BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF007E19

Length=516
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP11509.1|  unnamed protein product                              83.6    3e-15   Coffea canephora [robusta coffee]
gb|AAS92623.1|  NADPH:cytochrome P450-reductase                       82.4    8e-15   Centaurium erythraea
ref|XP_002514049.1|  cytochrome P450, putative                        79.0    9e-14   Ricinus communis
ref|XP_007136327.1|  hypothetical protein PHAVU_009G036200g           79.0    1e-13   Phaseolus vulgaris [French bean]
ref|XP_009630023.1|  PREDICTED: NADPH--cytochrome P450 reductase      78.6    1e-13   Nicotiana tomentosiformis
gb|ACF17649.1|  putative cytochrome reductase                         77.8    2e-13   Capsicum annuum
ref|XP_003522768.1|  PREDICTED: NADPH--cytochrome P450 reductase      77.8    2e-13   Glycine max [soybeans]
ref|XP_006338052.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  77.0    4e-13   Solanum tuberosum [potatoes]
ref|XP_004238001.1|  PREDICTED: NADPH--cytochrome P450 reductase      77.0    5e-13   Solanum lycopersicum
emb|CAA81211.1|  NADPH-ferrihemoprotein reductase                     76.6    5e-13   Vicia sativa [spring vetch]
gb|ADI49691.1|  cytochrome P450 reductase                             76.6    6e-13   Withania somnifera [ashwagandha]
ref|XP_004501653.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  76.6    7e-13   
ref|XP_004501654.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  76.3    7e-13   Cicer arietinum [garbanzo]
dbj|BAC41516.1|  NADPH-cytochrome P-450 reductase                     75.5    2e-12   Ophiorrhiza pumila
ref|XP_009786522.1|  PREDICTED: NADPH--cytochrome P450 reductase      75.1    2e-12   Nicotiana sylvestris
pir||A47298  NADPH-ferrihemoprotein reductase (EC 1.6.2.4) - mung...  73.6    6e-12
ref|XP_003602898.1|  NADPH cytochrome P450 reductase                  73.6    6e-12   Medicago truncatula
sp|P37116.1|NCPR_VIGRR  RecName: Full=NADPH--cytochrome P450 redu...  73.6    6e-12   Vigna radiata var. radiata [golden gram]
ref|XP_009791726.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  72.4    2e-11   Nicotiana sylvestris
ref|XP_007018236.1|  NADPH--cytochrome P450 reductase isoform 3       72.4    2e-11   
ref|XP_007018234.1|  P450 reductase 1 isoform 1                       72.0    2e-11   
ref|XP_008219251.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  70.9    5e-11   
ref|XP_008338958.1|  PREDICTED: NADPH--cytochrome P450 reductase      70.5    6e-11   Malus domestica [apple tree]
ref|XP_003526551.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  70.5    6e-11   Glycine max [soybeans]
gb|AAZ39648.1|  cytochrome P450 NADPH-reductase                       68.9    2e-10   Petunia x hybrida [garden petunia]
gb|KDP41487.1|  hypothetical protein JCGZ_15894                       68.6    3e-10   Jatropha curcas
ref|XP_010086660.1|  NADPH--cytochrome P450 reductase                 68.2    4e-10   Morus notabilis
ref|XP_007018237.1|  NADPH--cytochrome P450 reductase isoform 4       67.4    5e-10   
ref|XP_002265859.2|  PREDICTED: NADPH--cytochrome P450 reductase      67.8    6e-10   Vitis vinifera
ref|XP_009376208.1|  PREDICTED: NADPH--cytochrome P450 reductase      67.4    6e-10   Pyrus x bretschneideri [bai li]
ref|XP_010530279.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  67.4    8e-10   Tarenaya hassleriana [spider flower]
ref|XP_004299743.1|  PREDICTED: NADPH--cytochrome P450 reductase      66.2    2e-09   Fragaria vesca subsp. vesca
gb|KDO81196.1|  hypothetical protein CISIN_1g005496mg                 65.1    3e-09   Citrus sinensis [apfelsine]
gb|KDO81197.1|  hypothetical protein CISIN_1g005496mg                 65.1    4e-09   Citrus sinensis [apfelsine]
gb|KDO81193.1|  hypothetical protein CISIN_1g005496mg                 65.1    4e-09   Citrus sinensis [apfelsine]
ref|XP_006472452.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  65.1    4e-09   Citrus sinensis [apfelsine]
gb|KDO81198.1|  hypothetical protein CISIN_1g005496mg                 65.1    4e-09   Citrus sinensis [apfelsine]
ref|XP_007226979.1|  hypothetical protein PRUPE_ppa002280mg           65.1    4e-09   Prunus persica
ref|XP_008219252.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  64.7    5e-09   Prunus mume [ume]
gb|ACF35281.1|  cytochrome P450 reductase-like protein                64.7    5e-09   Nothapodytes nimmoniana
ref|XP_011016946.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...  64.7    5e-09   Populus euphratica
gb|KHN39959.1|  NADPH--cytochrome P450 reductase                      64.7    5e-09   Glycine soja [wild soybean]
ref|NP_001236742.1|  NADPH:P450 reductase                             64.7    5e-09   
ref|XP_006433816.1|  hypothetical protein CICLE_v10000469mg           64.3    7e-09   Citrus clementina [clementine]
ref|XP_010520739.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  63.9    9e-09   Tarenaya hassleriana [spider flower]
gb|KJB58863.1|  hypothetical protein B456_009G229300                  63.2    1e-08   Gossypium raimondii
gb|KJB58865.1|  hypothetical protein B456_009G229300                  63.2    1e-08   Gossypium raimondii
gb|KJB58864.1|  hypothetical protein B456_009G229300                  63.2    2e-08   Gossypium raimondii
gb|ACN54323.1|  NADPH:cytochrome P450 reductase                       62.8    2e-08   Gossypium hirsutum [American cotton]
gb|AHB33949.1|  cytochrome P450 reductase                             62.4    3e-08   Santalum album
gb|AIG15451.1|  NADPH-cytochrome P450 reductase 1                     60.8    8e-08   Azadirachta indica [Indian-lilac]
gb|KHG05124.1|  NADPH--cytochrome P450 reductase                      59.3    3e-07   Gossypium arboreum [tree cotton]
ref|XP_010254555.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  58.9    4e-07   Nelumbo nucifera [Indian lotus]
gb|EYU36460.1|  hypothetical protein MIMGU_mgv1a002296mg              57.4    1e-06   Erythranthe guttata [common monkey flower]
ref|NP_001190823.1|  NADPH--cytochrome P450 reductase 1               57.4    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006413419.1|  hypothetical protein EUTSA_v10024568mg           57.4    1e-06   Eutrema salsugineum [saltwater cress]
ref|XP_002307336.1|  NADPH-cytochrome P450 oxydoreductase isoform...  55.8    4e-06   
ref|XP_010448554.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  54.3    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010433757.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  53.9    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010439016.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  53.9    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_011015338.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  53.9    2e-05   Populus euphratica
ref|XP_009138137.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  53.5    2e-05   Brassica rapa
ref|XP_010692385.1|  PREDICTED: NADPH--cytochrome P450 reductase      53.1    3e-05   Beta vulgaris subsp. vulgaris [field beet]
emb|CAA46814.1|  NADPH-ferrihemoprotein reductase                     53.1    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194183.1|  NADPH--cytochrome P450 reductase 1                  53.1    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007141274.1|  hypothetical protein PHAVU_008G182200g           52.8    3e-05   Phaseolus vulgaris [French bean]
emb|CDY34287.1|  BnaA01g13900D                                        52.4    5e-05   Brassica napus [oilseed rape]
ref|XP_002867662.1|  hypothetical protein ARALYDRAFT_492391           52.4    5e-05   
ref|XP_009138145.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  52.0    6e-05   Brassica rapa
emb|CDY34288.1|  BnaA01g13910D                                        52.0    6e-05   Brassica napus [oilseed rape]
emb|CDY03447.1|  BnaC01g16350D                                        51.2    1e-04   
gb|KJB14707.1|  hypothetical protein B456_002G138900                  50.4    2e-04   Gossypium raimondii
gb|KJB14708.1|  hypothetical protein B456_002G138900                  50.4    2e-04   Gossypium raimondii
ref|XP_010277515.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  49.7    4e-04   Nelumbo nucifera [Indian lotus]
emb|CDX92639.1|  BnaC07g38970D                                        49.7    4e-04   
ref|XP_010277516.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  49.7    4e-04   
emb|CDY70343.1|  BnaCnng67910D                                        49.3    5e-04   Brassica napus [oilseed rape]
emb|CDY11017.1|  BnaA03g46760D                                        48.5    8e-04   Brassica napus [oilseed rape]
ref|XP_009137450.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  48.5    8e-04   Brassica rapa



>emb|CDP11509.1| unnamed protein product [Coffea canephora]
Length=691

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 61/82 (74%), Gaps = 3/82 (4%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDtvvvllttslaviv--GLLVFIWKRSGDRSKEVKPVVVPKAMTA  451
            L+RS+ESALGVSLG D   VLL  + ++    GLLVF+WKRS DRSKE KP+V+ K  T+
Sbjct  7    LIRSIESALGVSLGEDGNQVLLVLTTSLAAIVGLLVFLWKRSSDRSKETKPLVITKLNTS  66

Query  452  DPEEDA-VVDPGKVKVTVFFGT  514
             PEE+   VDP KVKVT+FFGT
Sbjct  67   VPEEEEDDVDPSKVKVTIFFGT  88



>gb|AAS92623.1| NADPH:cytochrome P450-reductase [Centaurium erythraea]
Length=692

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 60/84 (71%), Gaps = 5/84 (6%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDtvvvllttslaviv---GLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVRS+ESALGVSLG D   V++      +    GL+VF+WKRS DRS+E K VVVPK +T
Sbjct  7    LVRSIESALGVSLGEDGDKVVILVLTTSLAVIVGLVVFLWKRSSDRSRETKSVVVPKLVT  66

Query  449  A--DPEEDAVVDPGKVKVTVFFGT  514
            A  + EE+  +DP KVKVTVFFGT
Sbjct  67   ALQEEEEEVDLDPSKVKVTVFFGT  90



>ref|XP_002514049.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF48632.1| cytochrome P450, putative [Ricinus communis]
Length=692

 Score = 79.0 bits (193),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 52/84 (62%), Positives = 65/84 (77%), Gaps = 5/84 (6%)
 Frame = +2

Query  278  LVRSLESALGVSLG----NDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAM  445
            LVR +ES LGV LG    +D+VVV++TTS AVI+GLLVF+WKRS DRSKEV P+VVPK++
Sbjct  8    LVRYIESVLGVELGGSPMSDSVVVIITTSFAVIIGLLVFLWKRSSDRSKEVTPLVVPKSL  67

Query  446  TADPEED-AVVDPGKVKVTVFFGT  514
            +   EED A    GK KVT+F+GT
Sbjct  68   SVKDEEDEAETLAGKTKVTIFYGT  91



>ref|XP_007136327.1| hypothetical protein PHAVU_009G036200g [Phaseolus vulgaris]
 gb|ESW08321.1| hypothetical protein PHAVU_009G036200g [Phaseolus vulgaris]
Length=692

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 67/83 (81%), Gaps = 4/83 (5%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVR++ES LGVSLG+   D+++++ TTS AV++GL+VF+WK+S DRSKEVKPV+VPK + 
Sbjct  7    LVRTVESLLGVSLGDSVSDSLLLIATTSAAVVIGLIVFLWKKSSDRSKEVKPVIVPKDLL  66

Query  449  ADPEEDAV-VDPGKVKVTVFFGT  514
             + E+D V V  GK KVTVFFGT
Sbjct  67   MEEEDDEVDVGAGKTKVTVFFGT  89



>ref|XP_009630023.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana tomentosiformis]
Length=686

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMTADP  457
            LVRS+ESALGVSLG+DTV+VLLTTS AVIVGL+V   KRS DRSKEVKP+V PK++  + 
Sbjct  7    LVRSIESALGVSLGSDTVLVLLTTSFAVIVGLVVLFLKRSSDRSKEVKPIVFPKSLHVES  66

Query  458  EEDAVVDPGKVKVTVFFGT  514
            EE+  ++PGKVKVTVFFGT
Sbjct  67   EEEIELEPGKVKVTVFFGT  85



>gb|ACF17649.1| putative cytochrome reductase [Capsicum annuum]
 gb|AFV95075.1| cytochrome P450 reductase [Capsicum annuum]
Length=686

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMTADP  457
            LVRS+ESA+GVSLG+D V++LLTTS AVIVGL+VF  KRS DRSKEVKPVV PK++  +P
Sbjct  7    LVRSIESAIGVSLGSDAVLMLLTTSFAVIVGLVVFFLKRSSDRSKEVKPVVFPKSLNVEP  66

Query  458  EEDAVVDPGKVKVTVFFGT  514
            EE+  V+PGKVKVTVFFGT
Sbjct  67   EEEIEVEPGKVKVTVFFGT  85



>ref|XP_003522768.1| PREDICTED: NADPH--cytochrome P450 reductase [Glycine max]
 gb|KHN08276.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=691

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 65/82 (79%), Gaps = 3/82 (4%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVR++ES LGVSL +   D+++++ TTS AVI+GLLVF+WK+S DRSKEVKPV+VPK + 
Sbjct  7    LVRAVESLLGVSLADSVSDSLLLIATTSAAVIIGLLVFLWKKSSDRSKEVKPVIVPKGLP  66

Query  449  ADPEEDAVVDPGKVKVTVFFGT  514
             D +++  V  GK KVT+FFGT
Sbjct  67   KDEDDEIDVADGKTKVTIFFGT  88



>ref|XP_006338052.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Solanum tuberosum]
Length=686

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMTADP  457
            L+RS+ESALGVSLG+DTV+VLLTTS AVIVGL+VF  KRS DRSKEVKPVV PK++  +P
Sbjct  7    LLRSIESALGVSLGSDTVLVLLTTSFAVIVGLVVFFLKRSSDRSKEVKPVVFPKSLHVEP  66

Query  458  EEDAVVDPGKVKVTVFFGT  514
            EE+  ++PGKVKVTVFFGT
Sbjct  67   EEETELEPGKVKVTVFFGT  85



>ref|XP_004238001.1| PREDICTED: NADPH--cytochrome P450 reductase [Solanum lycopersicum]
Length=686

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMTADP  457
            L+RS+ESALGVSLG+DTV+VLLTTS AVIVGL+VF  KRS DRSKEVKPVV PK++  +P
Sbjct  7    LLRSIESALGVSLGSDTVLVLLTTSFAVIVGLVVFFLKRSSDRSKEVKPVVFPKSLHVEP  66

Query  458  EEDAVVDPGKVKVTVFFGT  514
            EE+  ++PGKVKVTVFFGT
Sbjct  67   EEETELEPGKVKVTVFFGT  85



>emb|CAA81211.1| NADPH-ferrihemoprotein reductase [Vicia sativa]
Length=692

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 66/82 (80%), Gaps = 3/82 (4%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVR++ESALG+SLG+   D+VV++ TTS AVI+GLLVF+W++S DRS+E++PV+VPK   
Sbjct  8    LVRTIESALGISLGDSVSDSVVIIATTSAAVIIGLLVFLWRKSPDRSRELRPVIVPKFTV  67

Query  449  ADPEEDAVVDPGKVKVTVFFGT  514
               +++  VD GK KVTVF+GT
Sbjct  68   KHEDDEVEVDRGKTKVTVFYGT  89



>gb|ADI49691.1| cytochrome P450 reductase [Withania somnifera]
Length=686

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 53/79 (67%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMTADP  457
            LVRS+ES++GVSLG+D V++LLTTS AVIVGL+VF  KRS D+ KEVKPVV+PK++  +P
Sbjct  7    LVRSIESSIGVSLGSDMVLMLLTTSFAVIVGLVVFFLKRSSDQRKEVKPVVLPKSLHLEP  66

Query  458  EEDAVVDPGKVKVTVFFGT  514
            EE+  ++PGK+KVTVFFGT
Sbjct  67   EEETEIEPGKIKVTVFFGT  85



>ref|XP_004501653.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X1 [Cicer 
arietinum]
Length=700

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 66/82 (80%), Gaps = 3/82 (4%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVR++ES LGVSLG+   D++++++TTS AV++GLLVF+WK+S DRS E+KPV+VPK++ 
Sbjct  8    LVRTIESVLGVSLGDSVSDSLILIVTTSAAVVIGLLVFLWKKSSDRSNELKPVIVPKSLV  67

Query  449  ADPEEDAVVDPGKVKVTVFFGT  514
             + ++D  V  GK KVTV FGT
Sbjct  68   KEEDDDIDVGDGKTKVTVLFGT  89



>ref|XP_004501654.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Cicer 
arietinum]
Length=692

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 66/82 (80%), Gaps = 3/82 (4%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVR++ES LGVSLG+   D++++++TTS AV++GLLVF+WK+S DRS E+KPV+VPK++ 
Sbjct  8    LVRTIESVLGVSLGDSVSDSLILIVTTSAAVVIGLLVFLWKKSSDRSNELKPVIVPKSLV  67

Query  449  ADPEEDAVVDPGKVKVTVFFGT  514
             + ++D  V  GK KVTV FGT
Sbjct  68   KEEDDDIDVGDGKTKVTVLFGT  89



>dbj|BAC41516.1| NADPH-cytochrome P-450 reductase [Ophiorrhiza pumila]
Length=690

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 64/82 (78%), Gaps = 3/82 (4%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDt--vvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT-  448
            L+RS+ESALGVSLG+D   ++++LTTSLAVIVGLL+F+WKRSGDR KE+KPV   +    
Sbjct  7    LIRSIESALGVSLGDDVNQILLVLTTSLAVIVGLLMFLWKRSGDRGKEIKPVGCSQGCAL  66

Query  449  ADPEEDAVVDPGKVKVTVFFGT  514
               EE   VDP KVKVTVFFGT
Sbjct  67   LVEEEKEEVDPTKVKVTVFFGT  88



>ref|XP_009786522.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana sylvestris]
Length=686

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMTADP  457
            LVRS+ESALGVSLG+DTV+VLLTTS AVIVGL+V   KRS DRSKEVKP+V PK++  +P
Sbjct  7    LVRSIESALGVSLGSDTVLVLLTTSFAVIVGLVVLFLKRSSDRSKEVKPIVFPKSLHVEP  66

Query  458  EEDAVVDPGKVKVTVFFGT  514
            EE+  ++PGKVKVTVFFGT
Sbjct  67   EEEIELEPGKVKVTVFFGT  85



>pir||A47298 NADPH-ferrihemoprotein reductase (EC 1.6.2.4) - mung bean
Length=690

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 66/82 (80%), Gaps = 3/82 (4%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVR++ES LGVSLG+   D+++++ TTS AV+VGLLVF+WK+S DRSKEVKPVVVP+ + 
Sbjct  7    LVRAVESFLGVSLGDSVSDSLLLIATTSAAVVVGLLVFLWKKSSDRSKEVKPVVVPRDLM  66

Query  449  ADPEEDAVVDPGKVKVTVFFGT  514
             + EE+  V  GK KVT+FFGT
Sbjct  67   MEEEEEVDVAAGKTKVTIFFGT  88



>ref|XP_003602898.1| NADPH cytochrome P450 reductase [Medicago truncatula]
 gb|AES73149.1| NADPH-cytochrome P450 family 2 reductase [Medicago truncatula]
Length=692

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 69/82 (84%), Gaps = 3/82 (4%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVR++ES LGVSLG+   D+VV+++TTS AVI+GLLVF+WK+S DRSKE+KPV+VPK++ 
Sbjct  8    LVRTIESVLGVSLGDSVSDSVVLIVTTSAAVIIGLLVFLWKKSSDRSKELKPVIVPKSLV  67

Query  449  ADPEEDAVVDPGKVKVTVFFGT  514
             + ++DA +  GK KVTVFFGT
Sbjct  68   KEEDDDADIADGKTKVTVFFGT  89



>sp|P37116.1|NCPR_VIGRR RecName: Full=NADPH--cytochrome P450 reductase; Short=CPR; Short=P450R 
[Vigna radiata var. radiata]
 gb|AAA34240.1| NADPH cytochrome P450 [Vigna radiata]
Length=690

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 66/82 (80%), Gaps = 3/82 (4%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVR++ES LGVSLG+   D+++++ TTS AV+VGLLVF+WK+S DRSKEVKPVVVP+ + 
Sbjct  7    LVRAVESFLGVSLGDSVSDSLLLIATTSAAVVVGLLVFLWKKSSDRSKEVKPVVVPRDLM  66

Query  449  ADPEEDAVVDPGKVKVTVFFGT  514
             + EE+  V  GK KVT+FFGT
Sbjct  67   MEEEEEVDVAAGKTKVTIFFGT  88



>ref|XP_009791726.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Nicotiana sylvestris]
Length=686

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMTADP  457
            LVRS+ES LGVSLG+DTV+VLLT S AVIVGL+V   KRS DRSKEVKP++ PK++  +P
Sbjct  7    LVRSIESELGVSLGSDTVLVLLTMSFAVIVGLVVLFLKRSSDRSKEVKPIMFPKSLHVEP  66

Query  458  EEDAVVDPGKVKVTVFFGT  514
            EE+  ++PGKVKVTVFFGT
Sbjct  67   EEEIELEPGKVKVTVFFGT  85



>ref|XP_007018236.1| NADPH--cytochrome P450 reductase isoform 3 [Theobroma cacao]
 gb|EOY15461.1| NADPH--cytochrome P450 reductase isoform 3 [Theobroma cacao]
Length=736

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 66/85 (78%), Gaps = 6/85 (7%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPK--  439
            LVR +ES LGVSLG    D+++V+ TTSLAVI+GLLVF+WK+S  +RS ++KP+V PK  
Sbjct  7    LVRFVESVLGVSLGGSVTDSMIVIATTSLAVILGLLVFLWKKSASERSHDIKPLVTPKPI  66

Query  440  AMTADPEEDAVVDPGKVKVTVFFGT  514
            ++  D ++DAV+  GK KVT+F+GT
Sbjct  67   SLKDDEDDDAVIAAGKTKVTIFYGT  91



>ref|XP_007018234.1| P450 reductase 1 isoform 1 [Theobroma cacao]
 gb|EOY15459.1| P450 reductase 1 isoform 1 [Theobroma cacao]
Length=693

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 66/85 (78%), Gaps = 6/85 (7%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPK--  439
            LVR +ES LGVSLG    D+++V+ TTSLAVI+GLLVF+WK+S  +RS ++KP+V PK  
Sbjct  7    LVRFVESVLGVSLGGSVTDSMIVIATTSLAVILGLLVFLWKKSASERSHDIKPLVTPKPI  66

Query  440  AMTADPEEDAVVDPGKVKVTVFFGT  514
            ++  D ++DAV+  GK KVT+F+GT
Sbjct  67   SLKDDEDDDAVIAAGKTKVTIFYGT  91



>ref|XP_008219251.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X1 [Prunus 
mume]
Length=728

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 60/83 (72%), Gaps = 4/83 (5%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LV  LESALGVS G    D+VVV+ TTS+A+I+G+LV +W+RS DRS+EVK + VPK + 
Sbjct  7    LVSMLESALGVSFGGSVTDSVVVIATTSVALILGVLVLVWRRSSDRSREVKQLAVPKPLV  66

Query  449  ADPEEDAV-VDPGKVKVTVFFGT  514
               EED   V  GK +VT+F+GT
Sbjct  67   VKDEEDEFEVASGKTRVTIFYGT  89



>ref|XP_008338958.1| PREDICTED: NADPH--cytochrome P450 reductase [Malus domestica]
Length=692

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 65/83 (78%), Gaps = 4/83 (5%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVR+LESALGVS G    DTVVV+ TTS+A+I+G+LV +W+RS DRS+EVK +VVPK + 
Sbjct  7    LVRALESALGVSFGGSVTDTVVVIATTSIALIIGVLVLVWRRSSDRSREVKQLVVPKPLA  66

Query  449  ADPEEDAV-VDPGKVKVTVFFGT  514
             + E+D   V  GK++VT+F+GT
Sbjct  67   VEEEKDEFEVAAGKIRVTIFYGT  89



>ref|XP_003526551.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Glycine max]
 gb|KHN08988.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=691

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 65/82 (79%), Gaps = 3/82 (4%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVR++ES LGVSL +   D+++++ TTS A+I+GLLVF+WK+S DRSKE+KPV+VPK + 
Sbjct  7    LVRAVESLLGVSLADSVSDSLLLIATTSAALIIGLLVFLWKKSSDRSKELKPVIVPKGLP  66

Query  449  ADPEEDAVVDPGKVKVTVFFGT  514
             D +++  V  GK KVT+FFGT
Sbjct  67   KDDDDEVDVADGKTKVTIFFGT  88



>gb|AAZ39648.1| cytochrome P450 NADPH-reductase [Petunia x hybrida]
Length=687

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMTADP  457
            L +S+ESA GVSL  DT++VLLTTS A+IVGL+VF+ KRS DRSKEVKPVV  K++  +P
Sbjct  8    LFKSIESAFGVSLSTDTLIVLLTTSFALIVGLIVFLLKRSSDRSKEVKPVVFTKSLNTEP  67

Query  458  EEDAVVDPGKVKVTVFFGT  514
            EE+  ++PGKVKVTVFFGT
Sbjct  68   EEETELEPGKVKVTVFFGT  86



>gb|KDP41487.1| hypothetical protein JCGZ_15894 [Jatropha curcas]
Length=689

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 64/83 (77%), Gaps = 4/83 (5%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVR +ES LGVSLG    D++++++TTS+AVIVGL VF+ K+S DRSKEVKPVVVPK++T
Sbjct  5    LVRYVESVLGVSLGGSVTDSLLLIVTTSVAVIVGLFVFLLKKSSDRSKEVKPVVVPKSLT  64

Query  449  ADPEE-DAVVDPGKVKVTVFFGT  514
               EE DA    GK +V +F+GT
Sbjct  65   VKKEEDDAEALAGKTRVIIFYGT  87



>ref|XP_010086660.1| NADPH--cytochrome P450 reductase [Morus notabilis]
 gb|EXB22547.1| NADPH--cytochrome P450 reductase [Morus notabilis]
Length=687

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 63/80 (79%), Gaps = 2/80 (3%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMTADP  457
            LVR+LES LGV +  D+V+V+ TT++A+I+GLLV +W+RS DRS+EVKPVVVPK +    
Sbjct  7    LVRTLESLLGVPV-TDSVIVIATTAVALILGLLVLVWRRSSDRSREVKPVVVPKPLLVKD  65

Query  458  EEDAV-VDPGKVKVTVFFGT  514
            E++ V +  GK KVTVF+GT
Sbjct  66   EDNEVELASGKTKVTVFYGT  85



>ref|XP_007018237.1| NADPH--cytochrome P450 reductase isoform 4 [Theobroma cacao]
 gb|EOY15462.1| NADPH--cytochrome P450 reductase isoform 4 [Theobroma cacao]
Length=517

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 66/85 (78%), Gaps = 6/85 (7%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPK--  439
            LVR +ES LGVSLG    D+++V+ TTSLAVI+GLLVF+WK+S  +RS ++KP+V PK  
Sbjct  7    LVRFVESVLGVSLGGSVTDSMIVIATTSLAVILGLLVFLWKKSASERSHDIKPLVTPKPI  66

Query  440  AMTADPEEDAVVDPGKVKVTVFFGT  514
            ++  D ++DAV+  GK KVT+F+GT
Sbjct  67   SLKDDEDDDAVIAAGKTKVTIFYGT  91



>ref|XP_002265859.2| PREDICTED: NADPH--cytochrome P450 reductase [Vitis vinifera]
 emb|CBI19275.3| unnamed protein product [Vitis vinifera]
Length=688

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 45/81 (56%), Positives = 65/81 (80%), Gaps = 3/81 (4%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMTADP  457
            L+ ++E+ LGVSLG+++ VV+LTT++AVI+GLL+F+W+ S DR ++VKP+VVPKA+ A P
Sbjct  7    LINTVEAFLGVSLGSESAVVILTTTVAVILGLLIFVWRISSDRGRDVKPLVVPKAV-AIP  65

Query  458  EEDAVVDP--GKVKVTVFFGT  514
             E+   +   GK KVTVFFGT
Sbjct  66   AEEDEAEAAVGKTKVTVFFGT  86



>ref|XP_009376208.1| PREDICTED: NADPH--cytochrome P450 reductase [Pyrus x bretschneideri]
Length=692

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 62/83 (75%), Gaps = 4/83 (5%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVR+LES LGVS G    DTVVV+ TTS+A+I+G+LV +W+RS DRS+EVK +VVPK + 
Sbjct  7    LVRALESVLGVSFGGSVTDTVVVIATTSIALIIGVLVLVWRRSSDRSREVKQLVVPKPLE  66

Query  449  ADPEEDAV-VDPGKVKVTVFFGT  514
               EED   V  GK +VT+F+GT
Sbjct  67   VKEEEDEFDVAAGKSRVTIFYGT  89



>ref|XP_010530279.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Tarenaya 
hassleriana]
Length=694

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 63/85 (74%), Gaps = 6/85 (7%)
 Frame = +2

Query  278  LVRSLESALGVSLGN----DtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPKA  442
            LVR LESALG+SLG+    D  +V+ TTSLAVIVG  V +W+++  DRS+EVKPVVVPK+
Sbjct  10   LVRYLESALGISLGDSVSDDVALVIATTSLAVIVGFAVLLWRKTATDRSREVKPVVVPKS  69

Query  443  MTADPEEDAV-VDPGKVKVTVFFGT  514
            + A  E+D   +  GK +VT+FFGT
Sbjct  70   LMAKDEDDNFDLGSGKTRVTIFFGT  94



>ref|XP_004299743.1| PREDICTED: NADPH--cytochrome P450 reductase [Fragaria vesca subsp. 
vesca]
Length=689

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 60/83 (72%), Gaps = 4/83 (5%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVR LESALGVS G    DT V++ TTS+A+I+G+LV +W+RS DRS+E K + VPKA+ 
Sbjct  7    LVRKLESALGVSFGESVTDTAVLIATTSIALIIGVLVVLWRRSSDRSREFKQLAVPKAVV  66

Query  449  ADPEEDAV-VDPGKVKVTVFFGT  514
               EED   V  GK +V++F+GT
Sbjct  67   VKEEEDEFEVASGKTRVSIFYGT  89



>gb|KDO81196.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=669

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 5/84 (6%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPKAM  445
            LV+ +ESALGVSLG+   DTV+++ TTS AV++GLLV +WK+S  DRSKEVKPVV  K +
Sbjct  9    LVKFVESALGVSLGDSVTDTVILIATTSFAVVIGLLVLVWKKSSSDRSKEVKPVVPLKPL  68

Query  446  TADPEED-AVVDPGKVKVTVFFGT  514
            +A  E+D A +  GK KVTVF+GT
Sbjct  69   SAKDEDDEADIAAGKTKVTVFYGT  92



>gb|KDO81197.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=635

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 5/84 (6%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPKAM  445
            LV+ +ESALGVSLG+   DTV+++ TTS AV++GLLV +WK+S  DRSKEVKPVV  K +
Sbjct  9    LVKFVESALGVSLGDSVTDTVILIATTSFAVVIGLLVLVWKKSSSDRSKEVKPVVPLKPL  68

Query  446  TADPEED-AVVDPGKVKVTVFFGT  514
            +A  E+D A +  GK KVTVF+GT
Sbjct  69   SAKDEDDEADIAAGKTKVTVFYGT  92



>gb|KDO81193.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=694

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 5/84 (6%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPKAM  445
            LV+ +ESALGVSLG+   DTV+++ TTS AV++GLLV +WK+S  DRSKEVKPVV  K +
Sbjct  9    LVKFVESALGVSLGDSVTDTVILIATTSFAVVIGLLVLVWKKSSSDRSKEVKPVVPLKPL  68

Query  446  TADPEED-AVVDPGKVKVTVFFGT  514
            +A  E+D A +  GK KVTVF+GT
Sbjct  69   SAKDEDDEADIAAGKTKVTVFYGT  92



>ref|XP_006472452.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Citrus sinensis]
Length=694

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 5/84 (6%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPKAM  445
            LV+ +ESALGVSLG+   DTV+++ TTS AV++GLLV +WK+S  DRSKEVKPVV  K +
Sbjct  9    LVKFVESALGVSLGDSVTDTVILIATTSFAVVIGLLVLVWKKSSSDRSKEVKPVVPLKPL  68

Query  446  TADPEED-AVVDPGKVKVTVFFGT  514
            +A  E+D A +  GK KVTVF+GT
Sbjct  69   SAKDEDDEADIAAGKTKVTVFYGT  92



>gb|KDO81198.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=599

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 5/84 (6%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPKAM  445
            LV+ +ESALGVSLG+   DTV+++ TTS AV++GLLV +WK+S  DRSKEVKPVV  K +
Sbjct  9    LVKFVESALGVSLGDSVTDTVILIATTSFAVVIGLLVLVWKKSSSDRSKEVKPVVPLKPL  68

Query  446  TADPEED-AVVDPGKVKVTVFFGT  514
            +A  E+D A +  GK KVTVF+GT
Sbjct  69   SAKDEDDEADIAAGKTKVTVFYGT  92



>ref|XP_007226979.1| hypothetical protein PRUPE_ppa002280mg [Prunus persica]
 gb|EMJ28178.1| hypothetical protein PRUPE_ppa002280mg [Prunus persica]
Length=692

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 60/83 (72%), Gaps = 4/83 (5%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LV  LESALGVS G    D+VVV+ TTS+A+I+G+LV +W+RS DRS+EVK + VPK + 
Sbjct  7    LVSMLESALGVSFGGSVTDSVVVIATTSVALILGVLVLVWRRSSDRSREVKQLAVPKPLV  66

Query  449  ADPEEDAV-VDPGKVKVTVFFGT  514
               EED   V  GK +VT+F+GT
Sbjct  67   VKDEEDEFEVASGKTRVTIFYGT  89



>ref|XP_008219252.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X2 [Prunus 
mume]
Length=692

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 60/83 (72%), Gaps = 4/83 (5%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LV  LESALGVS G    D+VVV+ TTS+A+I+G+LV +W+RS DRS+EVK + VPK + 
Sbjct  7    LVSMLESALGVSFGGSVTDSVVVIATTSVALILGVLVLVWRRSSDRSREVKQLAVPKPLV  66

Query  449  ADPEEDAV-VDPGKVKVTVFFGT  514
               EED   V  GK +VT+F+GT
Sbjct  67   VKDEEDEFEVASGKTRVTIFYGT  89



>gb|ACF35281.1| cytochrome P450 reductase-like protein [Nothapodytes nimmoniana]
Length=692

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 64/84 (76%), Gaps = 5/84 (6%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGDRSKEV-KPVVVPKAM  445
            L+R +ES  GVS G   +DTVV++ TTS+AVI GLLVF+WKRS ++S EV KPVVVPKA+
Sbjct  7    LIRWIESMFGVSFGESVSDTVVLIATTSVAVITGLLVFLWKRSSNQSTEVKKPVVVPKAL  66

Query  446  TADPEEDAVVD-PGKVKVTVFFGT  514
              D EE+ V   PGK KVTVFFGT
Sbjct  67   QLDAEEEEVEVGPGKKKVTVFFGT  90



>ref|XP_011016946.1| PREDICTED: LOW QUALITY PROTEIN: NADPH--cytochrome P450 reductase-like 
[Populus euphratica]
Length=692

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 10/86 (12%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVR +ES LGVS G+   D+VVV++TTS AV+ GL+VFI KRS DRSK VKP+VVPK+++
Sbjct  8    LVRFVESVLGVSFGDSVSDSVVVIITTSFAVVFGLVVFISKRSSDRSKVVKPLVVPKSLS  67

Query  449  ADPEEDAVVDP----GKVKVTVFFGT  514
               EED   +P    GK KVT+F+GT
Sbjct  68   VKDEED---EPEALAGKTKVTIFYGT  90



>gb|KHN39959.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=689

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 62/81 (77%), Gaps = 3/81 (4%)
 Frame = +2

Query  278  LVRSL-ESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMTAD  454
            LVR++ ES LGVS+ +D+V+V+  TS+A+++GLLVF+W++S DRSKE KP+ VPK +  +
Sbjct  7    LVRTVVESVLGVSV-SDSVMVIAATSVALVIGLLVFVWRKSSDRSKEQKPLAVPKLLVKE  65

Query  455  PEEDAV-VDPGKVKVTVFFGT  514
             EED V    GK +V +FFGT
Sbjct  66   DEEDEVDAGSGKTRVAIFFGT  86



>ref|NP_001236742.1| NADPH:P450 reductase [Glycine max]
 gb|AAN85869.1| NADPH:P450 reductase [Glycine max]
Length=689

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 62/81 (77%), Gaps = 3/81 (4%)
 Frame = +2

Query  278  LVRSL-ESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMTAD  454
            LVR++ ES LGVS+ +D+V+V+  TS+A+++GLLVF+W++S DRSKE KP+ VPK +  +
Sbjct  7    LVRTVVESVLGVSV-SDSVMVIAATSVALVIGLLVFVWRKSSDRSKEQKPLAVPKLLVKE  65

Query  455  PEEDAV-VDPGKVKVTVFFGT  514
             EED V    GK +V +FFGT
Sbjct  66   DEEDEVDAGSGKTRVAIFFGT  86



>ref|XP_006433816.1| hypothetical protein CICLE_v10000469mg [Citrus clementina]
 gb|ESR47056.1| hypothetical protein CICLE_v10000469mg [Citrus clementina]
Length=694

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 64/84 (76%), Gaps = 5/84 (6%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPKAM  445
            LV+ +ESALG+SLG+   DTV+++ TTS AV +GLLV +WK+S  DRSKEVKPVV  K +
Sbjct  9    LVKFVESALGLSLGDSVTDTVILIATTSFAVAIGLLVLVWKKSSSDRSKEVKPVVPLKPL  68

Query  446  TADPEED-AVVDPGKVKVTVFFGT  514
            +A  E+D A +  GK KVTVF+GT
Sbjct  69   SAKDEDDEADIAAGKTKVTVFYGT  92



>ref|XP_010520739.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Tarenaya 
hassleriana]
Length=694

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 63/85 (74%), Gaps = 6/85 (7%)
 Frame = +2

Query  278  LVRSLESALGVSLGN----DtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPKA  442
            LVR LESALG+SLG+    D  +V+ TTSLAVIVG  V +W+++  DRS+E+KPV VP++
Sbjct  10   LVRYLESALGISLGDSVSDDAALVIATTSLAVIVGFAVLLWRKTAADRSREMKPVTVPQS  69

Query  443  MTADPEEDAV-VDPGKVKVTVFFGT  514
            + A  E+D + +  GK +VT+FFGT
Sbjct  70   LMAKDEDDDLDMGSGKTRVTIFFGT  94



>gb|KJB58863.1| hypothetical protein B456_009G229300 [Gossypium raimondii]
Length=693

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 65/85 (76%), Gaps = 6/85 (7%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPKAM  445
            LV  +ES LGVSL     D+++V+ TTSLAVI+GLLVF+WK+SG +RS++VKP+V PK +
Sbjct  7    LVGFVESVLGVSLEGSVTDSMIVVATTSLAVILGLLVFLWKKSGSERSRDVKPLVAPKPV  66

Query  446  TADPEED--AVVDPGKVKVTVFFGT  514
            +   EED  AV+  GK KVT+F+GT
Sbjct  67   SLKDEEDDDAVIAAGKTKVTIFYGT  91



>gb|KJB58865.1| hypothetical protein B456_009G229300 [Gossypium raimondii]
Length=694

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 65/85 (76%), Gaps = 6/85 (7%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPKAM  445
            LV  +ES LGVSL     D+++V+ TTSLAVI+GLLVF+WK+SG +RS++VKP+V PK +
Sbjct  7    LVGFVESVLGVSLEGSVTDSMIVVATTSLAVILGLLVFLWKKSGSERSRDVKPLVAPKPV  66

Query  446  TADPEED--AVVDPGKVKVTVFFGT  514
            +   EED  AV+  GK KVT+F+GT
Sbjct  67   SLKDEEDDDAVIAAGKTKVTIFYGT  91



>gb|KJB58864.1| hypothetical protein B456_009G229300 [Gossypium raimondii]
Length=586

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 65/85 (76%), Gaps = 6/85 (7%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPKAM  445
            LV  +ES LGVSL     D+++V+ TTSLAVI+GLLVF+WK+SG +RS++VKP+V PK +
Sbjct  7    LVGFVESVLGVSLEGSVTDSMIVVATTSLAVILGLLVFLWKKSGSERSRDVKPLVAPKPV  66

Query  446  TADPEED--AVVDPGKVKVTVFFGT  514
            +   EED  AV+  GK KVT+F+GT
Sbjct  67   SLKDEEDDDAVIAAGKTKVTIFYGT  91



>gb|ACN54323.1| NADPH:cytochrome P450 reductase [Gossypium hirsutum]
Length=693

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 64/85 (75%), Gaps = 6/85 (7%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPKAM  445
            LV  +ES LGVSL     D+++V+ TTSLAVI+GLLVF WK+SG +RS++VKP+V PK +
Sbjct  7    LVGFVESVLGVSLEGSVTDSMIVIATTSLAVILGLLVFFWKKSGSERSRDVKPLVAPKPV  66

Query  446  TADPEED--AVVDPGKVKVTVFFGT  514
            +   EED  AV+  GK KVT+F+GT
Sbjct  67   SLKDEEDDDAVIAAGKTKVTIFYGT  91



>gb|AHB33949.1| cytochrome P450 reductase [Santalum album]
Length=692

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 59/84 (70%), Gaps = 5/84 (6%)
 Frame = +2

Query  278  LVRSLESALGVS----LGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAM  445
            L +S+ SALGVS       +   V++TTS A+IVG ++F+W+RSG++SKE++PVV  KA 
Sbjct  7    LWKSIGSALGVSPPPAWAEEWAAVIVTTSAALIVGFVMFMWRRSGEKSKELRPVVALKAA  66

Query  446  TADPEE-DAVVDPGKVKVTVFFGT  514
              + EE D  VD GK KVTVFFGT
Sbjct  67   PIEAEEDDGEVDSGKTKVTVFFGT  90



>gb|AIG15451.1| NADPH-cytochrome P450 reductase 1 [Azadirachta indica]
Length=695

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 62/84 (74%), Gaps = 5/84 (6%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKA--  442
            LV+ +ESALGVSLG+   DTV+V+ TT  AV++GLLV  WK+S DRSKEVKPVV  K+  
Sbjct  10   LVKFVESALGVSLGSSVTDTVIVIATTLFAVVIGLLVLAWKKSSDRSKEVKPVVPLKSPV  69

Query  443  MTADPEEDAVVDPGKVKVTVFFGT  514
            +  +  ++A +  GK KVT+F+GT
Sbjct  70   LKKEDHDEADIVWGKTKVTIFYGT  93



>gb|KHG05124.1| NADPH--cytochrome P450 reductase [Gossypium arboreum]
Length=693

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 63/85 (74%), Gaps = 6/85 (7%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPKAM  445
            LV  +ES LGVSL     D+++V+ TTSLAVI+GLL+F WK+SG +RS++VKP+V PK +
Sbjct  7    LVGFVESVLGVSLEGLVTDSMIVIATTSLAVILGLLLFFWKKSGSERSRDVKPLVAPKPV  66

Query  446  TADPEE--DAVVDPGKVKVTVFFGT  514
            +   EE  D V+  GK KVT+F+GT
Sbjct  67   SLKDEEDDDDVIASGKTKVTIFYGT  91



>ref|XP_010254555.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Nelumbo nucifera]
Length=692

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 43/80 (54%), Positives = 58/80 (73%), Gaps = 4/80 (5%)
 Frame = +2

Query  287  SLESALGVSLGN----DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMTAD  454
            SL+S LG+SLG+    D+ +++ TTS+AV+VGL+ FIWKRS    K  KPVVV K  + +
Sbjct  11   SLQSILGISLGSESVSDSFILIFTTSVAVLVGLVFFIWKRSSAPEKPAKPVVVLKPSSLE  70

Query  455  PEEDAVVDPGKVKVTVFFGT  514
             E++  VDPGK KVT+FFGT
Sbjct  71   EEDEVEVDPGKTKVTIFFGT  90



>gb|EYU36460.1| hypothetical protein MIMGU_mgv1a002296mg [Erythranthe guttata]
Length=690

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 64/82 (78%), Gaps = 3/82 (4%)
 Frame = +2

Query  278  LVRS-LESALGVSLGNDtvvvllttslavivGLLVFIWKR-SGDRSKEVKPVVVPKAMT-  448
            LVRS +E  LGV LG++T V++LTTS A+I+GLL+FIWKR SGD SK  KPVVVPK +T 
Sbjct  7    LVRSSVEQVLGVKLGDETAVLVLTTSAALILGLLIFIWKRSSGDLSKAAKPVVVPKLVTL  66

Query  449  ADPEEDAVVDPGKVKVTVFFGT  514
             D EE+  +DP KVKV VFFGT
Sbjct  67   KDDEEEEDLDPDKVKVAVFFGT  88



>ref|NP_001190823.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
 gb|AEE84920.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
Length=688

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 36/82 (44%), Positives = 60/82 (73%), Gaps = 3/82 (4%)
 Frame = +2

Query  278  LVRSLESALGV-SLGNDtvvvllttslavivGLLVFIWKRS-GDRSKEVKPVVVPKAMTA  451
            L + L+S +G  SL +D V+V+ TTSLA++ G +V +WK++  DRS E+KP+++PK++ A
Sbjct  10   LFKQLKSIMGTDSLSDDVVLVIATTSLALVAGFVVLLWKKTTADRSGELKPLMIPKSLMA  69

Query  452  DPEEDAV-VDPGKVKVTVFFGT  514
              E+D + +  GK +V++FFGT
Sbjct  70   KDEDDDLDLGSGKTRVSIFFGT  91



>ref|XP_006413419.1| hypothetical protein EUTSA_v10024568mg [Eutrema salsugineum]
 gb|ESQ54872.1| hypothetical protein EUTSA_v10024568mg [Eutrema salsugineum]
Length=694

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 58/81 (72%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPKAMTAD  454
            L  +L + LG SL +D V+ + TTSLA+ VG  V +WK+S  DRS+E+KP+V+PK++ A 
Sbjct  14   LKSTLTTFLGDSLSDDVVLAIATTSLALAVGFAVLLWKKSASDRSRELKPLVIPKSLMAK  73

Query  455  PEEDAV-VDPGKVKVTVFFGT  514
             E+D V +  GK +V++FFGT
Sbjct  74   DEDDDVDLISGKTRVSIFFGT  94



>ref|XP_002307336.1| NADPH-cytochrome P450 oxydoreductase isoform 1 family protein 
[Populus trichocarpa]
 gb|AAK15259.1|AF302496_1 NADPH-cytochrome P450 oxydoreductase isoform 1 [Populus trichocarpa 
x Populus deltoides]
 gb|EEE94332.1| NADPH-cytochrome P450 oxydoreductase isoform 1 family protein 
[Populus trichocarpa]
Length=692

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 62/83 (75%), Gaps = 4/83 (5%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            L R ++S LG+S G+   D+VVV++TTS A +VGL+V + KRS DRSK+VKP+VVPK+++
Sbjct  8    LARFVQSVLGISFGDSLSDSVVVIITTSFAALVGLVVLVLKRSSDRSKDVKPLVVPKSLS  67

Query  449  ADPEED-AVVDPGKVKVTVFFGT  514
               EED +    GK KVT+F+GT
Sbjct  68   IKDEEDESEALGGKTKVTIFYGT  90



>ref|XP_010448554.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Camelina 
sativa]
Length=691

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  LVRSLESALGV-SLGNDtvvvllttslavivGLLVFIWKRS-GDRSKEVKPVVVPKAMTA  451
            L + L+S +G  S+ +D V+V+ TTSLA++ G +V +W+++  D+++E+KP+V+PK++ A
Sbjct  10   LFKQLKSIIGTDSMSDDVVLVIATTSLALVAGFVVLLWRKTTADQTRELKPMVLPKSLMA  69

Query  452  DPEEDAVVDPGKVKVTVFFGT  514
              ++DA +  GK +V++FFGT
Sbjct  70   KDDDDADLGSGKTRVSIFFGT  90



>ref|XP_010433757.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X1 [Camelina 
sativa]
 ref|XP_010433758.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X2 [Camelina 
sativa]
 ref|XP_010433759.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X3 [Camelina 
sativa]
Length=691

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  LVRSLESALGV-SLGNDtvvvllttslavivGLLVFIWKRS-GDRSKEVKPVVVPKAMTA  451
            L + L+S +G  S+ +D V+V+ TTSLA++ G +V +W+++  D+++E+KP+V+PK++ A
Sbjct  10   LFKQLKSIIGTDSISDDVVLVIATTSLALVAGFVVLLWRKTTADQTRELKPMVLPKSLMA  69

Query  452  DPEEDAVVDPGKVKVTVFFGT  514
              ++DA +  GK +V++FFGT
Sbjct  70   KDDDDADLGSGKTRVSIFFGT  90



>ref|XP_010439016.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Camelina 
sativa]
Length=691

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  LVRSLESALGV-SLGNDtvvvllttslavivGLLVFIWKRS-GDRSKEVKPVVVPKAMTA  451
            L + L+S +G  S+ +D V+V+ TTSLA++ G +V +W+++  D+++E+KP+V+PK++ A
Sbjct  10   LFKQLKSIIGTDSISDDVVLVIATTSLALVAGFVVLLWRKTTADQTRELKPMVLPKSLMA  69

Query  452  DPEEDAVVDPGKVKVTVFFGT  514
              ++DA +  GK +V++FFGT
Sbjct  70   KDDDDADLGSGKTRVSIFFGT  90



>ref|XP_011015338.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
 ref|XP_011015339.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
Length=692

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 64/83 (77%), Gaps = 4/83 (5%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVR +ES LG+S G+   D+VVV++TTS A +VGL+V + KRS DRSK+VKP+VVPK+++
Sbjct  8    LVRFVESLLGISFGDSLSDSVVVIITTSFAALVGLVVLVLKRSSDRSKDVKPLVVPKSVS  67

Query  449  -ADPEEDAVVDPGKVKVTVFFGT  514
              D E+++    GK KVT+F+GT
Sbjct  68   IKDEEDESEALGGKTKVTIFYGT  90



>ref|XP_009138137.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Brassica 
rapa]
Length=694

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 61/85 (72%), Gaps = 8/85 (9%)
 Frame = +2

Query  278  LVRSLESALGVSL----GNDtvvvllttslavivGLLVFIWKRS-GDRSKEVKPVVVPKA  442
            L + L+S LG+SL     +D V+V+ TTSLA+ VG  V +WK++  D+S+EVKP++VPK+
Sbjct  11   LAKQLKSVLGMSLDTPVSDDAVLVIATTSLALAVGFAVLLWKKTTSDQSREVKPLMVPKS  70

Query  443  -MTADPEEDAVVDPGKVKVTVFFGT  514
             MT + EED  +  GK +V++FFGT
Sbjct  71   LMTKEEEED--LGSGKSRVSIFFGT  93



>ref|XP_010692385.1| PREDICTED: NADPH--cytochrome P450 reductase [Beta vulgaris subsp. 
vulgaris]
Length=693

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 5/84 (6%)
 Frame = +2

Query  278  LVRSLESALGVSL----GNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAM  445
            L+ S ES  G+SL    G+   ++LL TS+AVIVGL+  +W+RS D S + K VV PK++
Sbjct  8    LIGSTESVSGLSLDPSSGSSYAILLLWTSIAVIVGLVFVLWRRSNDNSGDSKVVVAPKSL  67

Query  446  TADPEEDAV-VDPGKVKVTVFFGT  514
              +PEED + +  GK KV++FFGT
Sbjct  68   KVEPEEDELEIAAGKTKVSIFFGT  91



>emb|CAA46814.1| NADPH-ferrihemoprotein reductase [Arabidopsis thaliana]
Length=692

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 60/82 (73%), Gaps = 3/82 (4%)
 Frame = +2

Query  278  LVRSLESALGV-SLGNDtvvvllttslavivGLLVFIWKRS-GDRSKEVKPVVVPKAMTA  451
            L + L+S +G  SL +D V+V+ TTSLA++ G +V +WK++  DRS E+KP+++PK++ A
Sbjct  10   LFKQLKSIMGTDSLSDDVVLVIATTSLALVAGFVVLLWKKTTADRSGELKPLMIPKSLMA  69

Query  452  DPEEDAV-VDPGKVKVTVFFGT  514
              E+D + +  GK +V++FFGT
Sbjct  70   KDEDDDLDLGSGKTRVSIFFGT  91



>ref|NP_194183.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
 sp|Q9SB48.1|NCPR1_ARATH RecName: Full=NADPH--cytochrome P450 reductase 1 [Arabidopsis 
thaliana]
 emb|CAA23011.1| NADPH-ferrihemoprotein reductase ATR1 [Arabidopsis thaliana]
 emb|CAB79362.1| NADPH-ferrihemoprotein reductase ATR1 [Arabidopsis thaliana]
 gb|AAK96879.1| NADPH-ferrihemoprotein reductase ATR1 [Arabidopsis thaliana]
 gb|AAP37785.1| At4g24520 [Arabidopsis thaliana]
 gb|AEE84919.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
 gb|AGA15807.1| CPR1 [Expression vector pUDE172]
Length=692

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 60/82 (73%), Gaps = 3/82 (4%)
 Frame = +2

Query  278  LVRSLESALGV-SLGNDtvvvllttslavivGLLVFIWKRS-GDRSKEVKPVVVPKAMTA  451
            L + L+S +G  SL +D V+V+ TTSLA++ G +V +WK++  DRS E+KP+++PK++ A
Sbjct  10   LFKQLKSIMGTDSLSDDVVLVIATTSLALVAGFVVLLWKKTTADRSGELKPLMIPKSLMA  69

Query  452  DPEEDAV-VDPGKVKVTVFFGT  514
              E+D + +  GK +V++FFGT
Sbjct  70   KDEDDDLDLGSGKTRVSIFFGT  91



>ref|XP_007141274.1| hypothetical protein PHAVU_008G182200g [Phaseolus vulgaris]
 gb|ESW13268.1| hypothetical protein PHAVU_008G182200g [Phaseolus vulgaris]
Length=685

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +2

Query  368  GLLVFIWKRSGDRSKEVKPVVVPK-AMTADPEEDAVVDPGKVKVTVFFGT  514
            GLLVF+ K+S DRSKE K + VPK A+  + E++A V  GK +V VFFGT
Sbjct  33   GLLVFVLKKSSDRSKEQKSLAVPKLALRQEEEDEADVGLGKTRVVVFFGT  82



>emb|CDY34287.1| BnaA01g13900D [Brassica napus]
Length=694

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 60/85 (71%), Gaps = 8/85 (9%)
 Frame = +2

Query  278  LVRSLESALGVSL----GNDtvvvllttslavivGLLVFIWKRS-GDRSKEVKPVVVPKA  442
            L + L+S LG+SL     +D V+V+ TTSLA+ VG    +WK++  D+S+EVKP++VPK+
Sbjct  11   LAKQLKSVLGMSLDTPVSDDAVLVIATTSLALAVGFAALLWKKTTSDQSREVKPLMVPKS  70

Query  443  -MTADPEEDAVVDPGKVKVTVFFGT  514
             MT + EED  +  GK +V++FFGT
Sbjct  71   LMTKEEEED--LGSGKSRVSIFFGT  93



>ref|XP_002867662.1| hypothetical protein ARALYDRAFT_492391 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43921.1| hypothetical protein ARALYDRAFT_492391 [Arabidopsis lyrata subsp. 
lyrata]
Length=692

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 61/82 (74%), Gaps = 3/82 (4%)
 Frame = +2

Query  278  LVRSLESALGV-SLGNDtvvvllttslavivGLLVFIWKRS-GDRSKEVKPVVVPKAMTA  451
            L + L+S +G  S+ +D V+V+ TTSLA++ G +V +W+++  DRS+E+KP+++PK++ A
Sbjct  10   LFKQLKSIIGTDSISDDVVLVIATTSLALVAGFVVLLWRKTTADRSQELKPLMIPKSLMA  69

Query  452  DPEEDAV-VDPGKVKVTVFFGT  514
              E+D + +  GK +V++FFGT
Sbjct  70   KDEDDDLDLGSGKTRVSIFFGT  91



>ref|XP_009138145.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Brassica 
rapa]
Length=695

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 57/73 (78%), Gaps = 2/73 (3%)
 Frame = +2

Query  302  LGVSLGNDtvvvllttslavivGLLVFIWKRS-GDRSKEVKPVVVPKAMTA-DPEEDAVV  475
            LG S+ +D V+V+ TTSLA++VG +V +W+++  D+SKE+KP+V+PK++ A D +ED  +
Sbjct  22   LGDSVSDDVVLVIATTSLALVVGFVVLVWRKTTSDQSKELKPLVIPKSLMAKDEDEDVDL  81

Query  476  DPGKVKVTVFFGT  514
              GK +V++FFGT
Sbjct  82   GSGKERVSIFFGT  94



>emb|CDY34288.1| BnaA01g13910D [Brassica napus]
Length=695

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 57/73 (78%), Gaps = 2/73 (3%)
 Frame = +2

Query  302  LGVSLGNDtvvvllttslavivGLLVFIWKRS-GDRSKEVKPVVVPKAMTA-DPEEDAVV  475
            LG S+ +D V+V+ TTSLA++VG +V +W+++  D+SKE+KP+V+PK++ A D +ED  +
Sbjct  22   LGDSVSDDVVLVIATTSLALVVGFVVLVWRKTTSDQSKELKPLVIPKSLMAKDEDEDVDL  81

Query  476  DPGKVKVTVFFGT  514
              GK +V++FFGT
Sbjct  82   GSGKERVSIFFGT  94



>emb|CDY03447.1| BnaC01g16350D [Brassica napus]
Length=695

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +2

Query  302  LGVSLGNDtvvvllttslavivGLLVFIWKRS-GDRSKEVKPVVVPKAMTA--DPEEDAV  472
            LG S+ +D V+V+ TTSLA++VG +V +WK++  D+S+E+KP+V+PK++ A  + EED  
Sbjct  22   LGDSVSDDVVLVIATTSLALVVGFVVLVWKKTTSDQSQELKPLVIPKSLMAKDEDEEDVD  81

Query  473  VDPGKVKVTVFFGT  514
            +  GK +V++FFGT
Sbjct  82   LGSGKERVSIFFGT  95



>gb|KJB14707.1| hypothetical protein B456_002G138900 [Gossypium raimondii]
Length=693

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 39/85 (46%), Positives = 58/85 (68%), Gaps = 6/85 (7%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKR-SGDRSKEVKPVVV--PK  439
            LV  +ES LG+SLG    D+++++ TTSLAVI+  L+F+WK     RS +VK +V   P 
Sbjct  7    LVSFVESVLGMSLGGSVTDSMLMIATTSLAVILVFLIFLWKNLVSQRSPDVKLLVASKPV  66

Query  440  AMTADPEEDAVVDPGKVKVTVFFGT  514
            ++  D ++DA+V  GK KVT+F+GT
Sbjct  67   SLKVDEDDDALVASGKKKVTIFYGT  91



>gb|KJB14708.1| hypothetical protein B456_002G138900 [Gossypium raimondii]
Length=672

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 39/85 (46%), Positives = 58/85 (68%), Gaps = 6/85 (7%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKR-SGDRSKEVKPVVV--PK  439
            LV  +ES LG+SLG    D+++++ TTSLAVI+  L+F+WK     RS +VK +V   P 
Sbjct  7    LVSFVESVLGMSLGGSVTDSMLMIATTSLAVILVFLIFLWKNLVSQRSPDVKLLVASKPV  66

Query  440  AMTADPEEDAVVDPGKVKVTVFFGT  514
            ++  D ++DA+V  GK KVT+F+GT
Sbjct  67   SLKVDEDDDALVASGKKKVTIFYGT  91



>ref|XP_010277515.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X1 [Nelumbo 
nucifera]
Length=691

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 41/83 (49%), Positives = 56/83 (67%), Gaps = 5/83 (6%)
 Frame = +2

Query  278  LVRSLESALGVSLG----NDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAM  445
            +  SL+S LGVSLG    +D+ VV+LTTS AV+V L   +W+RS    K +KPV   K +
Sbjct  8    ITNSLQSILGVSLGYESVSDSFVVVLTTSAAVLVALAFLVWRRSAPE-KPLKPVEALKPV  66

Query  446  TADPEEDAVVDPGKVKVTVFFGT  514
            + + EE+  VDPGK K+T+FFGT
Sbjct  67   SFEEEEEVEVDPGKTKITIFFGT  89



>emb|CDX92639.1| BnaC07g38970D [Brassica napus]
Length=695

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 38/51 (75%), Gaps = 2/51 (4%)
 Frame = +2

Query  368  GLLVFIWKRS-GDRSKEVKPVVVPKAMTADPEEDAV-VDPGKVKVTVFFGT  514
            G +V +W+++  DR +E+KP+++PK++ A  E+D V +  GK +V++FFGT
Sbjct  44   GFVVLLWRKTTSDRGQELKPLMIPKSLMAKDEDDDVDLGSGKERVSIFFGT  94



>ref|XP_010277516.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Nelumbo 
nucifera]
Length=651

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 41/83 (49%), Positives = 56/83 (67%), Gaps = 5/83 (6%)
 Frame = +2

Query  278  LVRSLESALGVSLG----NDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAM  445
            +  SL+S LGVSLG    +D+ VV+LTTS AV+V L   +W+RS    K +KPV   K +
Sbjct  8    ITNSLQSILGVSLGYESVSDSFVVVLTTSAAVLVALAFLVWRRSAPE-KPLKPVEALKPV  66

Query  446  TADPEEDAVVDPGKVKVTVFFGT  514
            + + EE+  VDPGK K+T+FFGT
Sbjct  67   SFEEEEEVEVDPGKTKITIFFGT  89



>emb|CDY70343.1| BnaCnng67910D, partial [Brassica napus]
Length=593

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 57/84 (68%), Gaps = 5/84 (6%)
 Frame = +2

Query  278  LVRSLESALGVSL----GNDtvvvllttslavivGLLVFIWKRS-GDRSKEVKPVVVPKA  442
            L + L+S LG+SL     +D V+V+ TTSLA+ VG    +WK++  D+ +EVKP++VPK+
Sbjct  11   LAKQLKSVLGMSLDTPVSDDVVLVIATTSLALAVGFAALLWKKTTSDQRREVKPLMVPKS  70

Query  443  MTADPEEDAVVDPGKVKVTVFFGT  514
            +    ++D  +  GK +V++FFGT
Sbjct  71   LIMAKDDDVDLGSGKSRVSIFFGT  94



>emb|CDY11017.1| BnaA03g46760D [Brassica napus]
Length=695

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 38/51 (75%), Gaps = 2/51 (4%)
 Frame = +2

Query  368  GLLVFIWKRS-GDRSKEVKPVVVPKAMTADPEEDAV-VDPGKVKVTVFFGT  514
            G +V +W+++  DR +E+KP+++PK++ A  E+D V +  GK +V++FFGT
Sbjct  44   GFVVLLWRKTTSDRGQELKPLMIPKSLMAKDEDDDVDLGSGKTRVSIFFGT  94



>ref|XP_009137450.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X1 [Brassica 
rapa]
Length=695

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 38/51 (75%), Gaps = 2/51 (4%)
 Frame = +2

Query  368  GLLVFIWKRS-GDRSKEVKPVVVPKAMTADPEEDAV-VDPGKVKVTVFFGT  514
            G +V +W+++  DR +E+KP+++PK++ A  E+D V +  GK +V++FFGT
Sbjct  44   GFVVLLWRKTTSDRGQELKPLMIPKSLMAKDEDDDVDLGSGKTRVSIFFGT  94



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552470516325