BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF007H14

Length=523
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009800816.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    152   3e-40   Nicotiana sylvestris
ref|XP_011093028.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    151   8e-40   Sesamum indicum [beniseed]
ref|XP_006339720.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    151   1e-39   Solanum tuberosum [potatoes]
ref|XP_004248083.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    150   1e-39   Solanum lycopersicum
ref|XP_009613969.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    149   7e-39   Nicotiana tomentosiformis
ref|XP_009600181.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    147   2e-38   
ref|XP_006362137.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    145   6e-38   Solanum tuberosum [potatoes]
gb|EYU32252.1|  hypothetical protein MIMGU_mgv1a005685mg                145   1e-37   Erythranthe guttata [common monkey flower]
gb|EYU38885.1|  hypothetical protein MIMGU_mgv1a026932mg                144   3e-37   Erythranthe guttata [common monkey flower]
gb|EYU40714.1|  hypothetical protein MIMGU_mgv1a019320mg                143   5e-37   Erythranthe guttata [common monkey flower]
ref|XP_004229990.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    143   9e-37   Solanum lycopersicum
ref|XP_009775618.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    141   3e-36   Nicotiana sylvestris
gb|KDP28482.1|  hypothetical protein JCGZ_14253                         140   6e-36   Jatropha curcas
ref|XP_006444833.1|  hypothetical protein CICLE_v10019938mg             139   2e-35   Citrus clementina [clementine]
ref|XP_006491285.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    139   2e-35   Citrus sinensis [apfelsine]
ref|XP_011093892.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    138   3e-35   Sesamum indicum [beniseed]
ref|XP_008351846.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    136   1e-34   
ref|XP_008343434.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    136   1e-34   
ref|XP_006418409.1|  hypothetical protein EUTSA_v10009389mg             136   2e-34   Eutrema salsugineum [saltwater cress]
gb|KEH24641.1|  eukaryotic aspartyl protease family protein             135   3e-34   Medicago truncatula
ref|XP_002892074.1|  aspartyl protease family protein                   135   4e-34   
ref|XP_010053832.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    135   4e-34   Eucalyptus grandis [rose gum]
emb|CDY15187.1|  BnaC05g00660D                                          135   5e-34   Brassica napus [oilseed rape]
ref|XP_004494825.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    134   9e-34   
ref|XP_007217966.1|  hypothetical protein PRUPE_ppa005289mg             133   2e-33   
ref|XP_011038277.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    132   6e-33   Populus euphratica
ref|XP_009336767.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    132   7e-33   Pyrus x bretschneideri [bai li]
ref|XP_010474721.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    132   7e-33   Camelina sativa [gold-of-pleasure]
ref|XP_002523337.1|  Aspartic proteinase nepenthesin-1 precursor,...    131   9e-33   Ricinus communis
emb|CDP08669.1|  unnamed protein product                                131   1e-32   Coffea canephora [robusta coffee]
ref|XP_011023172.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   2e-32   Populus euphratica
ref|XP_010095748.1|  Aspartic proteinase nepenthesin-1                  130   2e-32   Morus notabilis
gb|KJB49569.1|  hypothetical protein B456_008G125700                    130   2e-32   Gossypium raimondii
ref|XP_010266550.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    129   5e-32   Nelumbo nucifera [Indian lotus]
ref|XP_008376086.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    129   5e-32   Malus domestica [apple tree]
emb|CBI40559.3|  unnamed protein product                                129   7e-32   Vitis vinifera
ref|XP_002263964.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    128   1e-31   Vitis vinifera
gb|AAM66061.1|  chloroplast nucleoid DNA binding protein, putative      128   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010457141.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    128   2e-31   Camelina sativa [gold-of-pleasure]
ref|NP_171637.1|  aspartyl protease family protein                      127   3e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008461984.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   4e-31   
ref|XP_004139658.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    126   5e-31   Cucumis sativus [cucumbers]
ref|XP_002320868.1|  aspartyl protease family protein                   126   6e-31   Populus trichocarpa [western balsam poplar]
gb|EPS66029.1|  hypothetical protein M569_08742                         126   7e-31   Genlisea aurea
emb|CDX90023.1|  BnaA10g00590D                                          126   8e-31   
ref|XP_009119684.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    125   9e-31   Brassica rapa
gb|KFK42512.1|  hypothetical protein AALP_AA1G003500                    125   2e-30   Arabis alpina [alpine rockcress]
ref|XP_002302634.2|  aspartyl protease family protein                   124   4e-30   Populus trichocarpa [western balsam poplar]
ref|XP_010665756.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   6e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007147317.1|  hypothetical protein PHAVU_006G113700g             123   1e-29   Phaseolus vulgaris [French bean]
ref|XP_006307379.1|  hypothetical protein CARUB_v10009005mg             121   4e-29   Capsella rubella
ref|XP_010556596.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   8e-29   Tarenaya hassleriana [spider flower]
ref|XP_004306664.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   8e-29   Fragaria vesca subsp. vesca
emb|CDY43952.1|  BnaC04g21580D                                          120   1e-28   Brassica napus [oilseed rape]
ref|XP_010512555.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   3e-28   Camelina sativa [gold-of-pleasure]
emb|CDX89133.1|  BnaA04g00530D                                          119   3e-28   
ref|XP_010469025.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   3e-28   Camelina sativa [gold-of-pleasure]
ref|XP_009138753.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    118   5e-28   Brassica rapa
gb|KFK35370.1|  hypothetical protein AALP_AA5G276300                    118   6e-28   Arabis alpina [alpine rockcress]
ref|XP_010413342.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    117   9e-28   Camelina sativa [gold-of-pleasure]
ref|XP_002878415.1|  aspartyl protease family protein                   115   6e-27   
ref|XP_003554768.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   7e-27   Glycine max [soybeans]
ref|XP_007051537.1|  Eukaryotic aspartyl protease family protein ...    115   8e-27   
gb|AGV54495.1|  aspartic proteinase nepenthesin-1-like protein          114   1e-26   Phaseolus vulgaris [French bean]
ref|XP_010918360.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   1e-26   Elaeis guineensis
ref|XP_007135265.1|  hypothetical protein PHAVU_010G114700g             114   2e-26   Phaseolus vulgaris [French bean]
gb|AGV54447.1|  aspartic proteinase nepenthesin-1 precursor             114   2e-26   Phaseolus vulgaris [French bean]
ref|XP_007051536.1|  Eukaryotic aspartyl protease family protein ...    114   3e-26   
ref|XP_010480432.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    113   3e-26   Camelina sativa [gold-of-pleasure]
ref|XP_008437888.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    112   6e-26   Cucumis melo [Oriental melon]
ref|XP_004133810.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    112   7e-26   Cucumis sativus [cucumbers]
gb|KGN56421.1|  Aspartic proteinase nepenthesin-1                       112   8e-26   Cucumis sativus [cucumbers]
emb|CDY25081.1|  BnaC06g18230D                                          111   1e-25   Brassica napus [oilseed rape]
ref|XP_008799615.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    111   1e-25   Phoenix dactylifera
gb|AAK64003.1|  AT3g61820/F15G16_210                                    110   2e-25   Arabidopsis thaliana [mouse-ear cress]
gb|ABK24467.1|  unknown                                                 110   3e-25   Picea sitchensis
ref|NP_191741.1|  aspartyl protease                                     110   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011461997.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   4e-25   Fragaria vesca subsp. vesca
gb|KJB09628.1|  hypothetical protein B456_001G154400                    109   5e-25   Gossypium raimondii
gb|KJB09626.1|  hypothetical protein B456_001G154400                    109   8e-25   Gossypium raimondii
ref|XP_003529886.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   9e-25   Glycine max [soybeans]
ref|XP_009394177.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010544842.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   3e-24   Tarenaya hassleriana [spider flower]
gb|KJB41527.1|  hypothetical protein B456_007G108800                    106   7e-24   Gossypium raimondii
ref|XP_009104352.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   1e-23   Brassica rapa
ref|XP_004171805.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    104   3e-23   
emb|CDX67868.1|  BnaA07g19080D                                          105   3e-23   
ref|XP_010924503.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   2e-22   Elaeis guineensis
ref|XP_004969076.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   2e-22   Setaria italica
ref|NP_001043485.1|  Os01g0598600                                       102   4e-22   
gb|EAZ12575.1|  hypothetical protein OsJ_02481                          101   7e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003569303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   2e-21   Brachypodium distachyon [annual false brome]
ref|XP_006402438.1|  hypothetical protein EUTSA_v10005923mg           99.4    4e-21   Eutrema salsugineum [saltwater cress]
tpg|DAA58835.1|  TPA: hypothetical protein ZEAMMB73_701358            97.1    2e-20   
ref|XP_003520873.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  96.7    3e-20   Glycine max [soybeans]
ref|XP_011007544.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  96.3    6e-20   Populus euphratica
ref|XP_011031192.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  96.3    6e-20   Populus euphratica
ref|XP_002440367.1|  hypothetical protein SORBIDRAFT_09g030430        95.9    7e-20   
gb|KEH44446.1|  aspartic protease in GUARD CELL-like protein          95.5    1e-19   Medicago truncatula
gb|KJB49971.1|  hypothetical protein B456_008G147500                  94.7    2e-19   Gossypium raimondii
gb|ABK25248.1|  unknown                                               93.2    2e-19   Picea sitchensis
ref|XP_010279486.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.4    2e-19   Nelumbo nucifera [Indian lotus]
ref|XP_006852628.1|  hypothetical protein AMTR_s00021p00234660        94.4    3e-19   Amborella trichopoda
ref|XP_009629151.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.4    3e-19   Nicotiana tomentosiformis
gb|KHN16429.1|  Aspartic proteinase nepenthesin-1                     88.2    5e-19   Glycine soja [wild soybean]
ref|XP_002306246.2|  hypothetical protein POPTR_0005s06390g           93.6    6e-19   Populus trichocarpa [western balsam poplar]
gb|KDP40474.1|  hypothetical protein JCGZ_24473                       93.2    6e-19   Jatropha curcas
ref|XP_004497254.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  93.2    6e-19   Cicer arietinum [garbanzo]
ref|XP_008244017.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  93.2    7e-19   Prunus mume [ume]
ref|NP_001056485.1|  Os05g0590000                                     92.8    8e-19   
ref|XP_007209939.1|  hypothetical protein PRUPE_ppa004726mg           93.2    8e-19   Prunus persica
gb|KJB77420.1|  hypothetical protein B456_012G135900                  92.8    8e-19   Gossypium raimondii
gb|ABK24480.1|  unknown                                               93.2    8e-19   Picea sitchensis
gb|AAT38006.1|  unknow protein                                        92.8    9e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009145889.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  92.8    9e-19   Brassica rapa
gb|EAY99240.1|  hypothetical protein OsI_21202                        92.8    9e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_009337317.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  92.8    9e-19   Pyrus x bretschneideri [bai li]
emb|CDX92240.1|  BnaA05g21670D                                        92.8    9e-19   
gb|ABR17085.1|  unknown                                               92.8    1e-18   Picea sitchensis
ref|XP_009337150.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  92.8    1e-18   Pyrus x bretschneideri [bai li]
ref|XP_006345303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  92.4    1e-18   Solanum tuberosum [potatoes]
gb|KJB79793.1|  hypothetical protein B456_013G067200                  92.0    2e-18   Gossypium raimondii
gb|ABR16474.1|  unknown                                               92.0    2e-18   Picea sitchensis
ref|XP_002455897.1|  hypothetical protein SORBIDRAFT_03g026970        91.7    2e-18   
emb|CDY24483.1|  BnaC05g34710D                                        91.3    3e-18   Brassica napus [oilseed rape]
ref|XP_011022942.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  91.3    4e-18   Populus euphratica
ref|XP_010541885.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.8    4e-18   
ref|XP_006440937.1|  hypothetical protein CICLE_v10019848mg           90.9    5e-18   Citrus clementina [clementine]
ref|XP_002309912.2|  hypothetical protein POPTR_0007s04120g           90.9    5e-18   Populus trichocarpa [western balsam poplar]
ref|XP_007142740.1|  hypothetical protein PHAVU_007G013000g           90.5    5e-18   Phaseolus vulgaris [French bean]
ref|XP_010533981.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.9    5e-18   Tarenaya hassleriana [spider flower]
ref|XP_003637421.1|  Aspartic proteinase nepenthesin-1                88.6    5e-18   
ref|XP_006406427.1|  hypothetical protein EUTSA_v10020671mg           90.5    6e-18   Eutrema salsugineum [saltwater cress]
gb|KFK39179.1|  hypothetical protein AALP_AA3G210500                  90.5    6e-18   Arabis alpina [alpine rockcress]
dbj|BAJ86414.1|  predicted protein                                    90.5    7e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006847790.1|  hypothetical protein AMTR_s00029p00016750        90.5    7e-18   Amborella trichopoda
ref|XP_004961034.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.5    8e-18   Setaria italica
ref|XP_010551288.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.5    8e-18   Tarenaya hassleriana [spider flower]
gb|KDO64536.1|  hypothetical protein CISIN_1g011045mg                 90.1    9e-18   Citrus sinensis [apfelsine]
ref|XP_006485768.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.1    9e-18   Citrus sinensis [apfelsine]
ref|XP_009112699.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.1    9e-18   Brassica rapa
ref|XP_004147103.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.7    1e-17   Cucumis sativus [cucumbers]
ref|XP_004236867.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.7    1e-17   Solanum lycopersicum
ref|XP_008802841.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.7    1e-17   Phoenix dactylifera
ref|XP_003555824.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.7    1e-17   Glycine max [soybeans]
ref|XP_006415880.1|  hypothetical protein EUTSA_v10009899mg           89.7    1e-17   Eutrema salsugineum [saltwater cress]
ref|XP_008374731.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.7    1e-17   
ref|XP_010549135.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.7    1e-17   Tarenaya hassleriana [spider flower]
ref|XP_010248951.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.4    1e-17   Nelumbo nucifera [Indian lotus]
gb|KDO69941.1|  hypothetical protein CISIN_1g011042mg                 89.4    1e-17   Citrus sinensis [apfelsine]
ref|XP_003536757.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.4    1e-17   Glycine max [soybeans]
ref|XP_008351878.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.4    1e-17   
emb|CDY69364.1|  BnaCnng63170D                                        89.4    2e-17   Brassica napus [oilseed rape]
gb|EYU40681.1|  hypothetical protein MIMGU_mgv1a005122mg              89.4    2e-17   Erythranthe guttata [common monkey flower]
ref|XP_008367576.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.4    2e-17   
ref|XP_011459743.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  86.7    2e-17   Fragaria vesca subsp. vesca
ref|XP_010935575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.0    2e-17   Elaeis guineensis
ref|XP_007152794.1|  hypothetical protein PHAVU_004G160200g           89.0    2e-17   Phaseolus vulgaris [French bean]
ref|XP_010551158.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.0    2e-17   Tarenaya hassleriana [spider flower]
ref|XP_006437655.1|  hypothetical protein CICLE_v10031332mg           89.0    2e-17   
ref|XP_006484478.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.0    2e-17   Citrus sinensis [apfelsine]
ref|XP_006298983.1|  hypothetical protein CARUB_v10015108mg           89.0    2e-17   Capsella rubella
gb|KJB37242.1|  hypothetical protein B456_006G195400                  88.6    3e-17   Gossypium raimondii
ref|XP_009351765.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.0    3e-17   
gb|KEH44258.1|  aspartic protease in GUARD CELL-like protein          88.6    3e-17   Medicago truncatula
ref|XP_004498097.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.6    3e-17   Cicer arietinum [garbanzo]
ref|XP_004498098.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.2    3e-17   
ref|XP_011089579.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  88.2    4e-17   Sesamum indicum [beniseed]
ref|XP_009760593.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.2    4e-17   Nicotiana sylvestris
ref|XP_010466176.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.8    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010487964.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.8    5e-17   Camelina sativa [gold-of-pleasure]
ref|XP_002513132.1|  Aspartic proteinase nepenthesin-1 precursor,...  87.8    5e-17   Ricinus communis
ref|XP_010506935.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.8    5e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006360843.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.8    6e-17   Solanum tuberosum [potatoes]
ref|XP_008340423.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.2    6e-17   Malus domestica [apple tree]
ref|XP_007043208.1|  Aspartic proteinase nepenthesin-1, putative      87.4    6e-17   
ref|XP_010908909.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.0    9e-17   
ref|XP_008359997.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  87.4    9e-17   Malus domestica [apple tree]
ref|XP_002267930.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.0    9e-17   Vitis vinifera
ref|XP_010465949.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.0    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010487776.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.0    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010508355.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  86.7    1e-16   Camelina sativa [gold-of-pleasure]
emb|CBI35367.3|  unnamed protein product                              87.0    1e-16   Vitis vinifera
ref|NP_188478.1|  protein ASPARTIC PROTEASE IN GUARD CELL 1           86.7    1e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDY25371.1|  BnaA05g19130D                                        85.9    1e-16   Brassica napus [oilseed rape]
emb|CDY24395.1|  BnaCnng04620D                                        86.7    1e-16   Brassica napus [oilseed rape]
emb|CDY24567.1|  BnaC05g32510D                                        85.5    1e-16   Brassica napus [oilseed rape]
ref|XP_007153018.1|  hypothetical protein PHAVU_003G000900g           86.3    2e-16   Phaseolus vulgaris [French bean]
ref|XP_010036867.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  86.7    2e-16   
ref|XP_009385987.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  86.3    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008351877.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  86.3    2e-16   
ref|XP_002885351.1|  pepsin A                                         86.3    2e-16   Arabidopsis lyrata subsp. lyrata
gb|KDP20100.1|  hypothetical protein JCGZ_05869                       86.3    2e-16   Jatropha curcas
ref|XP_004297710.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  86.3    2e-16   Fragaria vesca subsp. vesca
ref|XP_002885261.1|  aspartyl protease family protein                 86.3    2e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_002990366.1|  hypothetical protein SELMODRAFT_43971            85.9    2e-16   
ref|XP_006406598.1|  hypothetical protein EUTSA_v10020568mg           86.3    2e-16   Eutrema salsugineum [saltwater cress]
gb|AAL87345.1|  putative chloroplast nucleoid DNA-binding protein     86.3    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008465249.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.9    2e-16   Cucumis melo [Oriental melon]
gb|KFK39328.1|  hypothetical protein AALP_AA3G230300                  85.5    3e-16   Arabis alpina [alpine rockcress]
ref|XP_010103590.1|  Aspartic proteinase nepenthesin-2                85.9    3e-16   Morus notabilis
ref|XP_008445900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.5    3e-16   Cucumis melo [Oriental melon]
ref|XP_004137465.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.5    3e-16   Cucumis sativus [cucumbers]
ref|XP_004157423.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.5    3e-16   
ref|XP_002970504.1|  hypothetical protein SELMODRAFT_93504            85.5    3e-16   
ref|XP_006297584.1|  hypothetical protein CARUB_v10013606mg           85.5    4e-16   Capsella rubella
ref|XP_009145693.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.5    4e-16   Brassica rapa
ref|XP_008791252.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.5    4e-16   
ref|XP_010477900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.5    4e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009607692.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.5    4e-16   Nicotiana tomentosiformis
ref|XP_008457107.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.1    4e-16   
ref|XP_009346910.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.1    5e-16   Pyrus x bretschneideri [bai li]
ref|NP_188636.2|  protein ASPARTIC PROTEASE IN GUARD CELL 2           85.1    5e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDY51131.1|  BnaA07g37140D                                        84.7    5e-16   Brassica napus [oilseed rape]
ref|XP_010031370.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.1    6e-16   Eucalyptus grandis [rose gum]
ref|XP_011008360.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.7    7e-16   Populus euphratica
ref|XP_010460347.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.7    7e-16   Camelina sativa [gold-of-pleasure]
emb|CDX75968.1|  BnaC03g40510D                                        84.7    7e-16   
ref|XP_004135107.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.3    8e-16   Cucumis sativus [cucumbers]
ref|XP_009135580.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.3    8e-16   Brassica rapa
ref|XP_004172253.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  84.3    8e-16   
emb|CDX82342.1|  BnaA03g34790D                                        84.3    9e-16   
ref|XP_004150193.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.0    1e-15   Cucumis sativus [cucumbers]
ref|NP_173922.1|  aspartyl protease family protein                    84.0    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004497116.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.0    1e-15   Cicer arietinum [garbanzo]
ref|XP_008446567.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.0    1e-15   Cucumis melo [Oriental melon]
ref|XP_002979394.1|  hypothetical protein SELMODRAFT_53966            82.8    1e-15   
ref|XP_003589787.1|  Aspartic proteinase nepenthesin-2                84.0    1e-15   
emb|CDP04865.1|  unnamed protein product                              84.3    1e-15   Coffea canephora [robusta coffee]
gb|AES60038.2|  aspartic protease in GUARD CELL-like protein          84.0    1e-15   Medicago truncatula
dbj|BAK07248.1|  predicted protein                                    84.0    1e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006362549.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.0    1e-15   Solanum tuberosum [potatoes]
ref|XP_006306517.1|  hypothetical protein CARUB_v10012516mg           83.6    1e-15   Capsella rubella
ref|XP_010688619.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.0    1e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010265215.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  83.6    2e-15   Nelumbo nucifera [Indian lotus]
gb|ABK24255.1|  unknown                                               83.6    2e-15   Picea sitchensis
ref|XP_009109887.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  83.6    2e-15   Brassica rapa
ref|XP_008221090.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  83.6    2e-15   Prunus mume [ume]
ref|XP_009770623.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  83.6    2e-15   Nicotiana sylvestris
ref|XP_009398943.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  83.6    2e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001757102.1|  predicted protein                                82.8    2e-15   
ref|XP_007227097.1|  hypothetical protein PRUPE_ppa025647mg           83.6    2e-15   
emb|CDM83204.1|  unnamed protein product                              83.2    2e-15   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010499100.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  83.2    2e-15   Camelina sativa [gold-of-pleasure]
emb|CBI27051.3|  unnamed protein product                              80.9    2e-15   Vitis vinifera
ref|XP_002511962.1|  Aspartic proteinase nepenthesin-1 precursor,...  83.2    2e-15   Ricinus communis
ref|XP_002275164.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  83.2    2e-15   Vitis vinifera
ref|XP_001759252.1|  predicted protein                                82.0    2e-15   
ref|XP_010916474.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  83.2    2e-15   Elaeis guineensis
ref|XP_003565317.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  83.2    3e-15   Brachypodium distachyon [annual false brome]
gb|KDO70057.1|  hypothetical protein CISIN_1g0117491mg                80.5    3e-15   Citrus sinensis [apfelsine]
gb|ABR17396.1|  unknown                                               81.6    3e-15   Picea sitchensis
ref|XP_006653026.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  82.8    3e-15   Oryza brachyantha
ref|XP_004253208.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  82.8    3e-15   Solanum lycopersicum
ref|XP_004960076.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  82.8    3e-15   Setaria italica
ref|XP_002315953.1|  aspartyl protease family protein                 82.8    3e-15   Populus trichocarpa [western balsam poplar]
ref|XP_006374138.1|  hypothetical protein POPTR_0015s02540g           82.8    3e-15   Populus trichocarpa [western balsam poplar]
gb|KCW86348.1|  hypothetical protein EUGRSUZ_B03036                   82.8    3e-15   Eucalyptus grandis [rose gum]
ref|XP_004238952.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  82.4    3e-15   Solanum lycopersicum
ref|XP_010044282.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  82.4    4e-15   Eucalyptus grandis [rose gum]
ref|XP_002890686.1|  aspartyl protease family protein                 82.4    4e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_011004863.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  82.4    4e-15   Populus euphratica
ref|XP_009103072.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  82.4    4e-15   Brassica rapa
ref|XP_011077177.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  82.4    4e-15   Sesamum indicum [beniseed]
ref|XP_009608744.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  82.4    5e-15   Nicotiana tomentosiformis
ref|XP_004512945.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  82.0    5e-15   Cicer arietinum [garbanzo]
ref|XP_008799310.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  82.0    6e-15   Phoenix dactylifera
ref|XP_008782298.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  82.0    7e-15   Phoenix dactylifera
ref|XP_010527532.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  81.6    7e-15   Tarenaya hassleriana [spider flower]
gb|EMS50115.1|  Aspartic proteinase nepenthesin-2                     79.3    7e-15   Triticum urartu
emb|CDM80984.1|  unnamed protein product                              81.6    7e-15   Triticum aestivum [Canadian hard winter wheat]
gb|KJB52970.1|  hypothetical protein B456_008G285900                  81.6    7e-15   Gossypium raimondii
ref|XP_009356391.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  81.6    7e-15   Pyrus x bretschneideri [bai li]
gb|KDP29378.1|  hypothetical protein JCGZ_18299                       81.6    8e-15   Jatropha curcas
tpg|DAA53545.1|  TPA: hypothetical protein ZEAMMB73_483039            81.6    8e-15   
ref|XP_003534178.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  81.6    8e-15   Glycine max [soybeans]
ref|XP_009762361.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  81.6    8e-15   Nicotiana sylvestris
ref|XP_006437718.1|  hypothetical protein CICLE_v10031364mg           81.3    9e-15   Citrus clementina [clementine]
ref|XP_007036465.1|  Eukaryotic aspartyl protease family protein      81.3    9e-15   
ref|XP_008243190.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  81.6    1e-14   
ref|XP_006484425.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  81.3    1e-14   
gb|KFK44545.1|  hypothetical protein AALP_AA1G270600                  81.3    1e-14   
ref|XP_002281973.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  81.3    1e-14   
ref|XP_009616228.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  81.3    1e-14   
ref|XP_010092769.1|  Aspartic proteinase nepenthesin-1                80.9    1e-14   
gb|EAY72467.1|  hypothetical protein OsI_00323                        80.9    2e-14   
ref|XP_002529147.1|  Aspartic proteinase nepenthesin-1 precursor,...  80.9    2e-14   
ref|XP_003517994.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  80.9    2e-14   
ref|XP_003520035.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  80.5    2e-14   
ref|XP_004299230.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  80.5    2e-14   
ref|XP_008389306.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  80.5    2e-14   
ref|XP_009336599.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  80.5    2e-14   
ref|XP_002442591.1|  hypothetical protein SORBIDRAFT_08g022580        80.5    2e-14   
ref|XP_002965292.1|  hypothetical protein SELMODRAFT_83230            80.1    2e-14   
ref|XP_002986620.1|  hypothetical protein SELMODRAFT_124369           80.1    2e-14   
ref|XP_004298296.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  80.1    3e-14   
gb|KJB50738.1|  hypothetical protein B456_008G185200                  80.1    3e-14   
ref|XP_006341626.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  80.1    3e-14   
emb|CDP20336.1|  unnamed protein product                              79.7    3e-14   
ref|XP_002978584.1|  hypothetical protein SELMODRAFT_54048            79.3    3e-14   
ref|XP_004241622.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  79.7    3e-14   
ref|XP_002457394.1|  hypothetical protein SORBIDRAFT_03g006630        79.7    4e-14   
ref|XP_007153356.1|  hypothetical protein PHAVU_003G028600g           79.7    4e-14   
ref|XP_006354732.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  79.7    4e-14   
emb|CDY03848.1|  BnaC07g10730D                                        79.3    4e-14   
ref|XP_004968151.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  79.7    4e-14   
ref|XP_002966033.1|  hypothetical protein SELMODRAFT_64135            78.2    5e-14   
ref|XP_002971459.1|  hypothetical protein SELMODRAFT_64134            78.2    5e-14   
ref|XP_004235788.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  79.3    5e-14   
ref|XP_008791253.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  79.0    6e-14   
dbj|BAJ97639.1|  predicted protein                                    79.0    6e-14   
ref|XP_002448772.1|  hypothetical protein SORBIDRAFT_06g032900        79.0    7e-14   
ref|XP_008668690.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  79.0    7e-14   
ref|XP_009800603.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  79.0    7e-14   
ref|XP_007046283.1|  Eukaryotic aspartyl protease family protein      79.0    7e-14   
ref|XP_002446596.1|  hypothetical protein SORBIDRAFT_06g018693        74.7    1e-13   
gb|EAY72465.1|  hypothetical protein OsI_00321                        77.0    1e-13   
ref|XP_010926497.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  78.2    1e-13   
ref|XP_004972145.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  77.8    1e-13   
ref|XP_002468182.1|  hypothetical protein SORBIDRAFT_01g041210        77.8    2e-13   
ref|XP_006843768.1|  hypothetical protein AMTR_s00007p00241440        77.8    2e-13   
emb|CAE05761.2|  OSJNBa0064G10.12                                     77.4    2e-13   
gb|EPS61272.1|  hypothetical protein M569_13524                       77.4    2e-13   
ref|NP_001054261.2|  Os04g0677100                                     77.4    2e-13   
ref|XP_011072934.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  77.4    2e-13   
gb|EAZ32412.1|  hypothetical protein OsJ_16623                        77.4    2e-13   
emb|CAJ86229.1|  H0402C08.5                                           77.4    2e-13   
ref|NP_001041979.1|  Os01g0140100                                     77.4    3e-13   
ref|XP_002442590.1|  hypothetical protein SORBIDRAFT_08g022570        77.0    3e-13   
ref|XP_010677970.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  77.0    3e-13   
gb|EYU40867.1|  hypothetical protein MIMGU_mgv1a023461mg              76.6    4e-13   
emb|CDP20730.1|  unnamed protein product                              76.6    4e-13   
ref|XP_009409187.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  76.6    4e-13   
ref|XP_010105777.1|  Aspartic proteinase nepenthesin-1                76.6    4e-13   
ref|XP_010911344.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  74.7    6e-13   
ref|XP_009380958.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  76.3    6e-13   
ref|XP_002964789.1|  hypothetical protein SELMODRAFT_82470            75.1    8e-13   
ref|XP_010695864.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  75.5    1e-12   
ref|XP_008675097.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  75.1    1e-12   
ref|XP_009609715.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  74.7    2e-12   
ref|XP_007225636.1|  hypothetical protein PRUPE_ppa003917mg           74.7    2e-12   
ref|XP_001784204.1|  predicted protein                                73.9    2e-12   
ref|XP_003567056.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  74.3    2e-12   
ref|XP_006646269.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  73.9    3e-12   
gb|EAY75637.1|  hypothetical protein OsI_03542                        73.9    3e-12   
dbj|BAB84414.1|  chloroplast nucleoid DNA-binding protein cnd41-like  73.9    3e-12   
ref|XP_009798772.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  73.9    3e-12   
gb|EAZ13356.1|  hypothetical protein OsJ_03278                        73.9    3e-12   
gb|EYU19035.1|  hypothetical protein MIMGU_mgv1a021892mg              73.6    5e-12   
ref|XP_002443631.1|  hypothetical protein SORBIDRAFT_08g022620        73.2    6e-12   
ref|XP_008668689.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  72.0    2e-11   
tpg|DAA35351.1|  TPA: hypothetical protein ZEAMMB73_696016            72.0    2e-11   
ref|XP_004500468.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  71.6    2e-11   
ref|XP_002524401.1|  basic 7S globulin 2 precursor small subunit,...  71.2    2e-11   
emb|CDM84701.1|  unnamed protein product                              70.9    4e-11   
ref|XP_002961719.1|  hypothetical protein SELMODRAFT_64161            70.1    4e-11   
gb|KEH27070.1|  aspartic protease in GUARD CELL-like protein          70.5    5e-11   
emb|CDO98452.1|  unnamed protein product                              69.3    1e-10   
ref|XP_001751688.1|  predicted protein                                68.9    1e-10   
ref|XP_010524109.1|  PREDICTED: aspartic proteinase nepenthesin-1...  68.6    2e-10   
ref|XP_008393394.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.9    2e-10   
ref|XP_008778737.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.6    2e-10   
ref|XP_003552901.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.6    3e-10   
gb|EEE64882.1|  hypothetical protein OsJ_19741                        68.2    3e-10   
ref|XP_002458414.1|  hypothetical protein SORBIDRAFT_03g033075        68.2    3e-10   
ref|XP_010525594.1|  PREDICTED: aspartic proteinase nepenthesin-2     68.2    4e-10   
ref|XP_003537377.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.8    4e-10   
gb|KHN24691.1|  Aspartic proteinase nepenthesin-2                     67.8    4e-10   
ref|XP_008229704.1|  PREDICTED: uncharacterized protein LOC103329046  68.2    4e-10   
ref|XP_001779661.1|  predicted protein                                67.4    4e-10   
ref|XP_002986201.1|  hypothetical protein SELMODRAFT_234982           67.4    5e-10   
ref|XP_009356142.1|  PREDICTED: aspartic proteinase nepenthesin-1     67.4    5e-10   
ref|XP_003580821.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.4    5e-10   
ref|XP_002865165.1|  predicted protein                                64.3    5e-10   
ref|XP_010508488.1|  PREDICTED: aspartic proteinase CDR1-like         67.4    5e-10   
ref|XP_006826832.1|  hypothetical protein AMTR_s00010p00081970        67.0    5e-10   
ref|XP_002985015.1|  hypothetical protein SELMODRAFT_121417           67.4    6e-10   
ref|XP_008670374.1|  PREDICTED: aspartic proteinase nepenthesin-2...  67.0    7e-10   
ref|XP_010517850.1|  PREDICTED: aspartic proteinase CDR1-like         67.0    8e-10   
ref|NP_174430.1|  aspartyl protease-like protein                      66.6    9e-10   
ref|XP_008380197.1|  PREDICTED: aspartic proteinase nepenthesin-2     66.6    9e-10   
ref|XP_007215315.1|  hypothetical protein PRUPE_ppa003547mg           66.6    1e-09   
ref|XP_010506150.1|  PREDICTED: aspartic proteinase CDR1-like         66.6    1e-09   
ref|XP_009142895.1|  PREDICTED: aspartic proteinase nepenthesin-2     66.6    1e-09   
ref|XP_009377195.1|  PREDICTED: aspartic proteinase nepenthesin-2...  66.6    1e-09   
ref|XP_010035929.1|  PREDICTED: aspartic proteinase nepenthesin-2...  66.6    1e-09   
ref|XP_006354419.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  66.6    1e-09   
ref|XP_010499694.1|  PREDICTED: probable aspartic protease At2g35615  66.2    1e-09   
ref|XP_006296519.1|  hypothetical protein CARUB_v10025708mg           66.2    1e-09   
ref|XP_011467594.1|  PREDICTED: aspartic proteinase nepenthesin-2     66.2    1e-09   
ref|XP_004239252.1|  PREDICTED: aspartic proteinase nepenthesin-1...  66.2    1e-09   
emb|CDX79836.1|  BnaA05g03200D                                        66.2    1e-09   
ref|XP_007146932.1|  hypothetical protein PHAVU_006G083000g           66.2    1e-09   
ref|XP_008784432.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  66.2    1e-09   
gb|KFK37140.1|  hypothetical protein AALP_AA4G218300                  65.9    1e-09   
ref|XP_004295663.1|  PREDICTED: uncharacterized protein LOC101292685  63.9    2e-09   
gb|KDO51883.1|  hypothetical protein CISIN_1g041228mg                 66.2    2e-09   
ref|XP_006373545.1|  hypothetical protein POPTR_0016s00260g           65.9    2e-09   
ref|XP_002881883.1|  hypothetical protein ARALYDRAFT_903676           65.9    2e-09   
ref|XP_006484924.1|  PREDICTED: uncharacterized protein LOC102625748  66.2    2e-09   
ref|XP_006597643.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.9    2e-09   
ref|XP_006437136.1|  hypothetical protein CICLE_v10031104mg           65.9    2e-09   
emb|CDY53652.1|  BnaC04g52860D                                        65.9    2e-09   
ref|XP_004243605.1|  PREDICTED: aspartic proteinase nepenthesin-2...  65.9    2e-09   
ref|XP_007227595.1|  hypothetical protein PRUPE_ppa017015mg           65.5    2e-09   
ref|XP_006357686.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.9    2e-09   
emb|CDP15730.1|  unnamed protein product                              65.9    2e-09   
gb|KGN63809.1|  hypothetical protein Csa_1G022480                     65.5    2e-09   
ref|XP_002278677.2|  PREDICTED: aspartic proteinase nepenthesin-1     65.5    2e-09   
ref|NP_181826.1|  aspartyl protease-like protein                      65.9    2e-09   
ref|XP_003573011.1|  PREDICTED: aspartic proteinase nepenthesin-2...  65.9    2e-09   
ref|NP_001046662.1|  Os02g0314600                                     65.9    2e-09   
gb|EAY85563.1|  hypothetical protein OsI_06935                        65.9    2e-09   
ref|XP_008353635.1|  PREDICTED: aspartic proteinase nepenthesin-2...  65.9    2e-09   
ref|XP_010093388.1|  Aspartic proteinase nepenthesin-2                65.9    2e-09   
ref|XP_004170576.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.5    2e-09   
ref|XP_004138237.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.5    2e-09   
emb|CDX98347.1|  BnaC06g17080D                                        65.5    2e-09   
ref|NP_001154646.1|  aspartyl protease family protein                 64.7    2e-09   
dbj|BAJ53226.1|  JHL06P13.6                                           65.1    2e-09   
ref|XP_006847614.1|  hypothetical protein AMTR_s00014p00246430        65.5    2e-09   
ref|XP_010241281.1|  PREDICTED: aspartic proteinase nepenthesin-1...  65.5    2e-09   
ref|XP_011044763.1|  PREDICTED: aspartic proteinase nepenthesin-2...  65.5    2e-09   
ref|XP_002520371.1|  basic 7S globulin 2 precursor small subunit,...  65.5    3e-09   
ref|XP_007048981.1|  Eukaryotic aspartyl protease family protein ...  65.5    3e-09   
ref|XP_010480892.1|  PREDICTED: probable aspartic protease At2g35615  65.1    3e-09   
ref|XP_002279141.2|  PREDICTED: aspartic proteinase nepenthesin-2     65.5    3e-09   
ref|XP_010241283.1|  PREDICTED: aspartic proteinase nepenthesin-1...  65.5    3e-09   
gb|KFK35067.1|  hypothetical protein AALP_AA5G230900                  65.1    3e-09   
gb|KDP37099.1|  hypothetical protein JCGZ_06155                       64.7    3e-09   
ref|XP_007048982.1|  Eukaryotic aspartyl protease family protein ...  65.1    3e-09   
ref|XP_006648575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.1    3e-09   
ref|XP_006582668.1|  PREDICTED: probable aspartic protease At2g35...  63.5    3e-09   
ref|XP_002307559.2|  hypothetical protein POPTR_0005s22630g           65.1    3e-09   
ref|XP_007146226.1|  hypothetical protein PHAVU_006G022800g           65.1    3e-09   
gb|KHN18625.1|  Aspartic proteinase nepenthesin-2                     65.1    3e-09   
ref|XP_001778328.1|  predicted protein                                62.4    3e-09   
ref|XP_003553140.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.1    3e-09   
ref|XP_011040081.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  64.7    4e-09   
gb|KHN11976.1|  Aspartic proteinase nepenthesin-1                     65.1    4e-09   
ref|XP_002460980.1|  hypothetical protein SORBIDRAFT_02g038700        64.7    4e-09   
ref|XP_010087862.1|  Aspartic proteinase nepenthesin-1                64.7    4e-09   
ref|XP_011100548.1|  PREDICTED: aspartic proteinase nepenthesin-2...  64.7    4e-09   
ref|NP_189198.1|  aspartyl protease family protein                    64.7    4e-09   
ref|XP_002460653.1|  hypothetical protein SORBIDRAFT_02g032590        64.7    4e-09   
ref|XP_006291121.1|  hypothetical protein CARUB_v10017234mg           64.3    4e-09   
gb|KJB08584.1|  hypothetical protein B456_001G092100                  64.7    4e-09   
gb|AET00358.2|  eukaryotic aspartyl protease family protein           64.7    5e-09   
ref|XP_003617399.1|  60S ribosomal protein L18a                       65.1    5e-09   
ref|XP_006595492.1|  PREDICTED: uncharacterized protein LOC100305...  65.1    5e-09   
ref|XP_009759829.1|  PREDICTED: aspartic proteinase nepenthesin-2...  64.7    5e-09   
ref|XP_004952344.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  64.7    5e-09   
ref|XP_010058011.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  64.3    5e-09   
ref|XP_009625562.1|  PREDICTED: aspartic proteinase nepenthesin-2...  64.7    5e-09   
gb|KDP26966.1|  hypothetical protein JCGZ_22200                       64.7    5e-09   
ref|XP_006415326.1|  hypothetical protein EUTSA_v10009809mg           64.3    5e-09   
gb|KHN38336.1|  Aspartic proteinase nepenthesin-2                     64.7    5e-09   
gb|EYU42788.1|  hypothetical protein MIMGU_mgv1a008084mg              63.9    5e-09   
ref|XP_007153336.1|  hypothetical protein PHAVU_003G026700g           64.3    6e-09   
ref|XP_009421481.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  64.3    6e-09   
ref|XP_006574359.1|  PREDICTED: uncharacterized protein LOC100527...  64.7    6e-09   
ref|XP_006411570.1|  hypothetical protein EUTSA_v10016513mg           64.3    6e-09   
ref|XP_009356605.1|  PREDICTED: aspartic proteinase nepenthesin-2...  64.3    6e-09   
ref|XP_010904875.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  64.3    6e-09   
ref|XP_010556388.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...  64.3    6e-09   
ref|XP_007141420.1|  hypothetical protein PHAVU_008G193900g           64.3    6e-09   
ref|XP_008453383.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  63.9    6e-09   
gb|KEH33552.1|  eukaryotic aspartyl protease family protein           63.9    7e-09   
ref|XP_008339708.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...  63.9    8e-09   
ref|XP_010265280.1|  PREDICTED: aspartic proteinase nepenthesin-1...  63.9    8e-09   
ref|XP_002876487.1|  hypothetical protein ARALYDRAFT_486375           63.9    8e-09   
ref|XP_002525244.1|  Aspartic proteinase nepenthesin-2 precursor,...  63.9    8e-09   
ref|XP_004491319.1|  PREDICTED: LOW QUALITY PROTEIN: probable asp...  64.3    8e-09   
ref|XP_009104182.1|  PREDICTED: aspartic proteinase nepenthesin-2     63.9    9e-09   
emb|CDX67775.1|  BnaA07g18150D                                        63.9    9e-09   
ref|XP_004143702.1|  PREDICTED: aspartic proteinase nepenthesin-2...  63.5    9e-09   
ref|XP_008467208.1|  PREDICTED: aspartic proteinase nepenthesin-2     63.5    1e-08   
ref|XP_006437742.1|  hypothetical protein CICLE_v10031705mg           63.2    1e-08   
ref|XP_010514187.1|  PREDICTED: aspartic proteinase nepenthesin-1...  63.5    1e-08   
ref|XP_010688898.1|  PREDICTED: aspartic proteinase nepenthesin-1     63.5    1e-08   
ref|NP_001030891.1|  aspartyl protease family protein                 63.5    1e-08   
ref|XP_011085418.1|  PREDICTED: aspartic proteinase nepenthesin-2...  63.5    1e-08   
ref|XP_010425220.1|  PREDICTED: aspartic proteinase nepenthesin-1...  63.2    1e-08   
gb|KFK44926.1|  hypothetical protein AALP_AA1G320800                  63.2    1e-08   
ref|XP_006484403.1|  PREDICTED: aspartic proteinase nepenthesin-1...  63.2    1e-08   
ref|NP_191467.1|  aspartyl protease family protein                    63.5    1e-08   
ref|XP_002875271.1|  hypothetical protein ARALYDRAFT_484331           63.2    1e-08   
ref|XP_006402723.1|  hypothetical protein EUTSA_v10005882mg           63.5    1e-08   
ref|XP_006290872.1|  hypothetical protein CARUB_v10016982mg           63.5    1e-08   
gb|KHN14389.1|  Aspartic proteinase nepenthesin-2                     63.2    1e-08   
ref|XP_008465452.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  63.5    1e-08   
ref|XP_006395632.1|  hypothetical protein EUTSA_v10004188mg           63.2    1e-08   
ref|XP_010502452.1|  PREDICTED: aspartic proteinase nepenthesin-2...  63.2    1e-08   
ref|XP_002879561.1|  aspartyl protease family protein                 63.2    1e-08   
ref|XP_010512139.1|  PREDICTED: aspartic proteinase nepenthesin-2...  63.2    1e-08   
ref|XP_004503002.1|  PREDICTED: aspartic proteinase nepenthesin-1...  63.2    1e-08   
ref|XP_010512140.1|  PREDICTED: aspartic proteinase nepenthesin-1...  63.2    1e-08   
emb|CDX99757.1|  BnaC02g35630D                                        62.8    1e-08   
ref|XP_010512138.1|  PREDICTED: aspartic proteinase nepenthesin-1...  63.2    1e-08   
ref|XP_010516578.1|  PREDICTED: aspartic proteinase nepenthesin-2...  63.2    1e-08   



>ref|XP_009800816.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=474

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 107/143 (75%), Gaps = 6/143 (4%)
 Frame = +3

Query  96   KPFSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLIS--SAAVNATPKAL  269
            +  +LR LP  Q  SLS   Q S    QP +SENTL++ LHH+DLI+  ++  N TP AL
Sbjct  29   QTLTLRSLPEPQ--SLSWATQDSNDF-QPLNSENTLAVQLHHVDLITPYTSLSNTTPHAL  85

Query  270  FVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKY  449
            F  RLQRDA RAK LS LA A    NAT  +DFSSSVISGLAQGSGEYFTR+G+GTPPKY
Sbjct  86   FKLRLQRDAVRAKLLSNLAEAVANANATV-KDFSSSVISGLAQGSGEYFTRIGIGTPPKY  144

Query  450  AFMVLDTGSDVVWLQCSPCRKCY  518
            A+MVLDTGSDVVW+QC PCR+CY
Sbjct  145  AYMVLDTGSDVVWIQCLPCRQCY  167



>ref|XP_011093028.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Sesamum 
indicum]
Length=476

 Score =   151 bits (381),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 115/160 (72%), Gaps = 6/160 (4%)
 Frame = +3

Query  51   FSYFLAIPSSPPSITKPFSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDL  230
             S FL I SS P   + F L  LP  Q  S  ++ Q S+T VQP  S  TLSLDLHH+D 
Sbjct  14   LSLFLTISSSAPLQYQTFLLTSLPNPQSLSWPTQ-QDSETQVQPH-SHTTLSLDLHHVDN  71

Query  231  ISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR---DFSSSVISGLAQG  401
            +S    N+TP++LF  RL+RDA R KALS ++A +  + + + R   DFSSSVISGLAQG
Sbjct  72   LS-PDFNSTPQSLFKLRLRRDAIRVKALSTISAVSQTNVSGQPRAAGDFSSSVISGLAQG  130

Query  402  SGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            SGEYFTR+G+GTPPKY +MVLDTGSDVVW+QCSPCRKCY+
Sbjct  131  SGEYFTRIGIGTPPKYVYMVLDTGSDVVWVQCSPCRKCYS  170



>ref|XP_006339720.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=480

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 96/145 (66%), Gaps = 10/145 (7%)
 Frame = +3

Query  108  LRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQ  287
            L  LP  Q  SL    Q         D +NTLSL LHH+DL+S ++ NATP ALF  RLQ
Sbjct  32   LHSLPLTQLQSLDFDAQLLSGDGSDLDPDNTLSLQLHHVDLVSPSSFNATPHALFKLRLQ  91

Query  288  RDa--------arakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPP  443
            RDA          A   ++   A  PH    GRDFSSSV+SGL+QGSGEYFTR+GVGTPP
Sbjct  92   RDAYRAKAISDLAAANATVGRRAGKPHAG--GRDFSSSVVSGLSQGSGEYFTRIGVGTPP  149

Query  444  KYAFMVLDTGSDVVWLQCSPCRKCY  518
            KY +MVLDTGSDVVW+QCSPC+KCY
Sbjct  150  KYVYMVLDTGSDVVWIQCSPCKKCY  174



>ref|XP_004248083.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Solanum 
lycopersicum]
Length=458

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 116/156 (74%), Gaps = 15/156 (10%)
 Frame = +3

Query  57   YFLAIPSSPPSIT-KPFSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLI  233
            +F  I ++  S+  +  +L PLP  Q  SLS +PQ S       D+ENTLS+ LHH+DL+
Sbjct  10   FFFTIFAAAHSLQYQTLTLNPLPQLQ--SLSWEPQLSS------DNENTLSVQLHHVDLL  61

Query  234  SSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEY  413
            S ++ NATP ALF  RLQRDA RAK+LSLL+A     N+T G+DFSSSVISGL+QGSGEY
Sbjct  62   SPSSFNATPHALFKLRLQRDAIRAKSLSLLSA-----NST-GKDFSSSVISGLSQGSGEY  115

Query  414  FTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            FTR+G+GTP KY ++VLDTGSD+VW+QC PC KCY+
Sbjct  116  FTRIGIGTPVKYVYLVLDTGSDIVWIQCLPCSKCYS  151



>ref|XP_009613969.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=510

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 115/170 (68%), Gaps = 15/170 (9%)
 Frame = +3

Query  54   SYFLAIPSSPPSITKP----FSLRPLPTAQHYSLSSKPQYSQTLVQPD----DSENTLSL  209
            S FL++ +   S T P      L  LP ++  SLS   +  +  +  D    D + TLS+
Sbjct  35   SIFLSLFAISVSSTSPQYQTLVLNSLPNSEPQSLSWATEDFEAQLSGDGSNPDPDTTLSV  94

Query  210  DLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaa-------PPHNATRGRDF  368
             LHH+DL+S ++ NATP ALF  RLQRDAARAKALS LAAA          H+    RDF
Sbjct  95   QLHHVDLVSPSSFNATPHALFKLRLQRDAARAKALSDLAAANITVGRRGGGHHVVGSRDF  154

Query  369  SSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            SSSV SGLAQGSGEYFTRLGVGTPPKYA+MVLDTGSDVVW+QCSPC+KCY
Sbjct  155  SSSVTSGLAQGSGEYFTRLGVGTPPKYAYMVLDTGSDVVWIQCSPCKKCY  204



>ref|XP_009600181.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=474

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 108/143 (76%), Gaps = 6/143 (4%)
 Frame = +3

Query  96   KPFSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLIS--SAAVNATPKAL  269
            +  +LR LP  Q  S +++  Y     QP +S+NTL++ LHH+DLI+  ++  N TP AL
Sbjct  29   QTLTLRSLPEPQSLSWATQDSYD---FQPLNSQNTLAVQLHHVDLITPYTSLFNTTPHAL  85

Query  270  FVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKY  449
            F  RLQRDA RA+ LS LA AA   NAT  +DFSSSVISGLAQGSGEYFTR+G+GTPPKY
Sbjct  86   FKLRLQRDAVRAELLSKLAEAAANANATV-KDFSSSVISGLAQGSGEYFTRIGIGTPPKY  144

Query  450  AFMVLDTGSDVVWLQCSPCRKCY  518
            A++VLDTGSDVVW+QC PCR+CY
Sbjct  145  AYLVLDTGSDVVWIQCLPCRQCY  167



>ref|XP_006362137.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=461

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 110/142 (77%), Gaps = 11/142 (8%)
 Frame = +3

Query  96   KPFSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFV  275
            +  +L  LP  Q  SLS +PQ S       D+ENTLS+ LHH+DL+S ++ NATP ALF 
Sbjct  24   QTLTLNSLPQLQ--SLSWEPQLSS------DNENTLSVQLHHVDLLSPSSFNATPHALFK  75

Query  276  KRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAF  455
             RLQRDA RAK+LSLL+A+A   N+T G+DFSSSVISGL+QGSGEYFTR+G+GTP KY +
Sbjct  76   LRLQRDAIRAKSLSLLSASA--ANST-GKDFSSSVISGLSQGSGEYFTRIGIGTPTKYVY  132

Query  456  MVLDTGSDVVWLQCSPCRKCYA  521
            +VLDTGSD+VW+QC PC KCY+
Sbjct  133  LVLDTGSDIVWIQCLPCAKCYS  154



>gb|EYU32252.1| hypothetical protein MIMGU_mgv1a005685mg [Erythranthe guttata]
Length=474

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 111/158 (70%), Gaps = 4/158 (3%)
 Frame = +3

Query  51   FSYFLAIPSSPPSITKPFSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDL  230
             S+FL I  S P   + F L  LP  Q  S  S+ Q SQ +  P +SE   SL+LHH+D 
Sbjct  12   LSFFLTISFSAPLQYQTFVLTSLPQPQTISWVSQ-QESQVIETPSESETDFSLNLHHVDS  70

Query  231  ISSAAVNATPKALFVKRLQRDaarakalsllaaaa--PPHNATRGRDFSSSVISGLAQGS  404
            +S +++ +TP++LF  RL+RD  R +ALS LAA+A  P + + +   FSSSVISGLA GS
Sbjct  71   LSPSSI-STPESLFQLRLRRDGVRVEALSTLAASAAAPTNVSGKPHGFSSSVISGLAHGS  129

Query  405  GEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            GEYFTRLGVGTP KY +MVLDTGSDVVW+QCSPCRKCY
Sbjct  130  GEYFTRLGVGTPAKYVYMVLDTGSDVVWIQCSPCRKCY  167



>gb|EYU38885.1| hypothetical protein MIMGU_mgv1a026932mg [Erythranthe guttata]
Length=471

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 108/144 (75%), Gaps = 13/144 (9%)
 Frame = +3

Query  108  LRPLPTAQHYSLS-SKPQYSQTLVQPDDSENTLSLDLHHIDLI---SSAAVNATPKALFV  275
            L  LP  Q  SLS    Q S + ++P+ S+ TLSLDLHH+D +   +SAA ++TP++LF 
Sbjct  29   LTSLPNPQSQSLSWPTQQQSDSQIRPE-SDTTLSLDLHHVDNLPPSASAAFSSTPQSLFK  87

Query  276  KRLQRDaarakalsllaaaaPPHNATRGR--DFSSSVISGLAQGSGEYFTRLGVGTPPKY  449
             RL+RDA R +ALS +A      N + GR  DFSSS++SGLAQGSGEYFTR+G+GTPPKY
Sbjct  88   LRLRRDAVRVRALSTIA------NVSVGRPGDFSSSIVSGLAQGSGEYFTRIGIGTPPKY  141

Query  450  AFMVLDTGSDVVWLQCSPCRKCYA  521
             +MVLDTGSDVVW+QCSPCRKCY+
Sbjct  142  VYMVLDTGSDVVWVQCSPCRKCYS  165



>gb|EYU40714.1| hypothetical protein MIMGU_mgv1a019320mg [Erythranthe guttata]
Length=469

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 107/142 (75%), Gaps = 11/142 (8%)
 Frame = +3

Query  108  LRPLPTAQHYSLS-SKPQYSQTLVQPDDSENTLSLDLHHID-LISSAAVNATPKALFVKR  281
            L  LP  Q  SLS    Q S + ++P+ S+ TLSLDLHH+D L  SAA ++TP++LF  R
Sbjct  29   LTSLPNPQSQSLSWPTQQQSDSQIRPE-SDTTLSLDLHHLDNLPPSAAFSSTPQSLFKLR  87

Query  282  LQRDaarakalsllaaaaPPHNATRGR--DFSSSVISGLAQGSGEYFTRLGVGTPPKYAF  455
            L+RDA R +ALS LA      N + GR  DFSSS++SGLAQGSGEYFTR+G+GTPPKY +
Sbjct  88   LRRDAVRVRALSTLA------NVSGGRPGDFSSSIVSGLAQGSGEYFTRIGIGTPPKYVY  141

Query  456  MVLDTGSDVVWLQCSPCRKCYA  521
            MVLDTGSDVVW+QCSPCRKCY+
Sbjct  142  MVLDTGSDVVWVQCSPCRKCYS  163



>ref|XP_004229990.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
lycopersicum]
Length=500

 Score =   143 bits (360),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 96/149 (64%), Gaps = 17/149 (11%)
 Frame = +3

Query  108  LRPLPTAQHYSLSSKPQYSQTLVQPD----DSENTLSLDLHHIDLISSAAVNATPKALFV  275
            L  LP  Q   L     +   L+  D    D +N LSL LHH+DL+S ++ NATP ALF 
Sbjct  51   LHSLPLTQ---LQKSLHFDAQLLSGDGSDLDPDNALSLQLHHVDLVSPSSFNATPHALFK  107

Query  276  KRLQRDa--------arakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGV  431
             RLQRDA          +   ++   A  PH    GRDFSSSV+SGL+QGSGEYFTR+GV
Sbjct  108  LRLQRDAYRAKAISDLASANATVGRRAGKPHPG--GRDFSSSVVSGLSQGSGEYFTRIGV  165

Query  432  GTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            GTP KY +MVLDTGSDVVW+QCSPC+KCY
Sbjct  166  GTPSKYVYMVLDTGSDVVWIQCSPCKKCY  194



>ref|XP_009775618.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=491

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 115/170 (68%), Gaps = 15/170 (9%)
 Frame = +3

Query  54   SYFLAIPSSPPSITKP----FSLRPLPTAQHYSLSSKPQYSQTLVQPD----DSENTLSL  209
            S FL++ +   S T P      L  LP +Q  SLS   +  +  +  D    D + TLS+
Sbjct  16   SIFLSLLAISVSSTSPQYQTLVLNSLPNSQPQSLSWATEDFEAQLSGDGSNPDPDYTLSV  75

Query  210  DLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaa-------PPHNATRGRDF  368
             LHH+DL+S ++ NATP  LF  RLQRDAARAKALS LAAA          H+   GRDF
Sbjct  76   QLHHVDLVSPSSFNATPHTLFKLRLQRDAARAKALSDLAAANITVGRRGGGHHVVGGRDF  135

Query  369  SSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            SSSV SGLAQGSGEYFTRLGVGTPPKYA+MVLDTGSDVVW+QCSPC+KCY
Sbjct  136  SSSVTSGLAQGSGEYFTRLGVGTPPKYAYMVLDTGSDVVWIQCSPCKKCY  185



>gb|KDP28482.1| hypothetical protein JCGZ_14253 [Jatropha curcas]
Length=478

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 108/162 (67%), Gaps = 9/162 (6%)
 Frame = +3

Query  51   FSYFLAIPS--SPPSITKPFSLRPLPTAQHYSL---SSKPQYSQTLVQPDDSENTLSLDL  215
            F+ FL++ +  S P   +   L PLP     S     S+ +  QTL    DS  T SL L
Sbjct  14   FTIFLSLSTTLSSPLDYQTLVLNPLPRQTALSWPAADSEAETLQTLTDTADS-TTFSLQL  72

Query  216  HHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLA  395
            HHID +S+   N TP+ LF +RLQRDA R +ALS +AA+A       G  FSSSVISGLA
Sbjct  73   HHIDALSN---NKTPQDLFGERLQRDAFRVEALSSVAASAVGAGGRVGTGFSSSVISGLA  129

Query  396  QGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            QGSGEYFTR+GVGTPP+Y +MVLDTGSD+VW+QC+PC KCY+
Sbjct  130  QGSGEYFTRIGVGTPPRYVYMVLDTGSDIVWIQCAPCNKCYS  171



>ref|XP_006444833.1| hypothetical protein CICLE_v10019938mg [Citrus clementina]
 gb|ESR58073.1| hypothetical protein CICLE_v10019938mg [Citrus clementina]
Length=480

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 87/118 (74%), Gaps = 9/118 (8%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDa---arakalsllaaaaPPHNATR  356
            D+E++LSL LHH+D +S    N TP+ LF  R+QRD        A +  A   PP N +R
Sbjct  60   DAESSLSLRLHHVDSLS---FNRTPEHLFNLRIQRDVLRVKSLTAFAESAVRVPPRNRSR  116

Query  357  GR---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            GR    FSSSVISGLAQGSGEYFTRLGVGTPP+Y +MVLDTGSDVVW+QC+PC+KCY+
Sbjct  117  GRANGGFSSSVISGLAQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWIQCAPCKKCYS  174



>ref|XP_006491285.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
 gb|KDO86492.1| hypothetical protein CISIN_1g040810mg [Citrus sinensis]
Length=480

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 87/118 (74%), Gaps = 9/118 (8%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDa---arakalsllaaaaPPHNATR  356
            D+E++LSL LHH+D +S    N TP+ LF  R+QRD        A +  A   PP N +R
Sbjct  60   DAESSLSLRLHHVDSLS---FNRTPEHLFNLRIQRDVLRVKSLTAFAESAVRVPPRNRSR  116

Query  357  GR---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            GR    FSSSVISGLAQGSGEYFTRLGVGTPP+Y +MVLDTGSDVVW+QC+PC+KCY+
Sbjct  117  GRANGGFSSSVISGLAQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWIQCAPCKKCYS  174



>ref|XP_011093892.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Sesamum 
indicum]
Length=478

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 100/140 (71%), Gaps = 8/140 (6%)
 Frame = +3

Query  108  LRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQ  287
            L PLPT Q  S    P   ++ + P  SENT SL+LHH+D +S  A N+TP++LF  RL 
Sbjct  37   LTPLPTPQTLSW---PSQQESELGPL-SENTFSLNLHHVDSLS-PAFNSTPESLFKLRLH  91

Query  288  RDaarakalsllaaaaPPHNATRGRD---FSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  458
            RD  R KALS LAAA   + + R R    FSSSV SGLAQGSGEYFTRLGVGTP KY +M
Sbjct  92   RDGVRVKALSTLAAATQTNVSARARGAPGFSSSVTSGLAQGSGEYFTRLGVGTPAKYVYM  151

Query  459  VLDTGSDVVWLQCSPCRKCY  518
            VLDTGSDVVW+QCSPCR+CY
Sbjct  152  VLDTGSDVVWVQCSPCRRCY  171



>ref|XP_008351846.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=486

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 89/114 (78%), Gaps = 10/114 (9%)
 Frame = +3

Query  195  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRG-----  359
            NTLS+ LHHID +   A+N TP  LF  RLQRDA R K L+ LAAA+P +  TRG     
Sbjct  70   NTLSVQLHHIDAV---ALNKTPTQLFNLRLQRDAFRVKTLTSLAAASP-NRTTRGGGXVP  125

Query  360  -RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
             R FSSSV+SGL+QGSGEYFTRLGVGTPP+Y +MVLDTGSDVVWLQC+PCR+CY
Sbjct  126  VRGFSSSVVSGLSQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWLQCAPCRRCY  179



>ref|XP_008343434.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=486

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 89/114 (78%), Gaps = 10/114 (9%)
 Frame = +3

Query  195  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRG-----  359
            NTLS+ LHHID +   A+N TP  LF  RLQRDA R K L+ LAAA+P +  TRG     
Sbjct  70   NTLSVQLHHIDAV---ALNKTPTQLFNLRLQRDAFRVKTLTSLAAASP-NRTTRGGGRVP  125

Query  360  -RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
             R FSSSV+SGL+QGSGEYFTRLGVGTPP+Y +MVLDTGSDVVWLQC+PCR+CY
Sbjct  126  VRGFSSSVVSGLSQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWLQCAPCRRCY  179



>ref|XP_006418409.1| hypothetical protein EUTSA_v10009389mg [Eutrema salsugineum]
 gb|ESQ36762.1| hypothetical protein EUTSA_v10009389mg [Eutrema salsugineum]
Length=486

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 108/155 (70%), Gaps = 15/155 (10%)
 Frame = +3

Query  66   AIPSSPPSITKPFSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAA  245
            ++PS+ P+  +P S    P ++     S+ +Y        DSE++++L+L HID +S+  
Sbjct  37   SLPSASPTSFQPESE---PDSESLLGGSESEYGS------DSESSITLNLDHIDALST--  85

Query  246  VNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFSSSVISGLAQGSGEYF  416
             N TP+ LF  RLQRD+ R ++++ LAA  P  NAT   R   FSSSV+SGL+QGSGEYF
Sbjct  86   -NRTPQELFSFRLQRDSRRVESIATLAARIPRRNATHAPRTVGFSSSVVSGLSQGSGEYF  144

Query  417  TRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            TRLGVGTP +Y +MVLDTGSD+VWLQC+PCRKCY+
Sbjct  145  TRLGVGTPARYVYMVLDTGSDIVWLQCAPCRKCYS  179



>gb|KEH24641.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=485

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 95/140 (68%), Gaps = 7/140 (5%)
 Frame = +3

Query  108  LRPLPTAQHYSLSSKPQYSQTLVQPDD--SENTLSLDLHHIDLISSAAVNATPKALFVKR  281
            +R LP     +     Q S ++ +  D   + +LSL LHHID +SS   + TP+ LF  R
Sbjct  44   IRSLPNPSTLTWPESEQESLSIPESVDPIEQESLSLQLHHIDTLSS---DKTPQQLFHLR  100

Query  282  LQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  461
            LQRDAAR ++ +       PH +  G  FSSS++SGL+QGSGEYFTR+GVGTP +Y FMV
Sbjct  101  LQRDAARVESFATALNKTRPHRSATG--FSSSIVSGLSQGSGEYFTRIGVGTPARYVFMV  158

Query  462  LDTGSDVVWLQCSPCRKCYA  521
            LDTGSDVVWLQC+PCRKCY+
Sbjct  159  LDTGSDVVWLQCAPCRKCYS  178



>ref|XP_002892074.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68333.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=485

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 90/115 (78%), Gaps = 6/115 (5%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---R  356
            DSE++++L+L HID +SS   N TP+ LF  RLQRD+ R K+++ LAA  P  N T   R
Sbjct  67   DSESSITLNLDHIDALSS---NKTPQELFSSRLQRDSRRVKSIATLAAQIPGRNVTHAPR  123

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
               FSSSV+SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+
Sbjct  124  TGGFSSSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYS  178



>ref|XP_010053832.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Eucalyptus 
grandis]
 gb|KCW78191.1| hypothetical protein EUGRSUZ_D02381 [Eucalyptus grandis]
Length=485

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 118/168 (70%), Gaps = 14/168 (8%)
 Frame = +3

Query  51   FSYFLAIPS-SPPSITKPFSLRPLPT-----AQHYSLSSKPQYSQTLVQPDDSENT-LSL  209
            F+  L +P+ S P+  +P  LRPLP+     +   S ++    S+T  + D +  T LS+
Sbjct  15   FAASLLLPALSAPAQLQPLVLRPLPSRPAPASWPESEAAASLSSETEAESDSAATTSLSV  74

Query  210  DLHHIDLISSAAVNATPKALFVKRLQRDaarakals---llaaaaPPHNATRGR-DFSSS  377
            +L H+D +S    N TP+ALF  RLQRDA+R +++S   + AAAAP  N +R R  FSSS
Sbjct  75   ELQHVDALS---FNLTPQALFHLRLQRDASRVQSISDLAVAAAAAPAGNVSRPRLGFSSS  131

Query  378  VISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            V+SGLAQGSGEYFTRLGVGTPP+Y +MVLDTGSDVVW+QC+PCRKCY+
Sbjct  132  VVSGLAQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWIQCAPCRKCYS  179



>emb|CDY15187.1| BnaC05g00660D [Brassica napus]
Length=481

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 99/140 (71%), Gaps = 8/140 (6%)
 Frame = +3

Query  117  LPTAQHYSL--SSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQR  290
            LP+A   S    S+P     +    DSE++++L+L HID +S+   N TP+ LF  RLQR
Sbjct  38   LPSASPISFQPESEPVSESLIGSGSDSESSITLNLDHIDALST---NRTPEELFSSRLQR  94

Query  291  DaarakalsllaaaaPPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  461
            D+ R K+++ LAA  P  N T   R   FSSSV+SGL+QGSGEYFTRLGVGTP +Y +MV
Sbjct  95   DSRRVKSIATLAARIPRRNTTHAPRPGGFSSSVVSGLSQGSGEYFTRLGVGTPARYVYMV  154

Query  462  LDTGSDVVWLQCSPCRKCYA  521
            LDTGSD+VWLQC+PCR+CY+
Sbjct  155  LDTGSDIVWLQCAPCRRCYS  174



>ref|XP_004494825.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cicer 
arietinum]
Length=473

 Score =   134 bits (337),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 90/123 (73%), Gaps = 5/123 (4%)
 Frame = +3

Query  153  PQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaa  332
            P+  + L  P+     LSL LHH+D +S+   N TP+ LF  RLQRDAAR ++ +L AA 
Sbjct  49   PESEELLSIPESDPQPLSLQLHHVDALSN---NKTPQQLFHLRLQRDAARVESFTLAAAL  105

Query  333  aPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRK  512
               H +  G  FSSS++SGL+QGSGEYFTR+GVGTP KY FMVLDTGSDVVWLQC+PCRK
Sbjct  106  NQSHRS--GSGFSSSIVSGLSQGSGEYFTRIGVGTPAKYVFMVLDTGSDVVWLQCAPCRK  163

Query  513  CYA  521
            CY+
Sbjct  164  CYS  166



>ref|XP_007217966.1| hypothetical protein PRUPE_ppa005289mg [Prunus persica]
 gb|EMJ19165.1| hypothetical protein PRUPE_ppa005289mg [Prunus persica]
Length=468

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 88/115 (77%), Gaps = 9/115 (8%)
 Frame = +3

Query  195  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaaraka-lsllaaaaPPHNATRG----  359
            NTLS+ LHH+D +S   +N TP  LF  RLQRDA R K   S+ AAAA P+   RG    
Sbjct  51   NTLSVQLHHLDALS---LNKTPSQLFNLRLQRDAVRVKTLSSIAAAAASPNRTARGGRVP  107

Query  360  -RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
             R FSSSV+SGLAQGSGEYFTRLGVGTPPKY +MVLDTGSDVVWLQC+PC++CY+
Sbjct  108  IRGFSSSVVSGLAQGSGEYFTRLGVGTPPKYVYMVLDTGSDVVWLQCAPCKRCYS  162



>ref|XP_011038277.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Populus 
euphratica]
Length=505

 Score =   132 bits (332),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 97/150 (65%), Gaps = 11/150 (7%)
 Frame = +3

Query  96   KPFSLRPLPTAQHYSLSSKPQYSQTLVQPDDSE------NTLSLDLHHIDLISSAAVNAT  257
            +  +L PLP     S +     +QT   P  SE       +LS+ LHHID +SS     +
Sbjct  52   QTLTLNPLPNKPTISWADTEPGTQTFTDPTISEPSSSATTSLSVQLHHIDALSSGK---S  108

Query  258  PKALFVKRLQRDaarakalsllaaaaPPHNATRGRD--FSSSVISGLAQGSGEYFTRLGV  431
             + LF  RL RDAAR K+L  LAA     N TR R   FSSSVISGLAQGSGEYFTRLGV
Sbjct  109  SQDLFNSRLARDAARVKSLISLAATVGGTNLTRARGPGFSSSVISGLAQGSGEYFTRLGV  168

Query  432  GTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            GTP +Y +MVLDTGSD+VW+QC+PC+KCY+
Sbjct  169  GTPARYVYMVLDTGSDIVWIQCAPCKKCYS  198



>ref|XP_009336767.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=485

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 86/112 (77%), Gaps = 11/112 (10%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRG------R  362
            LS+ LHHID +   A+N TP  LF  RLQRDA R K L+ LAA+  P+  TRG      R
Sbjct  72   LSVQLHHIDAV---ALNKTPTQLFNLRLQRDAFRVKTLTSLAAS--PNRTTRGGGRVPVR  126

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
             FSSSV+SGL+QGSGEYFTRLGVGTPP+Y +MVLDTGSDVVWLQC+PCR+CY
Sbjct  127  GFSSSVVSGLSQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWLQCAPCRRCY  178



>ref|XP_010474721.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=484

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 84/107 (79%), Gaps = 3/107 (3%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSV  380
            ++L+L HID +SS   N TP+ LF  RLQRD+ R ++++ LAA  P  N T    FSSSV
Sbjct  74   ITLNLDHIDALSS---NKTPQELFSSRLQRDSKRVQSIATLAARVPRRNVTHAPGFSSSV  130

Query  381  ISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            +SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+
Sbjct  131  VSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYS  177



>ref|XP_002523337.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF39053.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=469

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 96/140 (69%), Gaps = 13/140 (9%)
 Frame = +3

Query  129  QHYSLSSKPQYSQTLVQPDDSEN---------TLSLDLHHIDLISSAAVNATPKALFVKR  281
             + +L + P  SQ  +   DSE+         T S+ LHH+D +S    N+TP+ LF  R
Sbjct  27   NYQTLVANPLRSQPTLSWTDSESPTDTAESSATFSVQLHHVDALS---FNSTPETLFTTR  83

Query  282  LQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  461
            LQRDAAR +A+S LA  A       G  FSSSVISGLAQGSGEYFTR+GVGTPP+Y +MV
Sbjct  84   LQRDAARVEAISYLAETAGTGKRV-GTGFSSSVISGLAQGSGEYFTRIGVGTPPRYVYMV  142

Query  462  LDTGSDVVWLQCSPCRKCYA  521
            LDTGSD+VW+QC+PC++CYA
Sbjct  143  LDTGSDIVWIQCAPCKRCYA  162



>emb|CDP08669.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 92/119 (77%), Gaps = 2/119 (2%)
 Frame = +3

Query  165  QTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPH  344
            +T    +   N  SL+LHH+D +S  + +A+P++LF  RLQRDA RAK++S +A+     
Sbjct  63   ETAAGTEFQSNNFSLELHHVDALS-LSPHASPESLFNLRLQRDAFRAKSISDMASGRGRQ  121

Query  345  NATRGR-DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
                GR +FSSSVISGL+QGSGEYFTRLG+GTPPKY++MVLDTGSDVVW+QCSPC+KCY
Sbjct  122  GVGLGRMNFSSSVISGLSQGSGEYFTRLGIGTPPKYSYMVLDTGSDVVWIQCSPCKKCY  180



>ref|XP_011023172.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Populus 
euphratica]
Length=492

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 93/126 (74%), Gaps = 9/126 (7%)
 Frame = +3

Query  162  SQTLVQPDDSE----NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaa  329
            +QTL     SE     +LS+ LHH+D +SS   + TP+ LF  RL RDA+R K+L+ LAA
Sbjct  63   AQTLTDSTFSEASTTTSLSVQLHHLDALSS---DKTPQDLFNSRLARDASRVKSLTSLAA  119

Query  330  aaPPHNATRGRD--FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSP  503
            A    N TR R   FSSSVISGLAQGSGEYFTRLGVGTP +Y FMVLDTGSD+VW+QC+P
Sbjct  120  ATGRTNRTRARGPGFSSSVISGLAQGSGEYFTRLGVGTPARYVFMVLDTGSDIVWIQCAP  179

Query  504  CRKCYA  521
            C+KCY+
Sbjct  180  CKKCYS  185



>ref|XP_010095748.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
 gb|EXB62168.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
Length=491

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 84/111 (76%), Gaps = 7/111 (6%)
 Frame = +3

Query  198  TLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD----  365
            ++S  LHHID +S+   + +P+ LF  RLQRDA R K L  + AAA   N +R R     
Sbjct  77   SISAQLHHIDALSA---DKSPEQLFDLRLQRDALRVKNLVEVTAAAASRNVSRTRGAAPG  133

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            FSSSVISGLAQGSGEYFTRLGVGTPP+Y +MVLDTGSDVVWLQC+PCRKCY
Sbjct  134  FSSSVISGLAQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWLQCAPCRKCY  184



>gb|KJB49569.1| hypothetical protein B456_008G125700 [Gossypium raimondii]
Length=488

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 108/172 (63%), Gaps = 19/172 (11%)
 Frame = +3

Query  54   SYFLAIPSSPPSITKPFSL-----RPLPTAQHYSLSSKPQYSQTLVQPDD----SENT--  200
            S  L   S   +++ PF L     RPLP+A   S         +LV+  D    + NT  
Sbjct  14   SVILLFFSLSAAVSSPFQLHSLLLRPLPSAPVLSWQDSDLPFNSLVETSDLDTVNSNTSL  73

Query  201  -LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR--GR--D  365
             L L+LHH+D +SS     TP+ LF  RLQRDA RA+ ++ L + A      R  GR   
Sbjct  74   GLQLELHHLDALSS---EETPERLFDLRLQRDALRAETINSLVSKAVARKHPRAPGRRPG  130

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            FSSSVISGLAQGSGEYFTRLGVGTPP+Y +MVLDTGSDV+W+QCSPC+KCY+
Sbjct  131  FSSSVISGLAQGSGEYFTRLGVGTPPRYLYMVLDTGSDVIWVQCSPCKKCYS  182



>ref|XP_010266550.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=484

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 88/114 (77%), Gaps = 8/114 (7%)
 Frame = +3

Query  192  ENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPP---HNATR--  356
            +  L+  L H D +   A N TP+ALF  RL+RDAAR ++LS +AA APP    NATR  
Sbjct  65   QTILTARLEHRDAL---AFNVTPEALFHLRLERDAARVESLSTMAAGAPPVTSRNATRSR  121

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            G  FSSSVISGL+QGSGEYFTR+GVGTPP+Y +MVLDTGSD+VW+QC+PCRKCY
Sbjct  122  GNGFSSSVISGLSQGSGEYFTRIGVGTPPRYVYMVLDTGSDIVWIQCAPCRKCY  175



>ref|XP_008376086.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=487

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 85/115 (74%), Gaps = 10/115 (9%)
 Frame = +3

Query  195  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDa-arakalsllaaaaPPHNATRG----  359
            NTLS+ LHHID +   A+N TP  LF  RLQRDA       +L AAAA P+  TRG    
Sbjct  69   NTLSVQLHHIDAM---ALNKTPTQLFHLRLQRDAFRVKALTTLAAAAASPNRTTRGGGHV  125

Query  360  --RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
                FSSSV+SGL+QGSGEYFTRLGVGTPP+Y +MVLDTGSDVVWLQC+PC++CY
Sbjct  126  PVTGFSSSVVSGLSQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWLQCAPCKRCY  180



>emb|CBI40559.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 100/150 (67%), Gaps = 11/150 (7%)
 Frame = +3

Query  90   ITKPFSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKAL  269
            + +P    P   +Q     ++ Q S   V   D   T+++ L H D++   A NATP+AL
Sbjct  66   VVRPLGENPTTKSQLSWTETETQISTLPVSETDP--TMTMHLEHRDVL---AFNATPEAL  120

Query  270  FVKRLQRDaarakalsllaaaaPPH----NAT--RGRDFSSSVISGLAQGSGEYFTRLGV  431
            F  RLQRDA R +ALS +AAAA       N T  +G  FSSSV SGLAQGSGEYFTRLGV
Sbjct  121  FNLRLQRDAFRVEALSKMAAAAGGRRAGRNGTHAQGGGFSSSVTSGLAQGSGEYFTRLGV  180

Query  432  GTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            GTPPKY +MVLDTGSDVVW+QC+PCRKCY+
Sbjct  181  GTPPKYVYMVLDTGSDVVWIQCAPCRKCYS  210



>ref|XP_002263964.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Vitis vinifera]
 emb|CAN64659.1| hypothetical protein VITISV_009613 [Vitis vinifera]
Length=489

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 100/150 (67%), Gaps = 11/150 (7%)
 Frame = +3

Query  90   ITKPFSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKAL  269
            + +P    P   +Q     ++ Q S   V   D   T+++ L H D++   A NATP+AL
Sbjct  39   VVRPLGENPTTKSQLSWTETETQISTLPVSETDP--TMTMHLEHRDVL---AFNATPEAL  93

Query  270  FVKRLQRDaarakalsllaaaaPPH----NAT--RGRDFSSSVISGLAQGSGEYFTRLGV  431
            F  RLQRDA R +ALS +AAAA       N T  +G  FSSSV SGLAQGSGEYFTRLGV
Sbjct  94   FNLRLQRDAFRVEALSKMAAAAGGRRAGRNGTHAQGGGFSSSVTSGLAQGSGEYFTRLGV  153

Query  432  GTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            GTPPKY +MVLDTGSDVVW+QC+PCRKCY+
Sbjct  154  GTPPKYVYMVLDTGSDVVWIQCAPCRKCYS  183



>gb|AAM66061.1| chloroplast nucleoid DNA binding protein, putative [Arabidopsis 
thaliana]
Length=485

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 85/110 (77%), Gaps = 6/110 (5%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFS  371
            ++L+L HID +SS   N TP+ LF  RLQRD+ R ++++ LAA  P  N T   R   FS
Sbjct  72   ITLNLDHIDALSS---NKTPQELFSSRLQRDSRRVRSIATLAAQIPGRNVTHAPRPGGFS  128

Query  372  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            SSV+SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+
Sbjct  129  SSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYS  178



>ref|XP_010457141.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=485

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 84/110 (76%), Gaps = 6/110 (5%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFS  371
            ++L+L HID +SS   N TP+ LF  RLQRD+ R  +++ LAA  P  N T   R   FS
Sbjct  72   ITLNLDHIDALSS---NKTPQELFSSRLQRDSRRVNSIATLAARVPRRNVTHAPRPGGFS  128

Query  372  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            SSV+SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+
Sbjct  129  SSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYS  178



>ref|NP_171637.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAF97328.1|AC023628_9 Unknown protein [Arabidopsis thaliana]
 gb|AAM91547.1| chloroplast nucleoid DNA binding protein, putative [Arabidopsis 
thaliana]
 gb|AAP31963.1| At1g01300 [Arabidopsis thaliana]
 gb|AEE27268.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=485

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 84/110 (76%), Gaps = 6/110 (5%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFS  371
            ++L+L HID +SS   N TP  LF  RLQRD+ R K+++ LAA  P  N T   R   FS
Sbjct  72   ITLNLDHIDALSS---NKTPDELFSSRLQRDSRRVKSIATLAAQIPGRNVTHAPRPGGFS  128

Query  372  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            SSV+SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+
Sbjct  129  SSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYS  178



>ref|XP_008461984.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
melo]
Length=517

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 97/155 (63%), Gaps = 21/155 (14%)
 Frame = +3

Query  57   YFLAIPSSPPSITKPFSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLIS  236
            YF+   SS  S  +  +LR LPT    SL    +  Q+          L+LDLHH+D   
Sbjct  77   YFI---SSAASEFQTLTLRSLPTPSPLSLFPDSESLQS-----SPAAALTLDLHHLD---  125

Query  237  SAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYF  416
            S ++N TP  LF  RL RDA R  AL+          A  G  FSSSVISGLAQGSGEYF
Sbjct  126  SLSLNKTPTDLFNLRLHRDALRVHALTS--------RAAPG--FSSSVISGLAQGSGEYF  175

Query  417  TRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            TRLGVGTPP+Y +MVLDTGSDVVWLQCSPCRKCY+
Sbjct  176  TRLGVGTPPRYLYMVLDTGSDVVWLQCSPCRKCYS  210



>ref|XP_004139658.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 ref|XP_004154449.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN44550.1| hypothetical protein Csa_7G329350 [Cucumis sativus]
Length=453

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 94/149 (63%), Gaps = 19/149 (13%)
 Frame = +3

Query  75   SSPPSITKPFSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNA  254
            S+  S  +  +LR LPT     L    Q  Q+   PD     L+LDLHH+D   S ++N 
Sbjct  17   STAASEFQTLTLRSLPTPSPLPLFPDSQSLQS--SPD---APLTLDLHHLD---SLSLNK  68

Query  255  TPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVG  434
            TP  LF  RL RD  R  AL+           +R   FSSSV+SGL+QGSGEYFTRLGVG
Sbjct  69   TPTDLFNLRLHRDTLRVHALN-----------SRAAGFSSSVVSGLSQGSGEYFTRLGVG  117

Query  435  TPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            TPP+Y +MVLDTGSDVVWLQCSPCRKCY+
Sbjct  118  TPPRYLYMVLDTGSDVVWLQCSPCRKCYS  146



>ref|XP_002320868.1| aspartyl protease family protein [Populus trichocarpa]
 gb|EEE99183.1| aspartyl protease family protein [Populus trichocarpa]
Length=488

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 97/150 (65%), Gaps = 11/150 (7%)
 Frame = +3

Query  96   KPFSLRPLPTAQHYSLSSKPQYSQTLV-----QPDDSENT-LSLDLHHIDLISSAAVNAT  257
            +  +L PLP     S +     +QT       +P  S  T LS+ LHHID +SS   + +
Sbjct  35   QTLTLNPLPNKPTISWADTEPGTQTFTDQTTSEPSSSATTFLSVQLHHIDALSS---DKS  91

Query  258  PKALFVKRLQRDaarakalsllaaaaPPHNATRGRD--FSSSVISGLAQGSGEYFTRLGV  431
             + LF  RL RDAAR K+L  LAA     N TR R   FSSSVISGLAQGSGEYFTRLGV
Sbjct  92   SQDLFNSRLVRDAARVKSLISLAATVGGTNLTRARGPGFSSSVISGLAQGSGEYFTRLGV  151

Query  432  GTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            GTP +Y +MVLDTGSD+VW+QC+PC KCY+
Sbjct  152  GTPARYVYMVLDTGSDIVWIQCAPCIKCYS  181



>gb|EPS66029.1| hypothetical protein M569_08742 [Genlisea aurea]
Length=464

 Score =   126 bits (316),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 80/107 (75%), Gaps = 1/107 (1%)
 Frame = +3

Query  204  SLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT-RGRDFSSSV  380
            SL L H+D +  +  +A+P+ LF  RL+RDA R + LS     A   N + R RDFSSSV
Sbjct  50   SLGLFHVDDVYYSGADASPELLFQFRLRRDAIRVRDLSAAVVEAAARNVSGRARDFSSSV  109

Query  381  ISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
             SGL+QGSGEYFTR+G+GTPP+Y +MVLDTGSDVVW+QCSPC KCY+
Sbjct  110  TSGLSQGSGEYFTRIGIGTPPRYVYMVLDTGSDVVWIQCSPCTKCYS  156



>emb|CDX90023.1| BnaA10g00590D [Brassica napus]
Length=481

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 84/109 (77%), Gaps = 6/109 (6%)
 Frame = +3

Query  204  SLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFSS  374
            +L+L HID +S+   N TP+ LF  RLQRD+ R K+++ LAA  P  N T   R   FSS
Sbjct  69   TLNLDHIDALST---NRTPEELFSSRLQRDSRRVKSIATLAARIPRRNTTHAPRPGGFSS  125

Query  375  SVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            SV+SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+
Sbjct  126  SVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYS  174



>ref|XP_009119684.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=481

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 84/109 (77%), Gaps = 6/109 (6%)
 Frame = +3

Query  204  SLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFSS  374
            +L+L HID +S+   N TP+ LF  RLQRD+ R K+++ LAA  P  N T   R   FSS
Sbjct  69   TLNLDHIDALST---NRTPEELFSSRLQRDSRRVKSIATLAARIPRRNTTHAPRPGGFSS  125

Query  375  SVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            SV+SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+
Sbjct  126  SVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYS  174



>gb|KFK42512.1| hypothetical protein AALP_AA1G003500 [Arabis alpina]
Length=477

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 84/107 (79%), Gaps = 3/107 (3%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSV  380
            ++L+L HID +++   N TP+ LF  RLQRD+ R K+++ LA+     +A R   FSSSV
Sbjct  67   ITLNLDHIDALTT---NRTPQELFTSRLQRDSKRVKSIATLASQRNTTHAPRTGTFSSSV  123

Query  381  ISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            +SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PC++CY+
Sbjct  124  VSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCKRCYS  170



>ref|XP_002302634.2| aspartyl protease family protein [Populus trichocarpa]
 gb|EEE81907.2| aspartyl protease family protein [Populus trichocarpa]
Length=490

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 83/107 (78%), Gaps = 5/107 (5%)
 Frame = +3

Query  207  LDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD--FSSSV  380
            + LHH+D +SS   + TP+ LF  RL RDA+R K+L+ LAAA    N TR R   FSSSV
Sbjct  80   VQLHHLDALSS---DETPQDLFNSRLARDASRVKSLTSLAAAVGSTNRTRARGPGFSSSV  136

Query  381  ISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
             SGLAQGSGEYFTRLGVGTP +Y FMVLDTGSDVVW+QC+PC+KCY+
Sbjct  137  TSGLAQGSGEYFTRLGVGTPARYVFMVLDTGSDVVWIQCAPCKKCYS  183



>ref|XP_010665756.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Beta 
vulgaris subsp. vulgaris]
Length=484

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 92/131 (70%), Gaps = 13/131 (10%)
 Frame = +3

Query  156  QYSQTLVQPDDS---ENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaaraka--lsl  320
            Q +QTL + + S   ++T +L L H+D +SS   + TP+ LF  RL+RD ARAK      
Sbjct  49   QTTQTLEELELSTSIDSTFTLHLEHLDALSS---HLTPEELFSFRLKRDDARAKTIFARA  105

Query  321  laaaaPPHNATRG-----RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVV  485
             +++   H   R      RDFSSS++SGL+QGSGEYFTRLGVGTPPKY +MVLDTGSD+V
Sbjct  106  HSSSRSAHKHGRNASHSTRDFSSSIVSGLSQGSGEYFTRLGVGTPPKYMYMVLDTGSDIV  165

Query  486  WLQCSPCRKCY  518
            W+QC+PC+KCY
Sbjct  166  WIQCTPCKKCY  176



>ref|XP_007147317.1| hypothetical protein PHAVU_006G113700g [Phaseolus vulgaris]
 gb|ESW19311.1| hypothetical protein PHAVU_006G113700g [Phaseolus vulgaris]
Length=534

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 97/142 (68%), Gaps = 8/142 (6%)
 Frame = +3

Query  93   TKPFSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALF  272
            T   SL  LP   H    S PQ ++ L +PD  E  LSL+LHHID +SS   N TP+ LF
Sbjct  94   TLTLSLHSLP---HSPTLSWPQ-AEALAEPD-PEEALSLNLHHIDALSS---NKTPEQLF  145

Query  273  VKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYA  452
              RLQRD  R ++L  LAA    H    G  FSSS+ISGLAQGSGEYFTR+GVGTP KY 
Sbjct  146  HLRLQRDGKRVQSLLTLAALNSSHARRSGSGFSSSIISGLAQGSGEYFTRIGVGTPAKYV  205

Query  453  FMVLDTGSDVVWLQCSPCRKCY  518
            +MVLDTGSDVVWLQC+PCRKCY
Sbjct  206  YMVLDTGSDVVWLQCAPCRKCY  227



>ref|XP_006307379.1| hypothetical protein CARUB_v10009005mg [Capsella rubella]
 gb|EOA40277.1| hypothetical protein CARUB_v10009005mg [Capsella rubella]
Length=481

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 79/107 (74%), Gaps = 6/107 (6%)
 Frame = +3

Query  210  DLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFSSSV  380
            +L HID +SS   N TP  LF  RL RD+ R K++  LAA  P  N T   R   FSSSV
Sbjct  71   NLDHIDALSS---NKTPDELFSSRLLRDSRRVKSIVTLAARVPRRNVTHAPRPGGFSSSV  127

Query  381  ISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            +SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+
Sbjct  128  VSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYS  174



>ref|XP_010556596.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Tarenaya 
hassleriana]
Length=467

 Score =   120 bits (301),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 77/103 (75%), Gaps = 3/103 (3%)
 Frame = +3

Query  213  LHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGL  392
            LHHID +S+   N TP+ LF  RL RD+ R ++++ L       +A     FSSSVISGL
Sbjct  61   LHHIDALSA---NKTPEQLFHLRLHRDSRRVESIAALTRRGNASHAPSAAGFSSSVISGL  117

Query  393  AQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            +QGSGEYFTR+GVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+
Sbjct  118  SQGSGEYFTRIGVGTPARYLYMVLDTGSDIVWLQCAPCRRCYS  160



>ref|XP_004306664.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Fragaria 
vesca subsp. vesca]
Length=467

 Score =   120 bits (301),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 96/141 (68%), Gaps = 13/141 (9%)
 Frame = +3

Query  108  LRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQ  287
            L PLP+A   SLS    +S+T  +PD   ++LSL LHH+D +SS   + TP  LF  RL+
Sbjct  30   LSPLPSAP--SLSQPESFSETTSEPDSDPSSLSLPLHHLDALSS---DQTPSQLFHLRLR  84

Query  288  RDaarakalsllaaaaPPHNATRGRDFSSSVIS---GLAQGSGEYFTRLGVGTPPKYAFM  458
            RD+ R  +L+ LA     +N TR    S    S   GL+QGSGEYFTR+GVG+PPKY +M
Sbjct  85   RDSLRFNSLTSLA-----YNRTRPGPSSGFSSSIVSGLSQGSGEYFTRIGVGSPPKYLYM  139

Query  459  VLDTGSDVVWLQCSPCRKCYA  521
            VLDTGSDVVWLQC+PC++CY+
Sbjct  140  VLDTGSDVVWLQCAPCKRCYS  160



>emb|CDY43952.1| BnaC04g21580D [Brassica napus]
Length=483

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 86/124 (69%), Gaps = 6/124 (5%)
 Frame = +3

Query  162  SQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPP  341
            S++L  P  S  +LSL L HID ISS + +A+P  LF  RL+RD+ R ++L+ LAA +  
Sbjct  48   SESLTTPSQSTTSLSLHLSHIDAISSFS-DASPAELFDLRLKRDSIRVESLTSLAAVSSR  106

Query  342  HNATR-----GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
             N TR        FS +VISGL+QGSGEYF RLGVGTP    +MVLDTGSDVVWLQC+PC
Sbjct  107  RNVTRRAPRSAGGFSGAVISGLSQGSGEYFMRLGVGTPATNMYMVLDTGSDVVWLQCAPC  166

Query  507  RKCY  518
            + CY
Sbjct  167  KVCY  170



>ref|XP_010512555.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=483

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 85/119 (71%), Gaps = 6/119 (5%)
 Frame = +3

Query  177  QPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR  356
            QP+ + ++LS+ L H+D +SS + +A+P  LF  RLQRD+ R ++++ LAA +   N TR
Sbjct  53   QPESTTSSLSVHLSHVDALSSLS-DASPTDLFNLRLQRDSLRVESIASLAAVSTGRNVTR  111

Query  357  -----GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
                    FS +VISGL+QGSGEYF RLGVGTP    +MVLDTGSDVVWLQCSPC+ CY
Sbjct  112  KTPRSAGGFSGAVISGLSQGSGEYFMRLGVGTPATNVYMVLDTGSDVVWLQCSPCKACY  170



>emb|CDX89133.1| BnaA04g00530D [Brassica napus]
Length=483

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 86/124 (69%), Gaps = 6/124 (5%)
 Frame = +3

Query  162  SQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPP  341
            S++L     S  +LSL L H+D ISS + +A+P  LF  RL+RD+ R ++L+ LAA +  
Sbjct  48   SESLTTVSQSTTSLSLHLSHVDAISSFS-DASPAELFNLRLKRDSLRVESLTTLAAVSSR  106

Query  342  HNATR-----GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
             N TR        FS +VISGL+QGSGEYF RLGVGTP K  +MVLDTGSDVVWLQC+PC
Sbjct  107  RNVTRRAPRSAGGFSGAVISGLSQGSGEYFMRLGVGTPAKNMYMVLDTGSDVVWLQCAPC  166

Query  507  RKCY  518
            + CY
Sbjct  167  KVCY  170



>ref|XP_010469025.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=486

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 85/119 (71%), Gaps = 6/119 (5%)
 Frame = +3

Query  177  QPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR  356
            QP+ + ++LS+ L H+D + S + +A+P ALF  RLQRD+ R +++S LAA +   N TR
Sbjct  56   QPESTTSSLSVHLSHVDALYSFS-DASPTALFNLRLQRDSLRVESISSLAAVSTGRNVTR  114

Query  357  -----GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
                    FS +VISGL+QGSGEYF RLGVGTP    +MVLDTGSDVVWLQCSPC+ CY
Sbjct  115  RTPRSAGGFSGAVISGLSQGSGEYFMRLGVGTPATNVYMVLDTGSDVVWLQCSPCKACY  173



>ref|XP_009138753.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=483

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 85/124 (69%), Gaps = 6/124 (5%)
 Frame = +3

Query  162  SQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPP  341
            S++L     S  +LSL L H+D ISS A +A+P  LF  RL+RD+ R ++L+ LAA +  
Sbjct  48   SESLTTVSQSTTSLSLHLSHVDAISSFA-DASPAELFNLRLKRDSLRVESLTTLAAVSSR  106

Query  342  HNATR-----GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
             N TR        FS +VISGL+QGSGEYF RLGVGTP    +MVLDTGSDVVWLQC+PC
Sbjct  107  RNVTRRAPRSAGGFSGAVISGLSQGSGEYFMRLGVGTPATNMYMVLDTGSDVVWLQCAPC  166

Query  507  RKCY  518
            + CY
Sbjct  167  KVCY  170



>gb|KFK35370.1| hypothetical protein AALP_AA5G276300 [Arabis alpina]
Length=485

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 89/131 (68%), Gaps = 8/131 (6%)
 Frame = +3

Query  147  SKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalslla  326
            S P  S++  + + +  +LS+ L HID +SS + ++TP  LF  RL+RD+ R  +++ LA
Sbjct  43   SWPDQSESEFKSESTTTSLSVHLSHIDALSSFS-DSTPSELFNLRLRRDSLRVNSITKLA  101

Query  327  aaaPPHNATRGR-------DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVV  485
            A +   N TR +        FS +VISGL+QGSGEYF RLGVGTP   A+MVLDTGSDVV
Sbjct  102  AVSTGRNITRKKRTPKSSGGFSGAVISGLSQGSGEYFMRLGVGTPATNAYMVLDTGSDVV  161

Query  486  WLQCSPCRKCY  518
            WLQCSPC+ CY
Sbjct  162  WLQCSPCKVCY  172



>ref|XP_010413342.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=488

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 85/119 (71%), Gaps = 6/119 (5%)
 Frame = +3

Query  177  QPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR  356
            QP+ + ++LS+ L H+D + S + +A+P  LF  RLQRD+ R +++S LAA +   NATR
Sbjct  58   QPESTTSSLSVHLSHVDALFSFS-DASPTDLFNLRLQRDSLRVESISSLAAVSTGRNATR  116

Query  357  -----GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
                    FS +VISGL+QGSGEYF RLGVGTP    +MVLDTGSDVVWLQCSPC+ CY
Sbjct  117  RTPRSAGGFSGAVISGLSQGSGEYFMRLGVGTPATNVYMVLDTGSDVVWLQCSPCKACY  175



>ref|XP_002878415.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54674.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=486

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 92/142 (65%), Gaps = 8/142 (6%)
 Frame = +3

Query  108  LRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQ  287
            +  LP++   S      +S   V   +S  +LS+ L H+D +SS + +A+P  LF  RLQ
Sbjct  35   VNTLPSSATLSWPESKSFSDESVS--ESTTSLSVHLSHVDALSSFS-DASPVDLFKLRLQ  91

Query  288  RDaarakalsllaaaaPPHNATR-----GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYA  452
            RD+ R K+++ LAA +   NAT+        FS +VISGL+QGSGEYF RLGVGTP    
Sbjct  92   RDSLRVKSITSLAAVSTGRNATKRTPRSAGGFSGAVISGLSQGSGEYFMRLGVGTPATNV  151

Query  453  FMVLDTGSDVVWLQCSPCRKCY  518
            +MVLDTGSDVVWLQCSPC+ CY
Sbjct  152  YMVLDTGSDVVWLQCSPCKACY  173



>ref|XP_003554768.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=472

 Score =   115 bits (287),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 80/106 (75%), Gaps = 3/106 (3%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSV  380
            LSL LHHID +SS   N TP+ LF  RLQRDA R + +  LAA    H    G  FSSS+
Sbjct  62   LSLHLHHIDALSS---NKTPEQLFQLRLQRDAKRVEGVVALAALNQSHARRSGSSFSSSI  118

Query  381  ISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            ISGLAQGSGEYFTR+GVGTP +Y +MVLDTGSDVVWLQC+PCRKCY
Sbjct  119  ISGLAQGSGEYFTRIGVGTPARYVYMVLDTGSDVVWLQCAPCRKCY  164



>ref|XP_007051537.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
 gb|EOX95694.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
Length=488

 Score =   115 bits (287),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 99/161 (61%), Gaps = 19/161 (12%)
 Frame = +3

Query  87   SITKPFSL-----RPLPTAQHYSLSSKPQYSQTLVQPDD-----SENTLS--LDLHHIDL  230
            +++ PF L     R LP+    S       S +LV+  D     S  TL   L+LHH+D 
Sbjct  25   AVSTPFQLQTLVPRTLPSPSTLSGQDSELESDSLVETSDLDTVNSNTTLEVQLELHHVDA  84

Query  231  ISSAAVNATPKALFVKRLQRDaaraka----lsllaaaaPPHNATRGRDFSSSVISGLAQ  398
             SS  +   P+ LF  RLQRD  RA+     ++   A  PP    R   FSSS+ISGLAQ
Sbjct  85   FSSEEI---PERLFDLRLQRDELRAETINSLVAKAVARNPPRAPGRRSGFSSSIISGLAQ  141

Query  399  GSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            GSGEYFTRLGVGTPP+Y +MVLDTGSDVVW+QCSPC+KCY+
Sbjct  142  GSGEYFTRLGVGTPPRYLYMVLDTGSDVVWVQCSPCKKCYS  182



>gb|AGV54495.1| aspartic proteinase nepenthesin-1-like protein [Phaseolus vulgaris]
Length=476

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 88/115 (77%), Gaps = 6/115 (5%)
 Frame = +3

Query  186  DSE---NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR  356
            DSE   +T+S+++HHID +S   +N TP  LF  RLQRDAAR K+LS LAA       T 
Sbjct  59   DSEPDPDTISVNVHHIDALS---LNKTPSQLFHFRLQRDAARVKSLSSLAALNQTRPTTS  115

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            G  FSSSVISGLAQGSGEYFTRLGVGTPPKY +MVLDTGSDVVWLQC PC KCY+
Sbjct  116  GSGFSSSVISGLAQGSGEYFTRLGVGTPPKYVYMVLDTGSDVVWLQCKPCAKCYS  170



>ref|XP_010918360.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=507

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 80/113 (71%), Gaps = 8/113 (7%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPH----NATRGR--  362
            L + L H+D  S  A N+TP+ L   RL RD AR   L  + AAA        A RGR  
Sbjct  78   LRVRLAHLD--SLLAANSTPEHLLSLRLGRDVARVSNLHEILAAAMAAGNATRAIRGRRR  135

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
             FSSSV+SGLAQGSGEYFTR+G+GTP +YA+MVLDTGSDVVWLQC+PCR+CY+
Sbjct  136  GFSSSVVSGLAQGSGEYFTRIGIGTPARYAYMVLDTGSDVVWLQCAPCRRCYS  188



>ref|XP_007135265.1| hypothetical protein PHAVU_010G114700g [Phaseolus vulgaris]
 gb|ESW07259.1| hypothetical protein PHAVU_010G114700g [Phaseolus vulgaris]
Length=477

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 88/115 (77%), Gaps = 6/115 (5%)
 Frame = +3

Query  186  DSE---NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR  356
            DSE   +T+S+++HHID +S   +N TP  LF  RLQRDAAR K+LS LAA       T 
Sbjct  59   DSEPDPDTISVNVHHIDALS---LNKTPSQLFHFRLQRDAARVKSLSSLAALNQTRPTTS  115

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            G  FSSSVISGLAQGSGEYFTRLGVGTPPKY +MVLDTGSDVVWLQC PC KCY+
Sbjct  116  GSGFSSSVISGLAQGSGEYFTRLGVGTPPKYVYMVLDTGSDVVWLQCKPCAKCYS  170



>gb|AGV54447.1| aspartic proteinase nepenthesin-1 precursor [Phaseolus vulgaris]
Length=477

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 88/115 (77%), Gaps = 6/115 (5%)
 Frame = +3

Query  186  DSE---NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR  356
            DSE   +T+S+++HHID +S   +N TP  LF  RLQRDAAR K+LS LAA       T 
Sbjct  59   DSEPDPDTISVNVHHIDALS---LNKTPSQLFHFRLQRDAARVKSLSSLAALNQTRPTTS  115

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            G  FSSSVISGLAQGSGEYFTRLGVGTPPKY +MVLDTGSDVVWLQC PC KCY+
Sbjct  116  GSGFSSSVISGLAQGSGEYFTRLGVGTPPKYVYMVLDTGSDVVWLQCKPCAKCYS  170



>ref|XP_007051536.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOX95693.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
Length=557

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 99/161 (61%), Gaps = 19/161 (12%)
 Frame = +3

Query  87   SITKPFSL-----RPLPTAQHYSLSSKPQYSQTLVQPDD-----SENTLS--LDLHHIDL  230
            +++ PF L     R LP+    S       S +LV+  D     S  TL   L+LHH+D 
Sbjct  25   AVSTPFQLQTLVPRTLPSPSTLSGQDSELESDSLVETSDLDTVNSNTTLEVQLELHHVDA  84

Query  231  ISSAAVNATPKALFVKRLQRDaaraka----lsllaaaaPPHNATRGRDFSSSVISGLAQ  398
             SS  +   P+ LF  RLQRD  RA+     ++   A  PP    R   FSSS+ISGLAQ
Sbjct  85   FSSEEI---PERLFDLRLQRDELRAETINSLVAKAVARNPPRAPGRRSGFSSSIISGLAQ  141

Query  399  GSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            GSGEYFTRLGVGTPP+Y +MVLDTGSDVVW+QCSPC+KCY+
Sbjct  142  GSGEYFTRLGVGTPPRYLYMVLDTGSDVVWVQCSPCKKCYS  182



>ref|XP_010480432.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=488

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 84/110 (76%), Gaps = 6/110 (5%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFS  371
            ++L+L HID +SS   N TP+ LF  RLQRD+ R  +++ LAA  P  N T   R   FS
Sbjct  75   ITLNLDHIDALSS---NKTPQELFSSRLQRDSRRVNSIATLAARVPRRNVTHAPRSGGFS  131

Query  372  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            SSV+SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+
Sbjct  132  SSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYS  181



>ref|XP_008437888.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
melo]
Length=474

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = +3

Query  243  AVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR-DFSSSVISGLAQGSGEYFT  419
            + N TP+ LF  RLQRDA R K LS L A +   +   G   FSSSVISGLAQGSGEYFT
Sbjct  75   SFNRTPEELFHLRLQRDAIRVKKLSSLGATSRNLSRPSGTTGFSSSVISGLAQGSGEYFT  134

Query  420  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            R+GVGTPPKY +MVLDTGSD+VWLQC+PC+ CY+
Sbjct  135  RIGVGTPPKYVYMVLDTGSDIVWLQCAPCKNCYS  168



>ref|XP_004133810.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=471

 Score =   112 bits (280),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = +3

Query  243  AVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR-DFSSSVISGLAQGSGEYFT  419
            + N TP+ LF  RLQRDA R K LS L A +   +   G   FSSSVISGLAQGSGEYFT
Sbjct  72   SFNRTPEELFHLRLQRDAIRVKKLSSLGATSRNLSKPGGTTGFSSSVISGLAQGSGEYFT  131

Query  420  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            R+GVGTPPKY +MVLDTGSD+VWLQC+PC+ CY+
Sbjct  132  RIGVGTPPKYVYMVLDTGSDIVWLQCAPCKNCYS  165



>gb|KGN56421.1| Aspartic proteinase nepenthesin-1 [Cucumis sativus]
Length=512

 Score =   112 bits (280),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = +3

Query  243  AVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR-DFSSSVISGLAQGSGEYFT  419
            + N TP+ LF  RLQRDA R K LS L A +   +   G   FSSSVISGLAQGSGEYFT
Sbjct  113  SFNRTPEELFHLRLQRDAIRVKKLSSLGATSRNLSKPGGTTGFSSSVISGLAQGSGEYFT  172

Query  420  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            R+GVGTPPKY +MVLDTGSD+VWLQC+PC+ CY+
Sbjct  173  RIGVGTPPKYVYMVLDTGSDIVWLQCAPCKNCYS  206



>emb|CDY25081.1| BnaC06g18230D [Brassica napus]
Length=485

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 93/142 (65%), Gaps = 9/142 (6%)
 Frame = +3

Query  108  LRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQ  287
            +  LP++Q +S       + T+    DS  +L++ L H+D +SS + +A+P  LF  RL+
Sbjct  34   VNTLPSSQIFSSPEPGSLTSTVF---DSITSLTVHLSHVDALSSFS-DASPLELFNLRLR  89

Query  288  RDaarakalsllaaaaPPHNATRGR-----DFSSSVISGLAQGSGEYFTRLGVGTPPKYA  452
            RD+ R K+L+ LAA +   N T+        FS +VISGL+QGSGEYF RLGVGTP    
Sbjct  90   RDSLRVKSLTTLAAVSTGKNVTKRTPRSPGGFSGAVISGLSQGSGEYFMRLGVGTPATNV  149

Query  453  FMVLDTGSDVVWLQCSPCRKCY  518
            +MVLDTGSDVVWLQCSPC+ CY
Sbjct  150  YMVLDTGSDVVWLQCSPCKVCY  171



>ref|XP_008799615.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=504

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 75/110 (68%), Gaps = 5/110 (5%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaaraka--lsllaaaaPPHNATRGR-DFS  371
            L + + H D  S  A N+TP+ L   RL RDA R       L A     H    GR  FS
Sbjct  78   LRVRIAHRD--SLFAANSTPEHLLGLRLGRDATRVSHLHEILGAEGNATHAVRAGRRGFS  135

Query  372  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            SSV+SGLAQGSGEYFTR+G+GTP +YA+MVLDTGSDVVWLQC+PCR+CY+
Sbjct  136  SSVVSGLAQGSGEYFTRIGIGTPARYAYMVLDTGSDVVWLQCAPCRRCYS  185



>gb|AAK64003.1| AT3g61820/F15G16_210 [Arabidopsis thaliana]
Length=362

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 77/107 (72%), Gaps = 6/107 (6%)
 Frame = +3

Query  213  LHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR-----GRDFSSS  377
            L H+D +SS + +A+P  LF  RLQRD+ R K+++ LAA +   NAT+        FS +
Sbjct  65   LSHVDALSSFS-DASPADLFNLRLQRDSLRVKSITSLAAVSTGRNATKRTPRTAGGFSGA  123

Query  378  VISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            VISGL+QGSGEYF RLGVGTP    +MVLDTGSDVVWLQCSPC+ CY
Sbjct  124  VISGLSQGSGEYFMRLGVGTPATNVYMVLDTGSDVVWLQCSPCKACY  170



>gb|ABK24467.1| unknown [Picea sitchensis]
Length=497

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 92/140 (66%), Gaps = 17/140 (12%)
 Frame = +3

Query  147  SKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaara-------  305
            S  ++S+T VQ ++ +N++ L + H D +SS++  +  K +  +RL+RDAAR        
Sbjct  52   SAQEWSET-VQGEE-KNSIVLQVVHRDSLSSSSNTSLVKEILQERLKRDAARVDSINARV  109

Query  306  --kalsllaaaaPPHNATR------GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  461
               A+ +  A   P N +        +DFSSS+ISGLAQGSGEYFTRLGVGTPP+Y +MV
Sbjct  110  QLAAMGVSKAEMKPLNGSSIDARFDAKDFSSSIISGLAQGSGEYFTRLGVGTPPRYTYMV  169

Query  462  LDTGSDVVWLQCSPCRKCYA  521
            LDTGSD++W+QC PC KCY 
Sbjct  170  LDTGSDIMWIQCLPCAKCYG  189



>ref|NP_191741.1| aspartyl protease [Arabidopsis thaliana]
 emb|CAB71112.1| putative protein [Arabidopsis thaliana]
 gb|AEE80260.1| aspartyl protease [Arabidopsis thaliana]
Length=483

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 77/107 (72%), Gaps = 6/107 (6%)
 Frame = +3

Query  213  LHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR-----GRDFSSS  377
            L H+D +SS + +A+P  LF  RLQRD+ R K+++ LAA +   NAT+        FS +
Sbjct  65   LSHVDALSSFS-DASPADLFNLRLQRDSLRVKSITSLAAVSTGRNATKRTPRTAGGFSGA  123

Query  378  VISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            VISGL+QGSGEYF RLGVGTP    +MVLDTGSDVVWLQCSPC+ CY
Sbjct  124  VISGLSQGSGEYFMRLGVGTPATNVYMVLDTGSDVVWLQCSPCKACY  170



>ref|XP_011461997.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Fragaria 
vesca subsp. vesca]
Length=261

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 87/135 (64%), Gaps = 12/135 (9%)
 Frame = +3

Query  129  QHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarak  308
            Q  SL       +   +PD   ++LSL LHH+D +SS   N TP  LF  RL+RD+ R  
Sbjct  18   QRVSLGDHESTLEKTSEPDSDPSSLSLPLHHLDALSS---NQTPSQLFHLRLRRDSLRFN  74

Query  309  alsllaaaaPPHNATRGRDFSSSVIS----GLAQGSGEYFTRLGVGTPPKYAFMVLDTGS  476
            +L+ LA     +N TR    SS   S    GL+QGSGEYFTR+GVG+ PKY +MVLDTGS
Sbjct  75   SLTSLA-----YNRTRPGPPSSGFSSSIVSGLSQGSGEYFTRIGVGSSPKYLYMVLDTGS  129

Query  477  DVVWLQCSPCRKCYA  521
            +VVWLQC+PC++CY+
Sbjct  130  EVVWLQCAPCKRCYS  144



>gb|KJB09628.1| hypothetical protein B456_001G154400 [Gossypium raimondii]
Length=446

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 96/157 (61%), Gaps = 19/157 (12%)
 Frame = +3

Query  99   PFSL-----RPLPTAQHYSLSSKPQYSQTL-----VQPDDSENTLS--LDLHHIDLISSA  242
            PF L     RPLP+A   S       S +L     + P  S  TL   L+LHH+D +SS 
Sbjct  29   PFQLQTLLPRPLPSAPTLSWHDSEPESNSLEETSQLDPLSSNTTLEVQLELHHVDALSS-  87

Query  243  AVNATPKALFVKRLQRDaaraka----lsllaaaaPPHNATRGRDFSSSVISGLAQGSGE  410
                TP+ LF  RLQRDA R+      +S   A  PP  A R   FSSS+ISGLAQGSGE
Sbjct  88   --EDTPELLFDLRLQRDALRSGTIYSLVSKAVARNPPRAAGRRSGFSSSIISGLAQGSGE  145

Query  411  YFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            YFTRLGVGTP +  +MVLDTGSDVVW+QCSPC+ CY+
Sbjct  146  YFTRLGVGTPARNLYMVLDTGSDVVWVQCSPCKSCYS  182



>gb|KJB09626.1| hypothetical protein B456_001G154400 [Gossypium raimondii]
Length=488

 Score =   109 bits (272),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 96/157 (61%), Gaps = 19/157 (12%)
 Frame = +3

Query  99   PFSL-----RPLPTAQHYSLSSKPQYSQTL-----VQPDDSENTLS--LDLHHIDLISSA  242
            PF L     RPLP+A   S       S +L     + P  S  TL   L+LHH+D +SS 
Sbjct  29   PFQLQTLLPRPLPSAPTLSWHDSEPESNSLEETSQLDPLSSNTTLEVQLELHHVDALSS-  87

Query  243  AVNATPKALFVKRLQRDaaraka----lsllaaaaPPHNATRGRDFSSSVISGLAQGSGE  410
                TP+ LF  RLQRDA R+      +S   A  PP  A R   FSSS+ISGLAQGSGE
Sbjct  88   --EDTPELLFDLRLQRDALRSGTIYSLVSKAVARNPPRAAGRRSGFSSSIISGLAQGSGE  145

Query  411  YFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            YFTRLGVGTP +  +MVLDTGSDVVW+QCSPC+ CY+
Sbjct  146  YFTRLGVGTPARNLYMVLDTGSDVVWVQCSPCKSCYS  182



>ref|XP_003529886.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=473

 Score =   109 bits (272),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 88/120 (73%), Gaps = 11/120 (9%)
 Frame = +3

Query  174  VQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT  353
            V+PD  E T SL LHHID +S    N TP  LF  RL+RDAAR K L+ LAAA    N T
Sbjct  54   VEPD-PEPTTSLSLHHIDALS---FNKTPSQLFHLRLERDAARVKTLTHLAAAT---NKT  106

Query  354  RGRD----FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            R  +    FSSSV+SGL+QGSGEYFTRLGVGTPPKY +MVLDTGSDVVWLQC PC KCY+
Sbjct  107  RPANPGSGFSSSVVSGLSQGSGEYFTRLGVGTPPKYLYMVLDTGSDVVWLQCKPCTKCYS  166



>ref|XP_009394177.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=499

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 75/106 (71%), Gaps = 5/106 (5%)
 Frame = +3

Query  213  LHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaa---PPHNATRGRDFSSSVI  383
            L H D  S  A     + +F+ RL RDAAR + LS + A A   P  N T  R FSS V+
Sbjct  80   LSHRD--SLLADTTAAEQIFLLRLDRDAARVETLSQILAVATAPPAANVTSRRGFSSKVV  137

Query  384  SGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            SGLAQGSGEYF R+G+GTP +YA+MVLDTGSDVVWLQC+PCR+CY+
Sbjct  138  SGLAQGSGEYFARIGIGTPARYAYMVLDTGSDVVWLQCAPCRRCYS  183



>ref|XP_010544842.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Tarenaya 
hassleriana]
Length=510

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 83/140 (59%), Gaps = 5/140 (4%)
 Frame = +3

Query  108  LRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQ  287
            + PLPT+   S       +       ++  +LS  L H+D +S +  + +P+ LF  RL+
Sbjct  67   VNPLPTSPTLSWPDSEFVTDGSDSLSETATSLSAQLLHVDALSPS--DTSPEHLFDLRLR  124

Query  288  RDa---arakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  458
            RD+       + +  +     H       FS +V+SGL+QGSGEYFTRLGVGTP  YA+M
Sbjct  125  RDSLRVETLTSFAAASVRNVTHAPRAAGGFSGAVVSGLSQGSGEYFTRLGVGTPATYAYM  184

Query  459  VLDTGSDVVWLQCSPCRKCY  518
            VLDTGSD+VWLQCSPC+ CY
Sbjct  185  VLDTGSDIVWLQCSPCKVCY  204



>gb|KJB41527.1| hypothetical protein B456_007G108800, partial [Gossypium raimondii]
Length=460

 Score =   106 bits (265),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 96/163 (59%), Gaps = 14/163 (9%)
 Frame = +3

Query  63   LAIPSSPPSITKPFSLRPLPTAQHYSLSSKPQYSQTLVQPDD----SENT---LSLDLHH  221
            L+   S P   +   LRP P+A   S +     S +LV+  +    S NT   + L+LHH
Sbjct  15   LSAALSSPLQLQTLVLRPFPSAPTLSWTDAEPESDSLVEIFELNAVSFNTTLEMHLELHH  74

Query  222  IDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHN---ATRGRDFSSSVISGL  392
            +D  SS     T + LF   LQRD  RA+ +  L + A   N   AT    FSSS+I GL
Sbjct  75   LDAFSS---EETLERLFDLCLQRDMLRAETIYSLVSKAIACNRPRATGYLGFSSSIIFGL  131

Query  393  AQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            AQGSGEYFTRLGV T P+Y +MVLDTG DVVW+QCSPC+ CY+
Sbjct  132  AQGSGEYFTRLGVSTLPRYLYMVLDTG-DVVWVQCSPCKNCYS  173



>ref|XP_009104352.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=485

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 76/107 (71%), Gaps = 6/107 (6%)
 Frame = +3

Query  213  LHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR-----DFSSS  377
            L H+D +SS + +A+P  LF  RL+RD+ R K+L+ LAA +   N T+        FS +
Sbjct  66   LSHVDALSSFS-DASPSELFNLRLRRDSLRVKSLTTLAAVSTGKNVTKRTPRSPGGFSGA  124

Query  378  VISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            VISGL+QGSGEYF RLGVGTP    +MVLDTGSDVVWLQCSPC+ CY
Sbjct  125  VISGLSQGSGEYFMRLGVGTPATNVYMVLDTGSDVVWLQCSPCKVCY  171



>ref|XP_004171805.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like, partial 
[Cucumis sativus]
Length=384

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +3

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            FSSSVISGLAQGSGEYFTR+GVGTPPKY +MVLDTGSD+VWLQC+PC+ CY+
Sbjct  27   FSSSVISGLAQGSGEYFTRIGVGTPPKYVYMVLDTGSDIVWLQCAPCKNCYS  78



>emb|CDX67868.1| BnaA07g19080D [Brassica napus]
Length=485

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 76/107 (71%), Gaps = 6/107 (6%)
 Frame = +3

Query  213  LHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR-----DFSSS  377
            L H+D +SS + +A+P  LF  RL+RD+ R K+L+ LAA +   N T+        FS +
Sbjct  66   LSHVDALSSFS-DASPLELFNLRLRRDSLRVKSLTTLAAVSTGKNVTKRTPRSPGGFSGA  124

Query  378  VISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            VISGL+QGSGEYF RLGVGTP    +MVLDTGSDVVWLQCSPC+ CY
Sbjct  125  VISGLSQGSGEYFMRLGVGTPATNVYMVLDTGSDVVWLQCSPCKVCY  171



>ref|XP_010924503.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=508

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 76/115 (66%), Gaps = 8/115 (7%)
 Frame = +3

Query  195  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHN------ATR  356
            ++  + L H D  S  A N TP+ L   RL RDAAR   L  + AAA            R
Sbjct  77   SSFHVSLAHRD--SLLAANTTPEHLLRLRLGRDAARVANLHKILAAATAAGNATHAVGAR  134

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
             R FS+SV+SGL+QGSGEYFTR+G+GTP +Y  MVLDTGSDVVWLQC+PCR+CY+
Sbjct  135  PRGFSASVVSGLSQGSGEYFTRIGIGTPARYLNMVLDTGSDVVWLQCAPCRRCYS  189



>ref|XP_004969076.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Setaria 
italica]
Length=493

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 66/93 (71%), Gaps = 1/93 (1%)
 Frame = +3

Query  243  AVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT-RGRDFSSSVISGLAQGSGEYFT  419
            AVNAT   L   RL+RD  RA  +S  AA     N T RG   ++ V+SGLA+GSGEYFT
Sbjct  77   AVNATAAELLKHRLRRDKRRAARISKEAAGGAAANGTSRGGGVAAPVVSGLAEGSGEYFT  136

Query  420  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            ++GVGTP   A MVLDTGSDVVWLQC+PCR+CY
Sbjct  137  KIGVGTPATPALMVLDTGSDVVWLQCAPCRRCY  169



>ref|NP_001043485.1| Os01g0598600 [Oryza sativa Japonica Group]
 dbj|BAB63755.1| nucleoid DNA-binding protein cnd41-like [Oryza sativa Japonica 
Group]
 dbj|BAF05399.1| Os01g0598600 [Oryza sativa Japonica Group]
 gb|EAY74816.1| hypothetical protein OsI_02707 [Oryza sativa Indica Group]
Length=500

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 74/116 (64%), Gaps = 9/116 (8%)
 Frame = +3

Query  189  SENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR----  356
            + +T+ L + H D     AVNAT   L   RL+RD  RA  +S  A  A   N TR    
Sbjct  70   AASTVGLRVVHRDDF---AVNATAAELLAHRLRRDKRRASRISAAAGGAAAANGTRVGGG  126

Query  357  --GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
              G  F + V+SGLAQGSGEYFT++GVGTP   A MVLDTGSDVVWLQC+PCR+CY
Sbjct  127  GGGSGFVAPVVSGLAQGSGEYFTKIGVGTPVTPALMVLDTGSDVVWLQCAPCRRCY  182



>gb|EAZ12575.1| hypothetical protein OsJ_02481 [Oryza sativa Japonica Group]
Length=501

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 74/116 (64%), Gaps = 9/116 (8%)
 Frame = +3

Query  189  SENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR----  356
            + +T+ L + H D     AVNAT   L   RL+RD  RA  +S  A  A   N TR    
Sbjct  70   AASTVGLRVVHRDDF---AVNATAAELLAHRLRRDKRRASRISAAAGGAAAANGTRVGGG  126

Query  357  --GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
              G  F + V+SGLAQGSGEYFT++GVGTP   A MVLDTGSDVVWLQC+PCR+CY
Sbjct  127  GGGSGFVAPVVSGLAQGSGEYFTKIGVGTPVTPALMVLDTGSDVVWLQCAPCRRCY  182



>ref|XP_003569303.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brachypodium 
distachyon]
Length=494

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 83/143 (58%), Gaps = 12/143 (8%)
 Frame = +3

Query  108  LRPLPTAQHYSLS---SKPQYSQTLVQPDDSE-NTLSLDLHHIDLISSAAVNATPKALFV  275
            L P P +    L+    K  ++  L   +D+  +T+   + H D      VNAT   L  
Sbjct  41   LSPTPFSASSELARGDDKDVFAGNLAAAEDATPSTVQFSVVHRDDF---VVNATAAELLG  97

Query  276  KRLQRDaarakalsllaaaaPPHNATR--GRDFSSSVISGLAQGSGEYFTRLGVGTPPKY  449
             RLQRD  RA  +S  A A    N TR  G    + V+SGLAQGSGEYFT++GVGTP   
Sbjct  98   HRLQRDGKRAARISAAAGA---ANGTRRTGSGVVAPVVSGLAQGSGEYFTKIGVGTPATP  154

Query  450  AFMVLDTGSDVVWLQCSPCRKCY  518
            A MVLDTGSDVVWLQC+PCR+CY
Sbjct  155  ALMVLDTGSDVVWLQCAPCRRCY  177



>ref|XP_006402438.1| hypothetical protein EUTSA_v10005923mg [Eutrema salsugineum]
 dbj|BAJ34045.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ43891.1| hypothetical protein EUTSA_v10005923mg [Eutrema salsugineum]
Length=484

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 64/92 (70%), Gaps = 5/92 (5%)
 Frame = +3

Query  258  PKALFVKRLQRDaarakalsllaaaaPPHNATR-----GRDFSSSVISGLAQGSGEYFTR  422
            P  LF  RLQRD+ R ++L+ LAA +   N T+        FS  VISGL+QGSGEYF R
Sbjct  80   PAELFNLRLQRDSLRVESLTSLAAVSAGRNVTKRPPRSAGGFSGVVISGLSQGSGEYFMR  139

Query  423  LGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            LGVGTP    +MVLDTGSDVVWLQCSPC+ CY
Sbjct  140  LGVGTPATNMYMVLDTGSDVVWLQCSPCKVCY  171



>tpg|DAA58835.1| TPA: hypothetical protein ZEAMMB73_701358 [Zea mays]
Length=485

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 64/92 (70%), Gaps = 3/92 (3%)
 Frame = +3

Query  243  AVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTR  422
            AVNAT   L   RLQRD  RA  +S  A A   +     +  ++ V+SGLAQGSGEYFT+
Sbjct  76   AVNATAGELLKHRLQRDKRRAARISEAAGAGGGNGR---KGVAAPVVSGLAQGSGEYFTK  132

Query  423  LGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            +GVGTP   A MVLDTGSDVVW+QC+PCR+CY
Sbjct  133  IGVGTPATQALMVLDTGSDVVWVQCAPCRRCY  164



>ref|XP_003520873.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=461

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 82/120 (68%), Gaps = 8/120 (7%)
 Frame = +3

Query  162  SQTLVQPDDSENTLSLDLHH-IDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaP  338
            S+TL +P ++ +       H ID +SS   N TP+ LF  RLQRDA R +AL     A  
Sbjct  41   SETLSEPQETLSLSLHLHLHHIDALSS---NKTPEQLFHLRLQRDAKRVEALLNQIHARR  97

Query  339  PHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
               ++     SSS+ISGLAQGSGEYFTR+GVGTP +Y +MVLDTGSDVVWLQC+PCRKCY
Sbjct  98   SAGSSF----SSSIISGLAQGSGEYFTRIGVGTPARYVYMVLDTGSDVVWLQCAPCRKCY  153



>ref|XP_011007544.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=501

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 80/140 (57%), Gaps = 13/140 (9%)
 Frame = +3

Query  108  LRPLPTAQHYSLSSKPQYSQTLVQPDDS--ENTLSLDLHHIDLISSAAVNATPKALFVKR  281
            +RPL ++Q+  LS        +  P+DS  E    L L H D +S           F  R
Sbjct  68   IRPLKSSQYQELS--------MNIPNDSGSEGKQKLKLVHRDKVSFNKKFHNHSHDFHAR  119

Query  282  LQRDaarakalsllaaaaPPHNATRG-RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  458
            +QRD  R  +L    ++     A+ G  DF S V+SG+ QGSGEYF R+GVG+PP+  +M
Sbjct  120  MQRDVKRVVSLIRRVSSGSA--ASYGVEDFGSEVVSGMDQGSGEYFVRIGVGSPPRSQYM  177

Query  459  VLDTGSDVVWLQCSPCRKCY  518
            V+D+GSD+VW+QC PC +CY
Sbjct  178  VIDSGSDIVWVQCKPCTQCY  197



>ref|XP_011031192.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=501

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 80/140 (57%), Gaps = 13/140 (9%)
 Frame = +3

Query  108  LRPLPTAQHYSLSSKPQYSQTLVQPDDS--ENTLSLDLHHIDLISSAAVNATPKALFVKR  281
            +RPL ++Q+  LS        +  P+DS  E    L L H D +S           F  R
Sbjct  68   IRPLKSSQYQELS--------MNIPNDSGSEGKQKLKLVHRDKVSFNKKFHNHSHDFHAR  119

Query  282  LQRDaarakalsllaaaaPPHNATRG-RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  458
            +QRD  R  +L    ++     A+ G  DF S V+SG+ QGSGEYF R+GVG+PP+  +M
Sbjct  120  MQRDVKRVVSLIRRVSSGSA--ASYGVEDFGSEVVSGMDQGSGEYFVRIGVGSPPRSQYM  177

Query  459  VLDTGSDVVWLQCSPCRKCY  518
            V+D+GSD+VW+QC PC +CY
Sbjct  178  VIDSGSDIVWVQCKPCTQCY  197



>ref|XP_002440367.1| hypothetical protein SORBIDRAFT_09g030430 [Sorghum bicolor]
 gb|EES18797.1| hypothetical protein SORBIDRAFT_09g030430 [Sorghum bicolor]
Length=462

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 92/153 (60%), Gaps = 12/153 (8%)
 Frame = +3

Query  66   AIPSSPPSITKPFSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAA  245
            A P SP  IT+  +  PL +A      +  +     +  DD+ N  ++        + AA
Sbjct  37   ATPLSPDPITRADAALPLFSA------ASGEAPILELDSDDNGNASTVRFLLAHREAFAA  90

Query  246  VNATPKALFVKRLQRDaarakalsllaaaaPPHNATR-GRDFSSSVISGLAQGSGEYFTR  422
             NAT   L   RL RDAARA+A+S+ A      N TR G  FS+ V+SGLAQGSGEYF  
Sbjct  91   PNATAAQLLAHRLARDAARAEAISVSA-----RNVTRAGGGFSAPVVSGLAQGSGEYFAS  145

Query  423  LGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            +GVGTPP  A +VLDTGSDVVWLQC+PCR+CYA
Sbjct  146  VGVGTPPTPALLVLDTGSDVVWLQCAPCRQCYA  178



>gb|KEH44446.1| aspartic protease in GUARD CELL-like protein [Medicago truncatula]
Length=486

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 76/139 (55%), Gaps = 3/139 (2%)
 Frame = +3

Query  102  FSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKR  281
             +L+P  T +    + K        + D       L L H D IS+  ++    + F  R
Sbjct  47   LNLKPFHTTKQPQENKKSNAESMSEKSDAVSGKHKLKLLHRDKISAFNISGDHLSRFNAR  106

Query  282  LQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  461
            ++RD+ R  A+    A    +      +F S V+SG+ QGSGEYF R+GVG+PPK  ++V
Sbjct  107  MERDSKRVTAVVRQIAGGVGYET---EEFGSGVVSGMEQGSGEYFVRIGVGSPPKNQYVV  163

Query  462  LDTGSDVVWLQCSPCRKCY  518
            +D+GSD++W+QC PC +CY
Sbjct  164  VDSGSDIIWVQCQPCTQCY  182



>gb|KJB49971.1| hypothetical protein B456_008G147500 [Gossypium raimondii]
Length=480

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 79/141 (56%), Gaps = 15/141 (11%)
 Frame = +3

Query  111  RPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISS--AAVNATPKALFVKRL  284
            RPL T++H+ +S             +++    L L H D +SS  +A        F  R+
Sbjct  46   RPLQTSEHHQVS----------DVSETQGKWKLKLVHRDKLSSNTSATFRDHSRRFHARM  95

Query  285  QRDaarakalsllaaaaPPHN---ATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAF  455
            QRD  R  +L    +    H+   A    DF S V+SG+ QGSGEYF R+GVG+PPK  +
Sbjct  96   QRDVKRVASLLRRLSGGGGHDGGAAYEVNDFGSDVVSGMDQGSGEYFVRIGVGSPPKSQY  155

Query  456  MVLDTGSDVVWLQCSPCRKCY  518
            MV+D+GSD+VW+QC PC +CY
Sbjct  156  MVIDSGSDIVWVQCQPCNQCY  176



>gb|ABK25248.1| unknown [Picea sitchensis]
Length=366

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 78/154 (51%), Gaps = 25/154 (16%)
 Frame = +3

Query  105  SLRPLPTAQ---HYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP-----  260
            SLR   TA     Y   +KP+ S   V+           +H   L+   A NAT      
Sbjct  50   SLRETDTAAGGAEYKRETKPRRSPWSVEV----------VHRDALLLKNAANATASYERR  99

Query  261  -------KALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFT  419
                   +A+ V+ L+R   R   L+        + A    DF   V+SG+ QGSGEYFT
Sbjct  100  LKEKLRREAVRVRGLERQIERTLTLNKDPVNRYENVAEVDADFGGEVVSGMEQGSGEYFT  159

Query  420  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            R+GVGTP +  +MVLDTGSDV W+QC PCR+CY+
Sbjct  160  RIGVGTPTREQYMVLDTGSDVAWIQCEPCRECYS  193



>ref|XP_010279486.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=483

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 70/113 (62%), Gaps = 2/113 (2%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRG-  359
            D++E    L L H D+IS    +     L  +R++RD  R  +L+   +         G 
Sbjct  63   DEAEGRWKLKLVHRDMISLGNFSNHRHHL-SERIKRDVRRVASLTRRLSGGGGGGVNYGV  121

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
             DF+S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY
Sbjct  122  EDFASEVVSGVDQGSGEYFVRIGVGSPPRNQYMVIDSGSDIVWVQCQPCNQCY  174



>ref|XP_006852628.1| hypothetical protein AMTR_s00021p00234660 [Amborella trichopoda]
 gb|ERN14095.1| hypothetical protein AMTR_s00021p00234660 [Amborella trichopoda]
Length=489

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 91/174 (52%), Gaps = 41/174 (24%)
 Frame = +3

Query  84   PSITKPFSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLS------LDLHHIDLISSAA  245
            P  ++   LRPL         SKP      ++ +++E  LS      L LHH D   S +
Sbjct  22   PLESQTLLLRPL---------SKPPLLDEDLKQEETEGDLSDQTSLFLTLHHRD---SLS  69

Query  246  VNATPKALFVKRLQRDaarakalsllaaaaPP---------HNAT--------------R  356
            +N T + LF  RL+RD AR K+L+     A           H A               R
Sbjct  70   LNLTAEELFKLRLERDDARVKSLTNWVNLAAALGSSHRGHHHGAANPAAHANGSVQTRGR  129

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            G+ F++ V+SGL QGSGEYF R+ VGTPP+  +MVLDTGSD+ WLQC+PCR CY
Sbjct  130  GQAFTAPVVSGLPQGSGEYFARVKVGTPPQPMYMVLDTGSDLAWLQCTPCRHCY  183



>ref|XP_009629151.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Nicotiana 
tomentosiformis]
Length=491

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 83/157 (53%), Gaps = 17/157 (11%)
 Frame = +3

Query  93   TKPFSLRPLPTAQHYS-------LSSKPQYSQTLVQPD---DSEN-----TLSLDLHHID  227
            T   +L P PT ++++       L++K Q      + D   D EN      L L L H D
Sbjct  33   TTAHALFPYPTHENFNVQETISQLATKIQTPHEKQEEDFHFDDENGEEKRNLKLKLIHRD  92

Query  228  LISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSG  407
             +  +   +    +F  R++RD  R  +L          N  R  +F S V+SG+ QGSG
Sbjct  93   KLYFSNYFSNHSKMFEARMKRDVKRVSSLIHRITGGG--NGYRVEEFGSDVVSGMDQGSG  150

Query  408  EYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            EYF R+GVG+P +  +MV+D+GSD+VW+QC PC +CY
Sbjct  151  EYFVRIGVGSPARNQYMVIDSGSDIVWVQCQPCTQCY  187



>gb|KHN16429.1| Aspartic proteinase nepenthesin-1, partial [Glycine soja]
Length=104

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +3

Query  390  LAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            LAQGSGEYFTR+GVGTP +Y +MVLDTGSDVVWLQC+PCRKCY
Sbjct  1    LAQGSGEYFTRIGVGTPARYVYMVLDTGSDVVWLQCAPCRKCY  43



>ref|XP_002306246.2| hypothetical protein POPTR_0005s06390g [Populus trichocarpa]
 gb|EEE93242.2| hypothetical protein POPTR_0005s06390g [Populus trichocarpa]
Length=502

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 74/128 (58%), Gaps = 7/128 (5%)
 Frame = +3

Query  150  KPQYSQTLVQ--PDDS--ENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakals  317
            KP   Q L    P+DS  E    L L H D +S          +F  R+QRD  R  +L 
Sbjct  73   KPSLYQELSMNIPNDSGSEGKQKLKLVHRDKVSFNNKFHNHSHVFHARMQRDVKRVVSLI  132

Query  318  llaaaaPPHNATRG-RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQ  494
               ++     A+ G  DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+Q
Sbjct  133  RRVSSGS--TASYGVEDFGSEVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQ  190

Query  495  CSPCRKCY  518
            C PC +CY
Sbjct  191  CKPCTQCY  198



>gb|KDP40474.1| hypothetical protein JCGZ_24473 [Jatropha curcas]
Length=469

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 74/124 (60%), Gaps = 5/124 (4%)
 Frame = +3

Query  156  QYSQTLVQPDDSE--NTLSLDLHHID-LISSAAVNATPKALFVKRLQRDaarakalslla  326
            QY Q  +  +DS+      L L H D +I+S+        LF  R+ RD  R  +L    
Sbjct  44   QYQQLFINQNDSQSQGIWKLKLVHRDRIITSSNSLHNHTHLFHARINRDIKRVASLIRRL  103

Query  327  aaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            ++  P    +  DF + V+SG+ QGSGEYF R+GVG+PP+  ++V+D+GSD+VW+QC PC
Sbjct  104  SS--PAATYQVNDFGAEVVSGMNQGSGEYFVRIGVGSPPRDQYVVIDSGSDIVWVQCQPC  161

Query  507  RKCY  518
             +CY
Sbjct  162  TQCY  165



>ref|XP_004497254.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cicer 
arietinum]
Length=486

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 77/134 (57%), Gaps = 9/134 (7%)
 Frame = +3

Query  135  YSLSSKPQYSQTLVQPDDSENTLS------LDLHHIDLISSAAVNATPKALFVKRLQRDa  296
            +  + +PQ +Q      +SE T S      L L H D I    ++   ++ F  R++RDA
Sbjct  52   FHTTKQPQENQKSNTDAESEKTESGSGKRKLKLLHRDEIHIFNISRDHRSRFNARMKRDA  111

Query  297  arakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGS  476
             R  A+    A    +      +F S V+SG+ QGSGEYF R+GVG+PPK  ++V+D+GS
Sbjct  112  KRVAAVVRRIAGGVGYKT---EEFGSDVVSGMEQGSGEYFVRIGVGSPPKNQYVVIDSGS  168

Query  477  DVVWLQCSPCRKCY  518
            D++W+QC PC +CY
Sbjct  169  DIIWVQCQPCTQCY  182



>ref|XP_008244017.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Prunus 
mume]
Length=494

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +3

Query  336  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKC  515
            P H   R  D S+ V+SG++QGSGEYFTR+GVGTP K  +MVLDTGSD+ WLQC PC  C
Sbjct  133  PMHTEIRPEDLSTPVVSGVSQGSGEYFTRIGVGTPAKSLYMVLDTGSDINWLQCEPCSDC  192

Query  516  Y  518
            Y
Sbjct  193  Y  193



>ref|NP_001056485.1| Os05g0590000 [Oryza sativa Japonica Group]
 gb|AAT58814.1| putative nucleoid DNA-binding protein [Oryza sativa Japonica 
Group]
 dbj|BAF18399.1| Os05g0590000 [Oryza sativa Japonica Group]
Length=481

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 75/141 (53%), Gaps = 19/141 (13%)
 Frame = +3

Query  108  LRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQ  287
            L P P  Q   LS        L  P  + +TL   L H +     A+NAT   L      
Sbjct  40   LSPDPITQEQQLS--------LAAPRTNASTLHFRLAHREHF---ALNATASDLLAH---  85

Query  288  RDaarakalsllaaaaPPHNATRGR---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  458
                   A    A  A P+NATR R    F++ ++SGL QGSGEYF ++GVGTP   A M
Sbjct  86   --LLARDAARAAALLAAPNNATRPRRRGGFAAPLLSGLPQGSGEYFAQVGVGTPATTALM  143

Query  459  VLDTGSDVVWLQCSPCRKCYA  521
            VLDTGSDVVWLQC+PCR CYA
Sbjct  144  VLDTGSDVVWLQCAPCRHCYA  164



>ref|XP_007209939.1| hypothetical protein PRUPE_ppa004726mg [Prunus persica]
 gb|EMJ11138.1| hypothetical protein PRUPE_ppa004726mg [Prunus persica]
Length=494

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +3

Query  336  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKC  515
            P H   R  D S+ V+SG++QGSGEYFTR+GVGTP K  +MVLDTGSD+ WLQC PC  C
Sbjct  133  PMHTEIRPEDLSTPVVSGVSQGSGEYFTRIGVGTPAKSLYMVLDTGSDINWLQCEPCSDC  192

Query  516  Y  518
            Y
Sbjct  193  Y  193



>gb|KJB77420.1| hypothetical protein B456_012G135900 [Gossypium raimondii]
Length=484

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 71/120 (59%), Gaps = 5/120 (4%)
 Frame = +3

Query  174  VQPDDSENTLSLDLHHIDLISS--AAVNATPKALFVKRLQRDaarakalsllaaaaPPHN  347
            V   + +    L L H D +S+  A V+      F  R+QRD  R  +L L       H+
Sbjct  61   VTESEDQWKWKLKLIHRDWLSTENATVSRNHSRRFHARIQRDVKRVASLLLRIPGGVIHD  120

Query  348  --ATRG-RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
              A  G  DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY
Sbjct  121  GEAAHGVNDFGSDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCKPCNQCY  180



>gb|ABK24480.1| unknown [Picea sitchensis]
Length=496

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            +F S V+SG+ QGSGEYFTR+G+GTP +  +MVLDTGSDVVW+QC PCR+CY+
Sbjct  138  EFGSEVVSGMEQGSGEYFTRIGIGTPTREQYMVLDTGSDVVWIQCEPCRECYS  190



>gb|AAT38006.1| unknow protein [Oryza sativa Japonica Group]
Length=475

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 75/141 (53%), Gaps = 19/141 (13%)
 Frame = +3

Query  108  LRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQ  287
            L P P  Q   LS        L  P  + +TL   L H +     A+NAT   L      
Sbjct  34   LSPDPITQEQQLS--------LAAPRTNASTLHFRLAHREHF---ALNATASDLLAH---  79

Query  288  RDaarakalsllaaaaPPHNATRGR---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  458
                   A    A  A P+NATR R    F++ ++SGL QGSGEYF ++GVGTP   A M
Sbjct  80   --LLARDAARAAALLAAPNNATRPRRRGGFAAPLLSGLPQGSGEYFAQVGVGTPATTALM  137

Query  459  VLDTGSDVVWLQCSPCRKCYA  521
            VLDTGSDVVWLQC+PCR CYA
Sbjct  138  VLDTGSDVVWLQCAPCRHCYA  158



>ref|XP_009145889.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=492

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 73/115 (63%), Gaps = 5/115 (4%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR-  362
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R  ++      A     +  R 
Sbjct  75   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVASIIAKVNLAVEGADSETRY  133

Query  363  ---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
               + ++ VISG +QGSGEYF+RLGVGTP K  +MVLDTGSD+ W+QC PC  CY
Sbjct  134  NPEELTTPVISGASQGSGEYFSRLGVGTPAKEMYMVLDTGSDINWIQCKPCSSCY  188



>gb|EAY99240.1| hypothetical protein OsI_21202 [Oryza sativa Indica Group]
Length=475

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 75/141 (53%), Gaps = 19/141 (13%)
 Frame = +3

Query  108  LRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQ  287
            L P P  Q   LS        L  P  + +TL   L H +     A+NAT   L      
Sbjct  34   LSPDPITQEQQLS--------LAAPRTNASTLHFRLAHREHF---ALNATASDLLAH---  79

Query  288  RDaarakalsllaaaaPPHNATRGR---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  458
                   A    A  A P+NATR R    F++ ++SGL QGSGEYF ++GVGTP   A M
Sbjct  80   --LLARDAARAAALLAAPNNATRPRRRGGFAAPLLSGLPQGSGEYFAQVGVGTPATTALM  137

Query  459  VLDTGSDVVWLQCSPCRKCYA  521
            VLDTGSDVVWLQC+PCR CYA
Sbjct  138  VLDTGSDVVWLQCAPCRHCYA  158



>ref|XP_009337317.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 79/136 (58%), Gaps = 16/136 (12%)
 Frame = +3

Query  141  LSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsl  320
            L S+ Q SQ L     + +  SL LH  D + ++  +   K+L + RL RD+AR  +L  
Sbjct  57   LESQSQESQPL-----NSSAFSLQLHPRDALFNSQ-HKDYKSLTLTRLGRDSARVNSLHT  110

Query  321  laaaa----------PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDT  470
                A          P H   + +D S+ V+SG++QGSGEYF+R+GVGTP K  +MVLDT
Sbjct  111  KLQLALQGIKRVDLEPMHTEVQSQDLSTPVVSGVSQGSGEYFSRIGVGTPAKSFYMVLDT  170

Query  471  GSDVVWLQCSPCRKCY  518
            GSDV WLQC PC  CY
Sbjct  171  GSDVNWLQCGPCSDCY  186



>emb|CDX92240.1| BnaA05g21670D [Brassica napus]
Length=491

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 73/115 (63%), Gaps = 5/115 (4%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR-  362
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R  A+      A     +  R 
Sbjct  75   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAAIIAKVNLAVEGADSETRY  133

Query  363  ---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
               + ++ VISG +QGSGEYF+RLGVGTP K  +MVLDTGSD+ W+QC PC  CY
Sbjct  134  QPEELTTPVISGASQGSGEYFSRLGVGTPAKEMYMVLDTGSDINWIQCKPCSSCY  188



>gb|ABR17085.1| unknown [Picea sitchensis]
Length=498

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 78/154 (51%), Gaps = 25/154 (16%)
 Frame = +3

Query  105  SLRPLPTAQ---HYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP-----  260
            SLR   TA     Y   +KP+ S   V+           +H   L+   A NAT      
Sbjct  50   SLRETDTAAGGAEYKRETKPRRSPWSVEV----------VHRDALLLKNAANATASYERR  99

Query  261  -------KALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFT  419
                   +A+ V+ L+R   R   L+        + A    DF   V+SG+ QGSGEYFT
Sbjct  100  LKEKLRREAVRVRGLERQIERTLTLNKDPVNRYENVAEVDADFGGEVVSGMEQGSGEYFT  159

Query  420  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            R+GVGTP +  +MVLDTGSDV W+QC PCR+CY+
Sbjct  160  RIGVGTPTREQYMVLDTGSDVAWIQCEPCRECYS  193



>ref|XP_009337150.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 79/136 (58%), Gaps = 16/136 (12%)
 Frame = +3

Query  141  LSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsl  320
            L S+ Q SQ L     + +  SL LH  D + ++  +   K+L + RL RD+AR  +L  
Sbjct  57   LESQSQESQPL-----NSSAFSLQLHPRDALFNSQ-HKDYKSLTLTRLGRDSARVNSLHT  110

Query  321  laaaa----------PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDT  470
                A          P H   + +D S+ V+SG++QGSGEYF+R+GVGTP K  +MVLDT
Sbjct  111  KLQLALQGIKRVDLEPMHTEIQSQDLSTPVVSGVSQGSGEYFSRIGVGTPAKSFYMVLDT  170

Query  471  GSDVVWLQCSPCRKCY  518
            GSDV WLQC PC  CY
Sbjct  171  GSDVNWLQCGPCSDCY  186



>ref|XP_006345303.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=477

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 74/144 (51%), Gaps = 12/144 (8%)
 Frame = +3

Query  114  PLPTAQHYSLSSKPQYSQTLVQP---------DDSENTLSLDLHHIDLISSAAVNATPKA  266
            P PT +H  ++   + S TL+QP         DD  +   L L H D +  +     P  
Sbjct  32   PFPTHEHLDVNQAIKES-TLIQPPETHDINIVDDDNSRWKLKLLHRDKLPFSHFTDHPHR  90

Query  267  LFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPK  446
             F  R++RD  R   L+             G  F S VISG+ QGSGEYF R+GVG+P +
Sbjct  91   -FQARMKRDIKRVHTLTATTNYDEVKEEEFG-GFGSEVISGMEQGSGEYFVRIGVGSPVR  148

Query  447  YAFMVLDTGSDVVWLQCSPCRKCY  518
              +MV+D GSD+VW+QC PC  CY
Sbjct  149  QQYMVIDAGSDIVWVQCQPCTHCY  172



>gb|KJB79793.1| hypothetical protein B456_013G067200 [Gossypium raimondii]
Length=475

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 69/123 (56%), Gaps = 7/123 (6%)
 Frame = +3

Query  171  LVQPDDSENTLSLDLHHIDLI----SSAAVNATPKALFVKRLQRDaarakalsllaaaaP  338
            L + DD     +L L H D +     S +        F  R+QRD  R  +L        
Sbjct  48   LSETDDHRGKWNLKLVHRDKLLSPNDSLSTLHNHGRRFHARMQRDVKRVASLLRRLPGKG  107

Query  339  PHN---ATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCR  509
             H+   A +  DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC 
Sbjct  108  THDGDAAYQVNDFGSDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCN  167

Query  510  KCY  518
            +CY
Sbjct  168  QCY  170



>gb|ABR16474.1| unknown [Picea sitchensis]
Length=538

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            +F   V+SG+AQGSGEYFTR+GVGTP +  +MVLDTGSDVVW+QC PC KCY+
Sbjct  181  EFGGEVVSGMAQGSGEYFTRIGVGTPMREQYMVLDTGSDVVWIQCEPCSKCYS  233



>ref|XP_002455897.1| hypothetical protein SORBIDRAFT_03g026970 [Sorghum bicolor]
 gb|EES01017.1| hypothetical protein SORBIDRAFT_03g026970 [Sorghum bicolor]
Length=493

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  351  TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            +RG   ++ V+SGLAQGSGEYFT++GVGTP   A MVLDTGSDVVWLQC+PCR+CY
Sbjct  120  SRGGAVAAPVVSGLAQGSGEYFTKIGVGTPSTPALMVLDTGSDVVWLQCAPCRRCY  175



>emb|CDY24483.1| BnaC05g34710D [Brassica napus]
Length=491

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 72/115 (63%), Gaps = 5/115 (4%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRG--  359
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R  ++      A     +    
Sbjct  75   NSSSPLSLELHSRDTLV-ASQHKNYKSLVLSRLERDSSRVASIIAKVKLAVEGADSETHY  133

Query  360  --RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
               + ++ VISG +QGSGEYF+RLGVGTP K  +MVLDTGSD+ W+QC PC  CY
Sbjct  134  QPEELTTPVISGASQGSGEYFSRLGVGTPAKEMYMVLDTGSDINWIQCKPCSSCY  188



>ref|XP_011022942.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=502

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 75/135 (56%), Gaps = 20/135 (15%)
 Frame = +3

Query  150  KPQYSQTLVQ--PDDSENT---LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakal  314
            KP   Q L +  P+DSE+T     L L H D +S +        +F  R+ RD  R  +L
Sbjct  72   KPSQYQELFKTNPNDSESTGGKQKLKLVHRDKVSFSNQLHNHSHVFNARMHRDVKRVASL  131

Query  315  sllaaaaPPHNATRG-------RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTG  473
                     H  + G        +F S V+SG+ QGSGEYF R+G+G+PP+  +MV+D+G
Sbjct  132  I--------HRLSSGSAAKYEVENFGSDVVSGMNQGSGEYFVRIGLGSPPRSQYMVIDSG  183

Query  474  SDVVWLQCSPCRKCY  518
            SD+VW+QC PC +CY
Sbjct  184  SDIVWVQCKPCTQCY  198



>ref|XP_010541885.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like, partial 
[Tarenaya hassleriana]
Length=188

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC+ CY
Sbjct  109  DFGSDVVSGMDQGSGEYFVRIGVGSPPRNQYMVIDSGSDMVWVQCQPCKLCY  160



>ref|XP_006440937.1| hypothetical protein CICLE_v10019848mg [Citrus clementina]
 gb|ESR54177.1| hypothetical protein CICLE_v10019848mg [Citrus clementina]
Length=495

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 82/160 (51%), Gaps = 25/160 (16%)
 Frame = +3

Query  69   IPSSPPSITKPFSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAV  248
            I S  P   KPF+      A+ +              P +S ++ SL LH  +++     
Sbjct  50   ILSFEPETLKPFAEESETAAESF--------------PLNSSSSFSLPLHSREILHKTRH  95

Query  249  NATPKALFVKRLQRDaarakalsllaaaa----------PPHNATRGRDFSSSVISGLAQ  398
            N   ++L + RL+RD+AR   L      A          P        DFS+ V+SG +Q
Sbjct  96   NDY-RSLVLSRLERDSARVNTLITKLQLAIYNVDRHELKPAEAQILPEDFSTPVVSGASQ  154

Query  399  GSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            GSGEYF+R+GVGTPP+   MVLDTGSD+ WLQC PC +CY
Sbjct  155  GSGEYFSRIGVGTPPRQFSMVLDTGSDINWLQCRPCTECY  194



>ref|XP_002309912.2| hypothetical protein POPTR_0007s04120g [Populus trichocarpa]
 gb|EEE90362.2| hypothetical protein POPTR_0007s04120g [Populus trichocarpa]
Length=501

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 73/134 (54%), Gaps = 19/134 (14%)
 Frame = +3

Query  150  KPQYSQTLVQ--PDDSE--NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakals  317
            KP   Q L +  P+DSE      L L H D +S +        +F  R+ RD  R  +L 
Sbjct  72   KPSQYQELFKTNPNDSESGGKQKLKLVHRDKVSFSNKLHNHSHVFHARMHRDVKRVASLI  131

Query  318  llaaaaPPHNATRG-------RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGS  476
                    H  + G        DF S V+SG+ QGSGEYF R+G+G+PP+  +MV+D+GS
Sbjct  132  --------HRLSSGSAAKYEVEDFGSDVVSGMNQGSGEYFVRIGLGSPPRSQYMVIDSGS  183

Query  477  DVVWLQCSPCRKCY  518
            D+VW+QC PC +CY
Sbjct  184  DIVWVQCKPCTQCY  197



>ref|XP_007142740.1| hypothetical protein PHAVU_007G013000g [Phaseolus vulgaris]
 gb|ESW14734.1| hypothetical protein PHAVU_007G013000g [Phaseolus vulgaris]
Length=475

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 65/112 (58%), Gaps = 2/112 (2%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR  362
            D S     L L H D +S+       +  F  R++RDA R   L    AA  P       
Sbjct  62   DSSSTKWKLKLLHRDKVSTFNTTLDHQTRFNARIERDARRVAVLLRRLAAGKP--TLDSE  119

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
             F S V+SG+ QGSGEYF R+GVG+PP+  ++V+D+GSD++W+QC PC +CY
Sbjct  120  AFGSDVVSGMEQGSGEYFVRIGVGSPPRNQYVVIDSGSDIIWVQCEPCTQCY  171



>ref|XP_010533981.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=502

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 90/166 (54%), Gaps = 20/166 (12%)
 Frame = +3

Query  60   FLAIPSSPPSITKPFSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISS  239
             L + SS     +  SL P  T    +L+S+P      V  + S  + SL+LH  + +  
Sbjct  42   ILDVVSSLQQTHQILSLDPSGT----TLTSRPDLKSKPVFLNSS--SFSLELHSRETLVE  95

Query  240  AAVNATPKALFVKRLQRDaarakalsllaaaa----------PPHN---ATRGRDFSSSV  380
            +  +   ++L + RL+RD+AR   ++     A          P H+     R  D S+ V
Sbjct  96   SQ-HKDYRSLLLGRLERDSARVSGITAKVRLAIEGVERSKLHPVHDDDSLIRPEDMSTPV  154

Query  381  ISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            +SG +QGSGEYF+R+GVGTPPK  FMVLDTGSDV W+QC PC  CY
Sbjct  155  VSGASQGSGEYFSRVGVGTPPKEMFMVLDTGSDVNWIQCQPCSDCY  200



>ref|XP_003637421.1| Aspartic proteinase nepenthesin-1, partial [Medicago truncatula]
Length=280

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 70/111 (63%), Gaps = 10/111 (9%)
 Frame = +3

Query  189  SENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD-  365
            S +TLSL LH    +SS   +A  K+L + RL RD+AR K ++         N     D 
Sbjct  66   STSTLSLQLHSRASLSS---HADYKSLTLSRLDRDSARVKYITTKL------NQNFNTDK  116

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
             S  +ISG +QGSGEYF+R+G+G PP  A+MVLDTGSD+ W+QC+PC  CY
Sbjct  117  LSGPIISGTSQGSGEYFSRIGIGEPPSQAYMVLDTGSDISWVQCAPCADCY  167



>ref|XP_006406427.1| hypothetical protein EUTSA_v10020671mg [Eutrema salsugineum]
 gb|ESQ47880.1| hypothetical protein EUTSA_v10020671mg [Eutrema salsugineum]
Length=468

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 71/123 (58%), Gaps = 3/123 (2%)
 Frame = +3

Query  153  PQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaa  332
            P ++ T   PD+S+ TL L LH     S +  N   +     R   D   A    +   +
Sbjct  44   PDFNNTTF-PDESKYTLRL-LHRDKFPSVSYRNHHHRLHARMRRDSDRVAAILRRISGKS  101

Query  333  aPPHNAT-RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCR  509
             PP N+     DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC+
Sbjct  102  VPPSNSKYEVDDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCK  161

Query  510  KCY  518
             CY
Sbjct  162  LCY  164



>gb|KFK39179.1| hypothetical protein AALP_AA3G210500 [Arabis alpina]
Length=499

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 90/170 (53%), Gaps = 24/170 (14%)
 Frame = +3

Query  75   SSPPSITKPFSLRPLPTAQHYSLSSKPQYSQ-TLVQPD--------DSENTLSLDLHHID  227
            S+PP  T    +  L   QH  LS  P  S  T   P+        +S + LSL LH  D
Sbjct  29   STPPKTTVLDVVSSLQQTQHI-LSLDPTLSSLTTAIPESQSDPVFLNSSSPLSLTLHSRD  87

Query  228  LISSAAVNATPKALFVKRLQRDaarakalsll----------aaaaPPHN-ATR--GRDF  368
             +  A+ +   K+L + RL+RD++R   ++            +   P +N  TR    D 
Sbjct  88   TLV-ASQHKDYKSLVLSRLERDSSRVAGITAKIRFAVEGIDRSDLKPVYNDETRYQTEDL  146

Query  369  SSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            ++ V+SG  QGSGEYF+R+GVGTP K  FMVLDTGSD+ W+QC PC  CY
Sbjct  147  TTPVVSGAGQGSGEYFSRIGVGTPAKEMFMVLDTGSDINWIQCQPCSDCY  196



>dbj|BAJ86414.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92334.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 81/156 (52%), Gaps = 17/156 (11%)
 Frame = +3

Query  60   FLAIPSSPPSITKPFSLRPLPTAQHYSLSSKPQYSQTLVQPDDS-ENTLSLDLHHIDLIS  236
             LA P SP  ++ P  L                ++  L   +D+  +T+   L H D  S
Sbjct  34   LLATPLSPDRVSAPSEL--------ARDDDDSVFAGNLASAEDAPASTVRFRLVHRDDFS  85

Query  237  SAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISG--LAQGSGE  410
               VNAT   L   RL+RDA RA  LS  A    P N TR             LAQGSGE
Sbjct  86   ---VNATAAELLAYRLERDAKRAARLSAAAG---PANGTRRGGGGVVAPVVSGLAQGSGE  139

Query  411  YFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            YFT++GVGTP   A MVLDTGSDVVWLQC+PCR+CY
Sbjct  140  YFTKIGVGTPATPALMVLDTGSDVVWLQCAPCRRCY  175



>ref|XP_006847790.1| hypothetical protein AMTR_s00029p00016750 [Amborella trichopoda]
 gb|ERN09371.1| hypothetical protein AMTR_s00029p00016750 [Amborella trichopoda]
Length=524

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 69/116 (59%), Gaps = 6/116 (5%)
 Frame = +3

Query  177  QPDDSE--NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNA  350
            QP  S+  N L L L H D       +++ K  F  R++RD  R  AL+        +  
Sbjct  108  QPSASKPGNLLRLKLLHRDSFKPTN-SSSHKHRFESRMRRDLLRVAALAKKLGLESGYKL  166

Query  351  TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            T   DF + V+SG+ QGSGEYF R+GVG+P +  FMV+DTGSD+VW+QC PC +CY
Sbjct  167  T---DFGAEVVSGMEQGSGEYFVRIGVGSPARDQFMVIDTGSDIVWVQCRPCLQCY  219



>ref|XP_004961034.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Setaria 
italica]
Length=517

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 50/65 (77%), Gaps = 6/65 (9%)
 Frame = +3

Query  345  NATR------GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            N TR      G  F++ V+SGL+QGSGEYF ++GVGTPP  A +VLDTGSDVVWLQC+PC
Sbjct  128  NGTRAPRRRGGSGFAAPVLSGLSQGSGEYFAQVGVGTPPTPALLVLDTGSDVVWLQCAPC  187

Query  507  RKCYA  521
            R CYA
Sbjct  188  RHCYA  192



>ref|XP_010551288.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Tarenaya 
hassleriana]
Length=511

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 96/164 (59%), Gaps = 19/164 (12%)
 Frame = +3

Query  69   IPSSPPSITKPFSLRPLPTAQHYS-LSSKPQYSQTLVQPDDS--ENTLSLDLHHIDLISS  239
            +P +P +++    +  + TA+  S LSSK    ++  Q +D    ++LSL LH     S 
Sbjct  53   LPDTPKTMSVLDVVGSIQTAKDVSSLSSKTTAFRSNKQEEDQFPPSSLSLKLH-----SR  107

Query  240  AAVNATP----KALFVKRLQRDaarakals-----llaaaaPPHNATR--GRDFSSSVIS  386
            A++        + L + RL+RD+AR ++L+      ++  +P    TR  G   +  V+S
Sbjct  108  ASIRGNEHRDYRTLTLARLERDSARVRSLTTRLDLAVSRVSPAALETRDGGAKINGPVVS  167

Query  387  GLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            G +QGSGEYF+R+G+G PP+  +MVLDTGSDV WLQCSPC  CY
Sbjct  168  GTSQGSGEYFSRVGIGNPPRQVYMVLDTGSDVNWLQCSPCADCY  211



>gb|KDO64536.1| hypothetical protein CISIN_1g011045mg [Citrus sinensis]
Length=495

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 72/123 (59%), Gaps = 11/123 (9%)
 Frame = +3

Query  180  PDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaa--------  335
            P +S ++ SL LH  +++     N   ++L + RL+RD+AR   L      A        
Sbjct  73   PLNSSSSFSLPLHSREILHKTRHNDY-RSLVLSRLERDSARVNTLITKLQLAIYNVDRHE  131

Query  336  --PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCR  509
              P        DFS+ V+SG +QGSGEYF+R+GVGTPP+   MVLDTGSD+ WLQC PC 
Sbjct  132  LKPAEAQILPEDFSTPVVSGASQGSGEYFSRIGVGTPPRQFSMVLDTGSDINWLQCRPCT  191

Query  510  KCY  518
            +CY
Sbjct  192  ECY  194



>ref|XP_006485768.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Citrus 
sinensis]
Length=495

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 72/123 (59%), Gaps = 11/123 (9%)
 Frame = +3

Query  180  PDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaa--------  335
            P +S ++ SL LH  +++     N   ++L + RL+RD+AR   L      A        
Sbjct  73   PLNSSSSFSLPLHSREILHKTRHNDY-RSLVLSRLERDSARVNTLITKLQLAIYNVDRHE  131

Query  336  --PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCR  509
              P        DFS+ V+SG +QGSGEYF+R+GVGTPP+   MVLDTGSD+ WLQC PC 
Sbjct  132  LKPAEAQILPEDFSTPVVSGASQGSGEYFSRIGVGTPPRQFSMVLDTGSDINWLQCRPCT  191

Query  510  KCY  518
            +CY
Sbjct  192  ECY  194



>ref|XP_009112699.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
 emb|CDY18523.1| BnaA01g26720D [Brassica napus]
Length=499

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 74/124 (60%), Gaps = 14/124 (11%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R   ++            +   
Sbjct  74   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAGITAKIRFAVEGIDRSDLK  132

Query  336  PPHNATRG---RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            P +N        D ++ V+SG +QGSGEYF+R+GVGTP K  FMVLDTGSD+ W+QC PC
Sbjct  133  PVYNDETSYQPEDLTTPVVSGASQGSGEYFSRIGVGTPAKEMFMVLDTGSDINWIQCQPC  192

Query  507  RKCY  518
              CY
Sbjct  193  SDCY  196



>ref|XP_004147103.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
sativus]
 ref|XP_004166359.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
sativus]
 gb|KGN51568.1| hypothetical protein Csa_5G579060 [Cucumis sativus]
Length=482

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 68/113 (60%), Gaps = 7/113 (6%)
 Frame = +3

Query  192  ENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR---  362
             NT  L+L H D +S   V+   +  F  R++RDA R   L    +   P      R   
Sbjct  69   NNTFKLNLLHRDKLSH--VHGHRRG-FNDRMKRDAIRVATLVRRLSHGAPAAVKDSRYKV  125

Query  363  -DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
             +F++ VISG+  GSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY
Sbjct  126  ANFATDVISGMEAGSGEYFVRIGVGSPPRNQYMVIDSGSDIVWVQCKPCSRCY  178



>ref|XP_004236867.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
lycopersicum]
Length=479

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 76/142 (54%), Gaps = 11/142 (8%)
 Frame = +3

Query  93   TKPFSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALF  272
            TKP +  P    + Y + ++       ++ +     L L+L H D +           +F
Sbjct  45   TKPQT--PFENQEEYHVDNE-------IEQESGNLKLKLNLIHRDKLQIPHFPYNNDKVF  95

Query  273  VKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYA  452
              R+ RD  R  ++         +   R ++F S +ISG+ QGSGEYF R+GVG+PPK  
Sbjct  96   EGRISRDLKRVSSIIHRIENGGVN--YRVKEFGSDLISGMDQGSGEYFVRVGVGSPPKNQ  153

Query  453  FMVLDTGSDVVWLQCSPCRKCY  518
            +MVLD+GSD+VW+QC PC +CY
Sbjct  154  YMVLDSGSDIVWVQCQPCTQCY  175



>ref|XP_008802841.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Phoenix 
dactylifera]
Length=470

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            DF S V+SGL +GSGEYF R+GVG+PPK  FMV+D+GSD+VW+QC PC +CYA
Sbjct  110  DFGSDVVSGLDEGSGEYFVRIGVGSPPKEQFMVIDSGSDIVWVQCRPCTQCYA  162



>ref|XP_003555824.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=473

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 64/104 (62%), Gaps = 2/104 (2%)
 Frame = +3

Query  207  LDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVIS  386
            L L H D + +   +   +  F  R+QRD  R  AL    AA  P  A     F S V+S
Sbjct  68   LKLVHRDKVPTFNTSHDHRTRFNARMQRDTKRVAALRRHLAAGKPTYAEEA--FGSDVVS  125

Query  387  GLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            G+ QGSGEYF R+GVG+PP+  ++V+D+GSD++W+QC PC +CY
Sbjct  126  GMEQGSGEYFVRIGVGSPPRNQYVVIDSGSDIIWVQCEPCTQCY  169



>ref|XP_006415880.1| hypothetical protein EUTSA_v10009899mg [Eutrema salsugineum]
 gb|ESQ34233.1| hypothetical protein EUTSA_v10009899mg [Eutrema salsugineum]
Length=487

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 82/149 (55%), Gaps = 13/149 (9%)
 Frame = +3

Query  105  SLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRL  284
            S+R    A  + L+   Q  Q+L     S +  +L LH    +  A  ++  K+L + RL
Sbjct  41   SIRKTKDASSFQLN--KQEDQSLTHSPSSSSAFTLQLHSRASVRGAEHHSDYKSLTLARL  98

Query  285  QRDaarakalsllaaaaPPHNA-----------TRGRDFSSSVISGLAQGSGEYFTRLGV  431
            +RD+AR K+L      A  + +           T  +D  + +ISG  QGSGEYFTR+G+
Sbjct  99   ERDSARVKSLMARLDLAINNISKSDLKPISTTYTTQQDIEAPLISGTTQGSGEYFTRVGI  158

Query  432  GTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            G P +  +MVLDTGSDV WLQC+PC +CY
Sbjct  159  GNPAREVYMVLDTGSDVNWLQCAPCAECY  187



>ref|XP_008374731.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Malus domestica]
Length=487

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 76/133 (57%), Gaps = 11/133 (8%)
 Frame = +3

Query  150  KPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaaraka------  311
            KP  SQ+      + +  SL LH  D + ++  +   K+L + RL RD+AR  +      
Sbjct  55   KPLESQSQESRPLNSSAFSLQLHPRDALFNSQ-HKDYKSLTLTRLDRDSARVNSLHTKLQ  113

Query  312  ----lsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSD  479
                    +   P H     +D S+ V+SG++QGSGEYF+R+GVGTP K  +MVLDTGSD
Sbjct  114  LALQGIKKSDLEPMHAEILPQDLSTPVVSGVSQGSGEYFSRIGVGTPAKSFYMVLDTGSD  173

Query  480  VVWLQCSPCRKCY  518
            V WLQC+PC  CY
Sbjct  174  VNWLQCNPCSDCY  186



>ref|XP_010549135.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=496

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 86/167 (51%), Gaps = 21/167 (13%)
 Frame = +3

Query  78   SPPSITKPFSLRPLPTAQHYSLSSKPQYSQTLVQPDDSEN-------TLSLDLHHIDLIS  236
            SPPS T    +       H  LS  P  +    +PD   +       + SLDLH  + + 
Sbjct  29   SPPSETTILDVVLSIQQTHQILSFDPTRTTLAHRPDSESDPGFLNSSSFSLDLHSRETLV  88

Query  237  SAAVNATPKALFVKRLQRDaarakalsll----------aaaaPPHNA---TRGRDFSSS  377
             +  +   ++L + RL+RD+ R   ++            +   P ++     +  D S+ 
Sbjct  89   ESQ-HKDYRSLVLARLERDSVRVDGITAKVRLAVEGVDRSKLQPIYDEDTRIQPEDLSTP  147

Query  378  VISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            V+SG +QGSGEYF+R+G+G PPK  FMVLDTGSDV W+QC PC +CY
Sbjct  148  VVSGASQGSGEYFSRIGIGNPPKEMFMVLDTGSDVNWIQCQPCSECY  194



>ref|XP_010248951.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=475

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
             DF S VISG+ QGSGEYF R+GVG+PP+  +MVLD+GSD+VW+QC PC +CY
Sbjct  119  EDFGSEVISGMEQGSGEYFVRIGVGSPPRNQYMVLDSGSDIVWVQCQPCSQCY  171



>gb|KDO69941.1| hypothetical protein CISIN_1g011042mg [Citrus sinensis]
Length=495

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 69/117 (59%), Gaps = 9/117 (8%)
 Frame = +3

Query  192  ENTLSLDLHHIDLISSAAVNATPKAL-------FVKRLQRDaarakalsllaaaaPPHNA  350
            E   +L+L H D +SS++ N T           F  R+QRD  R   L    +      A
Sbjct  76   EARWNLELVHRDKMSSSS-NTTNNMHYHRHQHSFHARMQRDVKRVATLVRRLSGGGADAA  134

Query  351  TRG-RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
                +DF + V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY
Sbjct  135  KHEVQDFGTDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCSQCY  191



>ref|XP_003536757.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=475

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 64/104 (62%), Gaps = 2/104 (2%)
 Frame = +3

Query  207  LDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVIS  386
            L L H D + +       +  F  R+QRD  RA +L    AA  P  A     F S V+S
Sbjct  70   LKLVHRDKVPTFNTYHDHRTRFNARMQRDTKRAASLLRRLAAGKPTYAAEA--FGSDVVS  127

Query  387  GLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            G+ QGSGEYF R+GVG+PP+  ++V+D+GSD++W+QC PC +CY
Sbjct  128  GMEQGSGEYFVRIGVGSPPRNQYVVMDSGSDIIWVQCEPCTQCY  171



>ref|XP_008351878.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 82/144 (57%), Gaps = 16/144 (11%)
 Frame = +3

Query  132  HYSLSSKPQYSQTL-VQPDDSE----NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDa  296
            H  LS  P+  Q L  Q  +S+    +  SL LH  D + ++  +   K+L + RL RD+
Sbjct  44   HAVLSFDPESLQPLEXQSQESQPLNSSAFSLQLHPRDXLFNSQ-HKDYKSLTLTRLGRDS  102

Query  297  arakalsllaaaa----------PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPK  446
            AR  +L      A          P H   + +D S+ V+SG++QGSGEYF+R+GVGTP K
Sbjct  103  ARVNSLHTKLQLALQGIKRGDLEPMHAEIQPQDLSTPVVSGVSQGSGEYFSRIGVGTPAK  162

Query  447  YAFMVLDTGSDVVWLQCSPCRKCY  518
              +MVLDTGSDV WLQC PC  CY
Sbjct  163  SFYMVLDTGSDVNWLQCGPCSDCY  186



>emb|CDY69364.1| BnaCnng63170D [Brassica napus]
Length=501

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 75/124 (60%), Gaps = 14/124 (11%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R   ++            +   
Sbjct  76   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAGITTKIRFAVEGIDRSDLK  134

Query  336  PPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            P +N     +  D ++ V+SG +QGSGEYF+R+GVGTP K  FMVLDTGSD+ W+QC PC
Sbjct  135  PVYNDETLYQPEDLTTPVVSGASQGSGEYFSRIGVGTPAKEMFMVLDTGSDINWIQCQPC  194

Query  507  RKCY  518
              CY
Sbjct  195  SDCY  198



>gb|EYU40681.1| hypothetical protein MIMGU_mgv1a005122mg [Erythranthe guttata]
Length=496

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 78/139 (56%), Gaps = 3/139 (2%)
 Frame = +3

Query  108  LRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLH--HIDLISSAAVNATPKALFVKR  281
            LRP  ++ H +       S+   +P  + N+ +  LH  H D ++  + +   +  F  R
Sbjct  55   LRPPQSSSHDTNHYAAVDSELTQKPTTNHNSTAAKLHLVHRDKLA-FSWHHDHRRRFESR  113

Query  282  LQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  461
            ++RDA R   L    +      A    DF S V+SG+ QGSGEYF R+GVG+P +  +MV
Sbjct  114  MKRDARRVGGLIRRLSGGGGAAAYEVADFGSEVVSGMDQGSGEYFVRIGVGSPARSQYMV  173

Query  462  LDTGSDVVWLQCSPCRKCY  518
            +D+GSD+VW+QC PC +CY
Sbjct  174  IDSGSDIVWVQCQPCSQCY  192



>ref|XP_008367576.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +3

Query  336  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKC  515
            P H   + +D S+ V+SG++QGSGEYF+R+GVGTP K  +MVLDTGSDV WLQC PC  C
Sbjct  126  PMHAEIQPQDLSTPVVSGVSQGSGEYFSRIGVGTPAKSFYMVLDTGSDVNWLQCGPCSDC  185

Query  516  Y  518
            Y
Sbjct  186  Y  186



>ref|XP_011459743.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Fragaria 
vesca subsp. vesca]
Length=227

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 62/95 (65%), Gaps = 12/95 (13%)
 Frame = +3

Query  249  NATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVIS----GLAQGSGEYF  416
            N TP  LF  RL+RD+    +L+        +N TR    SS   S    GL+QGSGEYF
Sbjct  30   NQTPSQLFHLRLRRDSLHFNSLA--------YNRTRPGPPSSGFSSSIVSGLSQGSGEYF  81

Query  417  TRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            TR+  G+PPKY +MVLDTGSDVVWLQC+PC+ CY+
Sbjct  82   TRIDDGSPPKYLYMVLDTGSDVVWLQCAPCKHCYS  116



>ref|XP_010935575.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=467

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
             DF S V+SGL +GSGEYF R+G+G+PPK  FMV+D+GSD+VW+QC PC +CYA
Sbjct  105  EDFGSDVVSGLDEGSGEYFVRIGLGSPPKEQFMVIDSGSDIVWVQCQPCTQCYA  158



>ref|XP_007152794.1| hypothetical protein PHAVU_004G160200g [Phaseolus vulgaris]
 gb|ESW24788.1| hypothetical protein PHAVU_004G160200g [Phaseolus vulgaris]
Length=486

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 76/142 (54%), Gaps = 17/142 (12%)
 Frame = +3

Query  141  LSSKPQ--YSQTLVQPDD----SENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaar  302
            LS KPQ  + QTL Q       S +  SL LH  + + +A  +   K L + RL RD+AR
Sbjct  45   LSFKPQQAFQQTLTQKQTPTSRSSSFFSLQLHTRETLFNAQ-HPDYKTLVLSRLARDSAR  103

Query  303  akalsllaaaa----------PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYA  452
              +L      A          P     R  D S+ V SG +QGSGEYF+R+GVG P K  
Sbjct  104  VNSLETKLQLALNSVKRSELYPTQTEIRPEDLSTPVSSGTSQGSGEYFSRVGVGQPAKPF  163

Query  453  FMVLDTGSDVVWLQCSPCRKCY  518
            FMVLDTGSDV WLQC PC  CY
Sbjct  164  FMVLDTGSDVNWLQCKPCSDCY  185



>ref|XP_010551158.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=495

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  354  RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            R  D S+ V+SG +QGSGEYF+R+GVGTPPK  FMVLDTGSDV W+QC PC  CY
Sbjct  139  RPEDLSTPVVSGASQGSGEYFSRIGVGTPPKDMFMVLDTGSDVNWIQCQPCSDCY  193



>ref|XP_006437655.1| hypothetical protein CICLE_v10031332mg [Citrus clementina]
 gb|ESR50895.1| hypothetical protein CICLE_v10031332mg [Citrus clementina]
Length=495

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 68/117 (58%), Gaps = 9/117 (8%)
 Frame = +3

Query  192  ENTLSLDLHHIDLISSAAVNATPKAL-------FVKRLQRDaarakalsllaaaaPPHNA  350
            E    L+L H D +SS++ N T           F  R+QRD  R   L    +      A
Sbjct  76   EARWKLELVHRDKMSSSS-NTTNNMHYHRHQHSFHARMQRDVKRVATLVRRLSGGGADAA  134

Query  351  TRG-RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
                +DF + V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY
Sbjct  135  KHEVQDFGTDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCSQCY  191



>ref|XP_006484478.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
Length=495

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 68/117 (58%), Gaps = 9/117 (8%)
 Frame = +3

Query  192  ENTLSLDLHHIDLISSAAVNATPKAL-------FVKRLQRDaarakalsllaaaaPPHNA  350
            E    L+L H D +SS++ N T           F  R+QRD  R   L    +      A
Sbjct  76   EARWKLELVHRDKMSSSS-NTTNNMHYHRHQHSFHARMQRDVKRVATLVRRLSGGGADAA  134

Query  351  TRG-RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
                +DF + V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY
Sbjct  135  KHEVQDFGTDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCSQCY  191



>ref|XP_006298983.1| hypothetical protein CARUB_v10015108mg [Capsella rubella]
 gb|EOA31881.1| hypothetical protein CARUB_v10015108mg [Capsella rubella]
Length=501

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 85/142 (60%), Gaps = 16/142 (11%)
 Frame = +3

Query  138  SLSSKPQYSQTLVQPD--DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaaraka  311
            SL+S    S++L  P   +S + LSL+LH  D+   A+ +   K+L + RL+RD++R   
Sbjct  58   SLTSTRPESESLFDPVFLNSSSPLSLELHSRDIFV-ASQHKDYKSLVLSRLERDSSRVNG  116

Query  312  lsll----------aaaaPPHNA-TRGR--DFSSSVISGLAQGSGEYFTRLGVGTPPKYA  452
            ++            +   P  N  TR +  D ++ V+SG +QGSGEYF+R+GVGTP K  
Sbjct  117  IAAKVRFAVEGIDRSDLKPVSNEDTRYQPEDLTTPVVSGASQGSGEYFSRIGVGTPAKEM  176

Query  453  FMVLDTGSDVVWLQCSPCRKCY  518
            ++VLDTGSDV W+QC PC  CY
Sbjct  177  YLVLDTGSDVNWIQCQPCSDCY  198



>gb|KJB37242.1| hypothetical protein B456_006G195400 [Gossypium raimondii]
Length=482

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 81/152 (53%), Gaps = 19/152 (13%)
 Frame = +3

Query  117  LPTAQHYSLSSKPQ----YSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP----KALF  272
            L  AQH  LS  PQ    ++QT  QP    ++ S  +  + L S  +V+ T     KAL 
Sbjct  43   LSQAQHI-LSFDPQSLKAFAQTQTQPLFFNSSTSAAVFSVPLHSRGSVHKTHHTDYKALV  101

Query  273  VKRLQRDaa----------rakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTR  422
            + RL+RD+A           A      +   P     +    S+ +ISG +QGSGEYF+R
Sbjct  102  LSRLERDSARVDSLSTKLLLALNGVKKSQLRPLPTQIQAEALSTPIISGTSQGSGEYFSR  161

Query  423  LGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            +GVG P K  +MVLDTGSD+ W+QC PC +CY
Sbjct  162  VGVGKPAKQFYMVLDTGSDINWIQCEPCNECY  193



>ref|XP_009351765.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Pyrus x 
bretschneideri]
Length=548

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 66/112 (59%), Gaps = 9/112 (8%)
 Frame = +3

Query  207  LDLHHIDLISSAAVNATPKA--------LFVKRLQRDaarakalsllaaaaPPHNATRGR  362
            L + H D +SS   N             LF  R++RDA R  +L+        ++     
Sbjct  121  LKVVHRDKMSSQYSNRNGNGGSHTSHSHLFRARMKRDAKRVASLTRRLLN-DSNSELESL  179

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY
Sbjct  180  DFGSGVVSGMEQGSGEYFVRIGVGSPPRNQYMVIDSGSDIVWVQCQPCTECY  231



>gb|KEH44258.1| aspartic protease in GUARD CELL-like protein [Medicago truncatula]
Length=467

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 70/111 (63%), Gaps = 10/111 (9%)
 Frame = +3

Query  189  SENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD-  365
            S +TLSL LH    +SS   +A  K+L + RL RD+AR K ++         N     D 
Sbjct  66   STSTLSLQLHSRASLSS---HADYKSLTLSRLDRDSARVKYITTKL------NQNFNTDK  116

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
             S  +ISG +QGSGEYF+R+G+G PP  A+MVLDTGSD+ W+QC+PC  CY
Sbjct  117  LSGPIISGTSQGSGEYFSRIGIGEPPSQAYMVLDTGSDISWVQCAPCADCY  167



>ref|XP_004498097.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Cicer arietinum]
Length=478

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 69/139 (50%), Gaps = 19/139 (14%)
 Frame = +3

Query  120  PTAQHYSLSS---KPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQR  290
            P+ QH  L     +PQ+   L   D          H I+ I++A      K  F+ R++R
Sbjct  48   PSKQHSQLEKEQQQPQWKTKLFHRD----------HIINHINTAT---NHKTRFISRIKR  94

Query  291  Daarak---alsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  461
            D  R                   T    F S ++SG  +GSGEYF R+G+G+P  Y +MV
Sbjct  95   DIKRVSFLHNRLNKHTQVTEQETTADTSFGSDIVSGSEEGSGEYFVRIGIGSPAIYQYMV  154

Query  462  LDTGSDVVWLQCSPCRKCY  518
            +D+GSD+VW+QC PC +CY
Sbjct  155  IDSGSDIVWIQCQPCHQCY  173



>ref|XP_004498098.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Cicer arietinum]
Length=465

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 69/139 (50%), Gaps = 19/139 (14%)
 Frame = +3

Query  120  PTAQHYSLSS---KPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQR  290
            P+ QH  L     +PQ+   L   D          H I+ I++A      K  F+ R++R
Sbjct  48   PSKQHSQLEKEQQQPQWKTKLFHRD----------HIINHINTAT---NHKTRFISRIKR  94

Query  291  Daarak---alsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  461
            D  R                   T    F S ++SG  +GSGEYF R+G+G+P  Y +MV
Sbjct  95   DIKRVSFLHNRLNKHTQVTEQETTADTSFGSDIVSGSEEGSGEYFVRIGIGSPAIYQYMV  154

Query  462  LDTGSDVVWLQCSPCRKCY  518
            +D+GSD+VW+QC PC +CY
Sbjct  155  IDSGSDIVWIQCQPCHQCY  173



>ref|XP_011089579.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 2 [Sesamum indicum]
Length=479

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 82/147 (56%), Gaps = 17/147 (12%)
 Frame = +3

Query  87   SITKPFSLRPLPTAQHYSLSSKPQYS---QTLVQPDDSENTLSLDLHHIDLISSAAVNAT  257
            SI     LRP  +A      +  QY+   + + +P  S +T+ L L H D ++ +  N  
Sbjct  43   SIAAATHLRPPASA------TTTQYTDDNEVIQKPLTSNSTVKLHLVHRDKLAFSWHN-D  95

Query  258  PKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGT  437
             +  F  R++RDA R   L   A       A    DF + V+SG+ QGSGEYF R+GVG+
Sbjct  96   HRRRFEARMKRDARRVAGLLRXA-------AYEVADFGAEVVSGMDQGSGEYFVRIGVGS  148

Query  438  PPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            P +  +MV+D+GSD+VW+QC PC +CY
Sbjct  149  PARSQYMVIDSGSDIVWVQCQPCSQCY  175



>ref|XP_009760593.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=494

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 82/161 (51%), Gaps = 22/161 (14%)
 Frame = +3

Query  93   TKPFSLRPLPTAQHYSL-SSKPQYSQTLVQPDDSEN------------------TLSLDL  215
            T   ++ P PT +++++  +  Q+S  +  P + +                      L L
Sbjct  33   TTAHAIFPYPTHENFNVQETISQFSTKIQTPHEKQEEDFHFDNENGEENGEEQKNWKLKL  92

Query  216  HHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLA  395
             H D +  +   +    +F  R++RD  R  +L         +   R  +F S+VISG+ 
Sbjct  93   IHRDKLHFSNYFSNHSKMFEARMKRDIKRVSSLIHRITGGGVY---RVEEFGSNVISGMD  149

Query  396  QGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            QGSGEYF R+GVG+P +  +MV+D+GSD+VW+QC PC +CY
Sbjct  150  QGSGEYFVRIGVGSPARNQYMVIDSGSDIVWVQCQPCTQCY  190



>ref|XP_010466176.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Camelina 
sativa]
Length=470

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 68/116 (59%), Gaps = 5/116 (4%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR  362
            DDS +  +L L H D   S         L   R++RD  R  AL    +     +++  R
Sbjct  52   DDSTSKYTLRLLHRDRFPSVTYRNHHHRLHA-RMRRDTDRVAALLRRISGKAVSSSSDAR  110

Query  363  ----DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
                DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC+ CY
Sbjct  111  YEVDDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCY  166



>ref|XP_010487964.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=470

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 69/116 (59%), Gaps = 5/116 (4%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR  362
            DDS +  +L L H D   S +       L   R++RD  R  AL    +     +++  R
Sbjct  52   DDSNSKHTLRLLHRDRFPSVSYRNHHHRLHA-RMRRDTDRVAALLRRISGKTVSSSSDAR  110

Query  363  ----DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
                DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC+ CY
Sbjct  111  YEVDDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCY  166



>ref|XP_002513132.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF49635.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=481

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 76/137 (55%), Gaps = 3/137 (2%)
 Frame = +3

Query  117  LPTAQHYSLSSKPQYSQTLVQPDDS--ENTLSLDLHHIDLISSAAVNATPKAL-FVKRLQ  287
            L   +  + +   QY +     +D+  E    L L H D I++   ++   +  F  R+Q
Sbjct  41   LNVKEAITETKASQYQELFDNQNDTLTEGKWKLKLVHRDKITAFNKSSYDHSHNFHARIQ  100

Query  288  RDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLD  467
            RD  R   L    +     ++    +F + V+SG+ QGSGEYF R+GVG+PP+  ++V+D
Sbjct  101  RDKKRVATLIRRLSPRDATSSYSVEEFGAEVVSGMNQGSGEYFIRIGVGSPPREQYVVID  160

Query  468  TGSDVVWLQCSPCRKCY  518
            +GSD+VW+QC PC +CY
Sbjct  161  SGSDIVWVQCQPCTQCY  177



>ref|XP_010506935.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Camelina 
sativa]
Length=501

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 76/124 (61%), Gaps = 14/124 (11%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + LSL+LH  D+   A+ +   K+L + RL+RD++R   ++            +   
Sbjct  76   NSSSPLSLELHSRDIFV-ASQHKDYKSLVLSRLERDSSRVAGIAAKIRFAVEGIDRSDLK  134

Query  336  PPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            P +N     + ++ ++ V+SG +QGSGEYF+R+GVGTP K  ++VLDTGSDV W+QC PC
Sbjct  135  PVYNEDTRYQTQELTTPVVSGASQGSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPC  194

Query  507  RKCY  518
              CY
Sbjct  195  SDCY  198



>ref|XP_006360843.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=479

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 70/135 (52%), Gaps = 11/135 (8%)
 Frame = +3

Query  141  LSSKPQ---------YSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRD  293
            L +KPQ         +    ++ ++    L L L H D +           +F  R+ RD
Sbjct  43   LDTKPQTPFENQEEFHVDNEIEQENGNWKLKLKLIHRDKLQIPHFPYNNNKVFEGRINRD  102

Query  294  aarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTG  473
              R  ++         +   R  +F S +ISG+ QGSGEYF R+GVG+P K  +MVLD+G
Sbjct  103  LKRVSSIIHRIENGGVN--YRVEEFGSDLISGMDQGSGEYFVRIGVGSPAKNQYMVLDSG  160

Query  474  SDVVWLQCSPCRKCY  518
            SD+VW+QC PC +CY
Sbjct  161  SDIVWVQCQPCTQCY  175



>ref|XP_008340423.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Malus domestica]
Length=547

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY
Sbjct  179  DFGSGVVSGMEQGSGEYFVRIGVGSPPRNQYMVIDSGSDIVWVQCQPCTECY  230



>ref|XP_007043208.1| Aspartic proteinase nepenthesin-1, putative [Theobroma cacao]
 gb|EOX99039.1| Aspartic proteinase nepenthesin-1, putative [Theobroma cacao]
Length=481

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY
Sbjct  126  DFGSDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCNQCY  177



>ref|XP_010908909.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=448

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 75/125 (60%), Gaps = 5/125 (4%)
 Frame = +3

Query  144  SSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll  323
            S+  Q S+T V      N  +L+L H D ISS    ++    F + + RDA R   L+  
Sbjct  23   SNLHQLSKTHVH---KANKWALNLVHRDTISSRNY-SSHHHRFQELMNRDARRVAGLTRR  78

Query  324  aaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSP  503
             AA+    A    DF S V+SGL +GSGEYF R+GVG+PP+  +MV+D+GSD+ W+QC P
Sbjct  79   LAASTGL-AYSSEDFGSEVVSGLEEGSGEYFVRVGVGSPPREQYMVIDSGSDITWVQCQP  137

Query  504  CRKCY  518
            C +CY
Sbjct  138  CSQCY  142



>ref|XP_008359997.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 2-like [Malus domestica]
Length=539

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC  CY
Sbjct  171  DFGSGVVSGMEQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCTHCY  222



>ref|XP_002267930.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Vitis vinifera]
Length=479

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            DF + VISG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY
Sbjct  124  DFGTDVISGMEQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCTQCY  175



>ref|XP_010465949.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=502

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 77/124 (62%), Gaps = 14/124 (11%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + LSL+LH  D++  A+ +   K+L + RL+R+++R   ++            +   
Sbjct  77   NSSSPLSLELHSRDILV-ASQHKDYKSLVLSRLERESSRVAGIAAKIQFAVEGIDRSDLK  135

Query  336  PPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            P +N     + ++ ++ V+SG +QGSGEYF+R+GVGTP K  ++VLDTGSDV W+QC PC
Sbjct  136  PVYNEDTRYQTQELTTPVVSGASQGSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCQPC  195

Query  507  RKCY  518
              CY
Sbjct  196  SDCY  199



>ref|XP_010487776.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=501

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 75/124 (60%), Gaps = 14/124 (11%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + LSL+LH  D+   A+ +   K+L + RL+RD++R   ++            +   
Sbjct  76   NSSSPLSLELHSRDIFV-ASQHKDYKSLVLSRLERDSSRVSGIAAKIRFAVEGIDRSDLK  134

Query  336  PPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            P  N     + ++ ++ V+SG +QGSGEYF+R+GVGTP K  ++VLDTGSDV W+QC PC
Sbjct  135  PVDNEDTRYQTQELTTPVVSGASQGSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPC  194

Query  507  RKCY  518
              CY
Sbjct  195  SDCY  198



>ref|XP_010508355.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=471

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 67/116 (58%), Gaps = 5/116 (4%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR  362
            DDS +  +L L H D   S         L   R++RD  R  AL          +++  R
Sbjct  53   DDSTSKHTLRLLHRDRFPSVTYRNHHHRLHA-RMRRDTDRVAALLRRICGKAVSSSSDAR  111

Query  363  ----DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
                DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC+ CY
Sbjct  112  YEVDDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCY  167



>emb|CBI35367.3| unnamed protein product [Vitis vinifera]
Length=521

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  354  RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            R  DF + VISG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY
Sbjct  182  RVDDFGTDVISGMEQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCTQCY  236



>ref|NP_188478.1| protein ASPARTIC PROTEASE IN GUARD CELL 1 [Arabidopsis thaliana]
 sp|Q9LS40.1|ASPG1_ARATH RecName: Full=Protein ASPARTIC PROTEASE IN GUARD CELL 1; Short=AtASPG1; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01116.1| CND41, chloroplast nucleoid DNA binding protein-like [Arabidopsis 
thaliana]
 gb|AAN13013.1| putative chloroplast nucleoid DNA-binding protein [Arabidopsis 
thaliana]
 gb|AEE76104.1| protein aspartic protease in guard cell 1 [Arabidopsis thaliana]
Length=500

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 73/124 (59%), Gaps = 14/124 (11%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + LSL+LH  D    A+ +   K+L + RL+RD++R   +             +   
Sbjct  75   NSSSPLSLELHSRDTFV-ASQHKDYKSLTLSRLERDSSRVAGIVAKIRFAVEGVDRSDLK  133

Query  336  PPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            P +N     +  D ++ V+SG +QGSGEYF+R+GVGTP K  ++VLDTGSDV W+QC PC
Sbjct  134  PVYNEDTRYQTEDLTTPVVSGASQGSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPC  193

Query  507  RKCY  518
              CY
Sbjct  194  ADCY  197



>emb|CDY25371.1| BnaA05g19130D [Brassica napus]
Length=397

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC+ CY
Sbjct  111  DFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCY  162



>emb|CDY24395.1| BnaCnng04620D [Brassica napus]
Length=482

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 84/153 (55%), Gaps = 26/153 (17%)
 Frame = +3

Query  105  SLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP----KALF  272
            S+R    A  + L+ + ++SQ    P  S  + SL LH     S A+V  T      +L 
Sbjct  41   SIRKTKDASSFRLNQQEEHSQ---YPTSS--SFSLQLH-----SRASVRGTEHPDYNSLT  90

Query  273  VKRLQRDaarakalsllaaaaPPHNATRG-----------RDFSSSVISGLAQGSGEYFT  419
            + RL RD+AR K+L+        +N TR             +  + +ISG  QGSGEYFT
Sbjct  91   LARLHRDSARVKSLTARLNL-AINNITRADLKHTMYTTEQEEIEAPLISGTTQGSGEYFT  149

Query  420  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            R+G+G+P +  +MVLDTGSDV WLQC+PC +CY
Sbjct  150  RVGIGSPAREVYMVLDTGSDVNWLQCAPCAQCY  182



>emb|CDY24567.1| BnaC05g32510D [Brassica napus]
Length=395

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW QC PC+ CY
Sbjct  109  DFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWFQCQPCKLCY  160



>ref|XP_007153018.1| hypothetical protein PHAVU_003G000900g [Phaseolus vulgaris]
 gb|ESW25012.1| hypothetical protein PHAVU_003G000900g [Phaseolus vulgaris]
Length=464

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 71/118 (60%), Gaps = 7/118 (6%)
 Frame = +3

Query  177  QPDDSE---NTLSLDLHHIDLISSAA-VNATPKALFVKRLQRDaarakalsllaaaaPPH  344
            +P+D E       + L H D IS A  +N + +  F +R++RDA R  ++    + A   
Sbjct  46   EPEDLEEKQGNWKVQLLHRDKISKAPPMNHSTR--FNQRMKRDAKRVSSIVNKNSDARTE  103

Query  345  NATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
             A     F S V+SG+ +GSGEYF R+G+G+P  Y +MV+D+GSD+VW+QC PC  CY
Sbjct  104  AAEEA-SFGSDVVSGMEEGSGEYFVRIGIGSPATYQYMVIDSGSDIVWVQCQPCDLCY  160



>ref|XP_010036867.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1-like [Eucalyptus grandis]
Length=496

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 61/97 (63%), Gaps = 12/97 (12%)
 Frame = +3

Query  261  KALFVKRLQRDaarakalsllaaaaPPHNATRG-----------RDFSSSVISGLAQGSG  407
            KAL + RL RD+AR  AL+     A  +N TR             D S+ V+SG +QGSG
Sbjct  99   KALVLARLGRDSARVDALASKLNLAL-NNVTRTDLTPLRTEIQPEDLSTPVVSGTSQGSG  157

Query  408  EYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            EYF+R+GVGTP K  +MVLDTGSDV WLQC PC  CY
Sbjct  158  EYFSRIGVGTPAKQFYMVLDTGSDVNWLQCQPCTDCY  194



>ref|XP_009385987.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Musa acuminata 
subsp. malaccensis]
Length=464

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 66/111 (59%), Gaps = 5/111 (5%)
 Frame = +3

Query  189  SENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDF  368
              N LSL L H D +     +     L  + L+RD+ R   L+   + A  H      DF
Sbjct  49   GHNRLSLSLFHRDALPGRNFSGHRHRL-DRLLERDSRRVVTLTRRLSTARYHV----DDF  103

Query  369  SSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
             S V+SGL +GSGEYF R+GVG PP+  ++V+D+GSD+VW+QC PC +CYA
Sbjct  104  GSEVVSGLEEGSGEYFVRVGVGVPPRDQYLVVDSGSDIVWIQCRPCSQCYA  154



>ref|XP_008351877.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 81/144 (56%), Gaps = 16/144 (11%)
 Frame = +3

Query  132  HYSLSSKPQYSQTL-VQPDDSE----NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDa  296
            H  LS  P+  Q L  Q  +S+    +  SL LH  D + ++  +   K+L + RL RD+
Sbjct  44   HAVLSFDPESLQPLEXQSQESQPLNSSAFSLQLHPRDXLFNSQ-HKDYKSLTLTRLGRDS  102

Query  297  arakalsllaaaa----------PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPK  446
            AR  +L      A          P H   + +D S+ V+SG++QGSGEYF+R+GV TP K
Sbjct  103  ARVNSLHTKLQLALQGIKRGDLEPMHAEIQPQDLSTPVVSGVSQGSGEYFSRIGVXTPAK  162

Query  447  YAFMVLDTGSDVVWLQCSPCRKCY  518
              +MVLDTGSDV WLQC PC  CY
Sbjct  163  SFYMVLDTGSDVNWLQCGPCSDCY  186



>ref|XP_002885351.1| pepsin A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61610.1| pepsin A [Arabidopsis lyrata subsp. lyrata]
Length=471

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 67/116 (58%), Gaps = 5/116 (4%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR  362
            DDS +  +L L H D   S         L   R++RD  R  A+    +      ++  R
Sbjct  53   DDSNSKYTLRLLHRDRFPSVTYRNHHHRLHA-RMRRDTDRVSAILRRISGKVVVASSDSR  111

Query  363  ----DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
                DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC+ CY
Sbjct  112  YEVNDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCY  167



>gb|KDP20100.1| hypothetical protein JCGZ_05869 [Jatropha curcas]
Length=493

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 60/96 (63%), Gaps = 10/96 (10%)
 Frame = +3

Query  261  KALFVKRLQRDaarakalsllaaaa----------PPHNATRGRDFSSSVISGLAQGSGE  410
            K+L + RLQRD++R KA++     A          P     +  DFS+ V SG +QGSGE
Sbjct  97   KSLVLSRLQRDSSRVKAITTQVELAVNGISKNDLKPLVTEIQPEDFSTPVTSGTSQGSGE  156

Query  411  YFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            YF+R+GVG P K  +MVLDTGSD+ WLQC PC  CY
Sbjct  157  YFSRVGVGNPEKSFYMVLDTGSDITWLQCEPCSDCY  192



>ref|XP_004297710.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Fragaria 
vesca subsp. vesca]
Length=477

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 84/160 (53%), Gaps = 9/160 (6%)
 Frame = +3

Query  54   SYFLAIPSSPPSITKPFSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENT----LSLDLHH  221
            S+ ++  +   SIT     + L   Q  + +S   Y + L   +DS  +      + + H
Sbjct  15   SFGISGTAMASSITTYPDFQQLHVKQTIAAASTKLYKEEL--KEDSSGSGGGRWRVKVVH  72

Query  222  IDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR-DFSSSVISGLAQ  398
             D I   A  +  K++F  R+ RD  R  +L               + DF S V+SG+AQ
Sbjct  73   RDKIFPQA--SHNKSIFHARIHRDVKRVDSLMRRLGGNSNDQVMNKKLDFGSEVVSGMAQ  130

Query  399  GSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            GSGEYF R+GVG+P +  ++V+D+GSD+VW+QC PC +CY
Sbjct  131  GSGEYFVRIGVGSPARSQYVVIDSGSDIVWVQCQPCSQCY  170



>ref|XP_002885261.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61520.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=500

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 74/124 (60%), Gaps = 14/124 (11%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalslla---------aaaP  338
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R   ++            +   
Sbjct  75   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAGIAAKIRFAVEGIDRSDLK  133

Query  339  PHNATRGR----DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            P N    R      ++ V+SG++QGSGEYF+R+GVGTP K  ++VLDTGSDV W+QC PC
Sbjct  134  PVNNEDTRYQPEALTTPVVSGVSQGSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPC  193

Query  507  RKCY  518
              CY
Sbjct  194  SDCY  197



>ref|XP_002990366.1| hypothetical protein SELMODRAFT_43971, partial [Selaginella moellendorffii]
 gb|EFJ08635.1| hypothetical protein SELMODRAFT_43971, partial [Selaginella moellendorffii]
Length=420

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +3

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            F+S +ISG+A GSG+YF R+GVGTP +  +MV DTGSDV WLQCSPCRKCY
Sbjct  66   FASPLISGIAGGSGDYFARIGVGTPARSVYMVADTGSDVSWLQCSPCRKCY  116



>ref|XP_006406598.1| hypothetical protein EUTSA_v10020568mg [Eutrema salsugineum]
 dbj|BAJ33681.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48051.1| hypothetical protein EUTSA_v10020568mg [Eutrema salsugineum]
Length=502

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 75/124 (60%), Gaps = 14/124 (11%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalslla---------aaaP  338
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R   ++            +   
Sbjct  77   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAGIAAKIRFAVEGIDRSDLK  135

Query  339  PHNATRGR----DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            P +    R    D ++ V+SG +QGSGEYF+R+GVGTP K  ++VLDTGSDV W+QC PC
Sbjct  136  PVDIDETRFQPEDLTTPVVSGTSQGSGEYFSRIGVGTPAKEMYVVLDTGSDVNWIQCLPC  195

Query  507  RKCY  518
             +CY
Sbjct  196  SECY  199



>gb|AAL87345.1| putative chloroplast nucleoid DNA-binding protein [Arabidopsis 
thaliana]
Length=500

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 73/124 (59%), Gaps = 14/124 (11%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + LSL+LH  D    A+ +   K+L + RL+RD++R   +             +   
Sbjct  75   NSSSPLSLELHSRDTFV-ASQHKDYKSLTLSRLERDSSRVAGIVAKIRFAVEGVDRSDLK  133

Query  336  PPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            P +N     +  D ++ V+SG +QGSGEYF+R+GVGTP K  ++VLDTGSDV W+QC PC
Sbjct  134  PVYNEDTRYQTEDLTTPVVSGASQGSGEYFSRIGVGTPAKDMYLVLDTGSDVNWIQCEPC  193

Query  507  RKCY  518
              CY
Sbjct  194  ADCY  197



>ref|XP_008465249.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Cucumis 
melo]
Length=477

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 68/112 (61%), Gaps = 4/112 (4%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR  362
            + S++   L L H D +        P+  F +R+ RD+ R  +L  L + A     T   
Sbjct  66   NSSQSQWKLKLFHRDKLPLNFDTNHPRR-FKERISRDSKRVSSLLRLLSNASDEQVT---  121

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            DF S V+SG  QGSGEYF R+GVG+PP+  ++V+D+GSD+VW+QC PC +CY
Sbjct  122  DFGSDVVSGTEQGSGEYFVRIGVGSPPRSQYVVIDSGSDIVWVQCQPCSECY  173



>gb|KFK39328.1| hypothetical protein AALP_AA3G230300 [Arabis alpina]
Length=460

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC+ CY
Sbjct  105  DFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCY  156



>ref|XP_010103590.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
 gb|EXB96367.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
Length=521

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 60/90 (67%), Gaps = 6/90 (7%)
 Frame = +3

Query  267  LFVKRLQRDaarakalsllaaaaPPHNATRG------RDFSSSVISGLAQGSGEYFTRLG  428
            +F +R++RDA R  +L    A +  ++   G       DF S V+SG+ QGSGEYF R+G
Sbjct  128  IFNERMKRDAHRVASLVRRLANSSNNSRISGSDKYEVEDFGSEVVSGMDQGSGEYFVRIG  187

Query  429  VGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            VG+P +  +MV+D+GSD+VW+QC PC +CY
Sbjct  188  VGSPARSQYMVIDSGSDIVWVQCQPCSQCY  217



>ref|XP_008445900.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
melo]
Length=481

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 69/116 (59%), Gaps = 14/116 (12%)
 Frame = +3

Query  192  ENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD--  365
             +T  L+L H D +S   V+   +  F  R++RDA R   L    +    H A    D  
Sbjct  69   NDTFKLNLLHRDKLSH--VHGHRRG-FNDRMKRDAIRVATLVRRLS----HGAAAVEDSR  121

Query  366  -----FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
                 F++ VISG+ +GSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY
Sbjct  122  FKVANFATDVISGMEEGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCKPCSRCY  177



>ref|XP_004137465.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN64110.1| hypothetical protein Csa_1G042220 [Cucumis sativus]
Length=491

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 71/128 (55%), Gaps = 11/128 (9%)
 Frame = +3

Query  165  QTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaaraka----------l  314
            Q  + P +S  + SL LH  D + +A  +   K+L + RL RD++R K+           
Sbjct  64   QVHLVPSNSSFSFSLQLHPRDSLHNAG-HKDYKSLVLSRLSRDSSRVKSIYDRLEFALSE  122

Query  315  sllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQ  494
               +   P        D S+ +ISG +QGSGEYF+R+GVG P K  +MVLDTGSD+ WLQ
Sbjct  123  LKRSDLEPLKTEILPEDLSTPIISGTSQGSGEYFSRVGVGQPAKPFYMVLDTGSDINWLQ  182

Query  495  CSPCRKCY  518
            C PC  CY
Sbjct  183  CQPCTDCY  190



>ref|XP_004157423.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=491

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 71/128 (55%), Gaps = 11/128 (9%)
 Frame = +3

Query  165  QTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaaraka----------l  314
            Q  + P +S  + SL LH  D + +A  +   K+L + RL RD++R K+           
Sbjct  64   QVHLVPSNSSFSFSLQLHPRDSLHNAG-HKDYKSLVLSRLSRDSSRVKSIYDRLEFALSE  122

Query  315  sllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQ  494
               +   P        D S+ +ISG +QGSGEYF+R+GVG P K  +MVLDTGSD+ WLQ
Sbjct  123  LKRSDLEPLKTEILPEDLSTPIISGTSQGSGEYFSRVGVGQPAKPFYMVLDTGSDINWLQ  182

Query  495  CSPCRKCY  518
            C PC  CY
Sbjct  183  CQPCTDCY  190



>ref|XP_002970504.1| hypothetical protein SELMODRAFT_93504 [Selaginella moellendorffii]
 gb|EFJ28634.1| hypothetical protein SELMODRAFT_93504 [Selaginella moellendorffii]
Length=483

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 69/125 (55%), Gaps = 4/125 (3%)
 Frame = +3

Query  153  PQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNA--TPKALFVKRLQRDaarak-alsll  323
            P  ++  + P D   TLSL+L H + +   A     T + L ++ LQRD  R +   S  
Sbjct  41   PVKNKLQLSPRDG-GTLSLELIHRNSLLREAKEKLHTHEQLLLETLQRDEQRVRWIESKA  99

Query  324  aaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSP  503
              A    +     D +  V SGL  GSGEYF RLGVGTP +  FMV+DTGSD+ WLQC P
Sbjct  100  QLAGKKKDEASSTDLNGPVTSGLLYGSGEYFVRLGVGTPARSLFMVVDTGSDLPWLQCQP  159

Query  504  CRKCY  518
            C+ CY
Sbjct  160  CKSCY  164



>ref|XP_006297584.1| hypothetical protein CARUB_v10013606mg [Capsella rubella]
 gb|EOA30482.1| hypothetical protein CARUB_v10013606mg [Capsella rubella]
Length=475

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC+ CY
Sbjct  120  DFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCY  171



>ref|XP_009145693.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Brassica 
rapa]
Length=467

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC+ CY
Sbjct  112  DFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCY  163



>ref|XP_008791252.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=469

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            +DF S V+SGL +GSGEYF R+GVG+PP+  +MV+D+GSD+ W+QC PC +CY
Sbjct  111  QDFGSEVVSGLEEGSGEYFVRVGVGSPPREQYMVIDSGSDITWVQCQPCSQCY  163



>ref|XP_010477900.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=483

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 69/127 (54%), Gaps = 13/127 (10%)
 Frame = +3

Query  177  QPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNA--  350
            Q + S++  SL LH    +     ++  K+L + RL RD AR K+L      A  + +  
Sbjct  57   QEEQSQSPFSLKLHSRASVRGGVEHSDYKSLTLARLDRDTARVKSLVTRLDLALNNISKA  116

Query  351  -----------TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQC  497
                       T   D  + +ISG  QGSGEYFTR+G+G P +  +MVLDTGSDV WLQC
Sbjct  117  DLKPVITTMYTTDQEDIEAPLISGTTQGSGEYFTRVGIGNPAREVYMVLDTGSDVNWLQC  176

Query  498  SPCRKCY  518
            +PC  CY
Sbjct  177  APCADCY  183



>ref|XP_009607692.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=489

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = +3

Query  279  RLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  458
            R++RD  R   L         +N     +F S VISG+ QGSGEYF R+GVG+P +  +M
Sbjct  106  RVKRDVKRVDTLIHKITGGNNNNVYEVEEFGSEVISGMEQGSGEYFVRIGVGSPVREQYM  165

Query  459  VLDTGSDVVWLQCSPCRKCY  518
            V+D GSD+VW+QC PC  CY
Sbjct  166  VIDAGSDIVWVQCQPCTHCY  185



>ref|XP_008457107.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
melo]
Length=489

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 71/128 (55%), Gaps = 11/128 (9%)
 Frame = +3

Query  165  QTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaaraka----------l  314
            Q  + P +S  + SL LH  D + +A  +   K+L + RL RD++R K+           
Sbjct  62   QVRLVPSNSSFSFSLQLHPRDSLHNAG-HKDYKSLVLSRLSRDSSRVKSIYDRLEFALSE  120

Query  315  sllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQ  494
               +   P        D S+ ++SG +QGSGEYF+R+GVG P K  +MVLDTGSD+ WLQ
Sbjct  121  LKRSDLEPLKTEILPEDLSTPIVSGTSQGSGEYFSRVGVGQPAKPFYMVLDTGSDINWLQ  180

Query  495  CSPCRKCY  518
            C PC  CY
Sbjct  181  CQPCTDCY  188



>ref|XP_009346910.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 74/133 (56%), Gaps = 11/133 (8%)
 Frame = +3

Query  150  KPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaar---------  302
            KP  SQ+      + + LSL LH  D + ++  +   K+L   RL RD+AR         
Sbjct  55   KPLESQSQESRPLNSSALSLQLHPRDALFNSQ-HKDYKSLTRTRLYRDSARVHSLHSKLQ  113

Query  303  -akalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSD  479
             A      +   P H     +D S+ V+SG++QGSGEYF+R+GVGTP K  +MV DTGSD
Sbjct  114  LALQGIKKSDLEPMHAKILPQDLSTPVVSGVSQGSGEYFSRIGVGTPAKSFYMVPDTGSD  173

Query  480  VVWLQCSPCRKCY  518
            V WLQC PC  CY
Sbjct  174  VNWLQCDPCSDCY  186



>ref|NP_188636.2| protein ASPARTIC PROTEASE IN GUARD CELL 2 [Arabidopsis thaliana]
 sp|Q9LHE3.1|ASPG2_ARATH RecName: Full=Protein ASPARTIC PROTEASE IN GUARD CELL 2; Short=AtASPG2; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB03167.1| nucleoid chloroplast DNA-binding protein-like [Arabidopsis thaliana]
 gb|AAO41867.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76319.1| protein aspartic protease in guard cell 2 [Arabidopsis thaliana]
Length=470

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            DF S ++SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC+ CY
Sbjct  115  DFGSDIVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCY  166



>emb|CDY51131.1| BnaA07g37140D [Brassica napus]
Length=436

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 78/142 (55%), Gaps = 20/142 (14%)
 Frame = +3

Query  105  SLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP----KALF  272
            S+R    A  + L+ + + S T   P  S ++ SL LH     S A+V        K+L 
Sbjct  41   SIRRTKGAPSFQLNQQEEQSHT---PSFSSSSFSLQLH-----SRASVQGNEHSDYKSLT  92

Query  273  VKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYA  452
            + RL RD+AR    ++          T  ++  + +ISG  QGSGEYFTR+G+G P +  
Sbjct  93   LARLDRDSARPVITTMY--------TTEQQEIEAPLISGTTQGSGEYFTRVGIGNPAREV  144

Query  453  FMVLDTGSDVVWLQCSPCRKCY  518
            +MVLDTGSDV WLQC+PC  CY
Sbjct  145  YMVLDTGSDVNWLQCAPCADCY  166



>ref|XP_010031370.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Eucalyptus 
grandis]
Length=496

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
             DF S V+SG+ QGSGEYF R+GVG+P +  +MV+D+GSD+VW+QC PC +CY
Sbjct  142  EDFGSDVVSGMDQGSGEYFVRIGVGSPARSQYMVIDSGSDIVWVQCQPCNQCY  194



>ref|XP_011008360.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Populus 
euphratica]
Length=484

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 69/115 (60%), Gaps = 16/115 (14%)
 Frame = +3

Query  222  IDLISSAAVNATP----KALFVKRLQRDaarakalsllaaaa------------PPHNAT  353
            ++L+S  ++  T     K+L + RLQRD+AR K+L      A               +  
Sbjct  70   VELLSRTSIQKTTHTDYKSLTLSRLQRDSARVKSLVTRLDLAINSISSSDLKPLETDSEF  129

Query  354  RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            +  D  S +ISG +QGSGEYF+R+G+G PP  A+++LDTGSDV W+QC+PC +CY
Sbjct  130  KSEDLQSPIISGTSQGSGEYFSRVGIGKPPSQAYLILDTGSDVNWVQCAPCAECY  184



>ref|XP_010460347.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=482

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 68/126 (54%), Gaps = 12/126 (10%)
 Frame = +3

Query  177  QPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNA--  350
            Q +  ++  SL LH    +     ++  K+L + RL RD AR K+L      A  + +  
Sbjct  57   QEEQIQSPFSLKLHSRASVRGGVEHSDYKSLTLARLDRDTARVKSLVTRLDLALNNISKA  116

Query  351  ----------TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCS  500
                      T   D  + +ISG  QGSGEYFTR+G+G P +  +MVLDTGSDV WLQCS
Sbjct  117  DLKPVTTMYTTDQEDIEAPLISGTTQGSGEYFTRVGIGNPAREVYMVLDTGSDVNWLQCS  176

Query  501  PCRKCY  518
            PC  CY
Sbjct  177  PCADCY  182



>emb|CDX75968.1| BnaC03g40510D [Brassica napus]
Length=503

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 74/124 (60%), Gaps = 14/124 (11%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + L+L+LH  D +  A  +   K+L + RL+RD++R  A++            +   
Sbjct  78   NSSSPLTLELHSRDTLL-APHHKDYKSLVLSRLERDSSRVAAIAAKVRFSVEGVNRSDLK  136

Query  336  PPHNATRG---RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            P +N        + ++ V+SG +QGSGEYF+R+GVGTP K  +MVLDTGSDV WLQC PC
Sbjct  137  PVYNDETMYNPEELTTPVVSGASQGSGEYFSRIGVGTPAKEMYMVLDTGSDVNWLQCKPC  196

Query  507  RKCY  518
              CY
Sbjct  197  SDCY  200



>ref|XP_004135107.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN52057.1| hypothetical protein Csa_5G608450 [Cucumis sativus]
Length=486

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
             DF S ++SG +QGSGEYF+R+G+G PP   +MVLDTGSDV W+QC+PC +CY
Sbjct  134  EDFESPIVSGASQGSGEYFSRVGIGRPPSPVYMVLDTGSDVSWVQCAPCAECY  186



>ref|XP_009135580.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=499

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 73/124 (59%), Gaps = 14/124 (11%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + L+L+LH  D +  A  +   K+L + RL+RD++R   ++            +   
Sbjct  73   NSSSPLTLELHSRDTLL-APHHKDYKSLVLSRLERDSSRVAGIAAKVRFSVEGVDRSDLK  131

Query  336  PPHNATRG---RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            P +N        + ++ V+SG +QGSGEYF+R+GVGTP K  +MVLDTGSDV WLQC PC
Sbjct  132  PVYNDETMYNPEELTTPVVSGASQGSGEYFSRIGVGTPAKEMYMVLDTGSDVNWLQCKPC  191

Query  507  RKCY  518
              CY
Sbjct  192  SDCY  195



>ref|XP_004172253.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1-like [Cucumis sativus]
Length=486

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
             DF S ++SG +QGSGEYF+R+G+G PP   +MVLDTGSDV W+QC+PC +CY
Sbjct  134  EDFESPIVSGASQGSGEYFSRVGIGRPPSPVYMVLDTGSDVSWVQCAPCAECY  186



>emb|CDX82342.1| BnaA03g34790D [Brassica napus]
Length=499

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 73/124 (59%), Gaps = 14/124 (11%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + L+L+LH  D +  A  +   K+L + RL+RD++R   ++            +   
Sbjct  73   NSSSPLTLELHSRDTLL-APHHKDYKSLVLSRLERDSSRVAGIAAKVRFSVEGVDRSDLK  131

Query  336  PPHNATRG---RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            P +N        + ++ V+SG +QGSGEYF+R+GVGTP K  +MVLDTGSDV WLQC PC
Sbjct  132  PVYNDETMYNPEELTTPVVSGASQGSGEYFSRIGVGTPAKEMYMVLDTGSDVNWLQCKPC  191

Query  507  RKCY  518
              CY
Sbjct  192  SDCY  195



>ref|XP_004150193.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
sativus]
 ref|XP_004170426.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
sativus]
Length=476

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 69/114 (61%), Gaps = 8/114 (7%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAAVNATPK--ALFVKRLQRDaarakalsllaaaaPPHNATR  356
            + S++   L L H D +    +N  P     F +R+ RD+ R  +L  L ++      T 
Sbjct  65   NSSQSQWKLKLFHRDKL---PLNFDPDHPRRFKERISRDSKRVSSLLRLLSSGSDEQVT-  120

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
              DF S V+SG  QGSGEYF R+GVG+PP+  ++V+D+GSD+VW+QC PC +CY
Sbjct  121  --DFGSDVVSGTEQGSGEYFVRIGVGSPPRSQYVVIDSGSDIVWVQCQPCSECY  172



>ref|NP_173922.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAG50814.1|AC079281_16 hypothetical protein [Arabidopsis thaliana]
 gb|AAM20575.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15613.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00436.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE30636.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=483

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +3

Query  351  TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            T  +D  + +ISG  QGSGEYFTR+G+G P +  +MVLDTGSDV WLQC+PC  CY
Sbjct  128  TEEQDIEAPLISGTTQGSGEYFTRVGIGKPAREVYMVLDTGSDVNWLQCTPCADCY  183



>ref|XP_004497116.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cicer 
arietinum]
Length=469

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 59/90 (66%), Gaps = 5/90 (6%)
 Frame = +3

Query  249  NATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLG  428
            +A  K+L + RL RD+AR  ++       P  N  +    S  +ISG +QGSGEYF+R+G
Sbjct  85   HADYKSLTLARLARDSARVNSIVTQLD--PNFNVEK---LSGPIISGTSQGSGEYFSRIG  139

Query  429  VGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            +G PP  A+MVLDTGSD+ W+QC+PC  CY
Sbjct  140  IGEPPSQAYMVLDTGSDISWVQCAPCADCY  169



>ref|XP_008446567.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Cucumis 
melo]
Length=486

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
             DF S ++SG +QGSGEYF+R+G+G PP   +MVLDTGSDV W+QC+PC +CY
Sbjct  134  EDFESPIVSGASQGSGEYFSRVGIGRPPSPVYMVLDTGSDVSWVQCAPCAECY  186



>ref|XP_002979394.1| hypothetical protein SELMODRAFT_53966, partial [Selaginella moellendorffii]
 gb|EFJ19802.1| hypothetical protein SELMODRAFT_53966, partial [Selaginella moellendorffii]
Length=353

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +3

Query  372  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            S +ISG+A GSG+YF R+GVGTP +  +MV DTGSDV WLQCSPCRKCY
Sbjct  1    SPLISGIAGGSGDYFARIGVGTPARSVYMVADTGSDVSWLQCSPCRKCY  49



>ref|XP_003589787.1| Aspartic proteinase nepenthesin-2 [Medicago truncatula]
Length=456

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 70/144 (49%), Gaps = 13/144 (9%)
 Frame = +3

Query  114  PLPTAQHYSLSSKPQYSQTLVQPDDSEN------TLSLDLHHIDLISSAAVNATPKALFV  275
            PL   QH  L+ +   S+T ++P   +N           L H D I+      T K  F+
Sbjct  25   PLSYFQH--LNVENAISETKLKPLKQQNHNTQQPQWKTKLFHRDNINLK--KTTHKTRFI  80

Query  276  KRLQRDaarak---alsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPK  446
             R+ RD  R                        F S V+SG  +GSGEYF R+G+G+P  
Sbjct  81   SRINRDIKRVTFLLNRLNKNTQEQQTTTATEASFGSDVVSGTEEGSGEYFVRIGIGSPAI  140

Query  447  YAFMVLDTGSDVVWLQCSPCRKCY  518
            Y +MV+D+GSD+VW+QC PC +CY
Sbjct  141  YQYMVIDSGSDIVWIQCEPCDQCY  164



>emb|CDP04865.1| unnamed protein product [Coffea canephora]
Length=523

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
             +F + V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC  CY
Sbjct  167  EEFGTEVVSGMEQGSGEYFVRIGVGSPPRNQYMVVDSGSDIVWVQCQPCNLCY  219



>gb|AES60038.2| aspartic protease in GUARD CELL-like protein [Medicago truncatula]
Length=469

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 70/144 (49%), Gaps = 13/144 (9%)
 Frame = +3

Query  114  PLPTAQHYSLSSKPQYSQTLVQPDDSEN------TLSLDLHHIDLISSAAVNATPKALFV  275
            PL   QH  L+ +   S+T ++P   +N           L H D I+      T K  F+
Sbjct  25   PLSYFQH--LNVENAISETKLKPLKQQNHNTQQPQWKTKLFHRDNINLK--KTTHKTRFI  80

Query  276  KRLQRDaarak---alsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPK  446
             R+ RD  R                        F S V+SG  +GSGEYF R+G+G+P  
Sbjct  81   SRINRDIKRVTFLLNRLNKNTQEQQTTTATEASFGSDVVSGTEEGSGEYFVRIGIGSPAI  140

Query  447  YAFMVLDTGSDVVWLQCSPCRKCY  518
            Y +MV+D+GSD+VW+QC PC +CY
Sbjct  141  YQYMVIDSGSDIVWIQCEPCDQCY  164



>dbj|BAK07248.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=500

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 85/153 (56%), Gaps = 21/153 (14%)
 Frame = +3

Query  111  RPLPTAQHYSLSSKPQYSQTLVQPDD-SENTLSLDLHHIDLI-SSAAVNATPKALFVKRL  284
            RPL    H SL+S    +  LV+ +  S   L+L LH  D +      + +  +L + RL
Sbjct  52   RPL---LHQSLASTD--TDALVKEEQRSGGKLALRLHSRDFLPEEQGRHESYSSLVLARL  106

Query  285  QRDaarakalsllaaaaP---------PHNAT-----RGRDFSSSVISGLAQGSGEYFTR  422
            +RD+ARA ALS  A+ A          P NAT        +    V+SG+ QGSGEYF+R
Sbjct  107  RRDSARAAALSARASLAADGISRADLRPANATPVFEASAAEIQGPVVSGVGQGSGEYFSR  166

Query  423  LGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            +GVG P +  +MVLDTGSDV WLQC PC  CYA
Sbjct  167  VGVGRPARQLYMVLDTGSDVTWLQCQPCADCYA  199



>ref|XP_006362549.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
tuberosum]
Length=482

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 66/126 (52%), Gaps = 17/126 (13%)
 Frame = +3

Query  192  ENTLSLDLHHIDLISSAAVNATP----KALFVKRLQRDaarakalsllaa----------  329
            EN +S  L    L S  AV  T      +L + RL+RD+ARAK+L               
Sbjct  56   ENQISSSLLSFQLHSRVAVRGTSHKDYNSLMLARLERDSARAKSLQTRVDLVVQGIGKSD  115

Query  330  ---aaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCS  500
                       +  +    +ISG +QGSGEYF+R+G+G PP   +MVLDTGSDV W+QCS
Sbjct  116  LKPMETEFREIQAEEIEGPIISGTSQGSGEYFSRIGIGHPPSQVYMVLDTGSDVNWVQCS  175

Query  501  PCRKCY  518
            PC  CY
Sbjct  176  PCADCY  181



>ref|XP_006306517.1| hypothetical protein CARUB_v10012516mg [Capsella rubella]
 gb|EOA39415.1| hypothetical protein CARUB_v10012516mg [Capsella rubella]
Length=482

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +3

Query  351  TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            T   D  + +ISG  QGSGEYFTR+G+G P +  +MVLDTGSDV WLQC+PC  CY
Sbjct  127  TEQEDIEAPLISGTTQGSGEYFTRVGIGNPAREVYMVLDTGSDVNWLQCAPCADCY  182



>ref|XP_010688619.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Beta vulgaris 
subsp. vulgaris]
Length=544

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +3

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            F S V+SG+ QGSGEYF R+GVG+P +  +MV+D+GSD+VW+QC PC++CY
Sbjct  189  FGSDVVSGMDQGSGEYFIRIGVGSPQRKQYMVIDSGSDIVWVQCQPCKQCY  239



>ref|XP_010265215.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Nelumbo 
nucifera]
Length=494

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            +D    VISG++QGSGEYF+RLG+G P K  +MV+DTGSDV W+QC+PC  CY
Sbjct  141  KDLEGPVISGMSQGSGEYFSRLGIGVPAKQLYMVIDTGSDVNWVQCAPCTDCY  193



>gb|ABK24255.1| unknown [Picea sitchensis]
 gb|ABR16185.1| unknown [Picea sitchensis]
Length=485

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            DF S V+SG+ QGSGEYF+R+GVG P +   MVLDTGSDV W+QC PC  CY
Sbjct  129  DFQSPVVSGMDQGSGEYFSRIGVGAPRRDQLMVLDTGSDVTWIQCEPCSDCY  180



>ref|XP_009109887.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=482

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 81/153 (53%), Gaps = 26/153 (17%)
 Frame = +3

Query  105  SLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP----KALF  272
            S+R    A  + L+ + + S     P  S  + SL LH     S A+V  T      +L 
Sbjct  41   SIRKTKDASSFRLNQQEEQSH---YPTSS--SFSLQLH-----SRASVRGTEHPDYNSLT  90

Query  273  VKRLQRDaarakalsllaaaaPPHNATRG-----------RDFSSSVISGLAQGSGEYFT  419
            + RL RD+ R K+L+        +N TR             +  + +ISG  QGSGEYFT
Sbjct  91   LARLHRDSTRVKSLTARLNL-AINNITRANLKHTMYTTEQEEIEAPLISGTTQGSGEYFT  149

Query  420  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            R+G+G+P +  +MVLDTGSDV WLQC+PC +CY
Sbjct  150  RVGIGSPAREVYMVLDTGSDVNWLQCAPCAECY  182



>ref|XP_008221090.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Prunus 
mume]
Length=542

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +3

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            F S V+SG+ QGSGEYF R+GVG+PP+  ++V+D+GSD+VW+QC PC +CY
Sbjct  169  FGSEVVSGMEQGSGEYFVRIGVGSPPRSQYIVIDSGSDIVWVQCQPCSQCY  219



>ref|XP_009770623.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=512

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
             +F S VISG+ QGSGEYF R+GVG+P +  +MV+D GSD+VW+QC PC +CY
Sbjct  156  EEFGSEVISGMEQGSGEYFVRIGVGSPVREQYMVIDAGSDIVWVQCQPCTQCY  208



>ref|XP_009398943.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=522

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 85/152 (56%), Gaps = 23/152 (15%)
 Frame = +3

Query  132  HYSLSSKPQYSQTL---VQPDDSENTLSLDLHHIDLI-----SSAAVNATPKALFVKRLQ  287
            H +LS +P  S  L   + P D  + +S+ LH  D +     SSA  +   KAL + RL 
Sbjct  54   HLALSYRPPSSTELPSHLLPYDPSSAISVALHSRDFLPSFVGSSAHGHPDYKALTLARLF  113

Query  288  RDaarakalsllaaaa---------PPHNATRGRDFSS------SVISGLAQGSGEYFTR  422
            RD AR +++++ A  A          P+   +    ++      SVISG + GSGEYF+R
Sbjct  114  RDVARVRSIAVRATLAFGAVADSVLNPNTDVKALQIAAVNSIMGSVISGASMGSGEYFSR  173

Query  423  LGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            +GVG+PPK  +M+LDTGSDV W+QC PC  CY
Sbjct  174  VGVGSPPKPLYMILDTGSDVSWVQCLPCADCY  205



>ref|XP_001757102.1| predicted protein [Physcomitrella patens]
 gb|EDQ77961.1| predicted protein [Physcomitrella patens]
Length=406

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            +DF + V+SGL+ GSGEYF R+ VGTPP+  ++V+DTGSD++WLQC+PC  CY
Sbjct  41   QDFQAPVVSGLSLGSGEYFIRISVGTPPRRMYLVMDTGSDILWLQCAPCVNCY  93



>ref|XP_007227097.1| hypothetical protein PRUPE_ppa025647mg [Prunus persica]
 gb|EMJ28296.1| hypothetical protein PRUPE_ppa025647mg [Prunus persica]
Length=524

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +3

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            F S V+SG+ QGSGEYF R+GVG+PP+  ++V+D+GSD+VW+QC PC +CY
Sbjct  170  FGSEVVSGMEQGSGEYFVRIGVGSPPRSQYIVIDSGSDIVWVQCQPCSQCY  220



>emb|CDM83204.1| unnamed protein product [Triticum aestivum]
Length=492

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +3

Query  390  LAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            LAQGSGEYFT++GVGTP   A MVLDTGSDVVWLQC+PCR+CY
Sbjct  133  LAQGSGEYFTKIGVGTPATPALMVLDTGSDVVWLQCAPCRRCY  175



>ref|XP_010499100.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=482

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +3

Query  351  TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            T   D  + +ISG  QGSGEYFTR+G+G P +  +MVLDTGSDV WLQC+PC  CY
Sbjct  127  TDQEDIEAPLISGTTQGSGEYFTRVGIGNPAREVYMVLDTGSDVNWLQCAPCADCY  182



>emb|CBI27051.3| unnamed protein product [Vitis vinifera]
Length=256

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +3

Query  378  VISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            ++SG +QGSGEYF+R+G+G+PPK+ +MV+DTGSDV W+QC+PC  CY
Sbjct  42   LVSGASQGSGEYFSRVGIGSPPKHVYMVVDTGSDVNWVQCAPCADCY  88



>ref|XP_002511962.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF50631.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=495

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 59/96 (61%), Gaps = 10/96 (10%)
 Frame = +3

Query  261  KALFVKRLQRDaarakalsl----------laaaaPPHNATRGRDFSSSVISGLAQGSGE  410
            KAL + RL RD++R +A++            +   P     + +D S+ V SG +QGSGE
Sbjct  99   KALVLSRLHRDSSRVQAITTRLQLILNGVSKSDLKPLQTEIQPQDLSTPVSSGTSQGSGE  158

Query  411  YFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            YFTR+GVG P K  +MVLDTGSD+ W+QC PC  CY
Sbjct  159  YFTRVGVGNPAKSYYMVLDTGSDINWIQCQPCSDCY  194



>ref|XP_002275164.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Vitis vinifera]
Length=496

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 79/151 (52%), Gaps = 16/151 (11%)
 Frame = +3

Query  111  RPLPTAQHYSLSSKPQYSQ----TLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVK  278
            + L    H S  SKP   +    T   P    ++ SL+LH  +L+   + +   +AL + 
Sbjct  46   KTLDVLSHKSSVSKPSDQRDEKTTSFSPTSLASSFSLELHPRELLHGGS-HKDYRALMLS  104

Query  279  RLQRDaarakalsllaaaaPPHNATRG-----------RDFSSSVISGLAQGSGEYFTRL  425
            RL RD+AR KA++     A                   +DFS+ V SG +QGSGEYF R+
Sbjct  105  RLARDSARVKAINTKLQLAVSGTDKSDLVPMDTEILHPQDFSTPVTSGTSQGSGEYFLRV  164

Query  426  GVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            G+G P K  +MV+DTGSDV WLQC PC  CY
Sbjct  165  GIGRPSKTFYMVIDTGSDVNWLQCKPCDDCY  195



>ref|XP_001759252.1| predicted protein [Physcomitrella patens]
 gb|EDQ75936.1| predicted protein [Physcomitrella patens]
Length=385

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
            +DF + VISGL+ GSGEYF R+ VGTPP+  ++V+DTGSD++WLQC+PC  CY
Sbjct  20   QDFQAPVISGLSLGSGEYFIRVSVGTPPRGMYLVMDTGSDILWLQCAPCVSCY  72



>ref|XP_010916474.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=512

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 78/124 (63%), Gaps = 20/124 (16%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATP---KALFVKRLQRDaarakalsllaaaaPPHNATR-----  356
            L+L+LH  D + ++A +  P   K L + RL+RD+AR K+++   A A  H+  R     
Sbjct  82   LTLELHSRDFLPTSA-HPRPNDYKTLTLDRLRRDSARVKSIAAQLALAA-HSVKRTDLKP  139

Query  357  ---GRDFSSS-------VISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
                ++F++S       ++SG +QGSGEYF+R+G+G PPK  +MVLDTGSDV W+QC PC
Sbjct  140  VAEEKEFAASAESIRGPIVSGTSQGSGEYFSRVGIGNPPKPLYMVLDTGSDVTWVQCQPC  199

Query  507  RKCY  518
              CY
Sbjct  200  ADCY  203



>ref|XP_003565317.2| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brachypodium 
distachyon]
Length=529

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  378  VISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            V+SG+ QGSGEYF+R+G+G+P +  +MVLDTGSDV WLQC+PC  CYA
Sbjct  174  VVSGVGQGSGEYFSRIGIGSPARQLYMVLDTGSDVTWLQCAPCADCYA  221



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564104274800