factor                                 133   2e-34   Mucor ambiguus
ref|XP_009266106.1|  CCR4-NOT transcription complex subunit 7           133   2e-34   Wallemia ichthyophaga EXF-994
ref|XP_006956137.1|  ribonuclease CAF1                                  132   2e-34   Wallemia mellicola CBS 633.66
ref|XP_010459127.1|  PREDICTED: probable CCR4-associated factor 1...    132   3e-34   Camelina sativa [gold-of-pleasure]
emb|CBQ71168.1|  probable CCR4-NOT transcription complex, subunit 7     133   3e-34   Sporisorium reilianum SRZ2
ref|NP_001140241.1|  uncharacterized protein LOC100272282               132   3e-34   Zea mays [maize]
gb|KFK43832.1|  hypothetical protein AALP_AA1G179300                    132   4e-34   Arabis alpina [alpine rockcress]
emb|CCF48047.1|  probable CCR4-NOT transcription complex, subunit 7     133   4e-34   Ustilago hordei
emb|CDH54244.1|  ccr4-not transcription complex subunit 7               132   5e-34   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_002444415.1|  hypothetical protein SORBIDRAFT_07g021610          132   5e-34   Sorghum bicolor [broomcorn]
gb|KFH71636.1|  hypothetical protein MVEG_01932                         132   7e-34   Mortierella verticillata NRRL 6337
gb|AGT16865.1|  transcription complex                                   131   8e-34   Saccharum hybrid cultivar R570
gb|ACL52816.1|  unknown                                                 131   9e-34   Zea mays [maize]
ref|NP_001131670.1|  uncharacterized protein LOC100193030               131   9e-34   Zea mays [maize]
gb|KDN37229.1|  CAF1-domain-containing protein                          132   1e-33   Tilletiaria anomala UBC 951
ref|XP_006854720.1|  hypothetical protein AMTR_s00030p00236940          130   1e-33   
ref|XP_011388715.1|  putative CCR4-NOT core exoribonuclease subun...    131   2e-33   Ustilago maydis 521
gb|ADE10053.1|  CAF1 superfamily protein                                127   2e-33   Tremella fuciformis
ref|XP_006665053.1|  PREDICTED: probable CCR4-associated factor 1...    131   2e-33   Oryza brachyantha
ref|XP_638651.1|  CAF1 family protein                                   132   2e-33   Dictyostelium discoideum AX4
ref|XP_008548219.1|  PREDICTED: CCR4-NOT transcription complex su...    131   2e-33   Microplitis demolitor
ref|XP_008548220.1|  PREDICTED: CCR4-NOT transcription complex su...    130   2e-33   Microplitis demolitor
gb|ESA18671.1|  hypothetical protein GLOINDRAFT_75970                   130   2e-33   
ref|XP_008548221.1|  PREDICTED: CCR4-NOT transcription complex su...    130   2e-33   Microplitis demolitor
gb|KDP38659.1|  hypothetical protein JCGZ_04012                         129   3e-33   Jatropha curcas
ref|XP_006680570.1|  hypothetical protein BATDEDRAFT_90073              129   3e-33   Batrachochytrium dendrobatidis JAM81
ref|XP_845183.1|  CCR4 associated factor                                131   4e-33   Trypanosoma brucei brucei TREU927
ref|XP_004337732.1|  ccr4associated factor, putative                    129   4e-33   Acanthamoeba castellanii str. Neff
gb|EST05943.1|  CCR4-NOT transcription complex, subunit 7               130   5e-33   Kalmanozyma brasiliensis GHG001
gb|KIY68330.1|  CAF1-domain-containing protein                          130   5e-33   Cylindrobasidium torrendii FP15055 ss-10
gb|EXX67656.1|  Pop2p                                                   131   5e-33   Rhizophagus irregularis DAOM 197198w
emb|CBI38930.3|  unnamed protein product                                127   6e-33   Vitis vinifera
emb|CDI55400.1|  probable CCR4-NOT transcription complex, subunit 7     130   6e-33   Melanopsichium pennsylvanicum 4
gb|ELU44857.1|  CCR4-NOT transcription complex subunit 7                129   6e-33   Rhizoctonia solani AG-1 IA
ref|XP_004138705.1|  PREDICTED: probable CCR4-associated factor 1...    128   7e-33   
ref|XP_004497679.1|  PREDICTED: probable CCR4-associated factor 1...    129   7e-33   
gb|EFA83975.1|  CAF1 family protein                                     134   7e-33   Heterostelium album PN500
ref|XP_006416864.1|  hypothetical protein EUTSA_v10008404mg             129   8e-33   Eutrema salsugineum [saltwater cress]
ref|XP_011006693.1|  PREDICTED: probable CCR4-associated factor 1...    128   9e-33   Populus euphratica
ref|XP_011006712.1|  PREDICTED: probable CCR4-associated factor 1...    128   1e-32   Populus euphratica
ref|XP_006854719.1|  hypothetical protein AMTR_s00030p00236350          128   1e-32   
ref|XP_010541577.1|  PREDICTED: probable CCR4-associated factor 1...    127   1e-32   
ref|XP_010927524.1|  PREDICTED: probable CCR4-associated factor 1...    127   2e-32   
gb|KGO77996.1|  Ribonuclease CAF1                                       130   2e-32   
gb|KIJ62736.1|  hypothetical protein HYDPIDRAFT_176502                  129   2e-32   
ref|XP_011299712.1|  PREDICTED: CCR4-NOT transcription complex su...    128   2e-32   
ref|XP_007346111.1|  CAF1-domain-containing protein                     128   3e-32   
ref|XP_006568301.1|  PREDICTED: CCR4-NOT transcription complex su...    128   3e-32   
ref|XP_007271716.1|  CAF1-domain-containing protein                     129   3e-32   
ref|XP_003396031.1|  PREDICTED: CCR4-NOT transcription complex su...    127   3e-32   
gb|EKG06977.1|  CCR4 associated factor, putative                        128   3e-32   
ref|XP_011299715.1|  PREDICTED: CCR4-NOT transcription complex su...    127   3e-32   
ref|XP_003424661.1|  PREDICTED: CCR4-NOT transcription complex su...    127   3e-32   
gb|ABK21469.1|  unknown                                                 126   3e-32   
ref|XP_008206873.1|  PREDICTED: CCR4-NOT transcription complex su...    127   4e-32   
ref|XP_006568302.1|  PREDICTED: CCR4-NOT transcription complex su...    127   4e-32   
ref|XP_001601395.1|  PREDICTED: CCR4-NOT transcription complex su...    127   4e-32   
ref|XP_011299716.1|  PREDICTED: CCR4-NOT transcription complex su...    127   4e-32   
ref|XP_011501465.1|  PREDICTED: CCR4-NOT transcription complex su...    127   4e-32   
ref|XP_812690.1|  CCR4 associated factor                                128   4e-32   
ref|XP_003424663.1|  PREDICTED: CCR4-NOT transcription complex su...    128   4e-32   
ref|XP_011501464.1|  PREDICTED: CCR4-NOT transcription complex su...    128   4e-32   
ref|XP_003491312.1|  PREDICTED: LOW QUALITY PROTEIN: CCR4-NOT tra...    128   4e-32   
ref|XP_003693870.1|  PREDICTED: CCR4-NOT transcription complex su...    127   4e-32   
ref|XP_011299711.1|  PREDICTED: CCR4-NOT transcription complex su...    128   5e-32   
ref|XP_008206772.1|  PREDICTED: CCR4-NOT transcription complex su...    127   5e-32   
emb|CCC48219.1|  putative CCR4 associated factor                        127   5e-32   
gb|EKV12152.1|  CCR4-NOT core complex subunit Caf1, putative            129   6e-32   
ref|XP_010510103.1|  PREDICTED: probable CCR4-associated factor 1...    125   8e-32   
ref|XP_011337289.1|  PREDICTED: CCR4-NOT transcription complex su...    126   9e-32   
ref|XP_011261446.1|  PREDICTED: CCR4-NOT transcription complex su...    126   1e-31   
ref|XP_002084588.1|  GD12753                                            122   1e-31   
ref|XP_010246433.1|  PREDICTED: probable CCR4-associated factor 1...    125   1e-31   
gb|EGI59892.1|  CCR4-NOT transcription complex subunit 7                125   1e-31   
dbj|GAA97487.1|  hypothetical protein E5Q_04165                         126   1e-31   
gb|EFN64855.1|  CCR4-NOT transcription complex subunit 7                125   1e-31   
ref|XP_816565.1|  CCR4 associated factor                                127   1e-31   
emb|CCC90786.1|  putative CCR4 associated factor                        127   1e-31   
gb|EKF39493.1|  CCR4 associated factor, putative                        126   1e-31   
ref|XP_003283707.1|  hypothetical protein DICPUDRAFT_20033              125   1e-31   
gb|EMS56174.1|  putative CCR4-associated factor 1-like protein 7        120   1e-31   
gb|KGO45671.1|  Ribonuclease CAF1                                       127   2e-31   
ref|XP_007370165.1|  CAF1-domain-containing protein                     127   2e-31   
ref|XP_002565407.1|  Pc22g14870                                         129   2e-31   
gb|KIK97075.1|  hypothetical protein PAXRUDRAFT_825323                  126   2e-31   
gb|KIJ17908.1|  hypothetical protein PAXINDRAFT_111622                  126   2e-31   
gb|KIL59216.1|  hypothetical protein M378DRAFT_169624                   126   2e-31   
emb|CDM35902.1|  Ribonuclease CAF1                                      127   2e-31   
ref|XP_008037531.1|  CAF1-domain-containing protein                     126   2e-31   
ref|XP_011160727.1|  PREDICTED: CCR4-NOT transcription complex su...    125   2e-31   
ref|XP_006384784.1|  CCR4-NOT transcription complex family protein      124   3e-31   
gb|KIM89183.1|  hypothetical protein PILCRDRAFT_813097                  125   3e-31   
ref|XP_003703401.1|  PREDICTED: LOW QUALITY PROTEIN: CCR4-NOT tra...    126   3e-31   
ref|XP_001957405.1|  GF10398                                            125   3e-31   
gb|KHN17966.1|  Putative CCR4-associated factor 1 like 11               124   3e-31   
ref|XP_011160728.1|  PREDICTED: CCR4-NOT transcription complex su...    124   3e-31   
ref|XP_001985184.1|  GH16922                                            125   3e-31   
gb|KDP36143.1|  hypothetical protein JCGZ_08787                         124   4e-31   
emb|CEL51770.1|  CCR4-NOT transcription complex subunit 7 OS=Xeno...    125   4e-31   
ref|XP_002473783.1|  predicted protein                                  123   4e-31   
ref|XP_011179611.1|  PREDICTED: CCR4-NOT transcription complex su...    124   4e-31   
ref|XP_011135448.1|  PREDICTED: CCR4-NOT transcription complex su...    124   4e-31   
gb|KDQ25533.1|  hypothetical protein PLEOSDRAFT_51869                   124   4e-31   
ref|XP_003540260.1|  PREDICTED: probable CCR4-associated factor 1...    125   4e-31   
ref|XP_011200256.1|  PREDICTED: CCR4-NOT transcription complex su...    124   4e-31   
ref|XP_002389628.1|  hypothetical protein MPER_11217                    125   4e-31   
dbj|GAM18889.1|  hypothetical protein SAMD00019534_020640               125   5e-31   
ref|XP_009315491.1|  CCR4 associated factor                             125   5e-31   
ref|XP_005182888.1|  PREDICTED: CCR4-NOT transcription complex su...    124   5e-31   
ref|XP_004522122.1|  PREDICTED: CCR4-NOT transcription complex su...    124   5e-31   
gb|EPY38078.1|  CCR4-NOT transcription complex subunit 7/8              124   5e-31   
ref|XP_011179602.1|  PREDICTED: CCR4-NOT transcription complex su...    124   5e-31   
ref|XP_005182887.1|  PREDICTED: CCR4-NOT transcription complex su...    124   5e-31   
ref|XP_011200255.1|  PREDICTED: CCR4-NOT transcription complex su...    124   5e-31   
gb|EPY26063.1|  CCR4-NOT transcription complex subunit 7/8              124   5e-31   
ref|XP_004522121.1|  PREDICTED: CCR4-NOT transcription complex su...    124   6e-31   
gb|AGV54478.1|  CCR4-associated factor 1-like protein 11                124   6e-31   
ref|XP_007768705.1|  CAF1-domain-containing protein                     125   7e-31   
ref|XP_011179593.1|  PREDICTED: CCR4-NOT transcription complex su...    124   7e-31   
ref|XP_003554457.1|  PREDICTED: probable CCR4-associated factor 1...    123   7e-31   
ref|XP_011200254.1|  PREDICTED: CCR4-NOT transcription complex su...    124   7e-31   
ref|XP_007844903.1|  ccr4-not transcription complex subunit 7           124   7e-31   
ref|XP_004522120.1|  PREDICTED: CCR4-NOT transcription complex su...    124   7e-31   
ref|XP_005182886.1|  PREDICTED: CCR4-NOT transcription complex su...    124   7e-31   
ref|XP_002048516.1|  GJ14014                                            124   7e-31   
ref|XP_006361099.1|  PREDICTED: probable CCR4-associated factor 1...    123   9e-31   
ref|XP_001972481.1|  GG13860                                            124   9e-31   
ref|XP_002024844.1|  GL17886                                            124   9e-31   
emb|CBN76829.1|  conserved unknown protein                              125   9e-31   
ref|XP_010262944.1|  PREDICTED: probable CCR4-associated factor 1...    123   1e-30   
ref|XP_002008770.1|  GI13677                                            124   1e-30   
gb|ACO14594.1|  CCR4-NOT transcription complex subunit 7                124   1e-30   
gb|EMS21915.1|  CCR4-NOT transcription complex subunit 7/8              124   1e-30   
gb|KCW62735.1|  hypothetical protein EUGRSUZ_G00324                     121   1e-30   
ref|NP_588385.2|  CCR4-Not complex CAF1 family ribonuclease subun...    124   1e-30   
gb|KIO05987.1|  hypothetical protein M404DRAFT_139412                   124   1e-30   
gb|EMD40070.1|  hypothetical protein CERSUDRAFT_112283                  124   1e-30   
ref|XP_005707256.1|  CCR4-NOT transcription complex subunit 7/8         123   1e-30   
ref|XP_007870377.1|  ribonuclease CAF1                                  122   1e-30   
pdb|2P51|A  Chain A, Crystal Structure Of The S. Pombe Pop2p Dead...    124   1e-30   
ref|XP_002061857.1|  GK17222                                            123   1e-30   
gb|KIK57152.1|  hypothetical protein GYMLUDRAFT_762307                  124   1e-30   
gb|KJB35417.1|  hypothetical protein B456_006G114000                    123   1e-30   
gb|KDP27391.1|  hypothetical protein JCGZ_20215                         122   1e-30   
ref|XP_007319405.1|  hypothetical protein SERLADRAFT_449989             124   2e-30   
emb|CCM05935.1|  predicted protein                                      124   2e-30   
ref|XP_011043248.1|  PREDICTED: probable CCR4-associated factor 1...    122   2e-30   
ref|XP_011122519.1|  hypothetical protein AOL_s00079g342                124   2e-30   
gb|ACU19702.1|  unknown                                                 123   2e-30   
ref|XP_008387054.1|  PREDICTED: probable CCR4-associated factor 1...    122   2e-30   
gb|KDQ62591.1|  hypothetical protein JAAARDRAFT_171083                  123   2e-30   
ref|XP_009372560.1|  PREDICTED: probable CCR4-associated factor 1...    122   2e-30   
ref|XP_011113614.1|  hypothetical protein H072_7886                     124   2e-30   
gb|EGU13456.1|  hypothetical protein RTG_00172                          127   2e-30   
gb|KII86661.1|  hypothetical protein PLICRDRAFT_43301                   123   3e-30   
ref|XP_004689492.1|  PREDICTED: CCR4-NOT transcription complex su...    117   3e-30   
ref|XP_003521484.1|  PREDICTED: probable CCR4-associated factor 1...    122   3e-30   
ref|XP_007027917.1|  Polynucleotidyl transferase                        122   3e-30   
gb|KJA27905.1|  hypothetical protein HYPSUDRAFT_157307                  123   3e-30   
ref|NP_729775.1|  Pop2, isoform B                                       122   3e-30   
gb|AAN71585.1|  RH46192p                                                122   4e-30   
gb|EJT98783.1|  CCR4-NOT transcription complex subunit 7                122   4e-30   
gb|KIR46241.1|  CCR4-NOT transcription complex subunit 7/8              122   4e-30   
gb|KIR59674.1|  CCR4-NOT transcription complex subunit 7/8              122   4e-30   
gb|AFR94436.2|  CCR4-NOT transcription complex subunit 7/8              122   4e-30   
gb|EPS94721.1|  hypothetical protein FOMPIDRAFT_1026077                 123   4e-30   
gb|KGB78687.1|  ccr4-not transcription complex                          122   4e-30   
gb|KIR85314.1|  CCR4-NOT transcription complex subunit 7/8              122   4e-30   
ref|NP_648538.1|  Pop2, isoform A                                       122   4e-30   
gb|KDR17086.1|  CCR4-NOT transcription complex subunit 7                123   4e-30   
ref|XP_568004.1|  ccr4-not transcription complex, subunit 7             121   4e-30   
gb|KIP02893.1|  hypothetical protein PHLGIDRAFT_20367                   122   4e-30   
ref|NP_001163429.1|  Pop2, isoform D                                    122   4e-30   
ref|XP_007379942.1|  ribonuclease CAF1                                  121   5e-30   
ref|NP_001287041.1|  Pop2, isoform E                                    122   5e-30   
ref|XP_001836043.2|  hypothetical protein CC1G_05036                    122   5e-30   
gb|EPY40711.1|  CCR4-NOT transcription complex subunit 7/8              121   5e-30   
gb|KDE04055.1|  hypothetical protein MVLG_05494                         122   6e-30   
gb|EPZ33260.1|  CCR4-NOT transcription complex subunit 7                121   6e-30   
gb|KIK44361.1|  hypothetical protein CY34DRAFT_636777                   122   6e-30   
ref|XP_007162950.1|  hypothetical protein PHAVU_001G193900g             121   6e-30   
ref|XP_003193445.1|  ccr4-not transcription complex, subunit 7          121   7e-30   
gb|KHN82287.1|  CCR4-NOT transcription complex subunit 7                121   7e-30   
ref|XP_007412211.1|  hypothetical protein MELLADRAFT_72372              122   7e-30   
gb|KIL95297.1|  hypothetical protein FAVG1_00033                        124   8e-30   
gb|KDR82364.1|  hypothetical protein GALMADRAFT_237641                  122   8e-30   
gb|ERL90972.1|  hypothetical protein D910_08314                         121   8e-30   
gb|EPY32963.1|  CCR4-NOT transcription complex subunit 7/8              121   8e-30   
gb|ENN73721.1|  hypothetical protein YQE_09671                          121   9e-30   
gb|AEE62054.1|  unknown                                                 120   9e-30   
gb|EPS34728.1|  hypothetical protein PDE_09692                          122   9e-30   
gb|EPY20598.1|  CCR4-NOT transcription complex subunit 7/8              121   9e-30   
ref|XP_007304643.1|  CAF1-domain-containing protein                     121   1e-29   
ref|XP_011077819.1|  PREDICTED: probable CCR4-associated factor 1...    121   1e-29   
ref|XP_002271636.1|  PREDICTED: probable CCR4-associated factor 1...    120   1e-29   
ref|XP_002679115.1|  predicted protein                                  121   1e-29   
gb|KIW16931.1|  hypothetical protein PV08_04121                         122   1e-29   
ref|XP_010469633.1|  PREDICTED: probable CCR4-associated factor 1...    119   1e-29   
dbj|BAM20457.1|  ccr4-associated factor                                 120   1e-29   
gb|AFK45276.1|  unknown                                                 118   1e-29   
ref|XP_010129314.1|  PREDICTED: CCR4-NOT transcription complex su...    115   1e-29   
gb|KFY75926.1|  hypothetical protein V498_09839                         122   1e-29   
ref|XP_004927882.1|  PREDICTED: CCR4-NOT transcription complex su...    120   2e-29   
ref|XP_003539842.1|  PREDICTED: probable CCR4-associated factor 1...    120   2e-29   
emb|CEF86548.1|  unnamed protein product                                122   2e-29   
gb|EHJ70264.1|  hypothetical protein KGM_18080                          120   2e-29   
gb|EEH17659.2|  hypothetical protein PABG_00222                         122   2e-29   
ref|XP_010758060.1|  hypothetical protein PADG_02622                    122   2e-29   
emb|CDY33367.1|  BnaC05g12160D                                          122   2e-29   
ref|XP_010045176.1|  PREDICTED: probable CCR4-associated factor 1...    120   2e-29   
ref|XP_006379358.1|  hypothetical protein POPTR_0009s16310g             119   2e-29   
ref|XP_002793355.1|  CCR4-NOT transcription complex subunit 8           122   2e-29   
ref|XP_002838769.1|  hypothetical protein                               122   2e-29   
ref|XP_001274064.1|  CCR4-NOT core complex subunit Caf1, putative       122   2e-29   
ref|XP_007399767.1|  hypothetical protein PHACADRAFT_57542              114   2e-29   
gb|KIK26635.1|  hypothetical protein PISMIDRAFT_675520                  120   2e-29   
ref|XP_009604779.1|  PREDICTED: probable CCR4-associated factor 1...    119   2e-29   
ref|XP_007329866.1|  hypothetical protein AGABI1DRAFT_113727            120   2e-29   
ref|XP_007015724.1|  Polynucleotidyl transferase, ribonuclease H-...    119   3e-29   
ref|XP_007158752.1|  hypothetical protein PHAVU_002G179100g             119   3e-29   
ref|XP_008243475.1|  PREDICTED: probable CCR4-associated factor 1...    119   3e-29   
ref|XP_011063421.1|  PREDICTED: protein mesh-like                       125   3e-29   
ref|XP_009349767.1|  PREDICTED: probable CCR4-associated factor 1...    119   3e-29   
gb|KFY10537.1|  hypothetical protein V491_07602                         119   3e-29   
ref|XP_009157360.1|  hypothetical protein HMPREF1120_04963              121   3e-29   
gb|KFY47822.1|  hypothetical protein V495_01796                         121   3e-29   
ref|XP_975202.1|  PREDICTED: CCR4-NOT transcription complex subun...    119   3e-29   
gb|KFH44944.1|  CCR4-NOT transcription complex subunit-like protein     121   3e-29   
ref|XP_007008156.1|  hypothetical protein TREMEDRAFT_65998              119   3e-29   
ref|XP_001216724.1|  CCR4-NOT transcription complex subunit 7           121   3e-29   
ref|XP_002378506.1|  CCR4-NOT core complex subunit Caf1, putative       121   4e-29   
gb|KFY09471.1|  hypothetical protein V492_05484                         121   4e-29   
gb|EWC47793.1|  hypothetical protein DRE_02993                          121   4e-29   
ref|XP_008391953.1|  PREDICTED: probable CCR4-associated factor 1...    119   4e-29   
ref|XP_004251085.1|  PREDICTED: probable CCR4-associated factor 1...    119   4e-29   
gb|KJB21739.1|  hypothetical protein B456_004G011500                    119   4e-29   
gb|KEZ44827.1|  Ccr4-not core complex subunit                           121   4e-29   
ref|XP_001823171.2|  CCR4-NOT core complex subunit Caf1                 121   4e-29   
gb|AGG11497.1|  hypothetical protein                                    120   4e-29   
gb|KFY73241.1|  hypothetical protein V499_06659                         121   4e-29   
gb|EHA22292.1|  hypothetical protein ASPNIDRAFT_213915                  121   4e-29   
ref|XP_001242213.1|  hypothetical protein CIMG_06109                    121   5e-29   
ref|XP_005026245.1|  PREDICTED: CCR4-NOT transcription complex su...    119   5e-29   
ref|XP_007205684.1|  hypothetical protein PRUPE_ppa009650mg             119   5e-29   
dbj|GAA91925.1|  CCR4-NOT core complex subunit Caf1                     120   5e-29   
ref|XP_003048932.1|  predicted protein                                  120   5e-29   
ref|XP_007660704.1|  PREDICTED: CCR4-NOT transcription complex su...    114   5e-29   
ref|XP_007755571.1|  hypothetical protein A1O7_03360                    120   5e-29   
emb|CAN76920.1|  hypothetical protein VITISV_015622                     118   5e-29   
ref|XP_007202414.1|  hypothetical protein PRUPE_ppa009651mg             119   6e-29   
gb|KFP49034.1|  CCR4-NOT transcription complex subunit 8                115   6e-29   
gb|EPX73589.1|  CCR4-Not complex CAF1 family ribonulcease subunit...    119   6e-29   
ref|XP_007736370.1|  hypothetical protein A1O3_08081                    120   6e-29   
gb|KFY35524.1|  hypothetical protein V494_05831                         120   6e-29   
ref|XP_002161572.1|  PREDICTED: CCR4-NOT transcription complex su...    118   6e-29   
ref|XP_002433119.1|  CCR4-NOT transcription complex subunit, puta...    119   6e-29   
gb|KIV90749.1|  hypothetical protein PV10_05373                         120   6e-29   
ref|XP_004140166.1|  PREDICTED: probable CCR4-associated factor 1...    118   7e-29   
emb|CDI80060.1|  CCR4-NOT transcription complex subunit, putative       122   7e-29   
gb|AGG11686.1|  hypothetical protein                                    119   7e-29   
gb|KIW57324.1|  hypothetical protein PV05_05889                         120   8e-29   



>ref|XP_002272165.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Vitis 
vinifera]
 ref|XP_010655010.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Vitis 
vinifera]
Length=274

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLLPKSDSIQIREVW+ NLEEEF LIR +VD++PFIAMDTEFPGIVLRPVGNFKNS+DY
Sbjct  1    MSLLPKSDSIQIREVWNDNLEEEFALIRGIVDEFPFIAMDTEFPGIVLRPVGNFKNSNDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVDMLKLIQ+GLTFSDE+GNLPTCGTDKYCIWQFNFREF+
Sbjct  61   HYQTLKDNVDMLKLIQMGLTFSDEQGNLPTCGTDKYCIWQFNFREFN  107



>gb|KJB66334.1| hypothetical protein B456_010G136400 [Gossypium raimondii]
 gb|KJB66335.1| hypothetical protein B456_010G136400 [Gossypium raimondii]
 gb|KJB66336.1| hypothetical protein B456_010G136400 [Gossypium raimondii]
Length=271

 Score =   206 bits (524),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/107 (92%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLLPKSDSIQIREVW+ NLEEEF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFK+S DY
Sbjct  1    MSLLPKSDSIQIREVWNDNLEEEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKSSYDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNF EF+
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFCEFN  107



>gb|EYU24608.1| hypothetical protein MIMGU_mgv1a011718mg [Erythranthe guttata]
Length=272

 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLLPKSDSIQIR+VW  NLEEEF+LIRE+VD YP+IAMDTEFPG+VLRPVG FKNS DY
Sbjct  1    MSLLPKSDSIQIRDVWADNLEEEFELIREIVDAYPYIAMDTEFPGVVLRPVGTFKNSSDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVD+LKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREF+
Sbjct  61   HYQTLKDNVDLLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFN  107



>ref|XP_011082241.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Sesamum 
indicum]
Length=272

 Score =   205 bits (521),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLLPKSDSIQIREVW  NL+EEF LIRE+VDDYP+IAMDTEFPG+VLRPVGNFKNS D+
Sbjct  1    MSLLPKSDSIQIREVWADNLDEEFALIREIVDDYPYIAMDTEFPGVVLRPVGNFKNSSDF  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVD+LKLIQLGLTFSDEKGNLP CGTDKYCIWQFNFREF+
Sbjct  61   HYQTLKDNVDLLKLIQLGLTFSDEKGNLPDCGTDKYCIWQFNFREFN  107



>gb|KJB68026.1| hypothetical protein B456_010G222500 [Gossypium raimondii]
Length=274

 Score =   204 bits (519),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLLPKSDSI IREVWD N+EEEF LIRE+VDDYP++AMDTEFPGIVLRPVG FK+S DY
Sbjct  1    MSLLPKSDSIHIREVWDDNVEEEFALIREIVDDYPYVAMDTEFPGIVLRPVGYFKSSYDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVDMLKL+QLGLTFSDEKGNLPTCGTDKYCIWQFNFREF+
Sbjct  61   HYQTLKDNVDMLKLVQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFN  107



>ref|XP_011020623.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Populus 
euphratica]
Length=274

 Score =   204 bits (519),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLLPK DSI IREVW+ NLEEEF LIRE+VDD+P+IAMDTEFPGIVLRPVGNFKNS+DY
Sbjct  1    MSLLPKGDSIHIREVWNDNLEEEFALIREIVDDFPYIAMDTEFPGIVLRPVGNFKNSNDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVD+LKLIQLGLTFSD++GNLPTCGTDKYCIWQFNFREF+
Sbjct  61   HYQTLKDNVDVLKLIQLGLTFSDDQGNLPTCGTDKYCIWQFNFREFN  107



>ref|XP_002303842.1| hypothetical protein POPTR_0003s17950g [Populus trichocarpa]
 ref|XP_006385927.1| CCR4-NOT transcription complex family protein [Populus trichocarpa]
 gb|EEE78821.1| hypothetical protein POPTR_0003s17950g [Populus trichocarpa]
 gb|ERP63724.1| CCR4-NOT transcription complex family protein [Populus trichocarpa]
Length=274

 Score =   204 bits (519),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLLPK DSI IREVW+ NLEEEF LIRE+VDD+P+IAMDTEFPGIVLRPVGNFKNS+DY
Sbjct  1    MSLLPKGDSIHIREVWNDNLEEEFALIREIVDDFPYIAMDTEFPGIVLRPVGNFKNSNDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVD+LKLIQLGLTFSD++GNLPTCGTDKYCIWQFNFREF+
Sbjct  61   HYQTLKDNVDVLKLIQLGLTFSDDQGNLPTCGTDKYCIWQFNFREFN  107



>ref|XP_011073341.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Sesamum 
indicum]
Length=270

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLLPKSDS+QIREVW  NL+EEF LIRE+VD+YP+IAMDTEFPGIVLRPVGNFKN++DY
Sbjct  1    MSLLPKSDSVQIREVWAGNLDEEFALIREIVDEYPYIAMDTEFPGIVLRPVGNFKNANDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLK+NV++LKLIQLGLTFSDEKGNLPTCGTDK+CIWQFNFREF+
Sbjct  61   HYQTLKENVNLLKLIQLGLTFSDEKGNLPTCGTDKFCIWQFNFREFN  107



>ref|XP_006356242.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Solanum 
tuberosum]
Length=273

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLLPKSDSI IREVW+ NLEEEFDLIRE+VDDYPFIAMDTEFPG+VLRPVGNFKNS+DY
Sbjct  1    MSLLPKSDSIHIREVWNDNLEEEFDLIREIVDDYPFIAMDTEFPGVVLRPVGNFKNSNDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVD+LKLIQLGLTFSDE GNLP CGTDKYCIWQFNF +F+
Sbjct  61   HYQTLKDNVDLLKLIQLGLTFSDENGNLPKCGTDKYCIWQFNFCDFN  107



>ref|XP_004241682.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Solanum 
lycopersicum]
Length=274

 Score =   203 bits (516),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLLPKSDSI IREVW  NLEEEFDLIREVVDDYPFIAMDTEFPG+VLRPVGNFKNS+DY
Sbjct  1    MSLLPKSDSIHIREVWSDNLEEEFDLIREVVDDYPFIAMDTEFPGVVLRPVGNFKNSNDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVD+LKLIQLGLTFSDE GNLP CGTDKYCIWQFNF +F+
Sbjct  61   HYQTLKDNVDLLKLIQLGLTFSDEDGNLPKCGTDKYCIWQFNFCDFN  107



>ref|XP_010275748.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nelumbo 
nucifera]
Length=274

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPKSDSI IREVW+ NLEEEF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFK S DY
Sbjct  1    MSILPKSDSIHIREVWNDNLEEEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKTSSDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLK NVD+LKLIQLGLTFSDE GNLPTCGTDKYC+WQFNFREF+
Sbjct  61   HYQTLKANVDLLKLIQLGLTFSDEAGNLPTCGTDKYCVWQFNFREFN  107



>ref|XP_007023407.1| CCR4-associated factor 1 [Theobroma cacao]
 gb|EOY26029.1| CCR4-associated factor 1 [Theobroma cacao]
Length=356

 Score =   205 bits (521),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLLPK DSIQIREVW+ NLEEEF LIRE+VDDYP++AMDTEFPG+VLRP+GNFKNS DY
Sbjct  1    MSLLPKGDSIQIREVWNDNLEEEFALIREIVDDYPYVAMDTEFPGVVLRPLGNFKNSYDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVDMLKLIQLGLTFSDE+GNLPTC TDKYCIWQFNFREF+
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEEGNLPTCATDKYCIWQFNFREFN  107



>ref|XP_002527306.1| ccr4-associated factor, putative [Ricinus communis]
 gb|EEF35058.1| ccr4-associated factor, putative [Ricinus communis]
Length=274

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLL K DSIQIREVW+ NLEEEF LIRE+VD+Y +IAMDTEFPGIVLRPVGNFKNS++Y
Sbjct  1    MSLLLKGDSIQIREVWNDNLEEEFSLIREIVDEYSYIAMDTEFPGIVLRPVGNFKNSNEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVDMLKLIQLGLTFSDE+GNLPTCGTDKYCIWQFNFREF+
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEQGNLPTCGTDKYCIWQFNFREFN  107



>ref|XP_007023408.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007023409.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY26030.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY26031.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
Length=274

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLLPKSDSIQIREVW+ NLEEEF LIRE+VDDYPF+AMDTEFPGIVLRPVGNFKNS D+
Sbjct  1    MSLLPKSDSIQIREVWNDNLEEEFALIREIVDDYPFVAMDTEFPGIVLRPVGNFKNSYDF  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVDMLKLIQLGLT SD++GNLPTCGTDKYCIWQFNF EF+
Sbjct  61   HYQTLKDNVDMLKLIQLGLTLSDDQGNLPTCGTDKYCIWQFNFCEFN  107



>gb|KDP41983.1| hypothetical protein JCGZ_27001 [Jatropha curcas]
Length=274

 Score =   201 bits (512),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLL K DSIQIREVW+ NLEEEF LIRE+VDD+P+IAMDTEFPGIVLRPVGNFKNS+DY
Sbjct  1    MSLLLKGDSIQIREVWNDNLEEEFALIREIVDDFPYIAMDTEFPGIVLRPVGNFKNSNDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVDMLK+IQLGLTFSDE+GNLPTCGT K+CIWQFNFREF+
Sbjct  61   HYQTLKDNVDMLKMIQLGLTFSDEQGNLPTCGTGKFCIWQFNFREFN  107



>ref|XP_007215794.1| hypothetical protein PRUPE_ppa009874mg [Prunus persica]
 gb|EMJ16993.1| hypothetical protein PRUPE_ppa009874mg [Prunus persica]
Length=274

 Score =   201 bits (511),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            M LLPK DSIQIREVW+ N EEEF LIR++VDDYP++AMDTEFPGIVLRPVGNFKNS DY
Sbjct  1    MKLLPKPDSIQIREVWNDNFEEEFALIRKIVDDYPYVAMDTEFPGIVLRPVGNFKNSYDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVDMLKLIQLGLTFSDE+GNLPTCGTDK+CIWQFNFREF+
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEQGNLPTCGTDKHCIWQFNFREFN  107



>gb|KHG18085.1| putative CCR4-associated factor 1 -like protein [Gossypium arboreum]
Length=300

 Score =   202 bits (513),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLLPKSDSI IREVWD N+EEEF LIR++VDDYP++AMDTEFPGIVLRPVG FK+S DY
Sbjct  27   MSLLPKSDSIHIREVWDDNVEEEFALIRDIVDDYPYVAMDTEFPGIVLRPVGYFKSSYDY  86

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVDMLKL+QLGLTFSDEKGNLPTCGTDKYCIWQFNFREF+
Sbjct  87   HYQTLKDNVDMLKLVQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFN  133



>ref|XP_006368924.1| hypothetical protein POPTR_0001s14860g [Populus trichocarpa]
 gb|ERP65493.1| hypothetical protein POPTR_0001s14860g [Populus trichocarpa]
Length=242

 Score =   200 bits (508),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLL K DSI IREVW+ NLEEEF  IRE+VDD+P+IAMDTEFPGIVLRPVGNFKNS+DY
Sbjct  1    MSLLLKGDSILIREVWNDNLEEEFAHIREIVDDFPYIAMDTEFPGIVLRPVGNFKNSNDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVDMLKLIQLGLTFSDE+GNLPTCGTDKYCIWQFNFREF+
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEQGNLPTCGTDKYCIWQFNFREFN  107



>ref|XP_006341359.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Solanum 
tuberosum]
Length=274

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPK+DSI IREVW  NLEEEF L+RE+VDD+PF+AMDTEFPG+V+RPVGNFKNS+DY
Sbjct  1    MSILPKTDSIHIREVWFDNLEEEFALMREIVDDFPFVAMDTEFPGVVIRPVGNFKNSNDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVDMLKLIQLGLTFSDE GNLP CGTDKYCIWQFNFREF+
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDENGNLPKCGTDKYCIWQFNFREFN  107



>ref|XP_004235935.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Solanum 
lycopersicum]
Length=274

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPK+DSI IREVW  NLEEEF L+RE+VDD+PF+AMDTEFPG+V+RPVGNFKNS+DY
Sbjct  1    MSILPKTDSIHIREVWFDNLEEEFALMREIVDDFPFVAMDTEFPGVVIRPVGNFKNSNDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVDMLKLIQLGLTFSDE GNLP CGTDKYCIWQFNFREF+
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDENGNLPKCGTDKYCIWQFNFREFN  107



>ref|XP_011034532.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Populus 
euphratica]
Length=274

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLL K DSI IREVW+ NLEEEF  IRE+VDD+P+IAMDTEFPGIVLRPVGNFKNS+DY
Sbjct  1    MSLLLKGDSILIREVWNDNLEEEFAHIREIVDDFPYIAMDTEFPGIVLRPVGNFKNSNDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVDMLKLIQLGLTFSDE+GNLPTCGTDKYCIWQFNFREF+
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEQGNLPTCGTDKYCIWQFNFREFN  107



>ref|XP_009605547.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Nicotiana 
tomentosiformis]
Length=275

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPK+DSI IREVW  NLEEEF LIREVVD++P+IAMDTEFPG+V+RPVGNFKNS DY
Sbjct  1    MSILPKTDSIHIREVWIDNLEEEFALIREVVDEFPYIAMDTEFPGVVIRPVGNFKNSYDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVDMLKLIQLGLTFSDEKGNLP CGTDKYCIWQFNFREF+
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEKGNLPKCGTDKYCIWQFNFREFN  107



>ref|XP_007023405.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 3, partial [Theobroma cacao]
 gb|EOY26027.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 3, partial [Theobroma cacao]
Length=194

 Score =   197 bits (501),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLLPKSDSIQIREVW+ NLEEEF LIRE+VDDYP++AMDTEFPG+VLRP+GNFK   DY
Sbjct  1    MSLLPKSDSIQIREVWNDNLEEEFALIREIVDDYPYVAMDTEFPGVVLRPLGNFKYICDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLKDNVDMLKLIQLGLTFSDE+GNLPTCGTDKYCIWQFNFREF+
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDEEGNLPTCGTDKYCIWQFNFREFN  107



>ref|XP_009760590.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nicotiana 
sylvestris]
Length=275

 Score =   199 bits (507),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLLPKSDSI IREVW  NLE+EFDLIRE+VD+YP+IAMDTEFPG+VLRPVGNFKNS+DY
Sbjct  1    MSLLPKSDSIHIREVWSDNLEQEFDLIREIVDEYPYIAMDTEFPGVVLRPVGNFKNSNDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVD+LKLIQLGLTFSDE GNLP CGTDKYCIWQFNF +F+
Sbjct  61   HYQTLKDNVDLLKLIQLGLTFSDENGNLPKCGTDKYCIWQFNFCDFN  107



>ref|XP_010265638.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nelumbo 
nucifera]
 ref|XP_010265639.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nelumbo 
nucifera]
Length=274

 Score =   199 bits (506),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+L K DSI IREVW+ NLEEEF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFK S DY
Sbjct  1    MSILSKGDSIHIREVWNDNLEEEFVLIREIVDDYPYIAMDTEFPGIVLRPVGNFKTSSDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLK NVDMLKLIQLGLTFSDE GNLPTCGTDKYC+WQFNFREF+
Sbjct  61   HYQTLKANVDMLKLIQLGLTFSDEAGNLPTCGTDKYCVWQFNFREFN  107



>ref|XP_007023403.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY26025.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
Length=274

 Score =   199 bits (506),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLLPKSDSIQIREVW+ NLEEEF LIRE+VDDYP++AMDTEFPG+VLRP+GNFK   DY
Sbjct  1    MSLLPKSDSIQIREVWNDNLEEEFALIREIVDDYPYVAMDTEFPGVVLRPLGNFKYICDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLKDNVDMLKLIQLGLTFSDE+GNLPTCGTDKYCIWQFNFREF+
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDEEGNLPTCGTDKYCIWQFNFREFN  107



>ref|XP_008228784.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Prunus 
mume]
 ref|XP_008228785.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Prunus 
mume]
 ref|XP_008228786.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Prunus 
mume]
Length=274

 Score =   199 bits (506),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            M LLPK DSIQIREVW+ N EEEF LIR+++DDYP++AMDTEFPGIVLRPVGNFKN+ DY
Sbjct  1    MKLLPKPDSIQIREVWNDNFEEEFALIRKIIDDYPYVAMDTEFPGIVLRPVGNFKNNYDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVDMLKLIQLGLTFSDE+GNLPTCGTDK+CIWQFNFREF+
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEQGNLPTCGTDKHCIWQFNFREFN  107



>ref|XP_006427595.1| hypothetical protein CICLE_v10026260mg [Citrus clementina]
 ref|XP_006427596.1| hypothetical protein CICLE_v10026260mg [Citrus clementina]
 gb|ESR40835.1| hypothetical protein CICLE_v10026260mg [Citrus clementina]
 gb|ESR40836.1| hypothetical protein CICLE_v10026260mg [Citrus clementina]
Length=274

 Score =   198 bits (504),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLLPK DSIQIREVW  NLE EFDLIR++VDDYP++AMDTEFPGI LRPVG+FK+S +Y
Sbjct  1    MSLLPKGDSIQIREVWSDNLELEFDLIRKIVDDYPYVAMDTEFPGIALRPVGSFKSSYEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLK NVDMLKLIQLGLTFSDE GNLPTCGTDKYC+WQFNFREFD
Sbjct  61   HYQTLKSNVDMLKLIQLGLTFSDENGNLPTCGTDKYCVWQFNFREFD  107



>gb|KDO42998.1| hypothetical protein CISIN_1g023991mg [Citrus sinensis]
Length=274

 Score =   198 bits (504),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLLPK DSIQIREVW  NLE EFDLIR++VDDYP++AMDTEFPGI LRPVG+FK+S +Y
Sbjct  1    MSLLPKGDSIQIREVWSDNLELEFDLIRKIVDDYPYVAMDTEFPGIALRPVGSFKSSYEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLK NVDMLKLIQLGLTFSDE GNLPTCGTDKYC+WQFNFREFD
Sbjct  61   HYQTLKSNVDMLKLIQLGLTFSDENGNLPTCGTDKYCVWQFNFREFD  107



>ref|XP_006465196.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Citrus 
sinensis]
Length=274

 Score =   198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLLPK DSIQIREVW  NLE EFDLIR++VDDYP++AMDTEFPGI LRPVG+FK+S +Y
Sbjct  1    MSLLPKGDSIQIREVWSDNLELEFDLIRKIVDDYPYVAMDTEFPGIALRPVGSFKSSYEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLK NVDMLKLIQLGLTFSDE GNLPTCGTDKYC+WQFNFREFD
Sbjct  61   HYQTLKSNVDMLKLIQLGLTFSDENGNLPTCGTDKYCVWQFNFREFD  107



>ref|XP_009801027.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nicotiana 
sylvestris]
 ref|XP_009801028.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nicotiana 
sylvestris]
Length=274

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPKSDSIQIREVW  NLEEEF LIRE+VD YP+IAMDTEFPG+VLRPVGNFK+ ++Y
Sbjct  1    MSVLPKSDSIQIREVWSNNLEEEFALIREIVDAYPYIAMDTEFPGVVLRPVGNFKHINEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCG+++YCIWQFNFREFD
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGSERYCIWQFNFREFD  107



>ref|XP_009793121.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Nicotiana 
sylvestris]
Length=275

 Score =   197 bits (501),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPK++SI IREVW  NLEEEF LIREVVD++P+IAMDTEFPG+V+RPVGNFKNS DY
Sbjct  1    MSILPKTESILIREVWIDNLEEEFALIREVVDEFPYIAMDTEFPGVVIRPVGNFKNSYDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVDMLKLIQLGLTFSDEKGNLP CGTDKYCIWQFNFREF+
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEKGNLPKCGTDKYCIWQFNFREFN  107



>gb|EPS59819.1| hypothetical protein M569_14984, partial [Genlisea aurea]
Length=275

 Score =   197 bits (501),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS  P SDSIQIREVWD NLEEE  LIRE+VD YP+IAMDTEFPG+V+RPVGNFKN+DDY
Sbjct  1    MSNFPDSDSIQIREVWDANLEEEMALIREIVDQYPYIAMDTEFPGVVIRPVGNFKNTDDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLKDNVD+LKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+
Sbjct  61   NYQTLKDNVDLLKLIQLGLTFSDEHGNLPTCGTDKHCIWQFNFREFN  107



>gb|KJB07590.1| hypothetical protein B456_001G031500 [Gossypium raimondii]
Length=274

 Score =   197 bits (501),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPKS+SI IREVWD NL  EF+LIRE+VDDYPFIAMDTEFPGIVLRP+GNFK+S DY
Sbjct  1    MSILPKSESIHIREVWDENLNCEFELIREIVDDYPFIAMDTEFPGIVLRPIGNFKSSFDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLK NVD+LKLIQLGLTFSD KGNLPTCGTDKYC+WQFNFREFD
Sbjct  61   NYQTLKANVDLLKLIQLGLTFSDAKGNLPTCGTDKYCVWQFNFREFD  107



>ref|XP_011082251.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Sesamum 
indicum]
Length=276

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLL K DSIQIREVW  NL+EEF LI+E+VDDYP+IAMDTEFPG+VLRPVGNFKNS DY
Sbjct  1    MSLLAKGDSIQIREVWADNLDEEFALIKEIVDDYPYIAMDTEFPGVVLRPVGNFKNSSDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVD+LKLIQLGLTFSDEKGNLPTCGT+K CIWQFNF EF+
Sbjct  61   HYQTLKDNVDLLKLIQLGLTFSDEKGNLPTCGTNKQCIWQFNFCEFN  107



>gb|EPS71126.1| hypothetical protein M569_03633, partial [Genlisea aurea]
Length=268

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLLPK+DSIQIREVW  NLE+EFDLIR +VD+YP+IAMDTEFPG+VLRP+GNFKNS DY
Sbjct  1    MSLLPKTDSIQIREVWADNLEQEFDLIRGIVDEYPYIAMDTEFPGVVLRPIGNFKNSSDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVD+LKLIQLGLT SDEKGNLP+ GTDK CIWQFNFREF+
Sbjct  61   HYQTLKDNVDLLKLIQLGLTLSDEKGNLPSFGTDKRCIWQFNFREFN  107



>gb|KHG00404.1| putative CCR4-associated factor 1 -like protein [Gossypium arboreum]
Length=274

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPKS+SI IREVWD NL  EF+LIR++VDDYPFIAMDTEFPGIVLRP+GNFK+S DY
Sbjct  1    MSILPKSESIHIREVWDENLNCEFELIRDIVDDYPFIAMDTEFPGIVLRPIGNFKSSFDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLK NVD+LKLIQLGLTFSD KGNLPTCGTDKYC+WQFNFREFD
Sbjct  61   NYQTLKANVDLLKLIQLGLTFSDAKGNLPTCGTDKYCVWQFNFREFD  107



>ref|XP_009594641.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nicotiana 
tomentosiformis]
Length=275

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLLPKSDSI IREVW  NLE+EFDLIRE+VD+YP+IAMDTEFPG+VLRPVGNFKNS+DY
Sbjct  1    MSLLPKSDSIHIREVWSDNLEQEFDLIREIVDEYPYIAMDTEFPGVVLRPVGNFKNSNDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVD+LKLIQLGLTFSDE GNLP CGTDKY IWQFNF +F+
Sbjct  61   HYQTLKDNVDLLKLIQLGLTFSDENGNLPKCGTDKYYIWQFNFCDFN  107



>ref|XP_009354185.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Pyrus 
x bretschneideri]
Length=274

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            M LLPK DSI IREVW+ NLEEEF LIR++VDDYP++AMDTEFPGIV+RPVGNFKNS DY
Sbjct  1    MPLLPKIDSIHIREVWNDNLEEEFALIRKIVDDYPYVAMDTEFPGIVIRPVGNFKNSYDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVDMLKLIQLGLTFSDE+GN P+CGTDK CIWQFNFREF+
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEQGNFPSCGTDKQCIWQFNFREFN  107



>ref|XP_009620266.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nicotiana 
tomentosiformis]
Length=274

 Score =   194 bits (492),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS LPKSDSIQIREVW  NLEEEF LIRE+VD YP+IAMDTEFPG+VLRPVGNFK+ ++Y
Sbjct  1    MSALPKSDSIQIREVWSDNLEEEFALIREIVDAYPYIAMDTEFPGVVLRPVGNFKHINEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLKDNVDMLKLIQLGLTFSDE GNLP CG+++YCIWQFNFREFD
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPICGSERYCIWQFNFREFD  107



>ref|XP_008375521.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
 ref|XP_008375525.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=274

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            M LLPK DSI IREVW+ NLEEEF LIR++VDDYP++AMDTEFPGIV+RPVGNFKN  DY
Sbjct  1    MPLLPKIDSIHIREVWNDNLEEEFALIRKIVDDYPYVAMDTEFPGIVIRPVGNFKNGYDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLKDNVDMLKLIQLGLTFSDE+GN P+CGTDK CIWQFNFREF+
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEQGNFPSCGTDKQCIWQFNFREFN  107



>ref|XP_004305482.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Fragaria 
vesca subsp. vesca]
Length=274

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            M LLPK+DSIQIREVW+ NL+EEF+LIR++VDDYP++AMDTEFPGIV RPVGNF+NS DY
Sbjct  1    MPLLPKNDSIQIREVWNDNLDEEFELIRKIVDDYPYVAMDTEFPGIVCRPVGNFRNSYDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTL+DNVD+LKLIQLGLTFSDE+GNLPTCGTD+ CIWQFNFREF+
Sbjct  61   HYQTLRDNVDVLKLIQLGLTFSDEEGNLPTCGTDQQCIWQFNFREFN  107



>emb|CDO98220.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 101/108 (94%), Gaps = 1/108 (1%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLLPKS+S+QIREVW+ NLEEEF LIRE+VDDYP++AMDTEFPG+VLRPVGNFK++ D+
Sbjct  1    MSLLPKSESVQIREVWNDNLEEEFALIREIVDDYPYVAMDTEFPGVVLRPVGNFKSNTDF  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFD  510
            HYQTLKDNVD+LKLIQLGLTFSDEKGNLP CG D KYC WQFNFREF+
Sbjct  61   HYQTLKDNVDLLKLIQLGLTFSDEKGNLPKCGVDNKYCTWQFNFREFN  108



>ref|XP_010048831.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Eucalyptus 
grandis]
 gb|KCW81224.1| hypothetical protein EUGRSUZ_C02596 [Eucalyptus grandis]
Length=274

 Score =   192 bits (488),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+L KSDS++IREVW+YNLE+EF  IRE+VDDYP+IAMDTEFPG+VLRPVGNFK+S +Y
Sbjct  1    MSVLSKSDSVEIREVWEYNLEDEFSFIREIVDDYPYIAMDTEFPGMVLRPVGNFKSSSEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLK NVD+LKLIQLGLTF+DEKGNLPTCGTDKY +WQFNFREF+
Sbjct  61   NYQTLKANVDLLKLIQLGLTFADEKGNLPTCGTDKYYVWQFNFREFN  107



>ref|XP_003526204.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Glycine 
max]
Length=273

 Score =   191 bits (486),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPK DS+QIREVW+ NLEEEF LIRE+VD+Y ++AMDTEFPG+VLRPVGNFKN +DY
Sbjct  1    MSILPKGDSVQIREVWNDNLEEEFALIREIVDEYNYVAMDTEFPGVVLRPVGNFKNINDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGT+  CIWQFNFREF+
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTESTCIWQFNFREFN  107



>ref|XP_002515442.1| ccr4-associated factor, putative [Ricinus communis]
 gb|EEF46891.1| ccr4-associated factor, putative [Ricinus communis]
Length=274

 Score =   191 bits (486),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS++PK DSI IREVW+ NLEEEF LIRE+VD + ++AMDTEFPG+VLRPVGNFKN +DY
Sbjct  1    MSIIPKGDSIHIREVWNDNLEEEFTLIREIVDQFNYVAMDTEFPGVVLRPVGNFKNINDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFN  107



>ref|XP_010063560.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Eucalyptus 
grandis]
 ref|XP_010063561.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Eucalyptus 
grandis]
 ref|XP_010063562.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Eucalyptus 
grandis]
 ref|XP_010063564.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Eucalyptus 
grandis]
 gb|KCW70795.1| hypothetical protein EUGRSUZ_F03953 [Eucalyptus grandis]
Length=281

 Score =   191 bits (486),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSL  KS+SIQIR+VWD NL+EEF  IRE+VDDYP++AMDTEFPGIV+RPVGNFKNS ++
Sbjct  1    MSLSAKSESIQIRDVWDDNLDEEFARIREIVDDYPYVAMDTEFPGIVVRPVGNFKNSSEF  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLK+NVDMLKLIQLGLTFSDE+GNLPTCG+DK CIWQFNFREF+
Sbjct  61   HYQTLKENVDMLKLIQLGLTFSDERGNLPTCGSDKCCIWQFNFREFN  107



>gb|KHN07034.1| Putative CCR4-associated factor 1 like 7 [Glycine soja]
Length=274

 Score =   191 bits (486),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPK DS+QIREVW+ NLEEEF LIRE+VD+Y ++AMDTEFPG+VLRPVGNFKN +DY
Sbjct  1    MSILPKGDSVQIREVWNDNLEEEFALIREIVDEYNYVAMDTEFPGVVLRPVGNFKNINDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGT+  CIWQFNFREF+
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTESTCIWQFNFREFN  107



>gb|KHN29617.1| Putative CCR4-associated factor 1 like 7 [Glycine soja]
Length=265

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPK DS+QIREVW+ NLEEEF LIRE+VD+Y ++AMDTEFPG+VLRPVGNFKN +DY
Sbjct  1    MSILPKGDSVQIREVWNDNLEEEFALIREIVDEYNYVAMDTEFPGVVLRPVGNFKNINDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGT+  CIWQFNFREF+
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTESPCIWQFNFREFN  107



>ref|XP_003522433.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Glycine 
max]
Length=273

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPK DS+QIREVW+ NLEEEF LIRE+VD+Y ++AMDTEFPG+VLRPVGNFKN +DY
Sbjct  1    MSILPKGDSVQIREVWNDNLEEEFALIREIVDEYNYVAMDTEFPGVVLRPVGNFKNINDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGT+  CIWQFNFREF+
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTESPCIWQFNFREFN  107



>ref|XP_010532089.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010532090.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 isoform 
X1 [Tarenaya hassleriana]
Length=274

 Score =   189 bits (481),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSL  K DSIQIREVW+ NLEEEF LIR +V+D+P++AMDTEFPGIV RPVG FK S+DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLEEEFALIRRIVEDFPYVAMDTEFPGIVCRPVGTFKTSNDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +Y+TLK NVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD
Sbjct  61   NYETLKTNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  107



>ref|XP_010532091.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 isoform 
X2 [Tarenaya hassleriana]
Length=275

 Score =   189 bits (481),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSL  K DSIQIREVW+ NLEEEF LIR +V+D+P++AMDTEFPGIV RPVG FK S+DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLEEEFALIRRIVEDFPYVAMDTEFPGIVCRPVGTFKTSNDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +Y+TLK NVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD
Sbjct  61   NYETLKTNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  107



>gb|EYU21723.1| hypothetical protein MIMGU_mgv1a019889mg [Erythranthe guttata]
Length=272

 Score =   189 bits (480),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 102/110 (93%), Gaps = 3/110 (3%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSL+PKS+S+QIREVW +NL+EEFDLIRE+VD+YP+IAMDTEFPGIVLRPVG F++++DY
Sbjct  1    MSLMPKSESVQIREVWAHNLDEEFDLIREIVDEYPYIAMDTEFPGIVLRPVGTFRSANDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTC---GTDKYCIWQFNFREFD  510
            HYQTLKDNV++LKLIQLGLTFSDE GNLP C   G +++CIWQFNFREFD
Sbjct  61   HYQTLKDNVNLLKLIQLGLTFSDENGNLPECSGAGKNRHCIWQFNFREFD  110



>ref|XP_006857184.1| hypothetical protein AMTR_s00065p00182000 [Amborella trichopoda]
 gb|ERN18651.1| hypothetical protein AMTR_s00065p00182000 [Amborella trichopoda]
Length=274

 Score =   189 bits (480),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPK+++I IREVW  NLE+EF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFKNS D+
Sbjct  1    MSILPKNETILIREVWGDNLEDEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKNSSDF  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HY+TLK NVDMLKLIQLGLTFSDE GNLPTCGTDK+ IWQFNFREF+
Sbjct  61   HYKTLKANVDMLKLIQLGLTFSDEDGNLPTCGTDKFYIWQFNFREFN  107



>gb|KDP33530.1| hypothetical protein JCGZ_07101 [Jatropha curcas]
Length=275

 Score =   188 bits (478),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 101/108 (94%), Gaps = 1/108 (1%)
 Frame = +1

Query  190  MSLLPKSD-SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  366
            MS++PK+D SIQIREVW+ NLEEEF LIRE+VD + ++AMDTEFPG+VLRPVGNFKN +D
Sbjct  1    MSIIPKNDDSIQIREVWNDNLEEEFALIREIVDQFNYVAMDTEFPGVVLRPVGNFKNIND  60

Query  367  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            Y+YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+
Sbjct  61   YNYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFN  108



>ref|XP_010532085.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Tarenaya 
hassleriana]
Length=274

 Score =   188 bits (478),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSL  K DSIQIREVW+ NLEEEF LIR++V+D+P++AMDTEFPGIV +PVG FK S+DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLEEEFALIRKIVEDFPYVAMDTEFPGIVCKPVGTFKTSNDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +Y+TLK NVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD
Sbjct  61   NYKTLKTNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  107



>ref|XP_006356929.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Solanum 
tuberosum]
Length=274

 Score =   188 bits (478),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPK+DSIQIREVW  NLEEEF LIR++VDDYP+IAMDTEFPG+VLRPVGNFK+ ++Y
Sbjct  1    MSVLPKTDSIQIREVWSDNLEEEFALIRQIVDDYPYIAMDTEFPGVVLRPVGNFKHINEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLKDNVDML LIQLGLTFSDE GNLPTCG++ Y IWQFNFREFD
Sbjct  61   NYQTLKDNVDMLNLIQLGLTFSDENGNLPTCGSEYYYIWQFNFREFD  107



>ref|XP_008336906.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=295

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = +1

Query  187  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  366
            KMS  PKSDSI IREVW  NLEEEF LIR VV++Y ++AMDTEFPGIVLRPVG FK+S D
Sbjct  21   KMSXFPKSDSIHIREVWSDNLEEEFKLIRSVVEEYQYVAMDTEFPGIVLRPVGTFKDSYD  80

Query  367  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            YHYQTLK NVD+LKLIQLGLTFSDEKGNLPTCGTDK+C+WQFNFR+F+
Sbjct  81   YHYQTLKANVDLLKLIQLGLTFSDEKGNLPTCGTDKHCVWQFNFRDFN  128



>ref|XP_010665982.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Beta 
vulgaris subsp. vulgaris]
Length=272

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = +1

Query  187  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  366
             + L    DSI IREVW++NLEEEF  IRE+VDDYP++AMD+EFPG+V+RPVGNFKN  D
Sbjct  2    SLGLTKSDDSIHIREVWNHNLEEEFGYIREIVDDYPYVAMDSEFPGVVIRPVGNFKNITD  61

Query  367  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            Y+Y+TLK+NVDMLKLIQLGLTFSDEKGNLPTCGTDK+CIWQFNFREFD
Sbjct  62   YNYKTLKENVDMLKLIQLGLTFSDEKGNLPTCGTDKFCIWQFNFREFD  109



>ref|XP_003530297.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
1 [Glycine max]
 ref|XP_003530298.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
2 [Glycine max]
 gb|KHN04172.1| Putative CCR4-associated factor 1 like 7 [Glycine soja]
Length=277

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 97/107 (91%), Gaps = 2/107 (2%)
 Frame = +1

Query  196  LLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHY  375
            +L KSDSIQIREVW+ NLEEEF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFKNS DYHY
Sbjct  4    VLAKSDSIQIREVWNDNLEEEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKNSYDYHY  63

Query  376  QTLKDNVDMLKLIQLGLTFSDEKGNLPTCG--TDKYCIWQFNFREFD  510
            QTLKDNVDMLKLIQLGLTFSDE GNLPTCG  +   CIWQFNFREF+
Sbjct  64   QTLKDNVDMLKLIQLGLTFSDEHGNLPTCGDESGTCCIWQFNFREFN  110



>gb|ACU24625.1| unknown [Glycine max]
Length=277

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 97/107 (91%), Gaps = 2/107 (2%)
 Frame = +1

Query  196  LLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHY  375
            +L KSDSIQIREVW+ NLEEEF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFKNS DYHY
Sbjct  4    VLAKSDSIQIREVWNDNLEEEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKNSYDYHY  63

Query  376  QTLKDNVDMLKLIQLGLTFSDEKGNLPTCG--TDKYCIWQFNFREFD  510
            QTLKDNVDMLKLIQLGLTFSDE GNLPTCG  +   CIWQFNFREF+
Sbjct  64   QTLKDNVDMLKLIQLGLTFSDEHGNLPTCGDESGTCCIWQFNFREFN  110



>ref|XP_010089956.1| putative CCR4-associated factor 1-7-like protein [Morus notabilis]
 gb|EXB38652.1| putative CCR4-associated factor 1-7-like protein [Morus notabilis]
Length=276

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 99/109 (91%), Gaps = 2/109 (2%)
 Frame = +1

Query  190  MSLLPKSD--SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSD  363
            MS+L K D  SIQIREVW+ NLEEEF LIRE+VD Y ++AMDTEFPG+VLRPVGNFKN +
Sbjct  1    MSILTKGDGDSIQIREVWNDNLEEEFALIREIVDKYNYVAMDTEFPGVVLRPVGNFKNIN  60

Query  364  DYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            DY+YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+
Sbjct  61   DYNYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFN  109



>ref|XP_009358471.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Pyrus 
x bretschneideri]
Length=295

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = +1

Query  187  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  366
            KMS  PKSDSI IREVW  NLEEEF LIR VV++Y ++AMDTEFPGIVLRPVG FK+S D
Sbjct  21   KMSTFPKSDSIHIREVWSDNLEEEFKLIRNVVEEYRYVAMDTEFPGIVLRPVGTFKDSYD  80

Query  367  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            YHYQTLK NVD+LKLIQLGLTFSDEKGNLPTCGTDK+C+WQFNFR+F+
Sbjct  81   YHYQTLKANVDLLKLIQLGLTFSDEKGNLPTCGTDKHCVWQFNFRDFN  128



>ref|XP_010648684.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Vitis 
vinifera]
 ref|XP_010648686.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Vitis 
vinifera]
Length=273

 Score =   187 bits (474),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+ PK++S+ IREVW+ NLE EF LIRE+VD YP+IAMDTEFPG+VLRP+G FKN +DY
Sbjct  1    MSISPKTESVLIREVWNENLESEFALIREIVDKYPYIAMDTEFPGVVLRPMGTFKNINDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLKDNVDMLKLIQLGLTFSD  GNLPTCGTDK CIWQFNFREFD
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDANGNLPTCGTDKLCIWQFNFREFD  107



>ref|XP_002309667.1| hypothetical protein POPTR_0006s27840g [Populus trichocarpa]
 gb|EEE93190.1| hypothetical protein POPTR_0006s27840g [Populus trichocarpa]
Length=277

 Score =   187 bits (474),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +1

Query  202  PKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQT  381
            PK +SIQIREVW+ NLEEEF LIRE+VD + F+AMDTEFPG+VLRPVGNFKN +DY+YQT
Sbjct  8    PKEESIQIREVWNDNLEEEFALIREIVDQFNFVAMDTEFPGVVLRPVGNFKNINDYNYQT  67

Query  382  LKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            LKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+
Sbjct  68   LKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFN  110



>ref|XP_007202386.1| hypothetical protein PRUPE_ppa009376mg [Prunus persica]
 gb|EMJ03585.1| hypothetical protein PRUPE_ppa009376mg [Prunus persica]
Length=295

 Score =   187 bits (474),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +1

Query  187  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  366
            KMSLL KSDSI IREVW+ NLE+EF+LIR++VDDYP+IAMDTEFPGIVLRP+G FKNS D
Sbjct  21   KMSLLTKSDSIHIREVWNDNLEKEFELIRKIVDDYPYIAMDTEFPGIVLRPIGTFKNSFD  80

Query  367  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            Y+YQTLK NVD+LKLIQLGLTF+DE GNLPTC TDK+C+WQFNFR+F+
Sbjct  81   YNYQTLKANVDLLKLIQLGLTFTDENGNLPTCETDKHCVWQFNFRDFN  128



>ref|XP_006483458.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Citrus 
sinensis]
 gb|KDO67487.1| hypothetical protein CISIN_1g023967mg [Citrus sinensis]
Length=274

 Score =   186 bits (472),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 98/108 (91%), Gaps = 1/108 (1%)
 Frame = +1

Query  190  MSLLPKS-DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  366
            MS+LPK  D IQIREVW+ NLEEEF LIRE+VD Y +IAMDTEFPG+VLRPVG FKN +D
Sbjct  1    MSVLPKGGDEIQIREVWNDNLEEEFALIREIVDKYNYIAMDTEFPGVVLRPVGAFKNIND  60

Query  367  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            Y+YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+
Sbjct  61   YNYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFN  108



>gb|KHG16599.1| putative CCR4-associated factor 1 -like protein [Gossypium arboreum]
Length=270

 Score =   186 bits (472),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS LPK +S+ IREVW+ NLEEEF LIRE+VD Y ++AMDTEFPG+VLRPVG FKN +DY
Sbjct  1    MSGLPKGESVHIREVWNDNLEEEFALIREIVDSYNYVAMDTEFPGVVLRPVGTFKNINDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTD +CIWQFNFREF+
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTDSFCIWQFNFREFN  107



>ref|XP_007136961.1| hypothetical protein PHAVU_009G088600g [Phaseolus vulgaris]
 ref|XP_007136962.1| hypothetical protein PHAVU_009G088600g [Phaseolus vulgaris]
 gb|ESW08955.1| hypothetical protein PHAVU_009G088600g [Phaseolus vulgaris]
 gb|ESW08956.1| hypothetical protein PHAVU_009G088600g [Phaseolus vulgaris]
Length=273

 Score =   186 bits (472),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS++PK DS+QIREVW+ NL+EEF LIRE+VD+Y ++AMDTEFPG+VLRPVGNFKN +DY
Sbjct  1    MSIIPKGDSVQIREVWNDNLDEEFALIREIVDEYNYVAMDTEFPGVVLRPVGNFKNINDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCG++  CIWQFNFREF+
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGSESPCIWQFNFREFN  107



>gb|AFK45143.1| unknown [Lotus japonicus]
Length=272

 Score =   186 bits (472),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+L K DS+QIREVW+ NLEEEF LIRE+VDD+ ++AMDTEFPG+VLRP+GNFKN +DY
Sbjct  1    MSILQKGDSVQIREVWNDNLEEEFALIREIVDDFSYVAMDTEFPGVVLRPLGNFKNINDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGT+  CIWQFNFREF+
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTETPCIWQFNFREFN  107



>ref|XP_008242960.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 isoform 
X2 [Prunus mume]
Length=295

 Score =   186 bits (473),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +1

Query  187  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  366
            KMSLL KSDSI IREVW+ NLE+EF+LIR++VDDYP+IAMDTEFPGIVLRP+G FKNS D
Sbjct  21   KMSLLTKSDSIHIREVWNDNLEKEFELIRKIVDDYPYIAMDTEFPGIVLRPIGTFKNSFD  80

Query  367  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            Y+YQTLK NVD+LKLIQLGLTF+DE GNLPTC TDK+C+WQFNFR+F+
Sbjct  81   YNYQTLKANVDLLKLIQLGLTFTDENGNLPTCETDKHCVWQFNFRDFN  128



>gb|KJB68416.1| hypothetical protein B456_010G244300 [Gossypium raimondii]
Length=274

 Score =   186 bits (471),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS LPK +S+ IREVW+ NLEEEF LIRE+VD Y ++AMDTEFPG+VLRPVG FKN +DY
Sbjct  1    MSGLPKGESVHIREVWNDNLEEEFALIREIVDTYNYVAMDTEFPGVVLRPVGTFKNINDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTD +CIWQFNFREF+
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTDSFCIWQFNFREFN  107



>ref|XP_011036659.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Populus 
euphratica]
Length=277

 Score =   186 bits (471),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +1

Query  202  PKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQT  381
            PK DSIQIREVW+ NLEEEF LIRE+VD +  +AMDTEFPG+VLRPVGNFKN  DY+YQT
Sbjct  8    PKEDSIQIREVWNDNLEEEFALIREIVDQFNHVAMDTEFPGVVLRPVGNFKNISDYNYQT  67

Query  382  LKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            LKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+
Sbjct  68   LKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFN  110



>ref|XP_008242959.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 isoform 
X1 [Prunus mume]
Length=307

 Score =   186 bits (473),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +1

Query  187  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  366
            KMSLL KSDSI IREVW+ NLE+EF+LIR++VDDYP+IAMDTEFPGIVLRP+G FKNS D
Sbjct  33   KMSLLTKSDSIHIREVWNDNLEKEFELIRKIVDDYPYIAMDTEFPGIVLRPIGTFKNSFD  92

Query  367  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            Y+YQTLK NVD+LKLIQLGLTF+DE GNLPTC TDK+C+WQFNFR+F+
Sbjct  93   YNYQTLKANVDLLKLIQLGLTFTDENGNLPTCETDKHCVWQFNFRDFN  140



>ref|XP_002324905.2| hypothetical protein POPTR_0018s02370g [Populus trichocarpa]
 gb|EEF03470.2| hypothetical protein POPTR_0018s02370g [Populus trichocarpa]
Length=277

 Score =   186 bits (471),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +1

Query  202  PKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQT  381
            PK DSIQIREVW+ NLEEEF LIRE+VD +  +AMDTEFPG+VLRPVGNFKN  DY+YQT
Sbjct  8    PKEDSIQIREVWNDNLEEEFALIREIVDQFNHVAMDTEFPGVVLRPVGNFKNISDYNYQT  67

Query  382  LKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            LKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+
Sbjct  68   LKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFN  110



>ref|NP_178193.1| putative CCR4-associated factor 1-like 6 [Arabidopsis thaliana]
 ref|NP_849915.1| putative CCR4-associated factor 1-like 6 [Arabidopsis thaliana]
 sp|Q9SAI2.1|CAF1F_ARATH RecName: Full=Probable CCR4-associated factor 1 homolog 6 [Arabidopsis 
thaliana]
 gb|AAF14666.1|AC011713_14 Similar to gb|U21855 CCR4-associated factor 1 (CAF1) from Mus 
musculus. ESTs gb|AAA394972, gb|AA585812 and gb|H77015 come 
from this gene [Arabidopsis thaliana]
 gb|AAL49916.1| putative CCR4-associated factorCCR4-associated factor [Arabidopsis 
thaliana]
 gb|AAM20381.1| putative CCR4-associated factor [Arabidopsis thaliana]
 gb|AEE36448.1| putative CCR4-associated factor 1-6 [Arabidopsis thaliana]
 gb|AEE36449.1| putative CCR4-associated factor 1-6 [Arabidopsis thaliana]
Length=274

 Score =   185 bits (470),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSL  K DSIQIREVW+ NL+EE DLIR+VVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLQEEMDLIRDVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HY+TLK NV++LK+IQLGLTFS+E+GNLPTCGTDKYCIWQFNFREFD
Sbjct  61   HYETLKTNVNILKMIQLGLTFSNEQGNLPTCGTDKYCIWQFNFREFD  107



>ref|XP_004138704.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
1 [Cucumis sativus]
 ref|XP_004160759.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
1 [Cucumis sativus]
 gb|KGN62988.1| hypothetical protein Csa_2G382610 [Cucumis sativus]
Length=274

 Score =   185 bits (470),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPK DSIQIREVW+ NLEEEF LIR +VD + +IAMDTEFPG+VLRP+G FKN +D+
Sbjct  1    MSILPKGDSIQIREVWNANLEEEFALIRAIVDKFNYIAMDTEFPGVVLRPLGTFKNINDF  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +Y+TLKDNV+MLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+
Sbjct  61   NYRTLKDNVEMLKLIQLGLTFSDEDGNLPTCGTDKFCIWQFNFREFN  107



>ref|XP_007135810.1| hypothetical protein PHAVU_010G160400g [Phaseolus vulgaris]
 gb|ESW07804.1| hypothetical protein PHAVU_010G160400g [Phaseolus vulgaris]
Length=283

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 97/113 (86%), Gaps = 8/113 (7%)
 Frame = +1

Query  196  LLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHY  375
            +LPKSDSIQIREVW+ NLEEEF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFKNS DYHY
Sbjct  4    ILPKSDSIQIREVWNDNLEEEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKNSYDYHY  63

Query  376  QTLKDNVDMLKLIQLGLTFSDEKGNLPTCG--------TDKYCIWQFNFREFD  510
            QTLKDNVDMLKLIQLGLTFSDE GNLPTC         +   CIWQFNFREF+
Sbjct  64   QTLKDNVDMLKLIQLGLTFSDEYGNLPTCAGAGDVDEESHSCCIWQFNFREFN  116



>ref|XP_008445259.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Cucumis 
melo]
Length=274

 Score =   185 bits (470),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPK DSIQIREVW+ NLEEEF LIR +VD + +IAMDTEFPG+VLRP+G FKN +D+
Sbjct  1    MSILPKGDSIQIREVWNANLEEEFALIRAIVDKFNYIAMDTEFPGVVLRPLGTFKNINDF  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +Y+TLKDNV+MLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+
Sbjct  61   NYRTLKDNVEMLKLIQLGLTFSDEDGNLPTCGTDKFCIWQFNFREFN  107



>ref|NP_001185452.1| putative CCR4-associated factor 1-like 6 [Arabidopsis thaliana]
 gb|AEE36450.1| putative CCR4-associated factor 1-6 [Arabidopsis thaliana]
Length=286

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSL  K DSIQIREVW+ NL+EE DLIR+VVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLQEEMDLIRDVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HY+TLK NV++LK+IQLGLTFS+E+GNLPTCGTDKYCIWQFNFREFD
Sbjct  61   HYETLKTNVNILKMIQLGLTFSNEQGNLPTCGTDKYCIWQFNFREFD  107



>ref|XP_007011965.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Theobroma cacao]
 gb|EOY29584.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Theobroma cacao]
Length=274

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPKS+SI IREVW+ NL  E +LI+  VD+YP+IAMDTEFPGIVLRP+GNFK+S +Y
Sbjct  1    MSILPKSESIHIREVWEENLGSEIELIKNTVDEYPYIAMDTEFPGIVLRPIGNFKSSFEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLK NVD+LKLIQLGLTFSD+KGNLPTCGTDK+C+WQFNFREFD
Sbjct  61   NYQTLKANVDLLKLIQLGLTFSDDKGNLPTCGTDKFCVWQFNFREFD  107



>ref|XP_010556071.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Tarenaya 
hassleriana]
Length=276

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+L K DSI IREVW+ NLEEEF LIREVVD Y ++AMDTEFPG+VLRP+G FKN  DY
Sbjct  1    MSVLLKDDSILIREVWNDNLEEEFTLIREVVDTYNYVAMDTEFPGVVLRPLGTFKNIADY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDEHGNLPTCGTDKFCIWQFNFREFN  107



>ref|XP_010472873.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Camelina 
sativa]
Length=274

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSL  K DSIQIREVW+ NLEEE DLIR+VVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLEEEMDLIRDVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HY+TLK NV++LK+IQLGLTFS+E+G+LPTCGTDKYCIWQFNFREFD
Sbjct  61   HYETLKTNVNILKMIQLGLTFSNEQGDLPTCGTDKYCIWQFNFREFD  107



>emb|CDP10211.1| unnamed protein product [Coffea canephora]
Length=274

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            M++LP  DSI IREVW+ NLE+EF LIRE+VDDYP+IAMDTEFPG+VLRP+G++KN  D+
Sbjct  1    MTVLPSHDSIHIREVWNDNLEDEFALIREIVDDYPYIAMDTEFPGVVLRPLGDYKNFTDF  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            H++TLK NVD+LKLIQLGLTFSDEKGNLPTCGT KYC+WQFNFREF+
Sbjct  61   HFKTLKANVDLLKLIQLGLTFSDEKGNLPTCGTGKYCVWQFNFREFN  107



>gb|KJB06630.1| hypothetical protein B456_001G037000 [Gossypium raimondii]
 gb|KJB06632.1| hypothetical protein B456_001G037000 [Gossypium raimondii]
Length=273

 Score =   184 bits (467),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPK DS+QIR+VW+ NLEEEF LIRE+VD Y ++AMDTEFPG+VLRPVG FKN  DY
Sbjct  1    MSVLPKGDSVQIRKVWNDNLEEEFVLIREIVDTYNYVAMDTEFPGVVLRPVGTFKNVSDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLK NVDMLKLIQLGLTFSD  GNLPTCGTD +CIWQFNFREF+
Sbjct  61   NYQTLKGNVDMLKLIQLGLTFSDANGNLPTCGTDNFCIWQFNFREFN  107



>emb|CAN79806.1| hypothetical protein VITISV_031504 [Vitis vinifera]
Length=270

 Score =   184 bits (466),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +1

Query  199  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQ  378
            +PK++S+ IREVW+ NLE EF LIRE+VD YP+IAMDTEFPG+VLRP+G FKN +DY+YQ
Sbjct  1    MPKTESVLIREVWNENLESEFALIREIVDKYPYIAMDTEFPGVVLRPMGTFKNINDYNYQ  60

Query  379  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            TLKDNVDMLKLIQLGLTFSD  GNLPTCGTDK CIWQFNFREFD
Sbjct  61   TLKDNVDMLKLIQLGLTFSDANGNLPTCGTDKLCIWQFNFREFD  104



>gb|KJB55043.1| hypothetical protein B456_009G061200 [Gossypium raimondii]
Length=274

 Score =   184 bits (466),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPK DS+ IREVW+ NLEEEF LIRE+VD Y ++AMDTEFPG+VLRPVG+FKN  DY
Sbjct  1    MSVLPKGDSVHIREVWNDNLEEEFALIREIVDTYNYVAMDTEFPGVVLRPVGSFKNISDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTD  CIWQFNF EF+
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTDSSCIWQFNFCEFN  107



>ref|XP_006302671.1| hypothetical protein CARUB_v10020778mg [Capsella rubella]
 gb|EOA35569.1| hypothetical protein CARUB_v10020778mg [Capsella rubella]
Length=274

 Score =   184 bits (466),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSL  K DSIQIREVW+ NLEEE DLIR+VVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLEEEMDLIRDVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HY+TLK NV++LK+IQLGLTFS+E+GNLPTCGTDKYCIWQFNF EFD
Sbjct  61   HYETLKTNVNILKMIQLGLTFSNEQGNLPTCGTDKYCIWQFNFGEFD  107



>gb|AFK43307.1| unknown [Lotus japonicus]
Length=274

 Score =   184 bits (466),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 95/103 (92%), Gaps = 1/103 (1%)
 Frame = +1

Query  202  PKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQT  381
            PK++SIQIREVW+ NLE+EF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFKNS DYHYQT
Sbjct  6    PKAESIQIREVWNENLEQEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKNSHDYHYQT  65

Query  382  LKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            LKDNVDMLKLIQLGLTFSDE+GNLP+C     CIWQFNFREF+
Sbjct  66   LKDNVDMLKLIQLGLTFSDEEGNLPSCDGSS-CIWQFNFREFN  107



>ref|XP_003604226.1| Ribonuclease CAF1 [Medicago truncatula]
Length=277

 Score =   184 bits (466),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 2/107 (2%)
 Frame = +1

Query  196  LLPKSD-SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYH  372
            +LP++D SIQIREVW  NLEEEF +IRE+VDDYPFIAMDTEFPGIVLRPVGNFK++ DYH
Sbjct  4    ILPQNDDSIQIREVWSDNLEEEFAVIREIVDDYPFIAMDTEFPGIVLRPVGNFKSNYDYH  63

Query  373  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFD  510
            YQTLKDNVDMLKLIQLGLTFSDE GNLPTCG  D++CIWQFNFREF+
Sbjct  64   YQTLKDNVDMLKLIQLGLTFSDEHGNLPTCGEDDRFCIWQFNFREFN  110



>ref|XP_010092187.1| putative CCR4-associated factor 1-7-like protein [Morus notabilis]
 gb|EXB50413.1| putative CCR4-associated factor 1-7-like protein [Morus notabilis]
Length=277

 Score =   184 bits (466),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 97/108 (90%), Gaps = 1/108 (1%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            M  LPK+DSI IREVW+ NL+EEF LIR++VD YP++AMDTEFPGIVLRPVGNFKNS D+
Sbjct  1    MPELPKTDSIHIREVWNDNLDEEFALIRDIVDQYPYVAMDTEFPGIVLRPVGNFKNSYDF  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCG-TDKYCIWQFNFREFD  510
            HYQTLKDNVDMLKLIQLGLTFSDE GNLP CG + +YCIWQFNFREF+
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEHGNLPACGASGEYCIWQFNFREFN  108



>gb|ACN40154.1| unknown [Picea sitchensis]
Length=274

 Score =   183 bits (465),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LP+SDS+ IREVW  NL EEF LIRE+VDDYP+IAMDTEFPGIV+RPVGNFK + ++
Sbjct  1    MSILPQSDSLIIREVWADNLVEEFALIREIVDDYPYIAMDTEFPGIVVRPVGNFKTASEF  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HY TLK NVD+L LIQLGLTFSDE GNLP CGTDKYCIWQFNFREF+
Sbjct  61   HYYTLKSNVDVLNLIQLGLTFSDEDGNLPRCGTDKYCIWQFNFREFN  107



>ref|XP_004507083.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Cicer 
arietinum]
Length=277

 Score =   183 bits (465),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 97/107 (91%), Gaps = 2/107 (2%)
 Frame = +1

Query  196  LLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHY  375
            +LPKSD IQIREVW+ NLEEEF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFK+S DYHY
Sbjct  4    ILPKSDLIQIREVWNDNLEEEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKSSYDYHY  63

Query  376  QTLKDNVDMLKLIQLGLTFSDEKGNLPTCG--TDKYCIWQFNFREFD  510
            QTLKDNVDMLKLIQLGLTFSDE GNLP  G   D++CIWQFNFREF+
Sbjct  64   QTLKDNVDMLKLIQLGLTFSDEHGNLPKIGDDDDRFCIWQFNFREFN  110



>ref|XP_003531734.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X1 [Glycine max]
 ref|XP_006585611.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X2 [Glycine max]
Length=281

 Score =   184 bits (466),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 96/111 (86%), Gaps = 6/111 (5%)
 Frame = +1

Query  196  LLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHY  375
            +L KSDSIQIREVW+ NLEEEF LIRE+VD+YP+IAMDTEFPGIVLRPVGNFKNS DYHY
Sbjct  4    ILAKSDSIQIREVWNDNLEEEFALIREIVDNYPYIAMDTEFPGIVLRPVGNFKNSYDYHY  63

Query  376  QTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDK------YCIWQFNFREFD  510
            QTLKDNVDMLKLIQLGLTFSDE GNLP CG D        CIWQFNFREF+
Sbjct  64   QTLKDNVDMLKLIQLGLTFSDEHGNLPMCGGDDEESDTCCCIWQFNFREFN  114



>ref|XP_006450304.1| hypothetical protein CICLE_v10008276mg [Citrus clementina]
 gb|ESR63544.1| hypothetical protein CICLE_v10008276mg [Citrus clementina]
Length=449

 Score =   188 bits (477),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 102/115 (89%), Gaps = 2/115 (2%)
 Frame = +1

Query  169  KFWVDWKMSLLPKS-DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVG  345
            KF V  +MS+LPK  D IQIREVW+ NLEEEF LIRE+VD Y +IAMDTEFPG+VLRPVG
Sbjct  170  KFAV-LEMSVLPKGGDEIQIREVWNDNLEEEFALIREIVDKYNYIAMDTEFPGVVLRPVG  228

Query  346  NFKNSDDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
             FKN +DY+YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+
Sbjct  229  AFKNINDYNYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFN  283



>ref|XP_008354337.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=295

 Score =   184 bits (467),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +1

Query  187  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  366
            KMS  P  DSI IREVW  NLEEEF LIR+VV++Y ++AMDTEFPGIVLRPVG FK+S D
Sbjct  21   KMSSFPNRDSIHIREVWSDNLEEEFKLIRKVVEEYRYVAMDTEFPGIVLRPVGTFKDSYD  80

Query  367  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            YHYQTLK NVD+LKLIQLGLTFSDEKGNLPTCGTDK+C+WQFNFR+F+
Sbjct  81   YHYQTLKANVDLLKLIQLGLTFSDEKGNLPTCGTDKHCVWQFNFRDFN  128



>ref|XP_006473977.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Citrus 
sinensis]
 gb|KDO59415.1| hypothetical protein CISIN_1g024017mg [Citrus sinensis]
 gb|KDO59416.1| hypothetical protein CISIN_1g024017mg [Citrus sinensis]
Length=274

 Score =   183 bits (464),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPKS+SI IREVW+ NLE EF LIR++VDDYP+IAMDTEFPGIVLR +GNFK+S +Y
Sbjct  1    MSILPKSESIHIREVWNDNLEHEFSLIRDIVDDYPYIAMDTEFPGIVLRSIGNFKSSSEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREF  507
            +YQ LK NVD+LKLIQLGLTF+DE GNLP CGTDKYC+WQFNFREF
Sbjct  61   NYQNLKVNVDLLKLIQLGLTFTDENGNLPKCGTDKYCLWQFNFREF  106



>emb|CDY63973.1| BnaC02g46620D [Brassica napus]
Length=274

 Score =   183 bits (464),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSL  K DSIQIREVW+ NL EE DLIR+VVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLHEEMDLIRQVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HY+TLK NV++L +IQLGLTFS+E+GNLPTCGTDKYCIWQFNFREFD
Sbjct  61   HYETLKLNVNILSIIQLGLTFSNEQGNLPTCGTDKYCIWQFNFREFD  107



>gb|ABK24400.1| unknown [Picea sitchensis]
Length=274

 Score =   183 bits (464),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LP+SDS+ IREVW  NL EEF LIRE+VDDYP+IAMDTEFPGIV+RPVGNFK + ++
Sbjct  1    MSILPQSDSLIIREVWADNLMEEFALIREIVDDYPYIAMDTEFPGIVVRPVGNFKTASEF  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HY TLK NVD+L LIQLGLTFSDE GNLP CGTDKYCIWQFNFREF+
Sbjct  61   HYYTLKSNVDILNLIQLGLTFSDEDGNLPRCGTDKYCIWQFNFREFN  107



>ref|XP_004501372.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X1 [Cicer arietinum]
 ref|XP_004501373.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X2 [Cicer arietinum]
 ref|XP_004501374.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X3 [Cicer arietinum]
 ref|XP_004501375.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X4 [Cicer arietinum]
Length=271

 Score =   182 bits (463),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+  K DS+QIREVW+ NL+EEF LIRE+VD + FIAMDTEFPG+VLRPVGNFKN +DY
Sbjct  1    MSVSSKGDSVQIREVWNDNLDEEFALIREIVDQFNFIAMDTEFPGVVLRPVGNFKNINDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLKDNVDMLKLIQLGLTFSDE GNLP CGTD  CIWQFNFREF+
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPNCGTDSSCIWQFNFREFN  107



>ref|XP_011039582.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Populus 
euphratica]
Length=277

 Score =   183 bits (464),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +1

Query  202  PKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQT  381
            PK +SIQIREVW+ NL+EEF LIRE+VD + ++AMDTEFPG+VLRPVGNFKN +DY+YQT
Sbjct  8    PKEESIQIREVWNDNLQEEFALIREIVDQFNYVAMDTEFPGVVLRPVGNFKNINDYNYQT  67

Query  382  LKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            LKDNVDMLKLIQLGLTFSDE GNLPTCGTDK CIWQFNFREF+
Sbjct  68   LKDNVDMLKLIQLGLTFSDENGNLPTCGTDKSCIWQFNFREFN  110



>ref|XP_002881215.1| hypothetical protein ARALYDRAFT_902256 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57474.1| hypothetical protein ARALYDRAFT_902256 [Arabidopsis lyrata subsp. 
lyrata]
Length=275

 Score =   182 bits (463),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 95/108 (88%), Gaps = 1/108 (1%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSL  K DSIQIREVW+ NLE E  LIREVVDD+PF+AMDTEFPGIV RPVG FK + +Y
Sbjct  1    MSLFLKDDSIQIREVWNENLESEMALIREVVDDFPFVAMDTEFPGIVCRPVGTFKTNTEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFD  510
            HY+TLK NV++LK+IQLGLTFSDEKGNLPTCGTD KYCIWQFNFREFD
Sbjct  61   HYETLKTNVNILKMIQLGLTFSDEKGNLPTCGTDNKYCIWQFNFREFD  108



>ref|XP_008344039.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=274

 Score =   182 bits (463),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS  P  DSI IREVW  NLEEEF LIR+VV++Y ++AMDTEFPGIVLRPVG FK+S DY
Sbjct  1    MSSFPNRDSIHIREVWSDNLEEEFKLIRKVVEEYRYVAMDTEFPGIVLRPVGTFKDSYDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTLK NVD+LKLIQLGLTFSDEKGNLPTCGTDK+C+WQFNFR+F+
Sbjct  61   HYQTLKANVDLLKLIQLGLTFSDEKGNLPTCGTDKHCVWQFNFRDFN  107



>gb|KHF99352.1| putative CCR4-associated factor 1 -like protein [Gossypium arboreum]
 gb|KHG05538.1| putative CCR4-associated factor 1 -like protein [Gossypium arboreum]
Length=327

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +1

Query  187  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  366
            +MS+LPK DS+ IREVW+ NLEEEF LIRE+VD Y ++AMDTEFPG+VLRPVG+FKN  D
Sbjct  53   EMSILPKGDSVHIREVWNDNLEEEFALIREIVDTYNYVAMDTEFPGVVLRPVGSFKNISD  112

Query  367  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            Y+YQTLKDNVDMLKLIQLGLTFSDE GNLP+CGTD  CIWQFNF EF+
Sbjct  113  YNYQTLKDNVDMLKLIQLGLTFSDENGNLPSCGTDSSCIWQFNFCEFN  160



>ref|XP_006294779.1| hypothetical protein CARUB_v10023830mg [Capsella rubella]
 gb|EOA27677.1| hypothetical protein CARUB_v10023830mg [Capsella rubella]
Length=275

 Score =   182 bits (462),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 96/108 (89%), Gaps = 1/108 (1%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSL  K DSIQIREVW+ NLE E  LIREVVDD+PF+AMDTEFPGIV RPVG+FK + +Y
Sbjct  1    MSLFLKDDSIQIREVWNDNLESEMALIREVVDDFPFVAMDTEFPGIVCRPVGSFKTNTEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFD  510
            HY+TLK NV++LK+IQLGLTFSDEKGNLPTCGTD KYCIWQFNFREFD
Sbjct  61   HYETLKTNVNILKMIQLGLTFSDEKGNLPTCGTDNKYCIWQFNFREFD  108



>ref|XP_009366159.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Pyrus 
x bretschneideri]
Length=295

 Score =   182 bits (462),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +1

Query  187  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  366
            KMS  P  DSI I+EVW  NLEEEF LIR VV++Y ++AMDTEFPGIVLRPVG FK+S D
Sbjct  21   KMSSFPNRDSIHIKEVWSDNLEEEFKLIRSVVEEYRYVAMDTEFPGIVLRPVGTFKDSFD  80

Query  367  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            YHYQTLK NVD+LKLIQLGLTFSDEKGNLPTCGTDK+C+WQFNFR+F+
Sbjct  81   YHYQTLKANVDLLKLIQLGLTFSDEKGNLPTCGTDKHCVWQFNFRDFN  128



>ref|NP_565735.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 sp|Q9SKZ2.2|CAF1G_ARATH RecName: Full=Probable CCR4-associated factor 1 homolog 7 [Arabidopsis 
thaliana]
 gb|AAK93623.1| putative CCR4-associated factor [Arabidopsis thaliana]
 gb|AAD15397.2| putative CCR4-associated factor [Arabidopsis thaliana]
 gb|AAN13153.1| putative CCR4-associated factor [Arabidopsis thaliana]
 gb|AEC08630.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
Length=275

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 95/108 (88%), Gaps = 1/108 (1%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSL  K DSIQIREVW+ NLE E  LIREVVDD+PF+AMDTEFPGIV RPVG FK + +Y
Sbjct  1    MSLFLKDDSIQIREVWNDNLESEMALIREVVDDFPFVAMDTEFPGIVCRPVGTFKTNTEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFD  510
            HY+TLK NV++LK+IQLGLTFSDEKGNLPTCGTD KYCIWQFNFREFD
Sbjct  61   HYETLKTNVNILKMIQLGLTFSDEKGNLPTCGTDNKYCIWQFNFREFD  108



>ref|XP_009128391.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Brassica 
rapa]
 emb|CDY53227.1| BnaA02g19410D [Brassica napus]
Length=274

 Score =   181 bits (460),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSL  K DSIQIREVW+ NL EE DLIR+VVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLLEEMDLIRQVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HY+TLK NV++L +IQLGLTFS+E+GNLPTCGTDKYCIWQFNFREFD
Sbjct  61   HYETLKLNVNILSIIQLGLTFSNEQGNLPTCGTDKYCIWQFNFREFD  107



>ref|XP_006389834.1| hypothetical protein EUTSA_v10018990mg [Eutrema salsugineum]
 gb|ESQ27120.1| hypothetical protein EUTSA_v10018990mg [Eutrema salsugineum]
Length=274

 Score =   181 bits (460),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSL  K DSIQIREVW+ NL+EE DLIREVVDD+P++AMDTEFPGIV+RPV  FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLQEEMDLIREVVDDFPYVAMDTEFPGIVVRPVMAFKSNADY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HY+TLK NV++LK+IQLGLTFS+E+GNLPTCGT+KYCIWQFNFREFD
Sbjct  61   HYETLKMNVNILKIIQLGLTFSNEQGNLPTCGTEKYCIWQFNFREFD  107



>ref|XP_010537879.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Tarenaya 
hassleriana]
Length=277

 Score =   181 bits (459),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLLPK DS+QI EVW+ NLEEEF LIR++VDD+P+++MDTEFPGIV R VG FK S+DY
Sbjct  1    MSLLPKDDSVQICEVWNDNLEEEFALIRQIVDDFPYVSMDTEFPGIVCRSVGIFKTSNDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HY+TLK NV+MLKLIQ+GLTFSDE GNLPTCGTDK+CIWQFN REFD
Sbjct  61   HYETLKLNVNMLKLIQIGLTFSDENGNLPTCGTDKHCIWQFNLREFD  107



>ref|XP_010942117.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Elaeis 
guineensis]
Length=275

 Score =   181 bits (459),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +1

Query  193  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYH  372
            S+LPKS+++QIREVW+ NL+ EF LIRE+VDD+PF+AMDTEFPGIV RP+GNFK S D++
Sbjct  3    SILPKSETVQIREVWNDNLDAEFSLIREIVDDFPFVAMDTEFPGIVARPLGNFKTSSDFN  62

Query  373  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            Y TLK NVDMLKLIQLGLTFSDE GNLPTCGT + C+WQFNFREFD
Sbjct  63   YATLKANVDMLKLIQLGLTFSDEFGNLPTCGTGRGCVWQFNFREFD  108



>gb|ABK22659.1| unknown [Picea sitchensis]
Length=284

 Score =   181 bits (460),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPKSDSI IREVW  NLEEEF+LI E+VDDYP +AMDTEFPGIV+RP+G FK   D+
Sbjct  1    MSILPKSDSIHIREVWADNLEEEFNLINEIVDDYPLVAMDTEFPGIVVRPLGKFKTVQDF  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +Y+TL+ NVD+LKLIQLGLTFSDE GNLP+CGTD+YC+WQFNFREF+
Sbjct  61   NYETLRSNVDVLKLIQLGLTFSDEDGNLPSCGTDRYCVWQFNFREFN  107



>ref|XP_010414034.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Camelina 
sativa]
Length=275

 Score =   180 bits (457),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 95/108 (88%), Gaps = 1/108 (1%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSL  K DSIQIREVW+ NLE E  LIREVVDD+PF+AMDTEFPGIV RPVG+FK + +Y
Sbjct  1    MSLFLKDDSIQIREVWNDNLESEMALIREVVDDFPFVAMDTEFPGIVCRPVGSFKTNTEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFD  510
            HY+TLK NV++LK+IQLGLTFSDEKGNLPTCG D KYCIWQFNFREFD
Sbjct  61   HYETLKTNVNILKMIQLGLTFSDEKGNLPTCGADSKYCIWQFNFREFD  108



>ref|XP_010469632.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Camelina 
sativa]
Length=275

 Score =   180 bits (457),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 95/108 (88%), Gaps = 1/108 (1%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSL  K DSIQIREVW+ NLE E  LIREVVDD+PF+AMDTEFPGIV RPVG+FK + +Y
Sbjct  1    MSLFLKDDSIQIREVWNDNLESEMALIREVVDDFPFVAMDTEFPGIVCRPVGSFKTNTEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFD  510
            HY+TLK NV++LK+IQLGLTFSDEKGNLPTCG D KYCIWQFNFREFD
Sbjct  61   HYETLKTNVNILKMIQLGLTFSDEKGNLPTCGADNKYCIWQFNFREFD  108



>ref|XP_009417447.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=275

 Score =   180 bits (457),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +1

Query  193  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYH  372
            S+LPK++++QIREVW  NLE+EF LIRE+VDD+PF+AMDTEFPGIV RP+GNF+ S D++
Sbjct  3    SILPKNETVQIREVWSNNLEQEFALIREIVDDFPFVAMDTEFPGIVCRPLGNFRTSSDFN  62

Query  373  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            Y TLK NVDMLKLIQLGLT SDE G+LPTCGTD+ C+WQFNFREFD
Sbjct  63   YATLKANVDMLKLIQLGLTLSDEHGSLPTCGTDRGCVWQFNFREFD  108



>gb|ACU20942.1| unknown [Glycine max]
Length=281

 Score =   181 bits (458),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 95/111 (86%), Gaps = 6/111 (5%)
 Frame = +1

Query  196  LLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHY  375
            +L KSDSIQIREVW+ NLEEEF LIRE+VD+YP+IAMDTEFPGIVLRPVGNFKNS DYHY
Sbjct  4    ILAKSDSIQIREVWNDNLEEEFALIREIVDNYPYIAMDTEFPGIVLRPVGNFKNSYDYHY  63

Query  376  QTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDK------YCIWQFNFREFD  510
            QTLKDNVDMLK IQLGLTFSDE GNLP CG D        CIWQFNFREF+
Sbjct  64   QTLKDNVDMLKPIQLGLTFSDEHGNLPMCGGDDEESDTCCCIWQFNFREFN  114



>ref|XP_004504674.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Cicer 
arietinum]
Length=282

 Score =   180 bits (457),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 96/110 (87%), Gaps = 3/110 (3%)
 Frame = +1

Query  190  MSL-LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  366
            MSL LPKSDSIQIREVW  NLEEEF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFKNS D
Sbjct  7    MSLILPKSDSIQIREVWSDNLEEEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKNSYD  66

Query  367  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTC--GTDKYCIWQFNFREFD  510
            YHYQTLKDNVDMLKLIQLG T SDE GNLP      D++C+WQFNFREF+
Sbjct  67   YHYQTLKDNVDMLKLIQLGFTLSDEDGNLPNFDDADDRFCVWQFNFREFN  116



>ref|XP_004250764.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Solanum 
lycopersicum]
 ref|XP_004250765.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Solanum 
lycopersicum]
Length=274

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPK DSI+IREVW  NLE+EF LIR++VDDYP+IAMDTEFPG+VLRPVGNFK+ ++Y
Sbjct  1    MSVLPKIDSIKIREVWSDNLEKEFALIRQIVDDYPYIAMDTEFPGVVLRPVGNFKHINEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLKDNVDML LIQLGLTFSDE GNLPTC ++ Y +WQFNFREFD
Sbjct  61   NYQTLKDNVDMLNLIQLGLTFSDENGNLPTCESEYYYVWQFNFREFD  107



>ref|XP_010429900.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Camelina 
sativa]
 ref|XP_010429901.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Camelina 
sativa]
Length=275

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 99/108 (92%), Gaps = 1/108 (1%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSL  K DSIQIREVW+ NLEEE DLIR+VVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLEEEMDLIRDVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFD  510
            HY+TLK NV++LK+IQLGLTFS+E+G+LPTCGTD KYCIWQFNFREFD
Sbjct  61   HYETLKTNVNILKMIQLGLTFSNEQGDLPTCGTDNKYCIWQFNFREFD  108



>ref|XP_004291948.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Fragaria 
vesca subsp. vesca]
Length=272

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPK DSI+IREVW+ NLEEEF +IR +VD Y ++AMDTEFPG+VLRPVG FKN  DY
Sbjct  1    MSILPKEDSIRIREVWNDNLEEEFHIIRGIVDKYNYVAMDTEFPGVVLRPVGAFKNISDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGT+ + IWQFNFREF+
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTENFFIWQFNFREFN  107



>emb|CDY39943.1| BnaC06g40210D [Brassica napus]
Length=275

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 97/108 (90%), Gaps = 1/108 (1%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSL  K DSIQIREVW  NL+EE DLIREVVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWSDNLQEEMDLIREVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFD  510
            HY+TLK NV++L +IQLGLTFS+E+GNLPTCGTD KYCIWQFNFREFD
Sbjct  61   HYETLKLNVNILNIIQLGLTFSNEQGNLPTCGTDSKYCIWQFNFREFD  108



>ref|XP_009106716.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Brassica 
rapa]
 emb|CDX87343.1| BnaA07g35300D [Brassica napus]
Length=275

 Score =   179 bits (454),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 97/108 (90%), Gaps = 1/108 (1%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSL  K DSIQIREVW  NL+EE DLIREVVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWSDNLQEEMDLIREVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFD  510
            HY+TLK NV++L +IQLGLTFS+E+GNLPTCGTD KYCIWQFNFREFD
Sbjct  61   HYETLKLNVNILNIIQLGLTFSNEQGNLPTCGTDNKYCIWQFNFREFD  108



>ref|XP_009363839.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Pyrus 
x bretschneideri]
Length=273

 Score =   179 bits (453),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLLPK DSIQIREVWD NL+EEF LIR++V  YP++AMDTEFPG+VLRPVG FKN +++
Sbjct  1    MSLLPKGDSIQIREVWDDNLDEEFALIRDIVLKYPYVAMDTEFPGVVLRPVGAFKNINEF  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HY+TLKDNVDMLKLIQLGLTFSDE GNLPT GT+ + IWQFNFREF+
Sbjct  61   HYKTLKDNVDMLKLIQLGLTFSDENGNLPTLGTENHYIWQFNFREFN  107



>ref|XP_008799630.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Phoenix 
dactylifera]
Length=275

 Score =   179 bits (453),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +1

Query  193  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYH  372
            S+LPKS+++QIREVW+ NL+ EF LIRE+VDD+P++AMDTEFPGIV RP+GNFK S D++
Sbjct  3    SILPKSETVQIREVWNDNLDAEFALIREIVDDFPYVAMDTEFPGIVARPLGNFKTSSDFN  62

Query  373  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            Y TLK NVDMLKLIQLGLTFSDE GNLPTCGT + C+WQFNFREFD
Sbjct  63   YATLKANVDMLKLIQLGLTFSDEFGNLPTCGTGRGCVWQFNFREFD  108



>ref|XP_011073532.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Sesamum 
indicum]
Length=271

 Score =   178 bits (452),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +1

Query  199  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQ  378
            LPK+D IQIREVW+ NLE+EF LIR++VD YP++AMDTEFPG+VLRPVGNF + + Y+YQ
Sbjct  4    LPKNDQIQIREVWNDNLEQEFALIRDIVDGYPYVAMDTEFPGVVLRPVGNFNHINQYNYQ  63

Query  379  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            TLKDNVDMLKLIQLGLTFSDE GNLPTCGT+  CIWQFNFREF+
Sbjct  64   TLKDNVDMLKLIQLGLTFSDENGNLPTCGTNTCCIWQFNFREFN  107



>ref|XP_010417661.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Camelina 
sativa]
Length=275

 Score =   178 bits (452),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 99/108 (92%), Gaps = 1/108 (1%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSL  K DSIQIREVW+ NLEEE DLIR+VVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLEEEMDLIRDVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFD  510
            HY+TLK NV++LK+IQLGLTFS+E+G+LPTCGT +KYCIWQFNFREFD
Sbjct  61   HYETLKTNVNILKMIQLGLTFSNEQGDLPTCGTNNKYCIWQFNFREFD  108



>ref|XP_006453661.1| hypothetical protein CICLE_v10009159mg [Citrus clementina]
 gb|ESR66901.1| hypothetical protein CICLE_v10009159mg [Citrus clementina]
Length=274

 Score =   178 bits (452),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPKS+SI IREVW+ NLE EF LIR++VDDYP+IAMDTEFPGIVLR +GNFK+S +Y
Sbjct  1    MSILPKSESIHIREVWNDNLEHEFSLIRDIVDDYPYIAMDTEFPGIVLRSIGNFKSSSEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREF  507
            +YQ LK NVD+LKLIQLGLTF+DE GNLP  GTDKYC+WQFNFREF
Sbjct  61   NYQNLKVNVDLLKLIQLGLTFTDENGNLPKYGTDKYCLWQFNFREF  106



>ref|XP_004160761.1| PREDICTED: LOW QUALITY PROTEIN: probable CCR4-associated factor 
1 homolog 7-like [Cucumis sativus]
Length=274

 Score =   178 bits (452),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPK +SI IREVW+ NLEEEF LIR++VD + +IAMDTEFPG+V+RPVG+FKN ++Y
Sbjct  1    MSILPKGESINIREVWNDNLEEEFALIRDIVDQFNYIAMDTEFPGVVVRPVGSFKNINEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +Y+TL++NVD LKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+
Sbjct  61   NYRTLRENVDTLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFN  107



>ref|XP_004138706.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Cucumis 
sativus]
 gb|KGN62986.1| Ccr4-associated factor [Cucumis sativus]
Length=274

 Score =   178 bits (452),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPK +SI IREVW+ NLEEEF LIR++VD + +IAMDTEFPG+V+RPVG+FKN ++Y
Sbjct  1    MSILPKGESINIREVWNDNLEEEFALIRDIVDQFNYIAMDTEFPGVVVRPVGSFKNINEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +Y+TL++NVD LKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+
Sbjct  61   NYRTLRENVDTLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFN  107



>ref|XP_003603309.1| Ribonuclease CAF1 [Medicago truncatula]
 gb|ACJ84747.1| unknown [Medicago truncatula]
 gb|AFK46979.1| unknown [Medicago truncatula]
Length=275

 Score =   178 bits (452),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +1

Query  199  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQ  378
            L K DSIQIREVW+ NLEEEF LIRE+VD Y ++AMDTEFPG+VLRPVGNFK+ +D++YQ
Sbjct  8    LQKGDSIQIREVWNDNLEEEFVLIREIVDKYNYVAMDTEFPGVVLRPVGNFKHINDFNYQ  67

Query  379  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            TLKDNVDMLKLIQLGLTFSDE GNLPTCGTD  CIWQFNFREF+
Sbjct  68   TLKDNVDMLKLIQLGLTFSDENGNLPTCGTDSPCIWQFNFREFN  111



>ref|XP_010691601.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Beta 
vulgaris subsp. vulgaris]
Length=274

 Score =   178 bits (451),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS++ KSDS+ IREVW+ NLE+EF LIR++VD YPF+AMDTEFPGIVLR VG F+N+ D+
Sbjct  1    MSVVLKSDSVHIREVWEENLEQEFGLIRDIVDAYPFVAMDTEFPGIVLRAVGEFENNTDF  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +Y+TLKDNVDMLKLIQLGLTFSDE+GNLPTCGT+++CIWQFNF EF+
Sbjct  61   NYRTLKDNVDMLKLIQLGLTFSDEQGNLPTCGTEQFCIWQFNFCEFN  107



>ref|XP_009399558.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=275

 Score =   178 bits (451),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  193  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYH  372
            S+LPKS++++IREVW  NLE EF LIRE+VDD+P++AMDTEFPGIV RP+G F+ S D++
Sbjct  3    SILPKSETVEIREVWSDNLEAEFSLIREIVDDFPYVAMDTEFPGIVCRPLGCFRTSSDFN  62

Query  373  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            Y TLK NVDMLKLIQLGLTFSDE GNLPTCGTD+ C+WQFNFREFD
Sbjct  63   YATLKANVDMLKLIQLGLTFSDELGNLPTCGTDRGCVWQFNFREFD  108



>ref|XP_008445257.1| PREDICTED: LOW QUALITY PROTEIN: probable CCR4-associated factor 
1 homolog 7 [Cucumis melo]
Length=274

 Score =   178 bits (451),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPK +SI IREVW+ NLEEEF LIR++VD + +IAMDTEFPG+V+RPVG+FKN ++Y
Sbjct  1    MSILPKGESINIREVWNDNLEEEFALIRDIVDQFNYIAMDTEFPGVVVRPVGSFKNINEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +Y+TL++NVD LKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+
Sbjct  61   NYRTLRENVDTLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFN  107



>ref|XP_010048142.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Eucalyptus 
grandis]
 ref|XP_010048359.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Eucalyptus 
grandis]
 gb|KCW80304.1| hypothetical protein EUGRSUZ_C01665 [Eucalyptus grandis]
 gb|KCW80609.1| hypothetical protein EUGRSUZ_C01976 [Eucalyptus grandis]
Length=274

 Score =   177 bits (450),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            M++  K DSI IREVW+ NLEEEF LIREVVD + ++AMDTEFPG+V RPVGNFKN  DY
Sbjct  1    MAVPLKDDSIDIREVWNDNLEEEFALIREVVDRFSYVAMDTEFPGVVSRPVGNFKNISDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +Y TLK+NVDMLKLIQLGLTFSDE GNLPTCGTDKYCIWQFNFREF+
Sbjct  61   NYLTLKNNVDMLKLIQLGLTFSDENGNLPTCGTDKYCIWQFNFREFN  107



>ref|XP_010911571.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Elaeis 
guineensis]
Length=133

 Score =   173 bits (438),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +1

Query  193  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYH  372
            S+LPK++++QIREVW+ N++ EF LIRE+VDD+P++AMDTEFP IV RP+GNFK S D++
Sbjct  3    SILPKNETVQIREVWNDNVDAEFALIREIVDDFPYVAMDTEFPAIVARPLGNFKTSSDFN  62

Query  373  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            Y TLK NVDMLKLIQLGLTFSDE GNLPTCGT   C+WQFNFREFD
Sbjct  63   YATLKFNVDMLKLIQLGLTFSDESGNLPTCGTGHGCVWQFNFREFD  108



>ref|XP_010510101.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Camelina 
sativa]
Length=275

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 94/108 (87%), Gaps = 1/108 (1%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSL  K DSIQIREVW  NLE E  LIREVVDD+PF+AMDTEFPGIV RPVG+FK + +Y
Sbjct  1    MSLFLKDDSIQIREVWYDNLESEMALIREVVDDFPFVAMDTEFPGIVCRPVGSFKTNTEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFD  510
            HY+TLK NV++LK+IQLGLTFSDEKGNLPTCG D KYCIWQFNFREFD
Sbjct  61   HYETLKTNVNILKMIQLGLTFSDEKGNLPTCGPDNKYCIWQFNFREFD  108



>ref|XP_010929136.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Elaeis 
guineensis]
Length=275

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  193  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYH  372
            S+LPK++++QIREVW+ N++ EF LIRE+VDD+P++AMDTEFPGIV RP+GNFK S D++
Sbjct  3    SILPKNETVQIREVWNDNVDAEFALIREIVDDFPYVAMDTEFPGIVARPLGNFKTSSDFN  62

Query  373  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            Y TLK NVDMLKLIQLGLTFSDE GNLPTCGT   C+WQFNFREFD
Sbjct  63   YATLKANVDMLKLIQLGLTFSDESGNLPTCGTGHGCVWQFNFREFD  108



>ref|XP_009390565.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=275

 Score =   176 bits (447),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  193  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYH  372
            S+LPK++++QIREVW  NL  EF LIRE+VDD+P++AMDTEFPGIV RP+GNF+ S +++
Sbjct  3    SILPKNETVQIREVWSDNLAAEFALIREIVDDFPYVAMDTEFPGIVCRPLGNFRTSSEFN  62

Query  373  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            Y TLK NVDMLKLIQLGLTFSD+ GNLPTCGTD+ C+WQFNFREFD
Sbjct  63   YATLKANVDMLKLIQLGLTFSDQLGNLPTCGTDRGCVWQFNFREFD  108



>ref|XP_008794330.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Phoenix 
dactylifera]
Length=275

 Score =   176 bits (446),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  193  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYH  372
            S+LPK++++QIREVW+ N++ EF LIRE+VDD+P++AMDTEFPGIV RP+GNFK S D++
Sbjct  3    SILPKNETVQIREVWNDNVDVEFALIREIVDDFPYVAMDTEFPGIVARPLGNFKTSSDFN  62

Query  373  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            Y TLK NVDMLKLIQLGLTFSDE GNLPTCGT   C+WQFNFREFD
Sbjct  63   YATLKANVDMLKLIQLGLTFSDESGNLPTCGTGHGCVWQFNFREFD  108



>emb|CDY12234.1| BnaC04g12640D [Brassica napus]
Length=276

 Score =   176 bits (445),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 94/109 (86%), Gaps = 2/109 (2%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLL K DSIQIREVW  NLE E  LIR++VDD+PF+AMDTEFPGIV RPVG FK + +Y
Sbjct  1    MSLLLKDDSIQIREVWHDNLESEMALIRDIVDDFPFVAMDTEFPGIVCRPVGTFKTNTEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD--KYCIWQFNFREFD  510
            HY+TL+ NV++LK+IQLGLTFSDE+GNLPTCG D  KYCIWQFNFREFD
Sbjct  61   HYETLRTNVNLLKMIQLGLTFSDERGNLPTCGPDDKKYCIWQFNFREFD  109



>gb|ACJ84891.1| unknown [Medicago truncatula]
Length=275

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  199  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQ  378
            L K DSIQIREVW+ NLEEEF LIRE+VD Y ++AMDTEFPG+VLRPVGNFK+ +D++YQ
Sbjct  8    LQKGDSIQIREVWNDNLEEEFVLIREIVDKYNYVAMDTEFPGVVLRPVGNFKHINDFNYQ  67

Query  379  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            TLKDNV MLKLIQLGLTFSDE GNLPTCGTD  CIWQFNFREF+
Sbjct  68   TLKDNVYMLKLIQLGLTFSDENGNLPTCGTDSPCIWQFNFREFN  111



>ref|XP_006410344.1| hypothetical protein EUTSA_v10017059mg [Eutrema salsugineum]
 gb|ESQ51797.1| hypothetical protein EUTSA_v10017059mg [Eutrema salsugineum]
Length=276

 Score =   174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 94/109 (86%), Gaps = 2/109 (2%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            M+L P+ DSIQIREVW+ NLE E  LIREVVDD+PF+AMDTEFPGIV RP+G FK + +Y
Sbjct  1    MTLFPEDDSIQIREVWNENLESEMALIREVVDDFPFVAMDTEFPGIVCRPIGTFKTNTEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD--KYCIWQFNFREFD  510
            HY+TLK NV++LK+IQLGLTFSD+KGNLPTCG    K+CIWQFNFR+FD
Sbjct  61   HYETLKTNVNLLKMIQLGLTFSDDKGNLPTCGGSDKKHCIWQFNFRDFD  109



>ref|XP_009144015.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Brassica 
rapa]
 emb|CDY64914.1| BnaA05g35260D [Brassica napus]
Length=276

 Score =   174 bits (440),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 93/109 (85%), Gaps = 2/109 (2%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSL  K DSIQIREVW  NLE E  LIR++VDD+PF+AMDTEFPGIV RPVG FK + +Y
Sbjct  1    MSLFLKDDSIQIREVWHDNLESEMALIRDIVDDFPFVAMDTEFPGIVCRPVGTFKTNTEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD--KYCIWQFNFREFD  510
            HY+TL+ NV++LK+IQLGLTFSDE+GNLPTCG D  KYCIWQFNFREFD
Sbjct  61   HYETLRTNVNLLKMIQLGLTFSDERGNLPTCGPDDSKYCIWQFNFREFD  109



>ref|XP_008378874.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
 ref|XP_008343758.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=271

 Score =   174 bits (440),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLLPK+DSIQIREVW+ NL+EEF LIR++V  YP++AMDTEFPG+VLRPVG FKN +++
Sbjct  1    MSLLPKADSIQIREVWNDNLDEEFALIRDIVLKYPYVAMDTEFPGVVLRPVGAFKNINEF  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HY+TLKDNVDMLKLIQLGLTFSDE G+LPT  T+ + IWQFNFREF+
Sbjct  61   HYKTLKDNVDMLKLIQLGLTFSDENGDLPTLATENHYIWQFNFREFN  107



>ref|NP_196657.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 sp|Q9LEU4.1|CAF1J_ARATH RecName: Full=Probable CCR4-associated factor 1 homolog 10 [Arabidopsis 
thaliana]
 emb|CAB96851.1| CCR4-ASSOCIATED FACTOR-like protein [Arabidopsis thaliana]
 gb|AAN13040.1| putative CCR4-associated factor [Arabidopsis thaliana]
 gb|AED91615.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
Length=277

 Score =   171 bits (432),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            M+   K DSI IREVWDYNL EEF LIRE+VD + +IAMDTEFPG+VL+PV  FK ++D 
Sbjct  1    MAETLKEDSIMIREVWDYNLVEEFALIREIVDKFSYIAMDTEFPGVVLKPVATFKYNNDL  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCGTDK+CIWQFNFREF+
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFN  107



>ref|XP_002871445.1| hypothetical protein ARALYDRAFT_487926 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47704.1| hypothetical protein ARALYDRAFT_487926 [Arabidopsis lyrata subsp. 
lyrata]
Length=276

 Score =   171 bits (432),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            M+   K DSI IREVWDYNL EEF LIRE+VD + +IAMDTEFPG+VL+PV  FK ++D 
Sbjct  1    MAETLKEDSIMIREVWDYNLVEEFALIREIVDKFSYIAMDTEFPGVVLKPVATFKYNNDL  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCGTDK+CIWQFNFREF+
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFN  107



>ref|XP_009122009.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Brassica 
rapa]
 ref|XP_009122010.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Brassica 
rapa]
Length=280

 Score =   171 bits (432),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            M+   K DSI IREVW+ NL EEF LIRE+VD YPFIAMDTEFPG+VL+PV  FK ++D 
Sbjct  1    MAETLKEDSIMIREVWNNNLVEEFALIREIVDKYPFIAMDTEFPGVVLKPVETFKYNNDL  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +Y+TLK+NVD+LKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+
Sbjct  61   NYRTLKENVDLLKLIQLGLTFSDEDGNLPTCGTDKFCIWQFNFREFN  107



>gb|AAK92792.1| putative CCR4-associated factor [Arabidopsis thaliana]
Length=277

 Score =   171 bits (432),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            M+   K DSI IREVWDYNL EEF LIRE+VD + +IAMDTEFPG+VL+PV  FK ++D 
Sbjct  1    MAETLKEDSIMIREVWDYNLVEEFALIREIVDKFSYIAMDTEFPGVVLKPVATFKYNNDL  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCGTDK+CIWQFNFREF+
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFN  107



>emb|CDX69796.1| BnaA10g21450D [Brassica napus]
Length=278

 Score =   170 bits (431),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            M+   K DSI IREVW+ NL EEF LIRE+VD YPFIAMDTEFPG+VL+PV  FK ++D 
Sbjct  1    MAETLKEDSIMIREVWNNNLLEEFALIREIVDKYPFIAMDTEFPGVVLKPVETFKYNNDL  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +Y+TLK+NVD+LKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+
Sbjct  61   NYRTLKENVDLLKLIQLGLTFSDEDGNLPTCGTDKFCIWQFNFREFN  107



>ref|XP_010453129.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Camelina 
sativa]
 ref|XP_010453130.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Camelina 
sativa]
Length=278

 Score =   170 bits (431),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            M+   K DSI IREVWDYNL EEF LIRE+VD + +IAMDTEFPG+VL+PV  FK ++D 
Sbjct  1    MAETLKEDSIMIREVWDYNLVEEFALIREIVDKFSYIAMDTEFPGVVLKPVATFKYNNDL  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCGTDK+CIWQFNFREF+
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFN  107



>ref|XP_010491786.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Camelina 
sativa]
Length=279

 Score =   170 bits (431),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            M+   K DSI IREVWDYNL EEF LIRE+VD + +IAMDTEFPG+VL+PV  FK ++D 
Sbjct  1    MAETLKEDSIMIREVWDYNLVEEFALIREIVDKFSYIAMDTEFPGVVLKPVATFKYNNDL  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCGTDK+CIWQFNFREF+
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFN  107



>ref|XP_006286536.1| hypothetical protein CARUB_v10001652mg [Capsella rubella]
 gb|EOA19434.1| hypothetical protein CARUB_v10001652mg [Capsella rubella]
Length=282

 Score =   170 bits (431),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            M+   K DSI IREVWDYNL EEF LIRE+VD + +IAMDTEFPG+VL+PV  FK ++D 
Sbjct  1    MAETLKEDSIMIREVWDYNLVEEFALIREIVDKFSYIAMDTEFPGVVLKPVATFKYNNDL  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCGTDK+CIWQFNFREF+
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFN  107



>ref|XP_002309331.1| hypothetical protein POPTR_0006s20130g [Populus trichocarpa]
 gb|EEE92854.1| hypothetical protein POPTR_0006s20130g [Populus trichocarpa]
Length=269

 Score =   170 bits (430),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS++   D + IR+VW YNLE+EF LI  +VDD+P+IAMDTEFPGIVLRPVG+ K   DY
Sbjct  1    MSVVHNKDLVVIRDVWKYNLEKEFKLILNIVDDFPYIAMDTEFPGIVLRPVGSVKTGSDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLK NVD+LKLIQLGLT SDEKGNLPTCGTDKYC+WQFNF +F+
Sbjct  61   NYQTLKANVDLLKLIQLGLTLSDEKGNLPTCGTDKYCVWQFNFCDFN  107



>ref|XP_011033459.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Populus 
euphratica]
Length=269

 Score =   169 bits (429),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+    D + IR+VW+YNLE+EF+LI  +VDD+P+IAMDTEFPGIVLRPVG+ K   DY
Sbjct  1    MSVQDNKDLVVIRDVWNYNLEKEFELILNIVDDFPYIAMDTEFPGIVLRPVGSVKTGSDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLK NVD+LKLIQLGLT SDEKGNLPTCGTDKYC+WQFNF +F+
Sbjct  61   NYQTLKANVDLLKLIQLGLTLSDEKGNLPTCGTDKYCVWQFNFCDFN  107



>ref|XP_001766532.1| predicted protein [Physcomitrella patens]
 gb|EDQ68597.1| predicted protein [Physcomitrella patens]
Length=272

 Score =   169 bits (427),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS++    S++IREVW  NLE+EF+LIR++VD+YP++AMDTEFPG+V+RPVG FKNS +Y
Sbjct  1    MSIVANGGSLRIREVWADNLEDEFELIRDIVDEYPYVAMDTEFPGVVVRPVGTFKNSAEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTL+ NVDMLKLIQLGLTFSDE G LP CG+   C+WQFNFREF+
Sbjct  61   HYQTLRANVDMLKLIQLGLTFSDENGVLPRCGSRDSCVWQFNFREFN  107



>gb|EYU32376.1| hypothetical protein MIMGU_mgv1a026872mg [Erythranthe guttata]
Length=272

 Score =   169 bits (427),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 95/107 (89%), Gaps = 1/107 (1%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS LPK+DS+ IREVW+ NLE+EF LIR++VD+YP++AMDTEFPG+VLRP+G+F +  +Y
Sbjct  1    MSELPKNDSVTIREVWNDNLEQEFALIRDIVDNYPYVAMDTEFPGVVLRPLGSFNHIHEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTC  +  CIWQFNFREF+
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTC-DNTCCIWQFNFREFN  106



>ref|XP_001755261.1| predicted protein [Physcomitrella patens]
 gb|EDQ79741.1| predicted protein [Physcomitrella patens]
Length=272

 Score =   168 bits (426),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS++    S++IREVW  NLE+EF+LIR++VD+YP++AMDTEFPG+V+RPVG FKNS +Y
Sbjct  1    MSIVANGGSLRIREVWADNLEDEFELIRDIVDEYPYVAMDTEFPGVVVRPVGTFKNSAEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HYQTL+ NVDMLKLIQLGLTFSDE G LP CG+   C+WQFNFREF+
Sbjct  61   HYQTLRANVDMLKLIQLGLTFSDENGVLPRCGSRDSCVWQFNFREFN  107



>ref|XP_004287117.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Fragaria 
vesca subsp. vesca]
Length=274

 Score =   168 bits (426),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS + KSD + IREVW+ N++ EF+LIR +VD+YP+IAMDTEFPGIV R +G FKNS DY
Sbjct  1    MSFVMKSDDVLIREVWNDNVDAEFELIRNIVDEYPYIAMDTEFPGIVSRALGTFKNSFDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLK NVD+LKLIQLGLTFSDE GNLPTCGTDKYC+WQFNF  F+
Sbjct  61   NYQTLKLNVDLLKLIQLGLTFSDENGNLPTCGTDKYCVWQFNFCNFN  107



>ref|XP_010541576.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 isoform 
X1 [Tarenaya hassleriana]
Length=275

 Score =   168 bits (426),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 94/107 (88%), Gaps = 1/107 (1%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLL K DSI IREVW+ NLEEEF LIR+VV    ++AMDTEFPG+VLRP+G FKN  +Y
Sbjct  1    MSLL-KDDSILIREVWNDNLEEEFALIRDVVVTCSYVAMDTEFPGVVLRPLGPFKNISEY  59

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +Y+TLK+NVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+
Sbjct  60   NYKTLKENVDMLKLIQLGLTFSDEDGNLPTCGTDKFCIWQFNFREFN  106



>ref|XP_010419649.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Camelina 
sativa]
 ref|XP_010419650.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Camelina 
sativa]
Length=277

 Score =   168 bits (426),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            M+   K DSI IREVWDYNL EEF LIRE+VD + +IAMDTEFPG+VL+PV  FK ++D 
Sbjct  1    MAETLKEDSIMIREVWDYNLVEEFALIREIVDKFSYIAMDTEFPGVVLKPVATFKYNNDL  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLP CGTDK+CIWQFNFREF+
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDENGNLPKCGTDKFCIWQFNFREFN  107



>ref|XP_006399590.1| hypothetical protein EUTSA_v10014350mg [Eutrema salsugineum]
 ref|XP_006399591.1| hypothetical protein EUTSA_v10014350mg [Eutrema salsugineum]
 gb|ESQ41043.1| hypothetical protein EUTSA_v10014350mg [Eutrema salsugineum]
 gb|ESQ41044.1| hypothetical protein EUTSA_v10014350mg [Eutrema salsugineum]
Length=277

 Score =   167 bits (424),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            M+   K DSI IREVW  NL EEF LIRE+VD Y +IAMDTEFPG+VL+PV  FK ++D 
Sbjct  1    MAETLKEDSIMIREVWSENLVEEFALIREIVDKYSYIAMDTEFPGVVLKPVATFKYNNDL  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCGTDK+CIWQFNFREF+
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFN  107



>ref|XP_002279241.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Vitis 
vinifera]
Length=270

 Score =   167 bits (423),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS +  +D+  IR+VWD NLE+E  LIR ++DDYP+IAMDTEFPG+VLR VGNFKN+++Y
Sbjct  1    MSDVLVNDTFHIRDVWDDNLEDEIRLIRGLLDDYPYIAMDTEFPGVVLRSVGNFKNNNEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            ++QTLK NVD+LKLIQLGLTFSDE GN PTCGT++YC+WQFNFREF+
Sbjct  61   NFQTLKTNVDLLKLIQLGLTFSDEHGNFPTCGTERYCVWQFNFREFN  107



>emb|CAN68032.1| hypothetical protein VITISV_022019 [Vitis vinifera]
Length=270

 Score =   167 bits (423),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS +  +D+  IR+VWD NLE+E  LIR ++DDYP+IAMDTEFPG+VLR VGNFKN+++Y
Sbjct  1    MSDVLVNDTFHIRDVWDDNLEDEIRLIRGLLDDYPYIAMDTEFPGVVLRSVGNFKNNNEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            ++QTLK NVD+LKLIQLGLTFSDE GN PTCGT++YC+WQFNFREF+
Sbjct  61   NFQTLKTNVDLLKLIQLGLTFSDEHGNFPTCGTERYCVWQFNFREFN  107



>emb|CDX97069.1| BnaC09g45560D [Brassica napus]
Length=280

 Score =   166 bits (421),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            M+   K DSI IREVW+ NL EEF LIRE+VD Y FIAMDTEFPG+VL+PV  FK ++D 
Sbjct  1    MAETLKEDSIMIREVWNDNLLEEFALIREIVDKYTFIAMDTEFPGVVLKPVETFKYNNDL  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +Y+TLK+NVD+LKLIQLGLTFSDE GNLPTCGTDK+C+WQFNFREF+
Sbjct  61   NYRTLKENVDLLKLIQLGLTFSDEDGNLPTCGTDKFCVWQFNFREFN  107



>ref|XP_008377668.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=273

 Score =   165 bits (418),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPK DSI+IREVW+ NL+EEF LIR++V  YP++AMDTEFPG+VLRPVG+FKN +++
Sbjct  1    MSILPKGDSIEIREVWNDNLDEEFALIRDIVLKYPYVAMDTEFPGVVLRPVGDFKNINEF  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +Y+TLKDNVDMLKLIQLGLTF DE GNLPT  T+   IWQFNFREF+
Sbjct  61   NYKTLKDNVDMLKLIQLGLTFFDENGNLPTLSTENQYIWQFNFREFN  107



>ref|XP_008220692.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Prunus 
mume]
Length=274

 Score =   165 bits (418),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPK DSIQIREVW  NL+EEF +IRE+V+ Y ++AMDTEFPG+VLRPVG FKN +DY
Sbjct  1    MSILPKGDSIQIREVWSDNLDEEFAIIREIVEKYNYVAMDTEFPGVVLRPVGAFKNINDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLKDNVDMLKLIQLGLTFSD+ G LP   T    IWQFNFREF+
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDKNGKLPDLDTQNQYIWQFNFREFN  107



>ref|XP_007222518.1| hypothetical protein PRUPE_ppa009848mg [Prunus persica]
 gb|EMJ23717.1| hypothetical protein PRUPE_ppa009848mg [Prunus persica]
Length=274

 Score =   164 bits (415),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+LPK DSIQIREVW  NL+EEF +IRE+V  Y ++AMDTEFPG+VLRPVG FKN +DY
Sbjct  1    MSILPKGDSIQIREVWSDNLDEEFAIIREIVGTYNYVAMDTEFPGVVLRPVGAFKNINDY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTLKDNVDMLKLIQLGLTFSD+ G LP   T    IWQFNFREF+
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDKNGKLPDLDTQNQYIWQFNFREFN  107



>emb|CDY12236.1| BnaC04g12660D [Brassica napus]
Length=412

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            M++  + DSIQIREVW  NLE E DLIREVVDD+P+++MDTEFPGIV RP+ N K   +Y
Sbjct  1    MTMFLQGDSIQIREVWSDNLEAEMDLIREVVDDFPYVSMDTEFPGIVFRPLENIKTITEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            HY+TL+ NV+++K+IQLGLTFS+E GNLPTCG+DKYCIWQFNF +FD
Sbjct  61   HYKTLRTNVNLMKMIQLGLTFSNESGNLPTCGSDKYCIWQFNFCDFD  107



>emb|CDX70376.1| BnaC03g04600D [Brassica napus]
Length=276

 Score =   163 bits (412),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            M+   K DSI IREVW+ NL EEF LIRE+VD + ++AMDTEFPG+VL+PV  FK+++D 
Sbjct  1    MAETLKEDSITIREVWNDNLLEEFALIREIVDKFTYVAMDTEFPGVVLKPVETFKHNNDL  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCGTDK+C+WQFNFREF+
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDEDGNLPTCGTDKFCVWQFNFREFN  107



>ref|XP_002981023.1| hypothetical protein SELMODRAFT_444748 [Selaginella moellendorffii]
 gb|EFJ17724.1| hypothetical protein SELMODRAFT_444748 [Selaginella moellendorffii]
Length=285

 Score =   160 bits (406),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS  PK  S++IR+VW  NLEEE   IR +VD++P +AMDTEFPG+V+RPVGNF++  +Y
Sbjct  1    MSKFPKGGSLRIRDVWASNLEEEISFIRSIVDEFPLLAMDTEFPGVVVRPVGNFRSCAEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTL++NV+MLKLIQLGLTF D  GNLP C T +YC+WQFNFREF+
Sbjct  61   NYQTLRENVNMLKLIQLGLTFCDADGNLPRCNTGEYCVWQFNFREFN  107



>ref|XP_002982500.1| hypothetical protein SELMODRAFT_179583 [Selaginella moellendorffii]
 gb|EFJ16253.1| hypothetical protein SELMODRAFT_179583 [Selaginella moellendorffii]
Length=287

 Score =   160 bits (406),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS  PK  S++IR+VW  NLEEE   IR +VD++P +AMDTEFPG+V+RPVGNF++  +Y
Sbjct  1    MSKFPKGGSLRIRDVWASNLEEEISFIRSIVDEFPLLAMDTEFPGVVVRPVGNFRSCAEY  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            +YQTL++NV+MLKLIQLGLTF D  GNLP C T +YC+WQFNFREF+
Sbjct  61   NYQTLRENVNMLKLIQLGLTFCDADGNLPRCNTGEYCVWQFNFREFN  107



>ref|XP_009131188.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Brassica 
rapa]
 emb|CDX78405.1| BnaA03g03170D [Brassica napus]
Length=278

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 92/108 (85%), Gaps = 1/108 (1%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            M+   K DSI IREVW+ NL EEF LIRE+VD + ++AMDTEFPG+VL+PV  FK+++D 
Sbjct  1    MAETLKEDSITIREVWNDNLLEEFALIREIVDKFTYVAMDTEFPGVVLKPVETFKHNNDL  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFD  510
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCG  DK+C+WQFNFREF+
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDEDGNLPTCGADDKFCVWQFNFREFN  108



>ref|XP_005843563.1| hypothetical protein CHLNCDRAFT_59811 [Chlorella variabilis]
 gb|EFN51461.1| hypothetical protein CHLNCDRAFT_59811 [Chlorella variabilis]
Length=290

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 86/102 (84%), Gaps = 1/102 (1%)
 Frame = +1

Query  202  PKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQT  381
            P  D++++REVW  NLE+E  LIR+VVDDYPF+AMDTEFPG+V RPVG+FKNS +YHYQT
Sbjct  14   PGGDTLRVREVWQDNLEQEMKLIRDVVDDYPFLAMDTEFPGVVARPVGSFKNSGEYHYQT  73

Query  382  LKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREF  507
            L+ NVDMLKLIQLGLTF+D +GNLP     + C+WQFNF+EF
Sbjct  74   LRLNVDMLKLIQLGLTFTDAEGNLPRI-NGELCVWQFNFKEF  114



>dbj|BAK01540.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00477.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 85/103 (83%), Gaps = 1/103 (1%)
 Frame = +1

Query  205  KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTL  384
            K D ++IREVW  NLE EF +IR++VDDYP++AMDTEFPG+V RP+G FK++ D++Y TL
Sbjct  8    KPDGVEIREVWAENLEAEFAVIRDIVDDYPYVAMDTEFPGVVCRPLGTFKSNADFNYATL  67

Query  385  KDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFD  510
            K NVDMLKLIQLGLTFSDE+G LP  G D + C+WQFNFR FD
Sbjct  68   KANVDMLKLIQLGLTFSDERGGLPALGPDGRPCVWQFNFRGFD  110



>gb|ACL53982.1| unknown [Zea mays]
 gb|AFW73867.1| CCR4-NOT transcription complex subunit 7 [Zea mays]
Length=287

 Score =   153 bits (386),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 6/116 (5%)
 Frame = +1

Query  181  DWKMSLLPKSD-----SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVG  345
            D   +++PK D     S++IREVW  NLEEEF LIR++VD+YPF+AMDTEFPGIV RPVG
Sbjct  5    DLTATVIPKPDGADDESVEIREVWADNLEEEFALIRDIVDEYPFVAMDTEFPGIVCRPVG  64

Query  346  NFKNSDDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFD  510
             F++  DY+Y TLK NVDML LIQLGLTFS  +G LP  G   + C+WQFNFREFD
Sbjct  65   AFRSPADYNYATLKANVDMLHLIQLGLTFSGPRGELPALGAGRRRCVWQFNFREFD  120



>ref|XP_004954218.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Setaria 
italica]
Length=287

 Score =   153 bits (386),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 89/116 (77%), Gaps = 6/116 (5%)
 Frame = +1

Query  181  DWKMSLLPKSD-----SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVG  345
            D   +++PK D     S++IREVW  NLEEEF LIR+VVD++PF+AMDTEFPGIV RPVG
Sbjct  5    DPTAAVIPKPDGGDDESVEIREVWADNLEEEFALIRDVVDEFPFVAMDTEFPGIVCRPVG  64

Query  346  NFKNSDDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFD  510
             F++  DY+Y TLK NVDML LIQLGLTFS  +G LP  G D + C+WQFNFREFD
Sbjct  65   AFRSPADYNYATLKANVDMLHLIQLGLTFSGPRGELPALGADRRRCVWQFNFREFD  120



>ref|XP_002452981.1| hypothetical protein SORBIDRAFT_04g035960 [Sorghum bicolor]
 gb|EES05957.1| hypothetical protein SORBIDRAFT_04g035960 [Sorghum bicolor]
Length=288

 Score =   151 bits (382),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 88/117 (75%), Gaps = 7/117 (6%)
 Frame = +1

Query  181  DWKMSLLPKSD------SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPV  342
            D   +++PK D      S++IREVW  NLEEEF LIR++VD++PF+AMDTEFPGIV RPV
Sbjct  5    DLTATMIPKPDEADDDESVEIREVWADNLEEEFALIRDIVDEFPFVAMDTEFPGIVCRPV  64

Query  343  GNFKNSDDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFD  510
            G F++  DY+Y TLK NVDML LIQLGLTFS  +G LP  G   + C+WQFNFREFD
Sbjct  65   GAFRSPADYNYATLKANVDMLHLIQLGLTFSGPRGELPALGAGRRRCVWQFNFREFD  121



>ref|XP_002862886.1| hypothetical protein ARALYDRAFT_920160 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39145.1| hypothetical protein ARALYDRAFT_920160 [Arabidopsis lyrata subsp. 
lyrata]
Length=252

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 77/83 (93%), Gaps = 1/83 (1%)
 Frame = +1

Query  265  LIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKDNVDMLKLIQLGLTFSDEK  444
            LIREVVDD+PF+AMDTEFPGIV RPVG FK + +YHY+TLK NV++LK+IQLGLTFSDEK
Sbjct  3    LIREVVDDFPFVAMDTEFPGIVCRPVGTFKTNTEYHYETLKTNVNILKMIQLGLTFSDEK  62

Query  445  GNLPTCGTD-KYCIWQFNFREFD  510
            GNLPTCGTD KYCIWQFNFREFD
Sbjct  63   GNLPTCGTDNKYCIWQFNFREFD  85



>ref|NP_001063181.1| Os09g0416800 [Oryza sativa Japonica Group]
 dbj|BAD28924.1| putative CCR4-NOT transcription complex subunit 7 [Oryza sativa 
Japonica Group]
 dbj|BAD29264.1| putative CCR4-NOT transcription complex subunit 7 [Oryza sativa 
Japonica Group]
 dbj|BAF25095.1| Os09g0416800 [Oryza sativa Japonica Group]
 gb|EAZ09108.1| hypothetical protein OsI_31373 [Oryza sativa Indica Group]
 gb|EAZ44741.1| hypothetical protein OsJ_29372 [Oryza sativa Japonica Group]
 dbj|BAG89495.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94386.1| unnamed protein product [Oryza sativa Japonica Group]
Length=280

 Score =   150 bits (380),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 86/103 (83%), Gaps = 1/103 (1%)
 Frame = +1

Query  205  KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTL  384
            K D ++IREVW+ NLE EF +IRE+VDD+P++AMDTEFPG+V RP+G FK++ D++Y TL
Sbjct  8    KPDGVEIREVWEDNLEAEFAVIREIVDDFPYVAMDTEFPGVVCRPLGTFKSNADFNYATL  67

Query  385  KDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFD  510
            K NVDMLKLIQLGLTFS+E G LP+ G + + C+WQFNFR FD
Sbjct  68   KANVDMLKLIQLGLTFSNEHGGLPSLGPEGRPCVWQFNFRGFD  110



>ref|XP_008676671.1| PREDICTED: uncharacterized protein LOC100216888 isoform X1 [Zea 
mays]
Length=308

 Score =   151 bits (381),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 88/116 (76%), Gaps = 6/116 (5%)
 Frame = +1

Query  181  DWKMSLLPK-----SDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVG  345
            D   +++PK      +S++IREVW  N+EEEF LIR++VD+YPF+AMDTEFPGIV RPVG
Sbjct  67   DLTATVIPKLGEADDESVEIREVWADNMEEEFALIRDIVDEYPFVAMDTEFPGIVCRPVG  126

Query  346  NFKNSDDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFD  510
             F++  DY+Y TLK NVDML LIQLGLTFS  +G LP  G   + C+WQFNFREFD
Sbjct  127  AFRSPADYNYATLKANVDMLHLIQLGLTFSGPRGELPVLGAGRRRCVWQFNFREFD  182



>ref|NP_001136747.1| uncharacterized protein LOC100216888 [Zea mays]
 gb|ACF82526.1| unknown [Zea mays]
 gb|AFW64146.1| hypothetical protein ZEAMMB73_273082 [Zea mays]
Length=287

 Score =   150 bits (379),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 88/116 (76%), Gaps = 6/116 (5%)
 Frame = +1

Query  181  DWKMSLLPK-----SDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVG  345
            D   +++PK      +S++IREVW  N+EEEF LIR++VD+YPF+AMDTEFPGIV RPVG
Sbjct  5    DLTATVIPKLGEADDESVEIREVWADNMEEEFALIRDIVDEYPFVAMDTEFPGIVCRPVG  64

Query  346  NFKNSDDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFD  510
             F++  DY+Y TLK NVDML LIQLGLTFS  +G LP  G   + C+WQFNFREFD
Sbjct  65   AFRSPADYNYATLKANVDMLHLIQLGLTFSGPRGELPVLGAGRRRCVWQFNFREFD  120



>ref|XP_010048148.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Eucalyptus 
grandis]
 gb|KCW80311.1| hypothetical protein EUGRSUZ_C01670 [Eucalyptus grandis]
Length=281

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 88/110 (80%), Gaps = 2/110 (2%)
 Frame = +1

Query  187  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLR--PVGNFKNS  360
            KM +    +S+ IREVW++NLEEEF LI E+VD + ++A+D EFPG+V R   + N KN 
Sbjct  5    KMPMPLTDESLVIREVWNHNLEEEFALIGEIVDKFNYVAVDAEFPGVVFRLPSLENIKNM  64

Query  361  DDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
             DY+YQT+K+NVD LKLIQLGLTF D++GNLPTCGTDKYCIWQFNFR FD
Sbjct  65   RDYNYQTMKNNVDKLKLIQLGLTFLDDEGNLPTCGTDKYCIWQFNFRGFD  114



>ref|XP_011395961.1| putative CCR4-associated factor 1-like protein 7 [Auxenochlorella 
protothecoides]
 gb|KFM23091.1| putative CCR4-associated factor 1-like protein 7 [Auxenochlorella 
protothecoides]
Length=293

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 84/102 (82%), Gaps = 1/102 (1%)
 Frame = +1

Query  202  PKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQT  381
            P  D++++REVW +NLEEE  LIRE++ D+P++AMDTEFPG+V +PVGNFK S ++HYQ 
Sbjct  19   PDGDTLRVREVWQHNLEEEMQLIRELISDFPYLAMDTEFPGVVAKPVGNFKKSREFHYQM  78

Query  382  LKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREF  507
            L+ NV+MLK+IQLGLTFSD  GNLP    ++ C+WQFNFREF
Sbjct  79   LRLNVNMLKMIQLGLTFSDHLGNLPRI-NNELCVWQFNFREF  119



>ref|XP_002460215.1| hypothetical protein SORBIDRAFT_02g024730 [Sorghum bicolor]
 gb|EER96736.1| hypothetical protein SORBIDRAFT_02g024730 [Sorghum bicolor]
Length=279

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = +1

Query  205  KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTL  384
            K + ++IREVW  NLE EF +IR++VDDYP++AMDTEFPG+V RP+G +K + +++Y TL
Sbjct  8    KPEDVEIREVWADNLEAEFAVIRDIVDDYPYVAMDTEFPGVVCRPLGTYKTAAEFNYATL  67

Query  385  KDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFD  510
            K NVDMLKLIQLGLTFSDE G LP  G D + C+WQFNFR FD
Sbjct  68   KANVDMLKLIQLGLTFSDEHGGLPALGADGRPCVWQFNFRGFD  110



>ref|XP_005649974.1| CCR4-associated factor [Coccomyxa subellipsoidea C-169]
 gb|EIE25430.1| CCR4-associated factor [Coccomyxa subellipsoidea C-169]
Length=284

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 84/108 (78%), Gaps = 4/108 (4%)
 Frame = +1

Query  184  WKMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSD  363
            WK       + +++REVW  NL+EE ++IR VVDDYPF+AMDTEFPG+V RPVG FKNS 
Sbjct  7    WKTK---SGEDLRVREVWQENLDEELEIIRNVVDDYPFLAMDTEFPGVVARPVGPFKNSG  63

Query  364  DYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREF  507
            +YHYQTL+ NVDMLKLIQLGLTFSD KG LP     + C+WQFNFREF
Sbjct  64   EYHYQTLRCNVDMLKLIQLGLTFSDAKGELPRW-KGELCVWQFNFREF  110



>gb|KIY93169.1| CCR4-NOT transcription complex subunit 7/8 [Monoraphidium neglectum]
Length=217

 Score =   146 bits (369),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 84/101 (83%), Gaps = 1/101 (1%)
 Frame = +1

Query  205  KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTL  384
            K +++++REVWD NLE E  +IR ++D+YP++AMDTEFPG+V RPVGNFK+S +YHY+ L
Sbjct  15   KGETLRVREVWDDNLEAELVIIRSILDEYPYVAMDTEFPGVVARPVGNFKSSREYHYRAL  74

Query  385  KDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREF  507
            K NVDMLKLIQLGLTF+D +GNLP C   ++ +WQFNFR F
Sbjct  75   KLNVDMLKLIQLGLTFTDAQGNLPVC-NGEHTVWQFNFRGF  114



>ref|XP_006660627.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Oryza 
brachyantha]
Length=280

 Score =   147 bits (372),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 84/103 (82%), Gaps = 1/103 (1%)
 Frame = +1

Query  205  KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTL  384
            K D ++IREVW  NLE EF +IR++VD +P++AMDTEFPG+V RP+G FK++ D++Y TL
Sbjct  8    KPDGVEIREVWADNLEAEFLVIRDIVDRFPYVAMDTEFPGVVCRPLGTFKSAADFNYATL  67

Query  385  KDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFD  510
            K NVDMLKLIQLGLTFSDE+G LP  G + + C+WQFNFR FD
Sbjct  68   KANVDMLKLIQLGLTFSDERGGLPALGPEGRPCVWQFNFRGFD  110



>ref|NP_001048387.1| Os02g0796300 [Oryza sativa Japonica Group]
 dbj|BAF10301.1| Os02g0796300 [Oryza sativa Japonica Group]
 dbj|BAG88128.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93253.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99633.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57976.1| hypothetical protein OsJ_08719 [Oryza sativa Japonica Group]
Length=295

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 81/101 (80%), Gaps = 1/101 (1%)
 Frame = +1

Query  211  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKD  390
            + ++IREVW  NLEEEF LIR+VVD++PF+AMDTEFPGIV RPVG F++  DY+Y TLK 
Sbjct  28   EPVEIREVWADNLEEEFALIRDVVDEFPFVAMDTEFPGIVCRPVGAFRSPADYNYATLKA  87

Query  391  NVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFD  510
            NVDML LIQLGLTFS  +G LP  G   + C+WQFNFREFD
Sbjct  88   NVDMLHLIQLGLTFSSPRGELPALGPGRRRCVWQFNFREFD  128



>dbj|BAD19081.1| putative CCR4-NOT transcription complex subunit 7 [Oryza sativa 
Japonica Group]
 dbj|BAD19282.1| putative CCR4-NOT transcription complex subunit 7 [Oryza sativa 
Japonica Group]
Length=293

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 81/101 (80%), Gaps = 1/101 (1%)
 Frame = +1

Query  211  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKD  390
            + ++IREVW  NLEEEF LIR+VVD++PF+AMDTEFPGIV RPVG F++  DY+Y TLK 
Sbjct  26   EPVEIREVWADNLEEEFALIRDVVDEFPFVAMDTEFPGIVCRPVGAFRSPADYNYATLKA  85

Query  391  NVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFD  510
            NVDML LIQLGLTFS  +G LP  G   + C+WQFNFREFD
Sbjct  86   NVDMLHLIQLGLTFSSPRGELPALGPGRRRCVWQFNFREFD  126



>gb|EEC74173.1| hypothetical protein OsI_09281 [Oryza sativa Indica Group]
Length=295

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 81/101 (80%), Gaps = 1/101 (1%)
 Frame = +1

Query  211  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKD  390
            + ++IREVW  NLEEEF LIR+VVD++PF+AMDTEFPGIV RPVG F++  DY+Y TLK 
Sbjct  28   EPVEIREVWADNLEEEFALIRDVVDEFPFVAMDTEFPGIVCRPVGAFRSPADYNYATLKA  87

Query  391  NVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFD  510
            NVDML LIQLGLTFS  +G LP  G   + C+WQFNFREFD
Sbjct  88   NVDMLHLIQLGLTFSSPRGELPALGPGRRRCVWQFNFREFD  128



>ref|NP_001132298.1| CCR4-NOT transcription complex subunit 7 isoform 1 [Zea mays]
 gb|ACF81091.1| unknown [Zea mays]
 gb|ACG42346.1| CCR4-NOT transcription complex subunit 7 [Zea mays]
 tpg|DAA61464.1| TPA: CCR4-NOT transcription complex subunit 7 isoform 1 [Zea 
mays]
 tpg|DAA61465.1| TPA: CCR4-NOT transcription complex subunit 7 isoform 2 [Zea 
mays]
Length=279

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = +1

Query  205  KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTL  384
            K + ++IREVW  NLE EF +IR++VDDYP++AMDTEFPG+V RP+G +K++ +++Y TL
Sbjct  8    KPEDVEIREVWADNLETEFAVIRDIVDDYPYVAMDTEFPGVVCRPLGTYKSAAEFNYATL  67

Query  385  KDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFD  510
            K NVDMLKLIQLGLT SDE G LP  G D + C+WQFNFR FD
Sbjct  68   KANVDMLKLIQLGLTLSDEHGGLPALGPDGRPCVWQFNFRGFD  110



>gb|EMS59499.1| putative CCR4-associated factor 1-like protein 7 [Triticum urartu]
Length=294

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 82/101 (81%), Gaps = 1/101 (1%)
 Frame = +1

Query  211  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKD  390
            + ++IREVW  NLE EF +IR+VVDDYP+IAMDTEFPGIV RP+G+F+++D+Y+Y TLK 
Sbjct  20   EGVEIREVWANNLEAEFAVIRDVVDDYPYIAMDTEFPGIVCRPLGSFRSNDEYNYATLKA  79

Query  391  NVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFD  510
            NVDML LIQLGLT SDE G LP  GT  + C WQFNFR FD
Sbjct  80   NVDMLSLIQLGLTLSDENGALPARGTGGRPCAWQFNFRGFD  120



>ref|XP_002890137.1| hypothetical protein ARALYDRAFT_312582 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66396.1| hypothetical protein ARALYDRAFT_312582 [Arabidopsis lyrata subsp. 
lyrata]
Length=284

 Score =   145 bits (367),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 84/104 (81%), Gaps = 4/104 (4%)
 Frame = +1

Query  211  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQ----  378
            D+I+IREVW++NLEEE  LI + +DD+P++AMDTEFPG+V + V    + +  HY+    
Sbjct  12   DTIEIREVWNHNLEEEMALIEQAIDDFPYVAMDTEFPGVVCKTVTANPSPNPKHYEFNYE  71

Query  379  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            TLK NV+MLKLIQLGLT SDEKGNLPTCGT+K CIWQFNFREF+
Sbjct  72   TLKTNVNMLKLIQLGLTLSDEKGNLPTCGTNKQCIWQFNFREFN  115



>ref|NP_173044.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 ref|NP_973838.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 sp|Q9S9P2.1|CAF1B_ARATH RecName: Full=Probable CCR4-associated factor 1 homolog 2 [Arabidopsis 
thaliana]
 gb|AAF18489.1|AC010924_2 Similar to gi|Q60809 CCR4-associated factor 1 (CAF1) from Mus 
musculus. EST gb|Z26822 comes from this gene [Arabidopsis thaliana]
 gb|AAL86000.1| putative BTG1 binding factor 1 [Arabidopsis thaliana]
 gb|AAM45088.1| putative BTG1 binding factor 1 [Arabidopsis thaliana]
 dbj|BAH19897.1| AT1G15920 [Arabidopsis thaliana]
 gb|AEE29383.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 gb|AEE29384.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
Length=286

 Score =   145 bits (365),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 85/106 (80%), Gaps = 6/106 (6%)
 Frame = +1

Query  211  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSD------DYH  372
            D+I+IREVW++NLE+E  LI + +DD+P++AMDTEFPGIV + V    N +      +Y+
Sbjct  12   DTIEIREVWNHNLEQEMALIEQSIDDFPYVAMDTEFPGIVCKTVTANPNPNPYSIHYEYN  71

Query  373  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            Y TLK NV+MLKLIQLGLT SDEKGNLPTCGT+K CIWQFNFREF+
Sbjct  72   YDTLKANVNMLKLIQLGLTLSDEKGNLPTCGTNKQCIWQFNFREFN  117



>ref|XP_003056015.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59391.1| predicted protein [Micromonas pusilla CCMP1545]
Length=279

 Score =   144 bits (364),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 84/101 (83%), Gaps = 1/101 (1%)
 Frame = +1

Query  208  SDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLK  387
            SD++  REVW+ NL+EE  +IRE++DD+PF+AMDTEFPG+V RPVGN+K   ++ YQTL+
Sbjct  5    SDNLLTREVWEGNLDEELAVIREIIDDFPFVAMDTEFPGVVARPVGNYKLQSEHQYQTLR  64

Query  388  DNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
             NVDMLK+IQLGLT +D +GNLP  G + YC+WQFNFREF+
Sbjct  65   CNVDMLKIIQLGLTLTDARGNLPLIG-NFYCLWQFNFREFN  104



>gb|KCW53891.1| hypothetical protein EUGRSUZ_J03104, partial [Eucalyptus grandis]
Length=240

 Score =   143 bits (361),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  193  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYH  372
            SLLPKSDSI IR+V + NLE+EF+LIR +V+DY ++AMDTEFPG+VLRPVG+F++ +DYH
Sbjct  2    SLLPKSDSIHIRKVCNDNLEQEFELIRAIVNDYLYVAMDTEFPGVVLRPVGSFQSPNDYH  61

Query  373  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD  471
            YQTLKDNV++LKLI+LGLT  DEK NLPTC TD
Sbjct  62   YQTLKDNVNLLKLIRLGLTLFDEKENLPTCRTD  94



>dbj|BAJ92910.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   144 bits (364),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 79/101 (78%), Gaps = 1/101 (1%)
 Frame = +1

Query  211  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKD  390
            + ++IREVW  NLE EF LIR+VVD++PF+AMDTEFPGIV RPVG F++  DY+Y TLK 
Sbjct  22   EPVEIREVWADNLEAEFALIRDVVDEFPFVAMDTEFPGIVCRPVGAFRSPADYNYATLKA  81

Query  391  NVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFD  510
            NVDML LIQLGLTFS   G LP  G   + C+WQFNFREFD
Sbjct  82   NVDMLHLIQLGLTFSGPTGELPALGAGRRRCVWQFNFREFD  122



>ref|XP_003570299.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Brachypodium 
distachyon]
Length=295

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 78/99 (79%), Gaps = 1/99 (1%)
 Frame = +1

Query  217  IQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKDNV  396
            ++IREVW  NLE EF LIR+VVD++PF+AMDTEFPGIV RPVG F++  DY+Y TLK NV
Sbjct  30   VEIREVWADNLEAEFALIRDVVDEFPFVAMDTEFPGIVCRPVGVFRSPADYNYATLKANV  89

Query  397  DMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFD  510
            DML LIQLGLTFS   G LP  G   + C+WQFNFREFD
Sbjct  90   DMLHLIQLGLTFSGPTGELPALGAGRRRCVWQFNFREFD  128



>ref|XP_006304066.1| hypothetical protein CARUB_v10009915mg [Capsella rubella]
 gb|EOA36964.1| hypothetical protein CARUB_v10009915mg [Capsella rubella]
Length=289

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 91/116 (78%), Gaps = 9/116 (8%)
 Frame = +1

Query  190  MSLLP----KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKN  357
            MS +P    + DSI+IREVW++NLEEE  LI + +DD+PF+AMDTEFPGIV + V    +
Sbjct  1    MSQVPNPKDEDDSIEIREVWNHNLEEEMALIEQAIDDFPFVAMDTEFPGIVCKTVTANPS  60

Query  358  SD----DYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFD  510
             +    +Y+Y+TLK NV+MLKLIQLGLT SDE+GNLPTCGT +K CIWQFNFREF+
Sbjct  61   PNPKHYEYNYETLKTNVNMLKLIQLGLTLSDERGNLPTCGTNNKQCIWQFNFREFN  116



>dbj|GAC74710.1| mRNA deadenylase subunit [Pseudozyma antarctica T-34]
Length=196

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 76/105 (72%), Gaps = 4/105 (4%)
 Frame = +1

Query  187  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  366
            K+ +L     +QIREVW  NLE E  L+RE +D YP++AMDTEFPGIV RP+G FK S D
Sbjct  88   KLIVLAGDTLLQIREVWAENLEIEMALLRETIDKYPYVAMDTEFPGIVARPIGTFKGSSD  147

Query  367  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFR  501
            YHYQTL+ NVD+LKLIQLG+T  DE GNLP       C WQFNFR
Sbjct  148  YHYQTLRCNVDLLKLIQLGITLCDENGNLP----PDVCTWQFNFR  188



>ref|XP_010932239.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Elaeis 
guineensis]
Length=270

 Score =   142 bits (358),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 83/110 (75%), Gaps = 3/110 (3%)
 Frame = +1

Query  190  MSLLPKSD-SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  366
            MS+  KSD S++IREVW  NLE EF +IRE+VD+YPFIAMDTEFPG+ + PV  FKN  D
Sbjct  1    MSIPAKSDESVEIREVWADNLEVEFAVIREIVDEYPFIAMDTEFPGVAITPVRAFKNISD  60

Query  367  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLP--TCGTDKYCIWQFNFREFD  510
             HYQTL+ NVD+L LIQ+G+TFSD  G LP    G    C+WQFNFREFD
Sbjct  61   QHYQTLRANVDLLHLIQVGITFSDASGCLPPSPSGGGLRCVWQFNFREFD  110



>ref|XP_001697447.1| CCR4-associated factor [Chlamydomonas reinhardtii]
 gb|EDP00109.1| CCR4-associated factor [Chlamydomonas reinhardtii]
Length=300

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +1

Query  193  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYH  372
             + P  D++++REVW  N+E EF L+R++V+DYP+IAMDTEFPG+V +P+G FK+S +Y 
Sbjct  20   GITPAGDTLRVREVWADNMEVEFALLRDIVEDYPYIAMDTEFPGVVAKPIGTFKSSREYL  79

Query  373  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREF  507
            Y+ LK NVDMLKLIQLGLT +D KG LP     + C+WQFNF+ F
Sbjct  80   YKALKMNVDMLKLIQLGLTLTDAKGTLPRAANGELCVWQFNFKGF  124



>ref|XP_002965900.1| hypothetical protein SELMODRAFT_84624 [Selaginella moellendorffii]
 ref|XP_002983145.1| hypothetical protein SELMODRAFT_117491 [Selaginella moellendorffii]
 gb|EFJ15954.1| hypothetical protein SELMODRAFT_117491 [Selaginella moellendorffii]
 gb|EFJ33320.1| hypothetical protein SELMODRAFT_84624 [Selaginella moellendorffii]
Length=274

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 86/108 (80%), Gaps = 5/108 (5%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS + K  +++IREVW  NLEEEF LIRE+VDD+P++AMDTEFPG+V+RP+G FK     
Sbjct  1    MSAVSKGTTLRIREVWAENLEEEFKLIREIVDDFPYLAMDTEFPGVVVRPIG-FKAGT--  57

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYC-IWQFNFREFD  510
             YQ L+ NVD+LKLIQLGLTFSDE GNLPT G+ +   +WQFNFREF+
Sbjct  58   -YQMLRANVDLLKLIQLGLTFSDEDGNLPTFGSTRESYLWQFNFREFN  104



>ref|XP_003074753.1| Caf1 CCR4-associated (transcription) factor, putative (IC) [Ostreococcus 
tauri]
Length=275

 Score =   140 bits (352),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 81/102 (79%), Gaps = 3/102 (3%)
 Frame = +1

Query  208  SDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLK  387
            + +++ R+VW +NL+EE  LIRE+V  YPF+AMDTEFPGIV RPVG+FK+  ++ YQTL+
Sbjct  5    ASNLRTRDVWAHNLDEECTLIREIVSAYPFVAMDTEFPGIVARPVGSFKHQSEFQYQTLR  64

Query  388  DNVDMLKLIQLGLTFSDEKGNLPTCGTDKY-CIWQFNFREFD  510
             NVDMLKLIQLGLTF+D  GNLP    D Y CIWQFNFREF 
Sbjct  65   CNVDMLKLIQLGLTFTDADGNLPL--IDGYHCIWQFNFREFS  104



>ref|XP_001416204.1| polyA tail-shortening ribonuclease, probable [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO94497.1| polyA tail-shortening ribonuclease, probable [Ostreococcus lucimarinus 
CCE9901]
Length=276

 Score =   140 bits (352),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 83/107 (78%), Gaps = 1/107 (1%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS      ++  R+VW +NL+EE  LIREVV +YP++AMDTEFPG+V RPVG+FK+  ++
Sbjct  1    MSSALTPSTLHTRDVWAHNLDEECALIREVVCNYPYVAMDTEFPGVVARPVGSFKHQAEF  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
             YQTL+ NVD+LKLIQLGLTFSD  GNLP     ++CIWQFNF+EF+
Sbjct  61   QYQTLRCNVDLLKLIQLGLTFSDGAGNLPVV-DGRFCIWQFNFKEFN  106



>ref|XP_003578122.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Brachypodium 
distachyon]
Length=279

 Score =   140 bits (352),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 1/103 (1%)
 Frame = +1

Query  205  KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTL  384
            K D ++IREVW  NLE EF +IRE+VDDYP++AMDTEFPG+V RP+G FK++ D++Y TL
Sbjct  8    KPDDVEIREVWAENLEAEFAVIREIVDDYPYVAMDTEFPGVVCRPLGTFKSAADFNYATL  67

Query  385  KDNVDMLKLIQLGLTFSDEK-GNLPTCGTDKYCIWQFNFREFD  510
            K NVDMLKLIQLGLTFSDE+ G        + C+WQFNFR FD
Sbjct  68   KANVDMLKLIQLGLTFSDERGGLPALGPGGRPCVWQFNFRGFD  110



>emb|CEI90475.1| Putative CCR4-NOT transcription complex subunit 7 [Rhizopus microsporus]
Length=101

 Score =   134 bits (337),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 79/101 (78%), Gaps = 4/101 (4%)
 Frame = +1

Query  199  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQ  378
            +P +D   I+EVW  NLEEE   +R++V+DYP++AMDTEFPG+V RP+G+FK S DYHYQ
Sbjct  1    MPVNDVKYIKEVWAENLEEEMAYLRDLVEDYPYLAMDTEFPGVVARPIGSFKTSSDYHYQ  60

Query  379  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFR  501
            TL+ NVD+LK+IQLG+TF+D+ GNLP       C WQFNF+
Sbjct  61   TLRCNVDLLKIIQLGVTFADQHGNLP----GNVCTWQFNFK  97



>ref|XP_010497514.1| PREDICTED: probable CCR4-associated factor 1 homolog 2 [Camelina 
sativa]
Length=287

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 84/105 (80%), Gaps = 5/105 (5%)
 Frame = +1

Query  211  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSD----DYHYQ  378
            ++I+IREVW +NLE+E  LI + +DD+P++AMDTEFPGIV + V    N +    +Y+Y 
Sbjct  14   NTIEIREVWSHNLEQEMALIEQSIDDFPYVAMDTEFPGIVCKTVTANPNPNPKHYEYNYG  73

Query  379  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKY-CIWQFNFREFD  510
            TLK NV+MLKLIQLGLT SDE+GNLPTCGT+K  CIWQFNFREF+
Sbjct  74   TLKTNVNMLKLIQLGLTLSDERGNLPTCGTNKRQCIWQFNFREFN  118



>ref|XP_010476692.1| PREDICTED: probable CCR4-associated factor 1 homolog 2 [Camelina 
sativa]
Length=289

 Score =   138 bits (347),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 84/106 (79%), Gaps = 5/106 (5%)
 Frame = +1

Query  208  SDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSD----DYHY  375
            +++I+IREVW +NLE E  LI + +DD+P++AMDTEFPGIV + V    N +    +Y+Y
Sbjct  14   NNTIEIREVWSHNLEAEMALIEKSIDDFPYVAMDTEFPGIVCKTVTTNPNPNPKHYEYNY  73

Query  376  QTLKDNVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFD  510
             TLK NV+MLKLIQLGLT SDE+GNLPTCGT +K CIWQFNFREF+
Sbjct  74   GTLKTNVNMLKLIQLGLTLSDERGNLPTCGTNNKQCIWQFNFREFN  119



>ref|XP_009395283.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=269

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 82/108 (76%), Gaps = 4/108 (4%)
 Frame = +1

Query  199  LPKSD---SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            + KSD    ++IR+VW  NLE EF +IREVVDD+PF+AMDTEFPG+ +RP+G+FK   D 
Sbjct  1    MSKSDDDAGVEIRDVWADNLEAEFAVIREVVDDFPFVAMDTEFPGVAIRPLGDFKTVADS  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFD  510
            +Y  L+ NVD+L LIQLGLTFSD +GNLP   T  +  +WQFNFREFD
Sbjct  61   NYHILRANVDLLHLIQLGLTFSDAEGNLPATATGGRPIVWQFNFREFD  108



>dbj|BAD09890.1| putative CCR4-NOT transcription complex, subunit 7 [Oryza sativa 
Japonica Group]
 dbj|BAD09904.1| putative CCR4-NOT transcription complex, subunit 7 [Oryza sativa 
Japonica Group]
 gb|EAZ42877.1| hypothetical protein OsJ_27470 [Oryza sativa Japonica Group]
 dbj|BAG96259.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97485.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG98767.1| unnamed protein product [Oryza sativa Japonica Group]
Length=288

 Score =   137 bits (344),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 79/101 (78%), Gaps = 1/101 (1%)
 Frame = +1

Query  211  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKD  390
            + ++IREVW  NLE E   IR+ VD YP++AMDTEFPGIV RPVGNF+ +D+++Y  L+ 
Sbjct  14   EGVEIREVWAGNLEAEIAAIRDEVDRYPYVAMDTEFPGIVCRPVGNFRTTDEFNYANLEA  73

Query  391  NVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFD  510
            NV+MLKLIQLGLT SDE G+LP  GT  + CIWQFNFR FD
Sbjct  74   NVNMLKLIQLGLTLSDEGGDLPRRGTGGRRCIWQFNFRGFD  114



>ref|XP_006648046.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Oryza 
brachyantha]
Length=297

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 74/93 (80%), Gaps = 1/93 (1%)
 Frame = +1

Query  235  WDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKDNVDMLKLI  414
            W  NLE+EF LIR+VVD +PF+AMDTEFPGIV RPVG F++S DY+Y TLK NVDML LI
Sbjct  38   WADNLEKEFALIRDVVDKFPFVAMDTEFPGIVCRPVGAFRSSADYNYATLKANVDMLHLI  97

Query  415  QLGLTFSDEKGNLPTCG-TDKYCIWQFNFREFD  510
            QLGLTFS  +G LP  G   + C+WQFNFREFD
Sbjct  98   QLGLTFSGPRGELPVMGDGRRRCVWQFNFREFD  130



>emb|CAN81811.1| hypothetical protein VITISV_020892 [Vitis vinifera]
Length=179

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MSLLPKSDSIQIREVW+ NLEEEF LIR +VD++PFIAMDTEFPGIVLRPVGNFKNS+DY
Sbjct  1    MSLLPKSDSIQIREVWNDNLEEEFALIRGIVDEFPFIAMDTEFPGIVLRPVGNFKNSNDY  60

Query  370  HYQTLKDNVDM  402
            HYQTLKDNVD+
Sbjct  61   HYQTLKDNVDI  71



>emb|CDS05253.1| Putative CCR4-NOT transcription complex subunit7 [Absidia idahoensis 
var. thermophila]
Length=253

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 78/101 (77%), Gaps = 4/101 (4%)
 Frame = +1

Query  199  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQ  378
            +  SDS  IREVW  NLEEE   +R++V+DYP++AMDTEFPG+V RP+G F+ S DYHYQ
Sbjct  1    MHASDSNYIREVWADNLEEEMAYLRDLVEDYPYLAMDTEFPGVVARPIGTFRTSSDYHYQ  60

Query  379  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFR  501
            TL+ NVD+LK+IQLG+TF+DE GNLP       C WQFNF+
Sbjct  61   TLRCNVDLLKIIQLGVTFADEHGNLPR----NVCTWQFNFK  97



>ref|XP_009418496.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=276

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 80/109 (73%), Gaps = 2/109 (2%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS    + +++IR+VW  NLE EF +IRE+VDD+PF+AMDTEFPG+ +RP+G+FK   D 
Sbjct  1    MSKGDDASTVEIRDVWANNLEAEFAVIREIVDDFPFVAMDTEFPGVAVRPLGDFKTVADQ  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPT--CGTDKYCIWQFNFREFD  510
            +Y  L+ NVD+L LIQLGLTFSD  GNLPT         +WQFNFREFD
Sbjct  61   NYHILRANVDLLHLIQLGLTFSDADGNLPTSSAAGGHPVVWQFNFREFD  109



>ref|XP_002950174.1| hypothetical protein VOLCADRAFT_80930 [Volvox carteri f. nagariensis]
 gb|EFJ48842.1| hypothetical protein VOLCADRAFT_80930 [Volvox carteri f. nagariensis]
Length=320

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 81/104 (78%), Gaps = 1/104 (1%)
 Frame = +1

Query  196  LLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHY  375
            L    +++++REVW+ NLE EF LIR+ VD YP++AMDTEFPG+V +P+G FK+S +Y Y
Sbjct  6    LTATGETLRVREVWEDNLEAEFTLIRDFVDQYPYVAMDTEFPGVVAKPLGPFKSSREYLY  65

Query  376  QTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREF  507
            + LK NVDMLKLIQLGLTF+D KGNLP     + C+WQFNF+ F
Sbjct  66   RALKMNVDMLKLIQLGLTFTDAKGNLPRA-NGELCVWQFNFKGF  108



>ref|XP_009395282.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=269

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 80/108 (74%), Gaps = 1/108 (1%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS    +  ++ R+VW  NLE EF +IREVVDD+PF+AMDTEFPG+ +RP+G+FK   D 
Sbjct  1    MSKSDDAAGVEFRDVWADNLEAEFAVIREVVDDFPFVAMDTEFPGVAIRPLGDFKTVADS  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFD  510
            +Y  L+ NVD+L LIQLGLTFSD +GNLP   T  +  +WQFNFREFD
Sbjct  61   NYHILRANVDLLHLIQLGLTFSDAEGNLPASATGGRPIVWQFNFREFD  108



>gb|EYU24605.1| hypothetical protein MIMGU_mgv1a011876mg [Erythranthe guttata]
Length=268

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 87/108 (81%), Gaps = 1/108 (1%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            M L P +DSI  REVW  NL++EF++IR ++DDY  +AMDTEFPG++L+P+  F N+++ 
Sbjct  1    MYLQPPADSIDFREVWAENLDKEFEIIRSIIDDYYCVAMDTEFPGVILKPLRIFPNTNEE  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCG-TDKYCIWQFNFREFD  510
            +YQ LK+NV+ +KLIQLGLT ++EKG+LPTCG T  + +WQFNFR+F+
Sbjct  61   NYQCLKENVNTMKLIQLGLTLTNEKGDLPTCGETGLFIVWQFNFRDFN  108



>ref|XP_009396102.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=269

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 81/108 (75%), Gaps = 1/108 (1%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            M+   ++ +++IR+VW  NLE EF +IREVVDD+PF+AMDTEFPG+ +RP+G+FK   D 
Sbjct  1    MAKTAEAAAVEIRDVWAENLEAEFAVIREVVDDFPFVAMDTEFPGVAIRPLGDFKTVADS  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTC-GTDKYCIWQFNFREFD  510
            +Y  L+ NVD+L LIQLGLTFSD  GN P    + +  +WQFNFREFD
Sbjct  61   NYHILRANVDLLHLIQLGLTFSDADGNFPASPDSARPIVWQFNFREFD  108



>ref|XP_007877414.1| hypothetical protein PFL1_01713 [Pseudozyma flocculosa PF-1]
 gb|EPQ30814.1| hypothetical protein PFL1_01713 [Pseudozyma flocculosa PF-1]
Length=326

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 72/94 (77%), Gaps = 4/94 (4%)
 Frame = +1

Query  220  QIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKDNVD  399
            +IREVW  NLE E  L+RE +D YP++AMDTEFPGIV RP+G FK S DYHYQTL+ NVD
Sbjct  4    RIREVWAENLESEMALLRETIDKYPYVAMDTEFPGIVARPIGTFKGSSDYHYQTLRCNVD  63

Query  400  MLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFR  501
            +LKLIQLG+T  DE GNLP     + C WQFNFR
Sbjct  64   LLKLIQLGITLCDENGNLPP----EVCTWQFNFR  93



>ref|XP_006659446.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like, 
partial [Oryza brachyantha]
Length=280

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 77/101 (76%), Gaps = 1/101 (1%)
 Frame = +1

Query  211  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKD  390
            + ++IREVW  NLE E   IR+ VD Y F+AMDTEFPG+V RP+GNF+ +D+Y+Y  L+ 
Sbjct  7    EGVEIREVWAGNLEAEMAAIRDEVDRYRFVAMDTEFPGVVCRPLGNFRTADEYNYANLRA  66

Query  391  NVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFD  510
            NV+MLKLIQLGLT SDE G LP  GT  + CIWQFNFR FD
Sbjct  67   NVNMLKLIQLGLTLSDENGELPRRGTGGRPCIWQFNFRGFD  107



>emb|CEI89573.1| Putative CCR4-NOT transcription complex subunit 7 [Rhizopus microsporus]
Length=253

 Score =   134 bits (336),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 79/101 (78%), Gaps = 4/101 (4%)
 Frame = +1

Query  199  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQ  378
            +P +D   I+EVW  NLEEE   +R++V+DYP++AMDTEFPG+V RP+G+FK S DYHYQ
Sbjct  1    MPVNDVKYIKEVWAENLEEEMAYLRDLVEDYPYLAMDTEFPGVVARPIGSFKTSSDYHYQ  60

Query  379  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFR  501
            TL+ NVD+LK+IQLG+TF+D+ GNLP       C WQFNF+
Sbjct  61   TLRCNVDLLKIIQLGVTFADQHGNLP----GNVCTWQFNFK  97



>emb|CEG62914.1| Putative CCR4-NOT transcription complex subunit 7 [Rhizopus microsporus]
Length=291

 Score =   134 bits (338),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 79/101 (78%), Gaps = 4/101 (4%)
 Frame = +1

Query  199  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQ  378
            +P +D   I+EVW  NLEEE   +R++V+DYP++AMDTEFPG+V RP+G+FK S DYHYQ
Sbjct  1    MPVNDVKYIKEVWAENLEEEMAYLRDLVEDYPYLAMDTEFPGVVARPIGSFKTSSDYHYQ  60

Query  379  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFR  501
            TL+ NVD+LK+IQLG+TF+D+ GNLP       C WQFNF+
Sbjct  61   TLRCNVDLLKIIQLGVTFADQHGNLP----GNVCTWQFNFK  97



>emb|CDH53595.1| caf1 family protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=302

 Score =   135 bits (339),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 78/101 (77%), Gaps = 4/101 (4%)
 Frame = +1

Query  199  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQ  378
            +  +DS  IREVW  NLEEE   +R++V+DYP++AMDTEFPG+V RP+G F+ S DYHYQ
Sbjct  1    MHANDSNYIREVWADNLEEEMAYLRDLVEDYPYLAMDTEFPGVVARPIGTFRTSSDYHYQ  60

Query  379  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFR  501
            TL+ NVD+LK+IQLG+TF+DE GNLP       C WQFNF+
Sbjct  61   TLRCNVDLLKIIQLGVTFADEHGNLPR----NVCTWQFNFK  97



>ref|XP_004956826.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Setaria 
italica]
Length=279

 Score =   134 bits (337),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 80/103 (78%), Gaps = 1/103 (1%)
 Frame = +1

Query  205  KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTL  384
            K D ++IREVW  NLE EF +IR++VDDYP++AMDTEFPG+V RP+G +K++ +++Y TL
Sbjct  8    KPDDVEIREVWADNLEAEFAVIRDIVDDYPYVAMDTEFPGVVCRPLGTYKSAAEFNYATL  67

Query  385  KDNVDMLKLIQLGLTFSDEK-GNLPTCGTDKYCIWQFNFREFD  510
            K NVDMLKLIQLGLTFSDE  G        + C+WQFNFR FD
Sbjct  68   KANVDMLKLIQLGLTFSDEHGGLPALGPGGRPCVWQFNFRGFD  110



>ref|XP_008779663.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Phoenix 
dactylifera]
Length=268

 Score =   134 bits (336),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 83/110 (75%), Gaps = 3/110 (3%)
 Frame = +1

Query  190  MSLLPKSD-SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  366
            MS+  K+D  ++IREVW +NLE E  +IRE+VD+YPF+A+DTEFPG+V+ PV +FKN+ D
Sbjct  1    MSIPAKNDDPVEIREVWAHNLEAEMAVIREIVDEYPFVALDTEFPGVVITPVRDFKNNAD  60

Query  367  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLP--TCGTDKYCIWQFNFREFD  510
             +YQ  + NVD+L +IQ+G TFSD  G LP    G  + C+WQFNFREFD
Sbjct  61   ENYQKARANVDLLHVIQIGFTFSDASGCLPPSPSGVGRPCVWQFNFREFD  110



>gb|ACQ77596.1| CCR4-NOT [Dimocarpus longan]
Length=199

 Score =   132 bits (331),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 78/103 (76%), Gaps = 4/103 (4%)
 Frame = +1

Query  211  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLR---PVGNFKNSDDYHYQT  381
            D+I+IREVWD+NLE EF+LIR+V+D YP+I+MDTEFPGI+ R   P  + +   D HY+ 
Sbjct  9    DTIKIREVWDFNLESEFELIRQVIDHYPYISMDTEFPGIIYRSSKPYHSQRQPSD-HYEL  67

Query  382  LKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
            LK NVD L LIQ+GLT SD  GNLP  GTD   IWQFNFR+FD
Sbjct  68   LKSNVDALNLIQVGLTLSDSSGNLPDLGTDNQFIWQFNFRDFD  110



>ref|XP_004354599.1| CAF1 family protein [Dictyostelium fasciculatum]
 gb|EGG16215.1| CAF1 family protein [Dictyostelium fasciculatum]
Length=405

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 77/97 (79%), Gaps = 4/97 (4%)
 Frame = +1

Query  211  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKD  390
            D+ +IREVW +NLEEE  LIRE+VDDY +IAMDTEFPGIV RPVG+F+   DYHYQTL+ 
Sbjct  10   DTDEIREVWAHNLEEEMALIRELVDDYNYIAMDTEFPGIVTRPVGSFRTPSDYHYQTLRL  69

Query  391  NVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFR  501
            NVD+LK+IQLGLTFSD  GNL +      C WQFNF+
Sbjct  70   NVDLLKIIQLGLTFSDSDGNLAS----NTCTWQFNFK  102



>ref|XP_008796886.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Phoenix 
dactylifera]
Length=270

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 81/110 (74%), Gaps = 3/110 (3%)
 Frame = +1

Query  190  MSLLPKSD-SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  366
            MS+  K+D +++IREVW  NLE E  +IR++VD YPF+AMDTEFPG+ + PV  FK+  D
Sbjct  1    MSIPAKTDDAVEIREVWADNLEAEITVIRDIVDQYPFVAMDTEFPGVAITPVRAFKDIAD  60

Query  367  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPT--CGTDKYCIWQFNFREFD  510
             +YQTL+ NVD+L LIQ+G TFSD  G LP    G  + C+WQFNFREFD
Sbjct  61   KNYQTLRANVDLLHLIQIGFTFSDAAGRLPLSPSGGGRRCVWQFNFREFD  110



>gb|KDP38660.1| hypothetical protein JCGZ_04013 [Jatropha curcas]
Length=263

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 83/104 (80%), Gaps = 3/104 (3%)
 Frame = +1

Query  205  KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTL  384
             SDSI I+EVW++NLEEEF  IR +V+D+P+IA+DTEFPG +L+   N  +S    Y  +
Sbjct  2    SSDSITIKEVWEHNLEEEFVRIRAIVEDFPYIALDTEFPGFLLQRNQNV-DSTTSDYMIV  60

Query  385  KDNVDMLKLIQLGLTFSDEKGNLPTCGTD--KYCIWQFNFREFD  510
            ++NV++ +LIQLGLTFSDE+GNLPTC TD  KYC+WQFNFREFD
Sbjct  61   QNNVNLCRLIQLGLTFSDERGNLPTCETDSTKYCVWQFNFREFD  104



>ref|XP_007023404.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY26026.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 2 [Theobroma cacao]
Length=236

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +1

Query  304  MDTEFPGIVLRPVGNFKNSDDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCI  483
            MDTEFPG+VLRP+GNFK   DY+YQTLKDNVDMLKLIQLGLTFSDE+GNLPTCGTDKYCI
Sbjct  1    MDTEFPGVVLRPLGNFKYICDYNYQTLKDNVDMLKLIQLGLTFSDEEGNLPTCGTDKYCI  60

Query  484  WQFNFREFD  510
            WQFNFREF+
Sbjct  61   WQFNFREFN  69



>emb|CDS11386.1| Putative CCR4-NOT transcription complex subunit7 [Absidia idahoensis 
var. thermophila]
Length=253

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 78/101 (77%), Gaps = 4/101 (4%)
 Frame = +1

Query  199  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQ  378
            +  +DS  I+EVW  NLEEE   +R++V++YP++AMDTEFPG+V RP+G F+ S DYHYQ
Sbjct  1    MHANDSAYIKEVWSENLEEEMAHLRDLVEEYPYLAMDTEFPGVVARPIGTFRTSSDYHYQ  60

Query  379  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFR  501
            TL+ NVD+LK+IQLG+TF+DE GNLP       C WQFNF+
Sbjct  61   TLRCNVDVLKIIQLGITFADEHGNLPR----NICTWQFNFK  97



>gb|ETS62597.1| hypothetical protein PaG_03234 [Pseudozyma aphidis DSM 70725]
Length=317

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 71/94 (76%), Gaps = 4/94 (4%)
 Frame = +1

Query  220  QIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKDNVD  399
            +IREVW  NLE E  L+RE +D YP++AMDTEFPGIV RP+G FK S DYHYQTL+ NVD
Sbjct  4    RIREVWAENLEIEMALLRETIDKYPYVAMDTEFPGIVARPIGTFKGSSDYHYQTLRCNVD  63

Query  400  MLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFR  501
            +LKLIQLG+T  DE GNLP       C WQFNFR
Sbjct  64   LLKLIQLGITLCDENGNLPP----DVCTWQFNFR  93



>emb|CEP13830.1| hypothetical protein [Parasitella parasitica]
Length=302

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 79/101 (78%), Gaps = 4/101 (4%)
 Frame = +1

Query  199  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQ  378
            +P +D+  I+EVW  NLEEE   +R++V++YP++AMDTEFPG+V RP+G FK S DYHYQ
Sbjct  1    MPVNDAKYIKEVWAENLEEEMAYLRDLVEEYPYLAMDTEFPGVVARPIGTFKTSSDYHYQ  60

Query  379  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFR  501
            TL+ NVD+LK+IQLG+TF+D+ GNLP       C WQFNF+
Sbjct  61   TLRCNVDLLKIIQLGVTFADQYGNLP----GNICTWQFNFK  97



>ref|XP_002507260.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68518.1| predicted protein [Micromonas sp. RCC299]
Length=273

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 79/101 (78%), Gaps = 3/101 (3%)
 Frame = +1

Query  208  SDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLK  387
            +D++  REVW  NL+EE  +IR ++D+YP+IAMDTEFPG+V RPVG +++  DY YQTL+
Sbjct  8    NDNLLTREVWGSNLDEELAIIRNLIDEYPYIAMDTEFPGVVARPVGTYRS--DYQYQTLR  65

Query  388  DNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
             NVD+LKLIQLG+T +D  GNLP      YC+WQFNFREFD
Sbjct  66   CNVDLLKLIQLGITLTDGDGNLPLI-AGHYCVWQFNFREFD  105



>dbj|GAK65069.1| ribonuclease CAF1 [Pseudozyma antarctica]
Length=317

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 71/94 (76%), Gaps = 4/94 (4%)
 Frame = +1

Query  220  QIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKDNVD  399
            +IREVW  NLE E  L+RE +D YP++AMDTEFPGIV RP+G FK S DYHYQTL+ NVD
Sbjct  4    RIREVWAENLEIEMALLRETIDKYPYVAMDTEFPGIVARPIGTFKGSSDYHYQTLRCNVD  63

Query  400  MLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFR  501
            +LKLIQLG+T  DE GNLP       C WQFNFR
Sbjct  64   LLKLIQLGITLCDENGNLPP----DVCTWQFNFR  93



>gb|EPB85653.1| CCR4-NOT transcription complex subunit 7 [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=253

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 79/101 (78%), Gaps = 4/101 (4%)
 Frame = +1

Query  199  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQ  378
            +P +D+  I+EVW  NLEEE   +R++V++YP++AMDTEFPG+V RP+G FK S DYHYQ
Sbjct  1    MPVNDAKYIKEVWAENLEEEMAHLRDLVEEYPYLAMDTEFPGVVARPIGTFKTSSDYHYQ  60

Query  379  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFR  501
            TL+ NVD+LK+IQLG+TF+D+ GNLP       C WQFNF+
Sbjct  61   TLRCNVDLLKIIQLGVTFADQYGNLP----GNICTWQFNFK  97



>ref|XP_003574542.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Brachypodium 
distachyon]
Length=294

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 79/102 (77%), Gaps = 2/102 (2%)
 Frame = +1

Query  211  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPV-GNFKNSDDYHYQTLK  387
            D ++IREVW  N++ EF +IRE++DDY ++AMDTEFPG+V RPV GN++ +D+Y+Y TLK
Sbjct  20   DGVEIREVWADNVDAEFAVIREIIDDYRYVAMDTEFPGVVCRPVGGNYRTNDEYNYVTLK  79

Query  388  DNVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFD  510
             NVDML LIQLGLT  DE G LP  GT  + C WQFNFR FD
Sbjct  80   ANVDMLSLIQLGLTLCDESGALPPRGTGGRPCAWQFNFRGFD  121



>ref|XP_007509231.1| Caf1 CCR4-associated (transcription) factor 1 [Bathycoccus prasinos]
 emb|CCO19688.1| Caf1 CCR4-associated (transcription) factor 1 [Bathycoccus prasinos]
Length=273

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 77/101 (76%), Gaps = 1/101 (1%)
 Frame = +1

Query  208  SDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLK  387
            S ++  REVW  NL+EE  +IR++V  +P+IAMDTEFPG+V RPVG FK   ++HYQTLK
Sbjct  5    SYNLLTREVWSDNLDEEVAIIRKLVQAFPYIAMDTEFPGVVARPVGAFKQQSEFHYQTLK  64

Query  388  DNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD  510
             NVDMLKLIQLGLT +D  GNLP     +YC+WQFNF EF+
Sbjct  65   CNVDMLKLIQLGLTLTDANGNLPII-DGRYCLWQFNFGEFN  104



>dbj|GAN07390.1| CCR4 associated factor [Mucor ambiguus]
Length=308

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 79/101 (78%), Gaps = 4/101 (4%)
 Frame = +1

Query  199  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQ  378
            +P +D+  I+EVW  NLEEE   +R++V++YP++AMDTEFPG+V RP+G FK S DYHYQ
Sbjct  1    MPVNDAKYIKEVWAENLEEEMAHLRDLVEEYPYLAMDTEFPGVVARPIGTFKTSSDYHYQ  60

Query  379  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFR  501
            TL+ NVD+LK+IQLG+TF+D+ GNLP       C WQFNF+
Sbjct  61   TLRCNVDLLKIIQLGVTFADQYGNLP----GNICTWQFNFK  97



>ref|XP_009266106.1| CCR4-NOT transcription complex subunit 7 [Wallemia ichthyophaga 
EXF-994]
 gb|EOR03889.1| CCR4-NOT transcription complex subunit 7 [Wallemia ichthyophaga 
EXF-994]
Length=306

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 77/94 (82%), Gaps = 5/94 (5%)
 Frame = +1

Query  220  QIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKDNVD  399
            QIREVW  NL+ E D++RE+VD YP+++MDTEFPG+V RP+GNFKNS DYHYQTL+ NVD
Sbjct  4    QIREVWADNLDAELDILRELVDRYPYVSMDTEFPGVVARPIGNFKNSSDYHYQTLRCNVD  63

Query  400  MLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFR  501
            +LK+IQLG+T +D +GN+P     +Y  WQFNF+
Sbjct  64   LLKIIQLGITIADAEGNMP-----EYPTWQFNFK  92



>ref|XP_006956137.1| ribonuclease CAF1 [Wallemia sebi CBS 633.66]
 gb|EIM23480.1| ribonuclease CAF1 [Wallemia sebi CBS 633.66]
Length=248

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 76/94 (81%), Gaps = 5/94 (5%)
 Frame = +1

Query  220  QIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKDNVD  399
            QIREVW  NL+ E D++RE+VD YP+++MDTEFPG+V RP+GNFKNS DYHYQTL+ NVD
Sbjct  4    QIREVWADNLDAELDILRELVDRYPYVSMDTEFPGVVARPIGNFKNSSDYHYQTLRCNVD  63

Query  400  MLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFR  501
            +LK+IQLG+T +D  GN+P     +Y  WQFNF+
Sbjct  64   LLKIIQLGITIADADGNMP-----EYPTWQFNFK  92



>ref|XP_010459127.1| PREDICTED: probable CCR4-associated factor 1 homolog 2 [Camelina 
sativa]
Length=289

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 83/107 (78%), Gaps = 7/107 (7%)
 Frame = +1

Query  211  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSD------DYH  372
            ++I+IREVW +NLE E   I + +DD+P++AMDTEFPGIV + V    N +      +Y+
Sbjct  14   NTIEIREVWHHNLEAEMARIEQYIDDFPYVAMDTEFPGIVCKTVTTNPNPNPNPKHYEYN  73

Query  373  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFD  510
            Y+TLK NV+MLKLIQLGLT SDE+GNLPTCGT +K CIWQFNFREF+
Sbjct  74   YETLKTNVNMLKLIQLGLTLSDERGNLPTCGTNNKQCIWQFNFREFN  120



>emb|CBQ71168.1| probable CCR4-NOT transcription complex, subunit 7 [Sporisorium 
reilianum SRZ2]
Length=317

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 71/94 (76%), Gaps = 4/94 (4%)
 Frame = +1

Query  220  QIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKDNVD  399
            +IREVW  NLE E  L+RE ++ YP++AMDTEFPGIV RP+G FK S DYHYQTL+ NVD
Sbjct  4    RIREVWAENLEVEMTLLRETIEKYPYVAMDTEFPGIVARPIGTFKGSSDYHYQTLRCNVD  63

Query  400  MLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFR  501
            +LKLIQLG+T  DE GNLP       C WQFNFR
Sbjct  64   LLKLIQLGITLCDENGNLPP----DVCTWQFNFR  93



>ref|NP_001140241.1| uncharacterized protein LOC100272282 [Zea mays]
 gb|ACF83416.1| unknown [Zea mays]
 gb|ACG35731.1| CCR4-NOT transcription complex subunit 8 [Zea mays]
 tpg|DAA48917.1| TPA: CCR4-NOT transcription complex subunit 8 [Zea mays]
Length=286

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 81/112 (72%), Gaps = 5/112 (4%)
 Frame = +1

Query  190  MSLLPKS----DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKN  357
            M+ LP +    D+++IREVW  NLEEEF +IR VVD YP++AMDTEFPG V+ P   ++ 
Sbjct  1    MAALPPAAEDPDAVEIREVWASNLEEEFAVIRAVVDVYPYVAMDTEFPGFVVTPSAEYRF  60

Query  358  SDDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFD  510
            + D +Y  L+ NV++LKLIQLGLT S+  G LP CGT  + CIWQFNFR FD
Sbjct  61   TCDRNYAALEGNVNVLKLIQLGLTLSNGAGALPPCGTGGRRCIWQFNFRGFD  112



>gb|KFK43832.1| hypothetical protein AALP_AA1G179300 [Arabis alpina]
Length=272

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 83/108 (77%), Gaps = 1/108 (1%)
 Frame = +1

Query  190  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  369
            MS+  +  SI+IR+VWD N+E+E  LI + VDD+P++AMDTEFPGIV + V    +    
Sbjct  1    MSVDDEDSSIEIRQVWDKNVEQELSLISQYVDDFPYVAMDTEFPGIVCKSVTVDPSPRRN  60

Query  370  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFD  510
             Y++LK NV+ML LIQLGLT SD++GNLPTCGT +K C+WQFNFREF+
Sbjct  61   CYESLKTNVNMLNLIQLGLTLSDDQGNLPTCGTNNKQCVWQFNFREFN  108



>emb|CCF48047.1| probable CCR4-NOT transcription complex, subunit 7 [Ustilago 
hordei]
Length=317

 Score =   133 bits (334),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 71/94 (76%), Gaps = 4/94 (4%)
 Frame = +1

Query  220  QIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKDNVD  399
            +IREVW  NLE E  L+RE ++ YP++AMDTEFPGIV RP+G FK S DYHYQTL+ NVD
Sbjct  4    RIREVWSENLEMEMVLLRETIEKYPYVAMDTEFPGIVARPIGTFKGSSDYHYQTLRCNVD  63

Query  400  MLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFR  501
            +LKLIQLG+T  DE GNLP       C WQFNFR
Sbjct  64   LLKLIQLGITLCDENGNLPP----DVCTWQFNFR  93



>emb|CDH54244.1| ccr4-not transcription complex subunit 7 [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=303

 Score =   132 bits (333),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 78/101 (77%), Gaps = 4/101 (4%)
 Frame = +1

Query  199  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQ  378
            +  +DS  I+EVW  NLEEE   +R++V++YP++AMDTEFPG+V RP+G F+ S DYHYQ
Sbjct  1    MHANDSAYIKEVWSENLEEEMAHLRDLVEEYPYLAMDTEFPGVVARPIGTFRTSSDYHYQ  60

Query  379  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFR  501
            TL+ NVD+LK+IQLG+TF+DE GN+P       C WQFNF+
Sbjct  61   TLRCNVDVLKIIQLGITFADEHGNIPR----NICTWQFNFK  97



>ref|XP_002444415.1| hypothetical protein SORBIDRAFT_07g021610 [Sorghum bicolor]
 gb|EES13910.1| hypothetical protein SORBIDRAFT_07g021610 [Sorghum bicolor]
Length=286

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 77/101 (76%), Gaps = 1/101 (1%)
 Frame = +1

Query  211  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKD  390
            D+++IREVW  NLEEEF +IR VVD YP++AMDTEFPG V++P   ++ + D +Y  L+ 
Sbjct  12   DAVEIREVWAGNLEEEFAVIRAVVDAYPYVAMDTEFPGFVVKPSAEYRFTCDRNYAALEG  71

Query  391  NVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFD  510
            NV++LKLIQLGLT S+  G LP CGT  + CIWQFNFR FD
Sbjct  72   NVNVLKLIQLGLTLSNGAGALPPCGTGGRGCIWQFNFRGFD  112



>gb|KFH71636.1| hypothetical protein MVEG_01932 [Mortierella verticillata NRRL 
6337]
Length=307

 Score =   132 bits (332),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 75/93 (81%), Gaps = 4/93 (4%)
 Frame = +1

Query  223  IREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKDNVDM  402
            IREVW  NL++E  L+R++VD YP++AMDTEFPG+V RP+GNF+ S DYHYQTL+ NVD+
Sbjct  10   IREVWAENLDQEMALLRDLVDQYPYLAMDTEFPGVVARPIGNFRTSADYHYQTLRCNVDL  69

Query  403  LKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFR  501
            LK+IQLG+TF+DE GN+P       C WQFNF+
Sbjct  70   LKMIQLGVTFADENGNVPK----DACTWQFNFK  98



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557408213115