BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF007D19

Length=428
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009767919.1|  PREDICTED: 60S ribosomal protein L5                197   3e-59   Nicotiana sylvestris
ref|XP_004242456.1|  PREDICTED: 60S ribosomal protein L5                193   6e-58   Solanum lycopersicum
ref|XP_009625828.1|  PREDICTED: 60S ribosomal protein L5                192   2e-57   Nicotiana tomentosiformis
ref|XP_006366807.1|  PREDICTED: 60S ribosomal protein L5-like           191   6e-57   Solanum tuberosum [potatoes]
ref|XP_009611190.1|  PREDICTED: 60S ribosomal protein L5-like           190   1e-56   Nicotiana tomentosiformis
ref|XP_009774634.1|  PREDICTED: 60S ribosomal protein L5-like           190   2e-56   Nicotiana sylvestris
ref|XP_009801702.1|  PREDICTED: 60S ribosomal protein L5-like           189   2e-56   Nicotiana sylvestris
ref|XP_006344345.1|  PREDICTED: 60S ribosomal protein L5-like           188   5e-56   Solanum tuberosum [potatoes]
ref|XP_004246241.1|  PREDICTED: 60S ribosomal protein L5                188   5e-56   Solanum lycopersicum
ref|XP_009626989.1|  PREDICTED: 60S ribosomal protein L5-like           188   7e-56   Nicotiana tomentosiformis
ref|XP_010679028.1|  PREDICTED: 60S ribosomal protein L5                186   6e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001274803.1|  uncharacterized protein LOC102577675               185   1e-54   Solanum tuberosum [potatoes]
gb|AFK41626.1|  unknown                                                 182   2e-54   Lotus japonicus
ref|XP_004240444.1|  PREDICTED: 60S ribosomal protein L5-like           184   2e-54   
ref|XP_009358395.1|  PREDICTED: 60S ribosomal protein L5                184   2e-54   Pyrus x bretschneideri [bai li]
ref|XP_007135299.1|  hypothetical protein PHAVU_010G117700g             184   3e-54   Phaseolus vulgaris [French bean]
gb|AGV54354.1|  60S ribosomal protein L5-like protein                   184   3e-54   Phaseolus vulgaris [French bean]
gb|AHA84189.1|  60S ribosomal protein L5                                184   3e-54   Phaseolus vulgaris [French bean]
ref|XP_007135197.1|  hypothetical protein PHAVU_010G109200g             184   3e-54   Phaseolus vulgaris [French bean]
emb|CBI24704.3|  unnamed protein product                                184   4e-54   Vitis vinifera
ref|XP_006447906.1|  hypothetical protein CICLE_v10016107mg             181   4e-54   
ref|XP_006447904.1|  hypothetical protein CICLE_v10016107mg             182   5e-54   
ref|XP_007203851.1|  hypothetical protein PRUPE_ppa009282m2g            182   6e-54   
emb|CBI38286.3|  unnamed protein product                                179   7e-54   Vitis vinifera
ref|XP_008384135.1|  PREDICTED: 60S ribosomal protein L5-1-like         182   1e-53   Malus domestica [apple tree]
ref|XP_008394277.1|  PREDICTED: 60S ribosomal protein L5-like           182   1e-53   
gb|KDO51034.1|  hypothetical protein CISIN_1g022424mg                   180   1e-53   Citrus sinensis [apfelsine]
gb|KDO51035.1|  hypothetical protein CISIN_1g022424mg                   181   1e-53   Citrus sinensis [apfelsine]
ref|XP_009358396.1|  PREDICTED: 60S ribosomal protein L5-1-like         182   1e-53   Pyrus x bretschneideri [bai li]
ref|XP_009366222.1|  PREDICTED: 60S ribosomal protein L5-1-like         182   1e-53   Pyrus x bretschneideri [bai li]
ref|XP_010927913.1|  PREDICTED: 60S ribosomal protein L5-like iso...    182   1e-53   Elaeis guineensis
ref|XP_010688412.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     182   2e-53   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB71615.1|  hypothetical protein B456_011G133700                    181   2e-53   Gossypium raimondii
ref|XP_004500722.1|  PREDICTED: 60S ribosomal protein L5-like           182   2e-53   Cicer arietinum [garbanzo]
ref|XP_006447905.1|  hypothetical protein CICLE_v10016107mg             182   2e-53   Citrus clementina [clementine]
ref|XP_010551993.1|  PREDICTED: 60S ribosomal protein L5-like           182   2e-53   Tarenaya hassleriana [spider flower]
ref|XP_007160627.1|  hypothetical protein PHAVU_001G003200g             181   3e-53   Phaseolus vulgaris [French bean]
ref|XP_008800755.1|  PREDICTED: 60S ribosomal protein L5-like           181   3e-53   Phoenix dactylifera
gb|KJB71614.1|  hypothetical protein B456_011G133700                    181   3e-53   Gossypium raimondii
ref|XP_008339345.1|  PREDICTED: 60S ribosomal protein L5                181   3e-53   Malus domestica [apple tree]
gb|AFK34395.1|  unknown                                                 181   3e-53   Lotus japonicus
ref|XP_003548576.2|  PREDICTED: 60S ribosomal protein L5-like           182   4e-53   Glycine max [soybeans]
ref|XP_010273742.1|  PREDICTED: 60S ribosomal protein L5-like           181   4e-53   Nelumbo nucifera [Indian lotus]
ref|XP_008243040.1|  PREDICTED: 60S ribosomal protein L5                181   4e-53   Prunus mume [ume]
ref|XP_008791818.1|  PREDICTED: 60S ribosomal protein L5-like           181   4e-53   Phoenix dactylifera
gb|AFK46994.1|  unknown                                                 181   5e-53   Lotus japonicus
gb|AFK36106.1|  unknown                                                 181   5e-53   Lotus japonicus
gb|AGV54527.1|  60S ribosomal protein L5-like protein                   181   5e-53   Phaseolus vulgaris [French bean]
gb|KHG14330.1|  60S ribosomal L5                                        179   5e-53   Gossypium arboreum [tree cotton]
gb|ADR71226.1|  60S ribosomal protein L5B                               180   6e-53   Hevea brasiliensis [jebe]
gb|KJB22673.1|  hypothetical protein B456_004G060400                    177   7e-53   Gossypium raimondii
gb|KDO45958.1|  hypothetical protein CISIN_1g0225141mg                  179   7e-53   Citrus sinensis [apfelsine]
ref|XP_008394279.1|  PREDICTED: 60S ribosomal protein L5-like           180   7e-53   
gb|KJB22670.1|  hypothetical protein B456_004G060400                    176   8e-53   Gossypium raimondii
gb|ADR71225.1|  60S ribosomal protein L5A                               180   8e-53   Hevea brasiliensis [jebe]
ref|XP_006469375.1|  PREDICTED: 60S ribosomal protein L5-like           180   8e-53   Citrus sinensis [apfelsine]
ref|XP_009420140.1|  PREDICTED: 60S ribosomal protein L5-like           180   8e-53   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO51033.1|  hypothetical protein CISIN_1g022424mg                   179   8e-53   Citrus sinensis [apfelsine]
gb|KDO51032.1|  hypothetical protein CISIN_1g022424mg                   180   9e-53   Citrus sinensis [apfelsine]
ref|XP_008445491.1|  PREDICTED: 60S ribosomal protein L5-like           180   1e-52   Cucumis melo [Oriental melon]
ref|XP_008367742.1|  PREDICTED: 60S ribosomal protein L5-like           180   1e-52   
ref|XP_008361660.1|  PREDICTED: 60S ribosomal protein L5                180   1e-52   
ref|XP_010532933.1|  PREDICTED: 60S ribosomal protein L5-2              180   1e-52   Tarenaya hassleriana [spider flower]
ref|XP_004287154.1|  PREDICTED: 60S ribosomal protein L5                179   1e-52   Fragaria vesca subsp. vesca
ref|XP_003528812.1|  PREDICTED: 60S ribosomal protein L5-like iso...    179   1e-52   Glycine max [soybeans]
gb|KDO45957.1|  hypothetical protein CISIN_1g0225141mg                  179   1e-52   Citrus sinensis [apfelsine]
ref|XP_006492784.1|  PREDICTED: 60S ribosomal protein L5-like           179   1e-52   Citrus sinensis [apfelsine]
ref|XP_010547178.1|  PREDICTED: 60S ribosomal protein L5-2-like         179   1e-52   Tarenaya hassleriana [spider flower]
gb|KDO45956.1|  hypothetical protein CISIN_1g0225141mg                  178   1e-52   Citrus sinensis [apfelsine]
gb|KHN15970.1|  60S ribosomal protein L5                                179   2e-52   Glycine soja [wild soybean]
ref|XP_011002862.1|  PREDICTED: 60S ribosomal protein L5                179   2e-52   Populus euphratica
ref|XP_010927912.1|  PREDICTED: 60S ribosomal protein L5-like iso...    179   2e-52   
ref|XP_010688411.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     179   2e-52   
ref|XP_009416026.1|  PREDICTED: 60S ribosomal protein L5-like           179   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011037361.1|  PREDICTED: 60S ribosomal protein L5-like           179   2e-52   Populus euphratica
gb|KHN36792.1|  60S ribosomal protein L5                                179   2e-52   Glycine soja [wild soybean]
ref|XP_006594790.1|  PREDICTED: 60S ribosomal protein L5-like           179   2e-52   Glycine max [soybeans]
ref|XP_003543258.1|  PREDICTED: 60S ribosomal protein L5-like           179   2e-52   Glycine max [soybeans]
ref|XP_011073988.1|  PREDICTED: 60S ribosomal protein L5-like           179   2e-52   Sesamum indicum [beniseed]
ref|XP_010069235.1|  PREDICTED: 60S ribosomal protein L5                179   2e-52   Eucalyptus grandis [rose gum]
ref|XP_002524859.1|  ribosomal protein L5, putative                     179   2e-52   Ricinus communis
gb|KJB22672.1|  hypothetical protein B456_004G060400                    176   2e-52   Gossypium raimondii
ref|XP_010650723.1|  PREDICTED: 60S ribosomal protein L5                179   3e-52   Vitis vinifera
ref|XP_006371546.1|  hypothetical protein POPTR_0019s13040g             179   3e-52   Populus trichocarpa [western balsam poplar]
gb|KDP35145.1|  hypothetical protein JCGZ_10679                         179   3e-52   Jatropha curcas
gb|KJB22671.1|  hypothetical protein B456_004G060400                    176   3e-52   Gossypium raimondii
ref|XP_006442191.1|  hypothetical protein CICLE_v10020582mg             181   3e-52   
ref|XP_011089578.1|  PREDICTED: 60S ribosomal protein L5-like           178   4e-52   Sesamum indicum [beniseed]
ref|XP_004144191.1|  PREDICTED: 60S ribosomal protein L5-like           178   4e-52   Cucumis sativus [cucumbers]
ref|XP_011091526.1|  PREDICTED: 60S ribosomal protein L5                179   5e-52   Sesamum indicum [beniseed]
gb|KJB27799.1|  hypothetical protein B456_005G010200                    178   5e-52   Gossypium raimondii
ref|XP_010557737.1|  PREDICTED: 60S ribosomal protein L5-1-like         178   5e-52   Tarenaya hassleriana [spider flower]
ref|XP_008224357.1|  PREDICTED: 60S ribosomal protein L5-2-like         178   5e-52   Prunus mume [ume]
gb|ABK93902.1|  unknown                                                 178   5e-52   Populus trichocarpa [western balsam poplar]
ref|XP_008446013.1|  PREDICTED: 60S ribosomal protein L5                178   6e-52   Cucumis melo [Oriental melon]
gb|KJB27798.1|  hypothetical protein B456_005G010200                    178   6e-52   Gossypium raimondii
gb|ABK95722.1|  unknown                                                 178   6e-52   Populus trichocarpa [western balsam poplar]
ref|XP_010542064.1|  PREDICTED: 60S ribosomal protein L5-1-like         178   6e-52   Tarenaya hassleriana [spider flower]
gb|KHG15135.1|  60S ribosomal L5                                        177   6e-52   Gossypium arboreum [tree cotton]
ref|XP_007223197.1|  hypothetical protein PRUPE_ppa009300mg             177   7e-52   Prunus persica
ref|XP_007033700.1|  Ribosomal protein L5 B isoform 1                   177   7e-52   
ref|XP_003528810.1|  PREDICTED: 60S ribosomal protein L5-like           177   9e-52   Glycine max [soybeans]
ref|XP_007049513.1|  Ribosomal protein L5 B isoform 1                   179   1e-51   
gb|KJB22668.1|  hypothetical protein B456_004G060400                    177   1e-51   Gossypium raimondii
ref|XP_004296367.1|  PREDICTED: 60S ribosomal protein L5-like           177   1e-51   Fragaria vesca subsp. vesca
gb|ACU23594.1|  unknown                                                 177   1e-51   Glycine max [soybeans]
ref|XP_004510723.1|  PREDICTED: 60S ribosomal protein L5-like           177   1e-51   Cicer arietinum [garbanzo]
tpg|DAA56365.1|  TPA: hypothetical protein ZEAMMB73_635593              172   1e-51   
gb|KHG10378.1|  60S ribosomal protein L5                                176   1e-51   Gossypium arboreum [tree cotton]
ref|XP_008807248.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    177   2e-51   Phoenix dactylifera
ref|XP_009410739.1|  PREDICTED: 60S ribosomal protein L5                177   2e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006583256.1|  PREDICTED: 60S ribosomal protein L5-like iso...    177   2e-51   
gb|ACJ85054.1|  unknown                                                 176   3e-51   Medicago truncatula
gb|KHG04393.1|  60S ribosomal L5                                        175   3e-51   Gossypium arboreum [tree cotton]
gb|AFK41086.1|  unknown                                                 176   3e-51   Medicago truncatula
ref|NP_001267659.1|  60S ribosomal protein L5                           176   3e-51   Cucumis sativus [cucumbers]
ref|XP_007049514.1|  Ribosomal protein L5 B isoform 2                   176   5e-51   
emb|CDP17898.1|  unnamed protein product                                177   6e-51   Coffea canephora [robusta coffee]
emb|CDP18434.1|  unnamed protein product                                176   9e-51   Coffea canephora [robusta coffee]
ref|XP_002456780.1|  hypothetical protein SORBIDRAFT_03g042604          175   1e-50   
ref|XP_010646096.1|  PREDICTED: 60S ribosomal protein L5-like           174   1e-50   
gb|KFK38215.1|  hypothetical protein AALP_AA3G083700                    175   1e-50   Arabis alpina [alpine rockcress]
gb|KJB84072.1|  hypothetical protein B456_N001600                       174   1e-50   Gossypium raimondii
gb|KHG10377.1|  60S ribosomal protein L5                                173   1e-50   Gossypium arboreum [tree cotton]
gb|KDP45189.1|  hypothetical protein JCGZ_15054                         174   1e-50   Jatropha curcas
ref|XP_008807247.1|  PREDICTED: 60S ribosomal protein L5-like iso...    174   2e-50   
gb|KFK38214.1|  hypothetical protein AALP_AA3G083600                    174   2e-50   Arabis alpina [alpine rockcress]
ref|XP_002465922.1|  hypothetical protein SORBIDRAFT_01g048270          174   2e-50   Sorghum bicolor [broomcorn]
ref|XP_004970894.1|  PREDICTED: 60S ribosomal protein L5-1-like         174   2e-50   Setaria italica
gb|KCW57514.1|  hypothetical protein EUGRSUZ_H00286                     176   2e-50   Eucalyptus grandis [rose gum]
gb|AFW84310.1|  hypothetical protein ZEAMMB73_937605                    172   3e-50   
gb|ABK93596.1|  unknown                                                 173   3e-50   Populus trichocarpa [western balsam poplar]
ref|XP_002321226.2|  hypothetical protein POPTR_0014s17230g             173   3e-50   Populus trichocarpa [western balsam poplar]
ref|XP_007033701.1|  Ribosomal protein L5 B isoform 2                   173   4e-50   
gb|KJB10809.1|  hypothetical protein B456_001G226000                    171   5e-50   Gossypium raimondii
gb|AFK39593.1|  unknown                                                 173   5e-50   Lotus japonicus
gb|EYU46086.1|  hypothetical protein MIMGU_mgv1a010702mg                173   5e-50   Erythranthe guttata [common monkey flower]
gb|AFW84311.1|  hypothetical protein ZEAMMB73_937605                    172   6e-50   
ref|XP_010450776.1|  PREDICTED: 60S ribosomal protein L5-1-like         172   7e-50   Camelina sativa [gold-of-pleasure]
ref|XP_003579707.1|  PREDICTED: 60S ribosomal protein L5-1              172   8e-50   Brachypodium distachyon [annual false brome]
ref|XP_003561801.1|  PREDICTED: 60S ribosomal protein L5-1-like         172   9e-50   Brachypodium distachyon [annual false brome]
ref|XP_009151634.1|  PREDICTED: 60S ribosomal protein L5-2-like i...    172   9e-50   Brassica rapa
ref|XP_008674702.1|  PREDICTED: 60S ribosomal protein L5-1              172   9e-50   Zea mays [maize]
ref|XP_011006737.1|  PREDICTED: 60S ribosomal protein L5-like           172   1e-49   Populus euphratica
ref|XP_010264793.1|  PREDICTED: 60S ribosomal protein L5-like           172   1e-49   Nelumbo nucifera [Indian lotus]
ref|NP_001151284.1|  60S ribosomal protein L5-1                         172   1e-49   Zea mays [maize]
gb|ACR38045.1|  unknown                                                 172   1e-49   Zea mays [maize]
gb|EYU46087.1|  hypothetical protein MIMGU_mgv11b008897mg               172   1e-49   Erythranthe guttata [common monkey flower]
ref|NP_198790.1|  60S ribosomal protein L5-2                            171   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010435855.1|  PREDICTED: 60S ribosomal protein L5-1 isofor...    171   2e-49   Camelina sativa [gold-of-pleasure]
gb|KCW46049.1|  hypothetical protein EUGRSUZ_L00023                     171   2e-49   Eucalyptus grandis [rose gum]
ref|XP_010441086.1|  PREDICTED: 60S ribosomal protein L5-1-like         171   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_008650733.1|  PREDICTED: 60S ribosomal protein L5-1-like         171   2e-49   Zea mays [maize]
gb|ACG36552.1|  60S ribosomal protein L5-1                              171   2e-49   Zea mays [maize]
ref|XP_003577351.1|  PREDICTED: 60S ribosomal protein L5-1-like         171   3e-49   Brachypodium distachyon [annual false brome]
ref|XP_006418614.1|  hypothetical protein EUTSA_v10002621mg             171   3e-49   Eutrema salsugineum [saltwater cress]
gb|KCW46050.1|  hypothetical protein EUGRSUZ_L00023                     171   3e-49   Eucalyptus grandis [rose gum]
gb|KJB10810.1|  hypothetical protein B456_001G226000                    171   3e-49   Gossypium raimondii
ref|NP_566767.1|  60S ribosomal protein L5-1                            171   3e-49   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64753.1|  ribosomal protein, putative                             171   3e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006284123.1|  hypothetical protein CARUB_v10005255mg             171   3e-49   
ref|XP_002870764.1|  hypothetical protein ARALYDRAFT_916328             171   3e-49   Arabidopsis lyrata subsp. lyrata
emb|CDX86312.1|  BnaA06g30290D                                          171   4e-49   
ref|XP_009151633.1|  PREDICTED: 60S ribosomal protein L5-2-like i...    171   4e-49   
dbj|BAJ89012.1|  predicted protein                                      170   5e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AEV92989.1|  60S ribosomal protein L5                                170   6e-49   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001172693.1|  Os01g0896620                                       165   6e-49   
ref|XP_009136123.1|  PREDICTED: 60S ribosomal protein L5-1-like         170   7e-49   Brassica rapa
ref|XP_009102410.1|  PREDICTED: 60S ribosomal protein L5-1              170   7e-49   
emb|CDY52294.1|  BnaA03g57870D                                          171   8e-49   Brassica napus [oilseed rape]
ref|XP_004968269.1|  PREDICTED: 60S ribosomal protein L5-1-like         169   1e-48   
ref|XP_006296719.1|  hypothetical protein CARUB_v10014269mg             169   2e-48   Capsella rubella
gb|KHN27258.1|  60S ribosomal protein L5                                169   2e-48   Glycine soja [wild soybean]
ref|XP_006284122.1|  hypothetical protein CARUB_v10005255mg             168   3e-48   Capsella rubella
ref|XP_002524558.1|  ribosomal protein L5, putative                     168   3e-48   Ricinus communis
ref|XP_010488654.1|  PREDICTED: 60S ribosomal protein L5-1-like         168   3e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010514215.1|  PREDICTED: 60S ribosomal protein L5-1-like         168   3e-48   Camelina sativa [gold-of-pleasure]
ref|XP_002885727.1|  hypothetical protein ARALYDRAFT_480054             168   5e-48   
gb|KHN36791.1|  60S ribosomal protein L5                                166   5e-48   Glycine soja [wild soybean]
gb|ABK21084.1|  unknown                                                 167   6e-48   Picea sitchensis
ref|XP_010039360.1|  PREDICTED: 60S ribosomal protein L5-like           169   7e-48   
emb|CDY27889.1|  BnaA07g04790D                                          167   8e-48   Brassica napus [oilseed rape]
gb|EPS64989.1|  hypothetical protein M569_09790                         164   8e-48   Genlisea aurea
emb|CDY15089.1|  BnaC03g44500D                                          168   8e-48   Brassica napus [oilseed rape]
ref|XP_006282684.1|  hypothetical protein CARUB_v10005363mg             167   8e-48   Capsella rubella
emb|CDY50258.1|  BnaC07g47930D                                          167   8e-48   Brassica napus [oilseed rape]
emb|CDY52293.1|  BnaA03g57860D                                          168   9e-48   Brassica napus [oilseed rape]
emb|CDY15088.1|  BnaC03g44490D                                          168   9e-48   Brassica napus [oilseed rape]
ref|XP_009136122.1|  PREDICTED: 60S ribosomal protein L5-1-like         167   1e-47   Brassica rapa
ref|XP_006647221.1|  PREDICTED: 60S ribosomal protein L5-1-like         167   1e-47   Oryza brachyantha
emb|CDX85331.1|  BnaC07g26420D                                          169   1e-47   
ref|XP_010466965.1|  PREDICTED: 60S ribosomal protein L5-1-like         166   1e-47   Camelina sativa [gold-of-pleasure]
dbj|BAD82173.1|  putative ribosomal protein L5                          166   2e-47   Oryza sativa Japonica Group [Japonica rice]
gb|KJB22669.1|  hypothetical protein B456_004G060400                    166   2e-47   Gossypium raimondii
ref|NP_001045083.1|  Os01g0896800                                       166   3e-47   
ref|XP_006395196.1|  hypothetical protein EUTSA_v10004670mg             165   7e-47   Eutrema salsugineum [saltwater cress]
sp|A2WXX3.2|RL51_ORYSI  RecName: Full=60S ribosomal protein L5-1        165   7e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_006858792.1|  hypothetical protein AMTR_s00066p00162800          165   7e-47   
ref|XP_002876523.1|  predicted protein                                  164   1e-46   Arabidopsis lyrata subsp. lyrata
ref|XP_006645164.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    164   1e-46   
ref|XP_006645165.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    164   1e-46   Oryza brachyantha
ref|XP_010101365.1|  60S ribosomal protein L5                           164   2e-46   
gb|KJB84073.1|  hypothetical protein B456_N001600                       163   3e-46   Gossypium raimondii
gb|EPS61271.1|  hypothetical protein M569_13526                         158   7e-45   Genlisea aurea
gb|AES74307.2|  60S ribosomal protein L5-2                              159   7e-45   Medicago truncatula
ref|XP_010930276.1|  PREDICTED: 60S ribosomal protein L5                159   1e-44   Elaeis guineensis
ref|XP_003604056.1|  60S ribosomal protein L5                           159   1e-44   
ref|XP_010912766.1|  PREDICTED: 60S ribosomal protein L5-like           159   2e-44   Elaeis guineensis
gb|EMT04099.1|  60S ribosomal protein L5-2                              158   2e-44   
gb|EMT23062.1|  60S ribosomal protein L5-2                              157   4e-44   
ref|XP_010258446.1|  PREDICTED: 60S ribosomal protein L5                157   7e-44   Nelumbo nucifera [Indian lotus]
gb|EMT20601.1|  60S ribosomal protein L5-2                              157   7e-44   
gb|EMS59984.1|  60S ribosomal protein L5-2                              156   2e-43   Triticum urartu
ref|XP_001783620.1|  predicted protein                                  155   2e-43   
ref|XP_001783411.1|  predicted protein                                  155   4e-43   
sp|Q8L4L4.1|RL52_ORYSJ  RecName: Full=60S ribosomal protein L5-2        154   6e-43   
ref|XP_001767871.1|  predicted protein                                  154   6e-43   
ref|XP_001759628.1|  predicted protein                                  154   1e-42   
dbj|BAC06273.1|  putative 60S ribosomal protein L5                      154   1e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002967840.1|  hypothetical protein SELMODRAFT_144921             152   7e-42   Selaginella moellendorffii
ref|XP_006376458.1|  hypothetical protein POPTR_0013s13220g             151   8e-42   
ref|XP_002981679.1|  hypothetical protein SELMODRAFT_154687             151   9e-42   Selaginella moellendorffii
gb|AFW84312.1|  hypothetical protein ZEAMMB73_937605                    148   2e-41   
gb|ACN25149.1|  ribosomal-like protein                                  148   1e-40   Pectinaria gouldii
dbj|BAJ07363.1|  Tt5 protein                                            144   3e-40   Hydatigera taeniaeformis
ref|XP_005345167.1|  PREDICTED: 60S ribosomal protein L5-like           141   1e-39   Microtus ochrogaster [prairie voles]
ref|XP_005107604.1|  PREDICTED: 60S ribosomal protein L5-like           145   2e-39   Aplysia californica
ref|XP_005889093.1|  PREDICTED: 60S ribosomal protein L5-like           140   4e-39   Bos mutus
gb|ACO09732.1|  60S ribosomal protein L5                                141   4e-39   Osmerus mordax
ref|XP_010948703.1|  PREDICTED: 60S ribosomal protein L5                145   5e-39   Camelus bactrianus [camel]
gb|ACI70102.1|  60S ribosomal protein L5                                140   5e-39   Salmo salar
gb|AAM33437.1|  ribosomal protein L5                                    141   8e-39   Branchiostoma belcheri tsingtauense
gb|ABN14903.1|  60S ribosomal protein L5A                               140   9e-39   Taenia asiatica [Asian tapeworm]
ref|XP_005359733.1|  PREDICTED: 60S ribosomal protein L5                142   9e-39   Microtus ochrogaster [prairie voles]
ref|XP_008152973.1|  PREDICTED: 60S ribosomal protein L5                145   1e-38   
gb|ACJ61702.1|  ribosomal protein L5                                    138   1e-38   Artemia franciscana
emb|CDI98331.1|  ribosomal protein l5                                   143   1e-38   Echinococcus multilocularis
emb|CDS19989.1|  ribosomal protein l5                                   143   1e-38   Echinococcus granulosus
gb|AFU54189.1|  ribosomal protein L5                                    139   1e-38   Haliotis discus hannai [ezo abalone]
ref|XP_010973953.1|  PREDICTED: 60S ribosomal protein L5                145   1e-38   Camelus dromedarius [camel]
ref|XP_008049787.1|  PREDICTED: 60S ribosomal protein L5                140   2e-38   Carlito syrichta
ref|XP_011283311.1|  PREDICTED: 60S ribosomal protein L5                144   2e-38   
gb|AAO25760.1|  ribosomal protein L5b                                   140   2e-38   Ictalurus punctatus
ref|XP_005969822.1|  PREDICTED: 60S ribosomal protein L5-like           141   3e-38   Pantholops hodgsonii [Tibetan antelope]
ref|XP_007073490.1|  PREDICTED: 60S ribosomal protein L5-like           145   3e-38   
gb|ABO26701.1|  ribosomal protein l5                                    141   3e-38   Haliotis discus discus
ref|XP_011442103.1|  PREDICTED: 60S ribosomal protein L5-like           139   3e-38   Crassostrea gigas
emb|CCQ18634.1|  60S ribosomal protein L5                               142   5e-38   Sycon ciliatum
ref|XP_006197385.1|  PREDICTED: 60S ribosomal protein L5                141   5e-38   Vicugna pacos
ref|XP_008334234.1|  PREDICTED: 60S ribosomal protein L5                142   6e-38   
gb|EPZ34992.1|  60S ribosomal protein L5                                141   6e-38   Rozella allomycis CSF55
emb|CBX33183.1|  ribosomal protein L5                                   141   6e-38   Plecoglossus altivelis
gb|ADO28300.1|  60S ribosomal protein l5                                141   7e-38   Ictalurus furcatus
gb|ACO09827.1|  60S ribosomal protein L5                                141   7e-38   Osmerus mordax
ref|NP_001187035.1|  ribosomal protein L5a                              141   7e-38   Ictalurus punctatus
ref|XP_001634531.1|  predicted protein                                  141   7e-38   Nematostella vectensis
ref|XP_007533339.1|  PREDICTED: 60S ribosomal protein L5                141   7e-38   Erinaceus europaeus [common hedgehog]
ref|XP_005542775.1|  PREDICTED: 60S ribosomal protein L5 isoform X3     141   7e-38   Macaca fascicularis [crab eating macaque]
gb|ADO29334.1|  60S ribosomal protein l5                                141   7e-38   Ictalurus punctatus
ref|NP_000960.2|  60S ribosomal protein L5                              141   8e-38   Homo sapiens [man]
dbj|BAD96324.1|  ribosomal protein L5 variant                           141   8e-38   Homo sapiens [man]
ref|XP_005983309.1|  PREDICTED: 60S ribosomal protein L5                141   8e-38   Pantholops hodgsonii [Tibetan antelope]
ref|XP_004884144.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     141   8e-38   
sp|Q26481.3|RL5_STYCL  RecName: Full=60S ribosomal protein L5           141   8e-38   Styela clava
gb|AAI09371.1|  Ribosomal protein L5                                    141   8e-38   Homo sapiens [man]
ref|XP_004018480.1|  PREDICTED: 60S ribosomal protein L5-like           141   8e-38   Ovis aries [domestic sheep]
ref|XP_004884145.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     141   8e-38   
ref|XP_004752780.1|  PREDICTED: 60S ribosomal protein L5                143   8e-38   
ref|XP_004378798.1|  PREDICTED: 60S ribosomal protein L5                141   8e-38   Trichechus manatus latirostris
dbj|BAD92217.1|  ribosomal protein L5 variant                           141   8e-38   Homo sapiens [man]
gb|EHH14955.1|  hypothetical protein EGK_00972                          141   8e-38   Macaca mulatta [rhesus macaque]
ref|XP_005610314.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     141   8e-38   Equus caballus [domestic horse]
ref|XP_002751148.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     141   8e-38   Callithrix jacchus [common marmoset]
emb|CDQ68843.1|  unnamed protein product                                139   9e-38   Oncorhynchus mykiss
ref|XP_010643206.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     141   9e-38   Fukomys damarensis [Damara mole rat]
ref|XP_006985881.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     141   9e-38   Peromyscus maniculatus bairdii
ref|XP_006728911.1|  PREDICTED: 60S ribosomal protein L5                141   9e-38   Leptonychotes weddellii
gb|ELW72620.1|  60S ribosomal protein L5                                141   9e-38   Tupaia chinensis
ref|XP_003505203.1|  PREDICTED: 60S ribosomal protein L5                141   9e-38   Cricetulus griseus [Chinese hamsters]
ref|XP_004002245.1|  PREDICTED: 60S ribosomal protein L5                141   9e-38   
ref|XP_007611466.1|  PREDICTED: 60S ribosomal protein L5                141   9e-38   
ref|XP_006093256.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     141   9e-38   
ref|XP_005385096.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     141   9e-38   
ref|XP_003479207.1|  PREDICTED: 60S ribosomal protein L5                141   9e-38   
gb|EDL14330.1|  mCG1026389                                              141   9e-38   
ref|XP_005610315.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     141   9e-38   
ref|XP_004699318.1|  PREDICTED: 60S ribosomal protein L5                141   9e-38   
ref|NP_001107756.1|  60S ribosomal protein L5                           141   9e-38   
ref|XP_007934240.1|  PREDICTED: 60S ribosomal protein L5                141   9e-38   
ref|XP_005385097.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     141   9e-38   
ref|XP_010870379.1|  PREDICTED: 60S ribosomal protein L5                141   9e-38   
ref|XP_003418527.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     141   9e-38   
ref|XP_007169651.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     141   9e-38   
ref|XP_004319592.1|  PREDICTED: 60S ribosomal protein L5-like           141   9e-38   
ref|XP_004402579.1|  PREDICTED: 60S ribosomal protein L5                141   9e-38   
ref|XP_001515074.2|  PREDICTED: 60S ribosomal protein L5                141   9e-38   
gb|KHF99386.1|  60S ribosomal L5                                        140   9e-38   
ref|XP_007480367.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     141   9e-38   
pdb|4W20|D  Chain D, Structure Of The Mammalian 60s Ribosomal Sub...    141   9e-38   
ref|NP_001182608.1|  60S ribosomal protein L5                           141   9e-38   
ref|XP_010643208.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     141   9e-38   
ref|XP_007110786.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     141   9e-38   
ref|XP_006758248.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     141   9e-38   
ref|XP_005542773.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     141   1e-37   
ref|XP_005077452.1|  PREDICTED: 60S ribosomal protein L5                141   1e-37   
ref|XP_006140244.1|  PREDICTED: 60S ribosomal protein L5                141   1e-37   
ref|XP_007641146.1|  PREDICTED: 60S ribosomal protein L5                141   1e-37   
ref|XP_010596404.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     141   1e-37   
ref|NP_112361.1|  60S ribosomal protein L5                              141   1e-37   
ref|XP_006985882.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     141   1e-37   
gb|AAX46329.1|  ribosomal protein L5                                    140   1e-37   
ref|XP_005879039.1|  PREDICTED: 60S ribosomal protein L5                141   1e-37   
ref|XP_008262168.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     141   1e-37   
ref|XP_004625113.1|  PREDICTED: 60S ribosomal protein L5-like           141   1e-37   
dbj|BAE31169.1|  unnamed protein product                                141   1e-37   
gb|AFM88396.1|  ribosomal protein L5                                    141   1e-37   
ref|XP_008578547.1|  PREDICTED: 60S ribosomal protein L5                141   1e-37   
ref|XP_006534747.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     140   1e-37   
ref|NP_058676.1|  60S ribosomal protein L5                              140   1e-37   
ref|XP_004653832.1|  PREDICTED: 60S ribosomal protein L5                139   1e-37   
gb|AFM74205.1|  ribosomal protein L5                                    141   1e-37   
gb|AFM87650.1|  60S ribosomal protein L5-like protein                   140   1e-37   
ref|XP_006250647.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     140   1e-37   
ref|XP_007169652.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     140   1e-37   
ref|XP_007480368.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     140   1e-37   
sp|P15125.2|RL5A_XENLA  RecName: Full=60S ribosomal protein L5-A        140   1e-37   
gb|AFM88337.1|  ribosomal protein L5                                    140   1e-37   
gb|AFM86481.1|  ribosomal protein L5                                    140   1e-37   
gb|AER35073.1|  60S ribosomal protein L5                                140   1e-37   
gb|AFM88682.1|  ribosomal protein L5                                    140   1e-37   
gb|AFM90058.1|  ribosomal protein L5                                    140   1e-37   
sp|Q4KTI3.1|RL5_SUBDO  RecName: Full=60S ribosomal protein L5           140   1e-37   
gb|AFM85809.1|  ribosomal protein L5                                    140   1e-37   
ref|XP_007882704.1|  PREDICTED: 60S ribosomal protein L5-like           140   1e-37   
gb|AFM89421.1|  ribosomal protein L5                                    140   1e-37   
ref|XP_003973919.1|  PREDICTED: 60S ribosomal protein L5-like           142   1e-37   
sp|Q95276.3|RL5_PIG  RecName: Full=60S ribosomal protein L5             135   1e-37   
ref|XP_010339421.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    140   1e-37   
ref|NP_001187210.1|  ribosomal protein L5b                              140   1e-37   
emb|CAX78293.1|  putative ribosomal protein L5                          140   1e-37   
sp|P15126.2|RL5B_XENLA  RecName: Full=60S ribosomal protein L5-B        140   2e-37   
ref|NP_001079437.1|  60S ribosomal protein L5-B                         140   2e-37   
gb|ACN10317.1|  60S ribosomal protein L5                                140   2e-37   
gb|ACO07720.1|  60S ribosomal protein L5                                140   2e-37   
ref|XP_003220130.1|  PREDICTED: 60S ribosomal protein L5                140   2e-37   
gb|ETE73605.1|  60S ribosomal protein L5                                140   2e-37   
emb|CAX78299.1|  putative ribosomal protein L5                          140   2e-37   
ref|XP_009680869.1|  PREDICTED: 60S ribosomal protein L5                141   2e-37   
emb|CAX78280.1|  putative ribosomal protein L5                          140   2e-37   
gb|AAP06189.1|  similar to GenBank Accession Number L78668 60S ri...    140   2e-37   
ref|XP_008070593.1|  PREDICTED: 60S ribosomal protein L5                140   2e-37   
ref|XP_004620003.1|  PREDICTED: 60S ribosomal protein L5                139   2e-37   
dbj|BAF98650.1|  ribosomal protein L5                                   140   2e-37   
ref|XP_004349238.1|  ribosomal protein L5                               140   2e-37   
gb|ACO07680.1|  60S ribosomal protein L5                                140   2e-37   
ref|XP_006265613.1|  PREDICTED: 60S ribosomal protein L5                140   2e-37   
gb|AEI69274.1|  ribosomal protein L5                                    140   2e-37   
ref|XP_005843140.1|  hypothetical protein CHLNCDRAFT_37575              140   2e-37   
gb|ACH70844.1|  ribosomal protein L5a                                   140   2e-37   
gb|ABI26260.1|  ribosomal protein L5                                    140   2e-37   
ref|XP_006040170.1|  PREDICTED: 60S ribosomal protein L5-like           137   2e-37   
ref|XP_008406082.1|  PREDICTED: 60S ribosomal protein L5                141   2e-37   
ref|XP_004068201.1|  PREDICTED: 60S ribosomal protein L5                140   2e-37   
tpg|DAA23524.1|  TPA: ribosomal protein L5-like                         140   2e-37   
ref|XP_007437567.1|  PREDICTED: 60S ribosomal protein L5                140   2e-37   
ref|NP_001232619.1|  putative ribosomal protein L5                      140   2e-37   
gb|KDO24705.1|  hypothetical protein SPRG_10239                         140   2e-37   
ref|XP_009908172.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     140   2e-37   
ref|XP_008143036.1|  PREDICTED: 60S ribosomal protein L5                140   3e-37   
ref|NP_989912.1|  60S ribosomal protein L5                              140   3e-37   
ref|XP_005153981.1|  PREDICTED: 60S ribosomal protein L5                140   3e-37   
ref|XP_008578545.1|  PREDICTED: 60S ribosomal protein L5                140   3e-37   
ref|XP_009939484.1|  PREDICTED: 60S ribosomal protein L5                140   3e-37   
gb|ACD65156.1|  putative 60S ribosomal protein RPL5                     138   3e-37   
ref|XP_004552954.1|  PREDICTED: 60S ribosomal protein L5-like           139   3e-37   
emb|CAD91421.1|  ribosomal protein L5                                   139   3e-37   
ref|XP_007233671.1|  PREDICTED: 60S ribosomal protein L5-like           139   3e-37   
ref|XP_006790548.1|  PREDICTED: 60S ribosomal protein L5-like           139   3e-37   
gb|AFM89559.1|  ribosomal protein L5                                    139   3e-37   
ref|NP_001270867.1|  60S ribosomal protein L5                           139   3e-37   
ref|XP_005727289.1|  PREDICTED: 60S ribosomal protein L5-like           139   3e-37   
gb|ACI34044.1|  60S ribosomal protein L5                                139   3e-37   
gb|ACH70882.1|  Ribosomal protein L5b                                   139   3e-37   
ref|XP_004417183.1|  PREDICTED: 60S ribosomal protein L5-like           139   3e-37   
emb|CDQ74996.1|  unnamed protein product                                141   3e-37   
ref|XP_006001656.1|  PREDICTED: 60S ribosomal protein L5                139   3e-37   
ref|XP_002588187.1|  hypothetical protein BRAFLDRAFT_113823             140   3e-37   
ref|XP_005451204.1|  PREDICTED: 60S ribosomal protein L5-like           139   3e-37   
ref|NP_001002106.1|  ribosomal protein L5                               139   3e-37   
gb|ACI66198.1|  60S ribosomal protein L5                                141   4e-37   
ref|XP_010732697.1|  PREDICTED: 60S ribosomal protein L5                140   4e-37   
gb|AFM87418.1|  60S ribosomal protein L5-B                              139   4e-37   
ref|XP_005298201.1|  PREDICTED: 60S ribosomal protein L5                139   4e-37   
ref|NP_001279040.1|  ribosomal protein L5                               139   4e-37   
ref|XP_004018164.1|  PREDICTED: 60S ribosomal protein L5-like           141   4e-37   
gb|AFM86790.1|  60S ribosomal protein L5-A                              139   4e-37   
emb|CDQ77184.1|  unnamed protein product                                140   4e-37   
emb|CAG05644.1|  unnamed protein product                                139   5e-37   
ref|XP_004589426.1|  PREDICTED: 60S ribosomal protein L5-like           139   5e-37   
ref|NP_001279541.1|  60S ribosomal protein L5-like                      139   5e-37   
ref|XP_011442101.1|  PREDICTED: 60S ribosomal protein L5-like           139   5e-37   
pdb|2ZKR|NN  Chain n, Structure Of A Mammalian Ribosomal 60s Subu...    139   5e-37   
ref|XP_002130156.1|  PREDICTED: 60S ribosomal protein L5                139   5e-37   
ref|XP_005806012.1|  PREDICTED: 60S ribosomal protein L5-like           140   5e-37   
gb|AFM87698.1|  60S ribosomal protein L5-A                              139   5e-37   
gb|KFM66007.1|  60S ribosomal protein L5-A                              138   5e-37   
ref|NP_001104213.1|  uncharacterized protein LOC100126642               139   5e-37   
ref|XP_537074.4|  PREDICTED: 60S ribosomal protein L5 isoform 1         141   5e-37   
ref|XP_007058944.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     139   6e-37   
ref|XP_004889785.1|  PREDICTED: 60S ribosomal protein L5-like           139   6e-37   
gb|ACD65111.1|  putative 60S ribosomal protein RPL5                     136   6e-37   
gb|ACZ13335.1|  60S ribosomal protein L5                                139   6e-37   
gb|EPY76441.1|  60S ribosomal protein L5                                139   6e-37   
ref|NP_001291805.1|  ribosomal protein L5                               139   6e-37   
ref|XP_004848203.1|  PREDICTED: 60S ribosomal protein L5-like           139   6e-37   
gb|ABU41033.1|  60S ribosomal protein L5                                139   7e-37   
ref|XP_005346907.1|  PREDICTED: 60S ribosomal protein L5-like           139   7e-37   
ref|XP_005592505.1|  PREDICTED: 60S ribosomal protein L5-like           139   7e-37   
ref|XP_004310188.1|  PREDICTED: 60S ribosomal protein L5-2-like         135   7e-37   
ref|NP_001079377.1|  60S ribosomal protein L5-A                         139   7e-37   
gb|ACI69521.1|  60S ribosomal protein L5                                138   8e-37   
gb|ELR57120.1|  60S ribosomal protein L5                                138   8e-37   
gb|KHJ46023.1|  ribosomal L18p/L5e family protein                       139   8e-37   
emb|CAX78288.1|  putative ribosomal protein L5                          138   9e-37   
ref|XP_006882544.1|  PREDICTED: 60S ribosomal protein L5                138   9e-37   
ref|XP_006093255.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     138   9e-37   
ref|XP_009273931.1|  PREDICTED: 60S ribosomal protein L5                138   9e-37   
ref|XP_002736904.1|  PREDICTED: 60S ribosomal protein L5-like           138   9e-37   
gb|ACO07510.1|  60S ribosomal protein L5                                138   1e-36   
emb|CDQ69914.1|  unnamed protein product                                139   1e-36   
ref|XP_005985559.1|  PREDICTED: 60S ribosomal protein L5-like           138   1e-36   
ref|XP_001689859.1|  ribosomal protein L5, component of cytosolic...    138   1e-36   
gb|EGT59594.1|  hypothetical protein CAEBREN_20463                      134   1e-36   
ref|XP_001639289.1|  predicted protein                                  138   1e-36   
ref|XP_008295524.1|  PREDICTED: 60S ribosomal protein L5                139   1e-36   
ref|XP_009020629.1|  hypothetical protein HELRODRAFT_185715             138   1e-36   
gb|AAN05603.1|  ribosomal protein L5                                    137   1e-36   
ref|XP_008628716.1|  PREDICTED: 60S ribosomal protein L5                138   1e-36   
ref|XP_005521032.1|  PREDICTED: 60S ribosomal protein L5                138   1e-36   
gb|ELK34439.1|  60S ribosomal protein L5                                139   1e-36   
ref|XP_007554751.1|  PREDICTED: 60S ribosomal protein L5                139   1e-36   
ref|XP_008992670.1|  PREDICTED: 60S ribosomal protein L5                138   2e-36   
ref|XP_006021921.1|  PREDICTED: 60S ribosomal protein L5                138   2e-36   
gb|ABW90387.1|  putative ribosomal protein L5                           138   2e-36   
gb|KFD48731.1|  hypothetical protein M513_10361                         139   2e-36   
ref|XP_011354001.1|  PREDICTED: 60S ribosomal protein L5                138   2e-36   
gb|ADV40159.1|  putative 60S ribosomal protein L5                       137   2e-36   
emb|CBN08634.1|  small nucleolar RNA, C/D box 21                        137   2e-36   
ref|XP_003767272.1|  PREDICTED: 60S ribosomal protein L5                139   2e-36   
gb|ERE68201.1|  60S ribosomal protein L5-like protein                   138   2e-36   
gb|ELK25888.1|  60S ribosomal protein L5-B                              134   2e-36   
ref|XP_006727091.1|  PREDICTED: 60S ribosomal protein L5-like           136   2e-36   
gb|EFX90266.1|  hypothetical protein DAPPUDRAFT_299917                  137   2e-36   
ref|XP_004078696.1|  PREDICTED: 60S ribosomal protein L5-like           137   2e-36   
ref|NP_001030383.1|  60S ribosomal protein L5                           137   2e-36   
gb|KFO56565.1|  60S ribosomal protein L5                                137   2e-36   
gb|KFV85217.1|  60S ribosomal protein L5                                137   2e-36   
ref|XP_005482139.1|  PREDICTED: 60S ribosomal protein L5                137   2e-36   
ref|XP_005422184.1|  PREDICTED: 60S ribosomal protein L5                137   2e-36   
ref|XP_009963721.1|  PREDICTED: 60S ribosomal protein L5                137   2e-36   
gb|KFO98657.1|  60S ribosomal protein L5                                137   2e-36   
gb|EOA96368.1|  60S ribosomal protein L5                                137   2e-36   
ref|XP_009075975.1|  PREDICTED: 60S ribosomal protein L5                137   2e-36   
ref|XP_010022288.1|  PREDICTED: 60S ribosomal protein L5                137   2e-36   
ref|XP_010891931.1|  PREDICTED: 60S ribosomal protein L5-like           137   2e-36   
ref|XP_009959874.1|  PREDICTED: 60S ribosomal protein L5                137   2e-36   
ref|XP_009512323.1|  PREDICTED: 60S ribosomal protein L5                137   2e-36   
gb|AFM89515.1|  ribosomal protein L5                                    137   2e-36   
ref|XP_005026595.1|  PREDICTED: 60S ribosomal protein L5                137   2e-36   
ref|XP_010291146.1|  PREDICTED: 60S ribosomal protein L5                137   3e-36   
ref|XP_010731643.1|  PREDICTED: 60S ribosomal protein L5-like           137   3e-36   
gb|KFO69584.1|  60S ribosomal protein L5                                137   3e-36   
gb|KFO07226.1|  60S ribosomal protein L5                                137   3e-36   
gb|KGG50093.1|  60S ribosomal protein L5-2                              138   3e-36   
ref|XP_010159869.1|  PREDICTED: 60S ribosomal protein L5                137   3e-36   
gb|AFM86403.1|  60S ribosomal protein L5-A                              137   3e-36   
ref|XP_008942395.1|  PREDICTED: 60S ribosomal protein L5                137   3e-36   
ref|XP_003391604.1|  PREDICTED: 60S ribosomal protein L5-like           134   3e-36   
ref|XP_004020669.1|  PREDICTED: 60S ribosomal protein L5-like           137   3e-36   
ref|XP_010713879.1|  PREDICTED: 60S ribosomal protein L5                137   3e-36   
ref|XP_009818493.1|  PREDICTED: 60S ribosomal protein L5                137   3e-36   
ref|XP_010196863.1|  PREDICTED: 60S ribosomal protein L5                137   3e-36   
gb|KFM02490.1|  60S ribosomal protein L5                                137   3e-36   
ref|XP_009087107.1|  PREDICTED: 60S ribosomal protein L5                137   3e-36   
ref|XP_004206528.1|  PREDICTED: 60S ribosomal protein L5-like           137   3e-36   
ref|XP_003264168.1|  PREDICTED: 60S ribosomal protein L5-like iso...    137   3e-36   
ref|XP_010303651.1|  PREDICTED: 60S ribosomal protein L5                137   3e-36   
gb|KFP17477.1|  60S ribosomal protein L5                                137   3e-36   
ref|XP_002434050.1|  60S ribosomal protein L5, putative                 137   3e-36   
ref|XP_010005060.1|  PREDICTED: 60S ribosomal protein L5                137   3e-36   
ref|XP_008489183.1|  PREDICTED: 60S ribosomal protein L5                137   3e-36   
ref|XP_009554761.1|  PREDICTED: 60S ribosomal protein L5                137   3e-36   
ref|XP_009920773.1|  PREDICTED: 60S ribosomal protein L5                137   3e-36   
ref|XP_010581057.1|  PREDICTED: 60S ribosomal protein L5                137   3e-36   
ref|XP_008605837.1|  50S ribosomal protein L5e                          137   3e-36   
ref|XP_005445628.1|  PREDICTED: 60S ribosomal protein L5                137   3e-36   
gb|ACO07790.1|  60S ribosomal protein L5                                137   3e-36   
ref|XP_010787501.1|  PREDICTED: 60S ribosomal protein L5                137   3e-36   
emb|CBN77695.1|  conserved unknown protein                              137   4e-36   
ref|XP_005690639.1|  PREDICTED: 60S ribosomal protein L5-like           136   4e-36   



>ref|XP_009767919.1| PREDICTED: 60S ribosomal protein L5 [Nicotiana sylvestris]
Length=302

 Score =   197 bits (500),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 118/125 (94%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAFIKVQKTRAYFKRFQVKFKR REG TDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   IAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  414  GNVEA  428
            GN+EA
Sbjct  121  GNLEA  125



>ref|XP_004242456.1| PREDICTED: 60S ribosomal protein L5 [Solanum lycopersicum]
Length=301

 Score =   193 bits (491),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 116/124 (94%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAFIKVQKTRAYFKRFQVKFKR REG TDYRARNRLINQDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   IAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  414  GNVE  425
            GN+E
Sbjct  121  GNLE  124



>ref|XP_009625828.1| PREDICTED: 60S ribosomal protein L5 [Nicotiana tomentosiformis]
Length=302

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/124 (93%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAFIKVQKTRAYFKRFQVKFKR REG TDYRARNRLINQDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EY+
Sbjct  61   IAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  414  GNVE  425
            GN+E
Sbjct  121  GNLE  124



>ref|XP_006366807.1| PREDICTED: 60S ribosomal protein L5-like [Solanum tuberosum]
Length=301

 Score =   191 bits (484),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAFIKVQKTRAYFKRFQVKFKR REG TDYRARNRLINQDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQ+VSASIAGDMILASAYANELPRYGL+VGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   IAQVVSASIAGDMILASAYANELPRYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  414  GNVE  425
            GN+E
Sbjct  121  GNLE  124



>ref|XP_009611190.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana tomentosiformis]
Length=301

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAFIKVQKTRAYFKRFQVKFKR REG TDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQIVSASIAGDMILASAYA ELP+YGL+VGLTNYAAAYCTGLLLARR+L+KLEMD EY+
Sbjct  61   IAQIVSASIAGDMILASAYARELPQYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  414  GNVEA  428
            GN EA
Sbjct  121  GNTEA  125



>ref|XP_009774634.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana sylvestris]
Length=301

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAFIKVQKTRAYFKRFQVKFKR REG TDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQIVSASIAGDMILASAYA ELPRYGL+VGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   IAQIVSASIAGDMILASAYARELPRYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  414  GNVE  425
            GN++
Sbjct  121  GNLD  124



>ref|XP_009801702.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana sylvestris]
Length=301

 Score =   189 bits (481),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAFIKVQKTRAYFKRFQVKFKR REG TDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQIVSASIAGDMILASAYA ELP+YGL+VGLTNYAAAYCTGLLLARR+L+KLEMD EY+
Sbjct  61   IAQIVSASIAGDMILASAYARELPQYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  414  GNVEA  428
            GN EA
Sbjct  121  GNPEA  125



>ref|XP_006344345.1| PREDICTED: 60S ribosomal protein L5-like [Solanum tuberosum]
Length=301

 Score =   188 bits (478),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAFIKVQKTRAYFKRFQVKFKR REG TDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQIVSASIAGDMILASAYA ELP++GL+VGLTNYAAAYCTGLLLARR+L+KLEMD EY+
Sbjct  61   IAQIVSASIAGDMILASAYARELPQFGLQVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  414  GNVEA  428
            GN EA
Sbjct  121  GNPEA  125



>ref|XP_004246241.1| PREDICTED: 60S ribosomal protein L5 [Solanum lycopersicum]
Length=301

 Score =   188 bits (478),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAFIKVQKTRAYFKRFQVKFKR REG TDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQIVSASIAGDMILASAYA ELP++GL+VGLTNYAAAYCTGLLLARR+L+KLEMD EY+
Sbjct  61   IAQIVSASIAGDMILASAYARELPQFGLQVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  414  GNVEA  428
            GN EA
Sbjct  121  GNPEA  125



>ref|XP_009626989.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana tomentosiformis]
Length=301

 Score =   188 bits (477),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAFIKVQKTRAYFKRFQVKFKR REG TDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQIVSASIAGDMILASAYA ELP YGL+VGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   IAQIVSASIAGDMILASAYARELPHYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  414  GNVE  425
            GN++
Sbjct  121  GNLD  124



>ref|XP_010679028.1| PREDICTED: 60S ribosomal protein L5 [Beta vulgaris subsp. vulgaris]
Length=304

 Score =   186 bits (471),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QK+RAYFKR+QVKF+R REG TDYRARNRLINQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MAFVKAQKSRAYFKRYQVKFRRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDV  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQI+SASI GD +LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L KLEMD EYE
Sbjct  61   TAQIISASITGDSVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLTKLEMDQEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|NP_001274803.1| uncharacterized protein LOC102577675 [Solanum tuberosum]
 gb|ABB16983.1| unknown [Solanum tuberosum]
Length=302

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAFIKVQKTRAYFKRFQVKFKR REG TDYRARNRLINQDKNKYNTPKYRFVVRFTN+DI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNRDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQIVSASIAGDMILASAYA+ELP +GL+VGLTNYAAAYCTGLLLARR+L+KLEMD EY+
Sbjct  61   IAQIVSASIAGDMILASAYASELPHFGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  414  GNVE  425
            GN++
Sbjct  121  GNLD  124



>gb|AFK41626.1| unknown [Lotus japonicus]
Length=207

 Score =   182 bits (461),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK+RAYFKRFQVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSRAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQI+SASIAGD++LASAYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_004240444.1| PREDICTED: 60S ribosomal protein L5-like [Solanum lycopersicum]
Length=301

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAFIKVQKTRAYFKRFQVKFKR REG TDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            + QIVSASIAGDMILASAYA+ELP +GL+VGLTNYAAAYCTGLLLARR+L+KLEMD EY+
Sbjct  61   ITQIVSASIAGDMILASAYASELPHFGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  414  GNVE  425
            GN++
Sbjct  121  GNLD  124



>ref|XP_009358395.1| PREDICTED: 60S ribosomal protein L5 [Pyrus x bretschneideri]
Length=302

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF K QK+RAYFKRFQVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIISASIAGDLVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_007135299.1| hypothetical protein PHAVU_010G117700g [Phaseolus vulgaris]
 gb|ESW07293.1| hypothetical protein PHAVU_010G117700g [Phaseolus vulgaris]
Length=299

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK+RAYFKR+QVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQI SASIAGD++LA+AYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   IAQITSASIAGDIVLAAAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|AGV54354.1| 60S ribosomal protein L5-like protein [Phaseolus vulgaris]
Length=301

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK+RAYFKR+QVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQI SASIAGD++LA+AYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   IAQITSASIAGDIVLAAAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|AHA84189.1| 60S ribosomal protein L5 [Phaseolus vulgaris]
Length=299

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK+RAYFKR+QVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQI SASIAGD++LA+AYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   IAQITSASIAGDIVLAAAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_007135197.1| hypothetical protein PHAVU_010G109200g [Phaseolus vulgaris]
 gb|ESW07191.1| hypothetical protein PHAVU_010G109200g [Phaseolus vulgaris]
Length=301

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK+RAYFKR+QVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQI SASIAGD++LA+AYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   IAQITSASIAGDIVLAAAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>emb|CBI24704.3| unnamed protein product [Vitis vinifera]
Length=333

 Score =   184 bits (468),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  3    LSPQETPLRG*SSSTAPMAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNK  182
            + P  + L G  S  + M F+K QK++AYFKR+QVKFKR REG TDYRAR RLINQDKNK
Sbjct  16   ICPLLSLLEGRGSRASAMVFVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNK  75

Query  183  YNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGl  362
            YNTPKYRFVVRFTNKDI+AQI SASIAGD++LASAY++ELP YGLEVGLTNYAAAYCTGL
Sbjct  76   YNTPKYRFVVRFTNKDIIAQITSASIAGDIVLASAYSHELPHYGLEVGLTNYAAAYCTGL  135

Query  363  llarrllqklEMDXEYEGNVEA  428
            LLARR+L+ LEMD EYEGNVEA
Sbjct  136  LLARRVLKMLEMDGEYEGNVEA  157



>ref|XP_006447906.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
 gb|ESR61146.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
Length=217

 Score =   181 bits (459),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF K QK++AYFKR+QVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_006447904.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
 gb|ESR61144.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
Length=268

 Score =   182 bits (463),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF K QK++AYFKR+QVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_007203851.1| hypothetical protein PRUPE_ppa009282m2g, partial [Prunus persica]
 gb|EMJ05050.1| hypothetical protein PRUPE_ppa009282m2g, partial [Prunus persica]
Length=264

 Score =   182 bits (461),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QK++AY+KRFQVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYYKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPSYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>emb|CBI38286.3| unnamed protein product [Vitis vinifera]
Length=177

 Score =   179 bits (454),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  48   APMAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNK  227
            +PMAF+K QKTRAY KRFQVKFKR R G TDYRAR RLINQDKNKYNTPKYRFVVRFTNK
Sbjct  27   SPMAFVKAQKTRAYSKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNK  86

Query  228  DIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXE  407
            DI AQI+SASIAGDM+LA+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+ LEMD E
Sbjct  87   DITAQIISASIAGDMVLAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEE  146

Query  408  YEGNV  422
            Y+G +
Sbjct  147  YQGKL  151



>ref|XP_008384135.1| PREDICTED: 60S ribosomal protein L5-1-like [Malus domestica]
Length=302

 Score =   182 bits (463),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK+RAYFKRFQVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKSQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_008394277.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
 ref|XP_008394278.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
 ref|XP_008367741.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=299

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK+RAYFKRFQVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKSQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|KDO51034.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=217

 Score =   180 bits (456),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF K QK++AYFKR+QVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  414  GNVEA  428
            G+VEA
Sbjct  121  GHVEA  125



>gb|KDO51035.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=252

 Score =   181 bits (459),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF K QK++AYFKR+QVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  414  GNVEA  428
            G+VEA
Sbjct  121  GHVEA  125



>ref|XP_009358396.1| PREDICTED: 60S ribosomal protein L5-1-like [Pyrus x bretschneideri]
Length=299

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK+RAYFKRFQVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKSQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_009366222.1| PREDICTED: 60S ribosomal protein L5-1-like [Pyrus x bretschneideri]
Length=302

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK+RAYFKRFQVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKSQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_010927913.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Elaeis guineensis]
Length=302

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QKT+AYFKRFQVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MGFVKTQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQI+SA+IAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EY+
Sbjct  61   IAQIISATIAGDLVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYQ  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_010688412.1| PREDICTED: 60S ribosomal protein L5 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=304

 Score =   182 bits (462),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QK+RAYFKR+QVKFKR REG TDYRARNRLINQDKNKYNTPKYR VVRFTNKD+
Sbjct  1    MAFVKAQKSRAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRIVVRFTNKDV  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQI+SASI GD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD +YE
Sbjct  61   TAQIISASITGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEDYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|KJB71615.1| hypothetical protein B456_011G133700 [Gossypium raimondii]
Length=274

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QKT+AYFKRFQV +KR REG TDYRAR RLINQDKNKYNTPKYRFVVRF+NKD+
Sbjct  1    MAFVKAQKTKAYFKRFQVPYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDV  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQIVSA+IAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLL RR+L+ LEMD EY+
Sbjct  61   TAQIVSANIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKMLEMDEEYQ  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_004500722.1| PREDICTED: 60S ribosomal protein L5-like [Cicer arietinum]
Length=302

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QK++AYFKR+QVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRYQVKFKRRREGKTDYRARVRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++LA+AYA+ELP +GLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVLAAAYAHELPHFGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_006447905.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
 gb|ESR61145.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
Length=297

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF K QK++AYFKR+QVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_010551993.1| PREDICTED: 60S ribosomal protein L5-like [Tarenaya hassleriana]
Length=304

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK+RAYFKR+QVKFKR R G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKAQKSRAYFKRYQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_007160627.1| hypothetical protein PHAVU_001G003200g [Phaseolus vulgaris]
 gb|ESW32621.1| hypothetical protein PHAVU_001G003200g [Phaseolus vulgaris]
Length=300

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK+RAYFKR+QVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQI SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   IAQITSASIAGDIVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_008800755.1| PREDICTED: 60S ribosomal protein L5-like [Phoenix dactylifera]
Length=305

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K  KTRAY KRFQVKFKR R+G TDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKTLKTRAYSKRFQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|KJB71614.1| hypothetical protein B456_011G133700 [Gossypium raimondii]
Length=298

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QKT+AYFKRFQV +KR REG TDYRAR RLINQDKNKYNTPKYRFVVRF+NKD+
Sbjct  1    MAFVKAQKTKAYFKRFQVPYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDV  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQIVSA+IAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLL RR+L+ LEMD EY+
Sbjct  61   TAQIVSANIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKMLEMDEEYQ  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_008339345.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=302

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F K QK+RAYFKRFQVK++R REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFAKAQKSRAYFKRFQVKYRRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|AFK34395.1| unknown [Lotus japonicus]
Length=301

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK+RAYFKRFQVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSRAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQI+SASIAGD++LASAYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_003548576.2| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=339

 Score =   182 bits (462),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +3

Query  3    LSPQETPLRG*SSSTAPMAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNK  182
            L+P+ET      S +A M ++K QK++AYFKR+QVKFKR REG TDYRAR RLINQDKNK
Sbjct  26   LNPKETQALLPFSPSA-MVYVKSQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNK  84

Query  183  YNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGl  362
            YNTPKYRFVVRF+NKDIVAQI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGL
Sbjct  85   YNTPKYRFVVRFSNKDIVAQIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGL  144

Query  363  llarrllqklEMDXEYEGNVEA  428
            LLARR+L+ LEMD EYEGNVEA
Sbjct  145  LLARRVLKTLEMDEEYEGNVEA  166



>ref|XP_010273742.1| PREDICTED: 60S ribosomal protein L5-like [Nelumbo nucifera]
Length=302

 Score =   181 bits (459),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QK++AYFKRFQVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQI+SASIAGDMILA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEM+ EY+
Sbjct  61   IAQILSASIAGDMILAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMEDEYQ  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_008243040.1| PREDICTED: 60S ribosomal protein L5 [Prunus mume]
Length=298

 Score =   181 bits (459),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QK++AY+KRFQVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYYKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+SASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQILSASIAGDLVLAAAYAHELPSYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_008791818.1| PREDICTED: 60S ribosomal protein L5-like [Phoenix dactylifera]
Length=305

 Score =   181 bits (459),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K  KTRAYFKRFQVKFKR R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKTLKTRAYFKRFQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|AFK46994.1| unknown [Lotus japonicus]
Length=302

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK+RAYFKR+QVKFKR REG TDYRAR RLINQDKNKY+TPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYSTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQIVSA+IAGD++LASAYA+ELPRYGLE+GLTNYAAAYCTGLLLARR LQKLEMD EYE
Sbjct  61   TAQIVSATIAGDIVLASAYAHELPRYGLEIGLTNYAAAYCTGLLLARRTLQKLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|AFK36106.1| unknown [Lotus japonicus]
Length=302

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK+RAYFKR+QVKFKR REG TDYRAR RLINQDKNKY+TPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYSTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQIVSA+IAGD++LASAYA+ELPRYGLE+GLTNYAAAYCTGLLLARR LQKLEMD EYE
Sbjct  61   TAQIVSATIAGDIVLASAYAHELPRYGLEIGLTNYAAAYCTGLLLARRTLQKLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|AGV54527.1| 60S ribosomal protein L5-like protein [Phaseolus vulgaris]
Length=300

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK+RAYFKR+QVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQI SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   IAQITSASIAGDIVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|KHG14330.1| 60S ribosomal L5 [Gossypium arboreum]
Length=260

 Score =   179 bits (455),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QKT+AYFKRFQV +KR REG TDYRAR RLINQDKNKYNTPKYRFVVRF+NKD+
Sbjct  1    MAFVKAQKTKAYFKRFQVPYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDV  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQIVSA+IAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLL RR+L+ LEMD EY+
Sbjct  61   TAQIVSANIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKMLEMDDEYQ  120

Query  414  GNVEA  428
            GNVE 
Sbjct  121  GNVEG  125



>gb|ADR71226.1| 60S ribosomal protein L5B [Hevea brasiliensis]
Length=298

 Score =   180 bits (457),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QKT+AYFKRFQVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+SASIAGDM+LA+AY++ELP++GLEVGLTNYAAAYCTGLLLARR L+KLEMD EYE
Sbjct  61   VAQIISASIAGDMVLAAAYSHELPQFGLEVGLTNYAAAYCTGLLLARRTLKKLEMDEEYE  120

Query  414  GNVEA  428
            GN EA
Sbjct  121  GNEEA  125



>gb|KJB22673.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=197

 Score =   177 bits (449),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK++AYFKR+QVKFKR REG TDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+ ASI+GD++LA+AYA+ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|KDO45958.1| hypothetical protein CISIN_1g0225141mg, partial [Citrus sinensis]
Length=264

 Score =   179 bits (454),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QK++AYFKRFQVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQIVSA+I GD +LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_008394279.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
Length=302

 Score =   180 bits (457),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF K QK+RAYFKRFQVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI SASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQITSASIAGDLVLAAAYAHELPXYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|KJB22670.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=171

 Score =   176 bits (446),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK++AYFKR+QVKFKR REG TDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+ ASI+GD++LA+AYA+ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|ADR71225.1| 60S ribosomal protein L5A [Hevea brasiliensis]
Length=298

 Score =   180 bits (457),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QKT+AYFKRFQVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+SASIAGDM+LA+AY++ELP++GLEVGLTNYAAAYCTGLLLARR L+KLEMD EYE
Sbjct  61   VAQIISASIAGDMVLAAAYSHELPQFGLEVGLTNYAAAYCTGLLLARRTLKKLEMDEEYE  120

Query  414  GNVEA  428
            GN EA
Sbjct  121  GNEEA  125



>ref|XP_006469375.1| PREDICTED: 60S ribosomal protein L5-like [Citrus sinensis]
Length=297

 Score =   180 bits (456),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF K QK++AYFKR+QVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  414  GNVEA  428
            G+VEA
Sbjct  121  GHVEA  125



>ref|XP_009420140.1| PREDICTED: 60S ribosomal protein L5-like [Musa acuminata subsp. 
malaccensis]
Length=303

 Score =   180 bits (457),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QKT+AY KR+QVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKTQKTKAYSKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQ++SASIAGD++LASAYA+ELP+YGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EY+
Sbjct  61   CAQVISASIAGDLVLASAYAHELPQYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYQ  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|KDO51033.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=274

 Score =   179 bits (455),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF K QK++AYFKR+QVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  414  GNVEA  428
            G+VEA
Sbjct  121  GHVEA  125



>gb|KDO51032.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=297

 Score =   180 bits (456),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF K QK++AYFKR+QVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  414  GNVEA  428
            G+VEA
Sbjct  121  GHVEA  125



>ref|XP_008445491.1| PREDICTED: 60S ribosomal protein L5-like [Cucumis melo]
Length=301

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF K QKT+AYFKR+QVKFKR REG TDYRAR RLINQDKNKYNTPKYRFV+RFTNKDI
Sbjct  1    MAFAKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVIRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQIVS+SIAGDM+LASAY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   TAQIVSSSIAGDMVLASAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  414  GNVEA  428
            GN+EA
Sbjct  121  GNLEA  125



>ref|XP_008367742.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
Length=302

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF K QK+RAYFKRFQVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI SASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQITSASIAGDLVLAAAYAHELPXYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_008361660.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=302

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF K  K+RAYFKRFQVK++R REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKALKSRAYFKRFQVKYRRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_010532933.1| PREDICTED: 60S ribosomal protein L5-2 [Tarenaya hassleriana]
Length=304

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK++AYFKR+QVK+KR R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSKAYFKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSA+IAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSATIAGDVVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_004287154.1| PREDICTED: 60S ribosomal protein L5 [Fragaria vesca subsp. vesca]
Length=299

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K  K++AYFKRFQVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKSHKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++LASAYA+ELP YGL+ GLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDLVLASAYAHELPHYGLDFGLTNYAAAYCTGLLLARRVLKTLEMDAEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_003528812.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Glycine 
max]
 gb|KHN27259.1| 60S ribosomal protein L5 [Glycine soja]
Length=298

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M ++K QK++AYFKR+QVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|KDO45957.1| hypothetical protein CISIN_1g0225141mg [Citrus sinensis]
Length=296

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QK++AYFKRFQVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQIVSA+I GD +LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_006492784.1| PREDICTED: 60S ribosomal protein L5-like [Citrus sinensis]
Length=296

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QK++AYFKRFQVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQIVSA+I GD +LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_010547178.1| PREDICTED: 60S ribosomal protein L5-2-like [Tarenaya hassleriana]
Length=304

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK++AYFKR+QVKFKR R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++LASAY +ELPRYGLEVGLT+YAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVLASAYGHELPRYGLEVGLTSYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|KDO45956.1| hypothetical protein CISIN_1g0225141mg [Citrus sinensis]
Length=257

 Score =   178 bits (452),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QK++AYFKRFQVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQIVSA+I GD +LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  414  GNVEA  428
            GNVE 
Sbjct  121  GNVEG  125



>gb|KHN15970.1| 60S ribosomal protein L5 [Glycine soja]
Length=292

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M ++K QK++AYFKR+QVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKSQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_011002862.1| PREDICTED: 60S ribosomal protein L5 [Populus euphratica]
Length=297

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF K QK+RAYFKRFQVKFKR R G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQI SASIAGD++LASAYA+ELPRYGLE GLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQITSASIAGDIVLASAYAHELPRYGLEAGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_010927912.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Elaeis guineensis]
Length=304

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +3

Query  57   AFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  236
             F+K QKT+AYFKRFQVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI+
Sbjct  4    GFVKTQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDII  63

Query  237  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEG  416
            AQI+SA+IAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EY+G
Sbjct  64   AQIISATIAGDLVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYQG  123

Query  417  NVEA  428
            NVEA
Sbjct  124  NVEA  127



>ref|XP_010688411.1| PREDICTED: 60S ribosomal protein L5 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=306

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +3

Query  57   AFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  236
            AF+K QK+RAYFKR+QVKFKR REG TDYRARNRLINQDKNKYNTPKYR VVRFTNKD+ 
Sbjct  4    AFVKAQKSRAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRIVVRFTNKDVT  63

Query  237  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEG  416
            AQI+SASI GD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD +YEG
Sbjct  64   AQIISASITGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEDYEG  123

Query  417  NVEA  428
            NVEA
Sbjct  124  NVEA  127



>ref|XP_009416026.1| PREDICTED: 60S ribosomal protein L5-like [Musa acuminata subsp. 
malaccensis]
Length=302

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K  K++AYFKRFQVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAHKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+S+SIAGD++LASA+A+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EY+
Sbjct  61   VAQIISSSIAGDLVLASAFAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYQ  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_011037361.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
 ref|XP_011037362.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
Length=297

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MA+ K QK+RAY KRFQVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAYAKAQKSRAYSKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI SASI GD +LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQITSASITGDTVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|KHN36792.1| 60S ribosomal protein L5 [Glycine soja]
Length=298

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M ++K QK++AYFKR+QVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIISASIAGDLVLATAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_006594790.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M ++K QK++AYFKR+QVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIISASIAGDLVLATAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_003543258.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M ++K QK++AYFKR+QVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIISASIAGDLVLATAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_011073988.1| PREDICTED: 60S ribosomal protein L5-like [Sesamum indicum]
Length=302

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QK++AYFKR+QVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASI GDM+LA+AYA+ELP YGLEVGL+NYAAAYCTGLLLARR+L+KLEMD EY+
Sbjct  61   VAQIVSASITGDMVLAAAYAHELPHYGLEVGLSNYAAAYCTGLLLARRVLKKLEMDDEYQ  120

Query  414  GNVEA  428
            GN+EA
Sbjct  121  GNLEA  125



>ref|XP_010069235.1| PREDICTED: 60S ribosomal protein L5 [Eucalyptus grandis]
 gb|KCW57513.1| hypothetical protein EUGRSUZ_H00286 [Eucalyptus grandis]
Length=301

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK+RAY KRFQVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYSKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQI+SA+I GDM+LASAY++ELP YGLE GLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISATITGDMVLASAYSHELPHYGLEAGLTNYAAAYCTGLLLARRVLKSLEMDSEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_002524859.1| ribosomal protein L5, putative [Ricinus communis]
 gb|EEF37483.1| ribosomal protein L5, putative [Ricinus communis]
Length=299

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QKT+AYFKR+QVKFKR R G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKTKAYFKRYQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++LA+AYA+ELP YGL+VGLTNYAAAYCTGLLLARR L+ LEMD EY+
Sbjct  61   VAQIVSASIAGDIVLAAAYAHELPHYGLDVGLTNYAAAYCTGLLLARRTLKMLEMDEEYQ  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|KJB22672.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=221

 Score =   176 bits (447),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK++AYFKR+QVKFKR REG TDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+ ASI+GD++LA+AYA+ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_010650723.1| PREDICTED: 60S ribosomal protein L5 [Vitis vinifera]
Length=301

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK++AYFKR+QVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQI SASIAGD++LASAY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQITSASIAGDIVLASAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDGEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_006371546.1| hypothetical protein POPTR_0019s13040g [Populus trichocarpa]
 gb|ABK95061.1| unknown [Populus trichocarpa]
 gb|ERP49343.1| hypothetical protein POPTR_0019s13040g [Populus trichocarpa]
Length=297

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF K QK+RAYFKR+QVKFKR R G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRYQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQI SASIAGD++LASAYA+ELPRYGLE GLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQIASASIAGDIVLASAYAHELPRYGLEAGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|KDP35145.1| hypothetical protein JCGZ_10679 [Jatropha curcas]
Length=298

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QK++AYFKRFQVKFKR R G TDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++LASAY++ELP YGLEVGLTNYAAAYCTGLLLARR L+ LEMD EY+
Sbjct  61   VAQIVSASIAGDLVLASAYSHELPHYGLEVGLTNYAAAYCTGLLLARRTLKMLEMDDEYQ  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|KJB22671.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=221

 Score =   176 bits (447),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK++AYFKR+QVKFKR REG TDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+ ASI+GD++LA+AYA+ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_006442191.1| hypothetical protein CICLE_v10020582mg [Citrus clementina]
 gb|ESR55431.1| hypothetical protein CICLE_v10020582mg [Citrus clementina]
Length=383

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +3

Query  36   SSSTAPMAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVR  215
            +S    MAF+K QK++AYFKRFQVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVR
Sbjct  82   NSKVRAMAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVR  141

Query  216  FTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklE  395
            FTNKDI+AQIVSA+I GD +LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LE
Sbjct  142  FTNKDIIAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLE  201

Query  396  MDXEYEGNVEA  428
            MD EYEGNVEA
Sbjct  202  MDDEYEGNVEA  212



>ref|XP_011089578.1| PREDICTED: 60S ribosomal protein L5-like [Sesamum indicum]
Length=302

 Score =   178 bits (452),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QKT+AYFKRFQVKFKR R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQ+ SASIAGD +LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+KL+MD EYE
Sbjct  61   IAQVSSASIAGDHVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLRKLDMDKEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_004144191.1| PREDICTED: 60S ribosomal protein L5-like [Cucumis sativus]
 gb|KGN47624.1| hypothetical protein Csa_6G365730 [Cucumis sativus]
Length=301

 Score =   178 bits (452),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF K QKT+AYFKR+QVKFKR REG TDYRAR RLINQDKNKYNTPKYRFV+R TNKDI
Sbjct  1    MAFAKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVIRITNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQIVS+SIAGDMILA+AY++ELPRYGLEVGLTNYAAAYCTGLL+ARR+L+KLEMD EYE
Sbjct  61   TAQIVSSSIAGDMILAAAYSHELPRYGLEVGLTNYAAAYCTGLLVARRVLKKLEMDDEYE  120

Query  414  GNVEA  428
            GN+EA
Sbjct  121  GNLEA  125



>ref|XP_011091526.1| PREDICTED: 60S ribosomal protein L5 [Sesamum indicum]
Length=319

 Score =   179 bits (453),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QKT+AYFKRFQVKFKR R G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  18   MAFVKAQKTKAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  77

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQI+SA+IAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EY+
Sbjct  78   IAQILSATIAGDVVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDDEYQ  137

Query  414  GNVEA  428
            GN+EA
Sbjct  138  GNLEA  142



>gb|KJB27799.1| hypothetical protein B456_005G010200 [Gossypium raimondii]
Length=296

 Score =   178 bits (451),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QKT+AYFKRFQV FKR REG TDYRAR RL NQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVPFKRRREGKTDYRARIRLTNQDKNKYNTPKYRFVVRFSNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQI+SA+I GDMILASAY++ELPRYGLEVGLTNYAAAYCTGLLL RR+L+ LEMD EY+
Sbjct  61   TAQIISANITGDMILASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKLLEMDDEYQ  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_010557737.1| PREDICTED: 60S ribosomal protein L5-1-like [Tarenaya hassleriana]
Length=305

 Score =   178 bits (452),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K  K+RAYFKR+QVK+KR R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAHKSRAYFKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSA+IAGD++L +AY++ELPRYGLE+GLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSATIAGDVVLTAAYSHELPRYGLEIGLTNYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_008224357.1| PREDICTED: 60S ribosomal protein L5-2-like [Prunus mume]
Length=298

 Score =   178 bits (451),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K  K+RAYFKRFQVK+KR R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKSLKSRAYFKRFQVKYKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++LASAYA+ELPRYGL+VGLTNYAAAYCTGLLLARR+L KLEM  EYE
Sbjct  61   VAQIVSASIAGDLVLASAYAHELPRYGLKVGLTNYAAAYCTGLLLARRVLHKLEMADEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|ABK93902.1| unknown [Populus trichocarpa]
Length=297

 Score =   178 bits (451),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MA+ K QK++AY KRFQVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAYAKAQKSKAYSKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI SASI GD +LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARRLL+ LEMD EYE
Sbjct  61   VAQITSASITGDTVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRLLKMLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_008446013.1| PREDICTED: 60S ribosomal protein L5 [Cucumis melo]
Length=303

 Score =   178 bits (451),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF K QKT+AYFKR+QVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVR +NKDI
Sbjct  1    MAFAKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRTSNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQI+SASIAGD++LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDLVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|KJB27798.1| hypothetical protein B456_005G010200 [Gossypium raimondii]
Length=299

 Score =   178 bits (451),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QKT+AYFKRFQV FKR REG TDYRAR RL NQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVPFKRRREGKTDYRARIRLTNQDKNKYNTPKYRFVVRFSNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQI+SA+I GDMILASAY++ELPRYGLEVGLTNYAAAYCTGLLL RR+L+ LEMD EY+
Sbjct  61   TAQIISANITGDMILASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKLLEMDDEYQ  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|ABK95722.1| unknown [Populus trichocarpa]
Length=297

 Score =   178 bits (451),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MA+ K QK++AY KRFQVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAYAKAQKSKAYSKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI SASI GD +LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARRLL+ LEMD EYE
Sbjct  61   VAQITSASITGDTVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRLLKMLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_010542064.1| PREDICTED: 60S ribosomal protein L5-1-like [Tarenaya hassleriana]
Length=304

 Score =   178 bits (451),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK++AYFKR+QVK+KR R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSKAYFKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSA+IAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSATIAGDVVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  414  GNVEA  428
            GN EA
Sbjct  121  GNTEA  125



>gb|KHG15135.1| 60S ribosomal L5 [Gossypium arboreum]
Length=262

 Score =   177 bits (448),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M ++K QK++AYFKR+QVKFKR REG TDYRARNRLINQDKNKYNTPKYRFV RFTNKDI
Sbjct  1    MPYVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVARFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+ ASI+GD++LA+AYA+ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  414  GNVEA  428
            GNVE 
Sbjct  121  GNVEG  125



>ref|XP_007223197.1| hypothetical protein PRUPE_ppa009300mg [Prunus persica]
 gb|EMJ24396.1| hypothetical protein PRUPE_ppa009300mg [Prunus persica]
Length=298

 Score =   177 bits (450),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K  K+RAYFKRFQVK+KR R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKSLKSRAYFKRFQVKYKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+SASIAGD++LASAYA+ELPRYGL+VGLTNYAAAYCTGLLLARR+L KLEM  EYE
Sbjct  61   VAQIISASIAGDLVLASAYAHELPRYGLKVGLTNYAAAYCTGLLLARRVLHKLEMADEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_007033700.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
 gb|EOY04626.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
Length=298

 Score =   177 bits (450),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MA++K QKT+AYFKRFQVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAYVKAQKTKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQIVSASIAGD +LA+AYA ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   TAQIVSASIAGDQVLAAAYARELPCYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_003528810.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   177 bits (449),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M ++K QK++AYFKR+QVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+SASIAGD++LA+AYA+ELP+YGLEVGLTNYAAAYCTGLLLARR+L  LEMD EYE
Sbjct  61   VAQIISASIAGDIVLAAAYAHELPQYGLEVGLTNYAAAYCTGLLLARRVLNTLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_007049513.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
 gb|EOX93670.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
Length=353

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MA++K QKT+AY KR+QVKFKR REG TDYRAR RLINQDKNKYNTPKYR V RFTNKD+
Sbjct  57   MAYVKAQKTKAYSKRYQVKFKRRREGKTDYRARTRLINQDKNKYNTPKYRLVARFTNKDL  116

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQIV ASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYC GLLLARR+L++LEMD EYE
Sbjct  117  IAQIVHASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCVGLLLARRVLKQLEMDAEYE  176

Query  414  GNVEA  428
            GNVEA
Sbjct  177  GNVEA  181



>gb|KJB22668.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=301

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK++AYFKR+QVKFKR REG TDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+ ASI+GD++LA+AYA+ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_004296367.1| PREDICTED: 60S ribosomal protein L5-like [Fragaria vesca subsp. 
vesca]
Length=300

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAFIK  K RAYFKRFQVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKASKPRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+S++I+GD++LASAY++ELPRYGL VGLTNYAA+YCTGLLLARR L+KLEMD EYE
Sbjct  61   VAQIISSTISGDLVLASAYSHELPRYGLHVGLTNYAASYCTGLLLARRTLKKLEMDEEYE  120

Query  414  GNVEA  428
            GN+EA
Sbjct  121  GNLEA  125



>gb|ACU23594.1| unknown [Glycine max]
Length=298

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M ++K +K++AYFKR++VKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKSRKSKAYFKRYRVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_004510723.1| PREDICTED: 60S ribosomal protein L5-like [Cicer arietinum]
Length=301

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M ++K QK++AYFKR+QVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQIVSASIAGD++LA+AY++ELP +GLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQIVSASIAGDIVLAAAYSHELPHFGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>tpg|DAA56365.1| TPA: hypothetical protein ZEAMMB73_635593 [Zea mays]
Length=149

 Score =   172 bits (436),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  57   AFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  236
             F+K  KT AYFKRFQVKFKR R G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  237  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEG  416
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +D EYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTRGLDKEYEG  122

Query  417  NVEA  428
            NVEA
Sbjct  123  NVEA  126



>gb|KHG10378.1| 60S ribosomal protein L5 [Gossypium arboreum]
Length=261

 Score =   176 bits (445),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QKT+AYFKR+QVKFKR REG TDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKTKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQIV ASI+GD++LA+AY +ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  61   IAQIVHASISGDIVLAAAYGHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  414  GNVEA  428
            GNVE 
Sbjct  121  GNVEG  125



>ref|XP_008807248.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X2 [Phoenix 
dactylifera]
Length=302

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QKT+AYFKRFQVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKTQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQ++SASIAGD++LA+A  +ELPRYGLEVGLTNYAAAYC GLLLARR+L+ LEMD EY+
Sbjct  61   IAQVISASIAGDLVLAAARTHELPRYGLEVGLTNYAAAYCAGLLLARRVLKMLEMDEEYQ  120

Query  414  GNVEA  428
            GN+EA
Sbjct  121  GNIEA  125



>ref|XP_009410739.1| PREDICTED: 60S ribosomal protein L5 [Musa acuminata subsp. malaccensis]
Length=302

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QKT+AYFKR+QVK+KR R G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKSQKTKAYFKRYQVKYKRRRVGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQI+SASIAGD++LASAYA+ELP YGLE GLTNYAAAYCTGLLLARR+L+ LEMD EY+
Sbjct  61   AAQIISASIAGDLVLASAYAHELPHYGLEAGLTNYAAAYCTGLLLARRVLKMLEMDEEYQ  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_006583256.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Glycine 
max]
Length=316

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +3

Query  60   FIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  239
            ++K QK++AYFKR+QVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRF+NKDIVA
Sbjct  21   YVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDIVA  80

Query  240  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEGN  419
            QI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYEGN
Sbjct  81   QIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYEGN  140

Query  420  VEA  428
            VEA
Sbjct  141  VEA  143



>gb|ACJ85054.1| unknown [Medicago truncatula]
 gb|KEH18731.1| 60S ribosomal protein L5-2 [Medicago truncatula]
Length=302

 Score =   176 bits (446),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M ++K QK++AYFKR+QVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++LA+AY++ELP +GL+VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVLAAAYSHELPHFGLKVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|KHG04393.1| 60S ribosomal L5 [Gossypium arboreum]
Length=260

 Score =   175 bits (443),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QKT+AYFKRFQV FKR REG TDYRAR RL NQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MGFVKAQKTKAYFKRFQVPFKRRREGKTDYRARIRLTNQDKNKYNTPKYRFVVRFSNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQI+SA+I GDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLL RR+L+ LEMD EY+
Sbjct  61   TAQIISANITGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKLLEMDDEYQ  120

Query  414  GNVEA  428
            GNVE 
Sbjct  121  GNVEG  125



>gb|AFK41086.1| unknown [Medicago truncatula]
Length=302

 Score =   176 bits (446),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M ++K QK++AYFKR+QVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++LA+AY++ELP +GL+VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVLAAAYSHELPHFGLKVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|NP_001267659.1| 60S ribosomal protein L5 [Cucumis sativus]
 sp|Q6UNT2.1|RL5_CUCSA RecName: Full=60S ribosomal protein L5 [Cucumis sativus]
 gb|AAQ72789.1| 60S ribosomal protein L5 [Cucumis sativus]
 gb|KGN51654.1| hypothetical protein Csa_5G588730 [Cucumis sativus]
Length=302

 Score =   176 bits (446),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF K QKT+AYFKR+QVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVR +NKDI
Sbjct  1    MAFAKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRTSNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQI+SASIAGD++LASAY++ELP+YGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDLVLASAYSHELPQYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_007049514.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
 gb|EOX93671.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
Length=299

 Score =   176 bits (445),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +3

Query  57   AFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  236
            A++K QKT+AY KR+QVKFKR REG TDYRAR RLINQDKNKYNTPKYR V RFTNKD++
Sbjct  4    AYVKAQKTKAYSKRYQVKFKRRREGKTDYRARTRLINQDKNKYNTPKYRLVARFTNKDLI  63

Query  237  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEG  416
            AQIV ASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYC GLLLARR+L++LEMD EYEG
Sbjct  64   AQIVHASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCVGLLLARRVLKQLEMDAEYEG  123

Query  417  NVEA  428
            NVEA
Sbjct  124  NVEA  127



>emb|CDP17898.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   177 bits (448),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QKT+AYFKR+QV FKR REG TDYRAR RLINQDKNKYNTPKYRFVVRFT KDI
Sbjct  55   MAFVKAQKTKAYFKRYQVPFKRRREGKTDYRARVRLINQDKNKYNTPKYRFVVRFTKKDI  114

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQIVSASIAGD++LA+AY++ELP +GLEVGLTNYAAAY TGLLLARR+L+KLEMD EYE
Sbjct  115  IAQIVSASIAGDLVLAAAYSHELPHFGLEVGLTNYAAAYATGLLLARRVLKKLEMDEEYE  174

Query  414  GNVEA  428
            GNVEA
Sbjct  175  GNVEA  179



>emb|CDP18434.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   176 bits (445),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +3

Query  72   QKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVS  251
            QKT+AYFKR+QV+FKR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDIVAQIVS
Sbjct  37   QKTKAYFKRYQVQFKRRREGKTDYRARVRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVS  96

Query  252  ASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEGNVEA  428
            ASIAGD++LASAYA+ELPRYGLE+GLTNYAAAYCTGLLLARR+L++L+MD EYEGNVEA
Sbjct  97   ASIAGDIVLASAYAHELPRYGLEIGLTNYAAAYCTGLLLARRVLKELQMDEEYEGNVEA  155



>ref|XP_002456780.1| hypothetical protein SORBIDRAFT_03g042604 [Sorghum bicolor]
 gb|EES01900.1| hypothetical protein SORBIDRAFT_03g042604 [Sorghum bicolor]
Length=304

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  57   AFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  236
             F+K QKT AYFKRFQVKFKR R G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTQKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  237  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEG  416
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +D EYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDQEYEG  122

Query  417  NVEA  428
            NVEA
Sbjct  123  NVEA  126



>ref|XP_010646096.1| PREDICTED: 60S ribosomal protein L5-like [Vitis vinifera]
Length=263

 Score =   174 bits (440),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QKTRAY KRFQVKFKR R G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKTRAYSKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQI+SASIAGDM+LA+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EY+
Sbjct  61   TAQIISASIAGDMVLAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYQ  120

Query  414  GN  419
            G 
Sbjct  121  GK  122



>gb|KFK38215.1| hypothetical protein AALP_AA3G083700 [Arabis alpina]
Length=303

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M  +K QK +AYFKR+QVKF+R REG TDYRAR RLINQDKNKYNTPKYR+VVRFTNKDI
Sbjct  1    MVIVKPQKKQAYFKRYQVKFRRRREGKTDYRARIRLINQDKNKYNTPKYRYVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQ+VSA+IAGD++LASAYA+ELPRYGL+VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQVVSATIAGDIVLASAYAHELPRYGLQVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|KJB84072.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=300

 Score =   174 bits (442),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QKT+AYFKR+QVKFKR REG TDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKTKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQI+ ASI+GD++LA+AY +ELP YGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  61   IAQIIHASISGDIVLAAAYGHELPHYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|KHG10377.1| 60S ribosomal protein L5 [Gossypium arboreum]
Length=268

 Score =   173 bits (439),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +3

Query  60   FIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  239
            F+K QKT+AYFKR+QVKFKR REG TDYRARNRLINQDKNKYNTPKYR V RFTNKDI+A
Sbjct  10   FVKAQKTKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDIIA  69

Query  240  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEGN  419
            QIV ASI+GD++LA+AY +ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYEGN
Sbjct  70   QIVHASISGDIVLAAAYGHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYEGN  129

Query  420  VEA  428
            VE 
Sbjct  130  VEG  132



>gb|KDP45189.1| hypothetical protein JCGZ_15054 [Jatropha curcas]
Length=299

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QK++AYFKRFQVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDV  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQI+ ++IAGD++LA+AY++ELP+YGLEVGLTNYAAAYCTGLLLARR+L+ L+MD EYE
Sbjct  61   TAQIIHSTIAGDIVLAAAYSHELPKYGLEVGLTNYAAAYCTGLLLARRVLKTLQMDGEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_008807247.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Phoenix 
dactylifera]
Length=304

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +3

Query  57   AFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  236
            AF+K QKT+AYFKRFQVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI+
Sbjct  4    AFVKTQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDII  63

Query  237  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEG  416
            AQ++SASIAGD++LA+A  +ELPRYGLEVGLTNYAAAYC GLLLARR+L+ LEMD EY+G
Sbjct  64   AQVISASIAGDLVLAAARTHELPRYGLEVGLTNYAAAYCAGLLLARRVLKMLEMDEEYQG  123

Query  417  NVEA  428
            N+EA
Sbjct  124  NIEA  127



>gb|KFK38214.1| hypothetical protein AALP_AA3G083600 [Arabis alpina]
Length=302

 Score =   174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M  +K QK +AYFKR+QVKF+R REG TDYRAR RLINQDKNKYNTPKYR+VVRFTNKDI
Sbjct  1    MVIVKPQKKQAYFKRYQVKFRRRREGKTDYRARIRLINQDKNKYNTPKYRYVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQ+VSA+IAGD++LASAYA+ELPRYGL+VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQVVSATIAGDIVLASAYAHELPRYGLQVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_002465922.1| hypothetical protein SORBIDRAFT_01g048270 [Sorghum bicolor]
 gb|EER92920.1| hypothetical protein SORBIDRAFT_01g048270 [Sorghum bicolor]
Length=302

 Score =   174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +3

Query  57   AFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  236
             F+K QKT AYFKRFQVKFKR R G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  4    GFVKTQKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  63

Query  237  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEG  416
            AQIVSASIAGDM+LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++D EYEG
Sbjct  64   AQIVSASIAGDMVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRDLDQEYEG  123

Query  417  NVEA  428
            NVEA
Sbjct  124  NVEA  127



>ref|XP_004970894.1| PREDICTED: 60S ribosomal protein L5-1-like [Setaria italica]
Length=303

 Score =   174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +3

Query  57   AFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  236
             F+K QKT AYFKRFQVKFKR R G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTQKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  237  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEG  416
            AQIVSASIAGDM+LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++D EYEG
Sbjct  63   AQIVSASIAGDMVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRDLDQEYEG  122

Query  417  NVEA  428
            NVEA
Sbjct  123  NVEA  126



>gb|KCW57514.1| hypothetical protein EUGRSUZ_H00286 [Eucalyptus grandis]
Length=365

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +3

Query  60   FIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  239
            F+K QK+RAY KRFQVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  67   FVKAQKSRAYSKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITA  126

Query  240  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEGN  419
            QI+SA+I GDM+LASAY++ELP YGLE GLTNYAAAYCTGLLLARR+L+ LEMD EYEGN
Sbjct  127  QIISATITGDMVLASAYSHELPHYGLEAGLTNYAAAYCTGLLLARRVLKSLEMDSEYEGN  186

Query  420  VEA  428
            VEA
Sbjct  187  VEA  189



>gb|AFW84310.1| hypothetical protein ZEAMMB73_937605 [Zea mays]
Length=233

 Score =   172 bits (435),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  57   AFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  236
             F+K  KT AYFKRFQVKFKR R G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  237  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEG  416
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +D EYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDQEYEG  122

Query  417  NVEA  428
            NVEA
Sbjct  123  NVEA  126



>gb|ABK93596.1| unknown [Populus trichocarpa]
Length=298

 Score =   173 bits (439),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF K QK+RAY KRFQVKFKR REG TDYRAR RLINQDKNKYNTPKYRFV+RFTNKDI
Sbjct  1    MAFAKAQKSRAYCKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVMRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQI+ AS+AGD+++A+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   TAQIIHASMAGDIVVAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_002321226.2| hypothetical protein POPTR_0014s17230g [Populus trichocarpa]
 gb|EEE99541.2| hypothetical protein POPTR_0014s17230g [Populus trichocarpa]
Length=298

 Score =   173 bits (439),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF K QK+RAY+KRFQVKFKR REG TDYRAR RLINQDKNKYNTPKYRFV+RFTNKDI
Sbjct  1    MAFAKAQKSRAYYKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVMRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQI+ AS+AGD+++A+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   TAQIIHASMAGDIVVAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_007033701.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
 gb|EOY04627.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
Length=299

 Score =   173 bits (438),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 116/126 (92%), Gaps = 1/126 (1%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MA++K QKT+AYFKRFQVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAYVKAQKTKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNY-AAAYCTGlllarrllqklEMDXEY  410
             AQIVSASIAGD +LA+AYA ELP YGLEVGLTNY AAAYCTGLLLARR+L+KLEMD EY
Sbjct  61   TAQIVSASIAGDQVLAAAYARELPCYGLEVGLTNYAAAAYCTGLLLARRVLKKLEMDDEY  120

Query  411  EGNVEA  428
            EGNVEA
Sbjct  121  EGNVEA  126



>gb|KJB10809.1| hypothetical protein B456_001G226000 [Gossypium raimondii]
Length=230

 Score =   171 bits (433),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MA++K QK++AYFKRFQVKFKR REG TDYRAR RLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MAYVKAQKSKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+ ASI+GD++LA+AY++ELP YGLEVGLTNYAAAYC GLLLARR+L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYSHELPHYGLEVGLTNYAAAYCVGLLLARRVLKQLEMDTEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|AFK39593.1| unknown [Lotus japonicus]
Length=301

 Score =   173 bits (438),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M FIK QK RAYFKRFQVKFKR REG TDYRAR RLINQDKNKYNT KYRFVVR TNKDI
Sbjct  1    MVFIKAQKPRAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTAKYRFVVRSTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQI+S++IAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQIISSTIAGDIVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|EYU46086.1| hypothetical protein MIMGU_mgv1a010702mg [Erythranthe guttata]
Length=304

 Score =   173 bits (438),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK+RAYFKRFQVKFKR REG TDYRAR R+INQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRFQVKFKRRREGKTDYRARIRMINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            + QIVSA+I GD +LA+AYA+ELP +GLEVGL+NYAAAYCTGLLL+RR+L+ LEMD EYE
Sbjct  61   ICQIVSATITGDHVLAAAYAHELPHFGLEVGLSNYAAAYCTGLLLSRRVLKTLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|AFW84311.1| hypothetical protein ZEAMMB73_937605 [Zea mays]
Length=278

 Score =   172 bits (436),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  57   AFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  236
             F+K  KT AYFKRFQVKFKR R G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  237  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEG  416
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +D EYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDQEYEG  122

Query  417  NVEA  428
            NVEA
Sbjct  123  NVEA  126



>ref|XP_010450776.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=265

 Score =   172 bits (435),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K  K+ AY+KR+QVKF+R R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPHKSNAYYKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLSVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_003579707.1| PREDICTED: 60S ribosomal protein L5-1 [Brachypodium distachyon]
Length=301

 Score =   172 bits (436),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QKTRAY KRFQVKFKR R+G TDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKTQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++D EYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKFRDLDQEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_003561801.1| PREDICTED: 60S ribosomal protein L5-1-like [Brachypodium distachyon]
Length=301

 Score =   172 bits (436),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QKTRAY KRFQVKFKR R+G TDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKTQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++D EYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKCRDLDQEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_009151634.1| PREDICTED: 60S ribosomal protein L5-2-like isoform X2 [Brassica 
rapa]
Length=303

 Score =   172 bits (436),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK +AYFKR+QVKF+R R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPQKKQAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSA+I GD++LASAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR+LQ LEMD EYE
Sbjct  61   VAQIVSATITGDIVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLQMLEMDAEYE  120

Query  414  GNVEA  428
            GN EA
Sbjct  121  GNAEA  125



>ref|XP_008674702.1| PREDICTED: 60S ribosomal protein L5-1 [Zea mays]
 tpg|DAA56366.1| TPA: 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   172 bits (436),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  57   AFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  236
             F+K  KT AYFKRFQVKFKR R G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  237  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEG  416
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +D EYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTRGLDKEYEG  122

Query  417  NVEA  428
            NVEA
Sbjct  123  NVEA  126



>ref|XP_011006737.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
Length=298

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF K QK+RAY+KRFQVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MAFAKAQKSRAYYKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDV  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQI+ AS+AGD+++A+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   TAQIIHASMAGDIVVAAAYSHELPCYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_010264793.1| PREDICTED: 60S ribosomal protein L5-like [Nelumbo nucifera]
Length=302

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +3

Query  57   AFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  236
             F+K  KT+AYFKRFQVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKAHKTKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  237  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEG  416
            AQ++ ASIAGDM+LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEM+ EY+G
Sbjct  63   AQVIYASIAGDMVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMEDEYQG  122

Query  417  NVEA  428
            NVEA
Sbjct  123  NVEA  126



>ref|NP_001151284.1| 60S ribosomal protein L5-1 [Zea mays]
 gb|ACG42230.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  57   AFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  236
             F+K  KT AYFKRFQVKFKR R G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  237  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEG  416
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +D EYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDKEYEG  122

Query  417  NVEA  428
            NVEA
Sbjct  123  NVEA  126



>gb|ACR38045.1| unknown [Zea mays]
 gb|AFW84309.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  57   AFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  236
             F+K  KT AYFKRFQVKFKR R G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  237  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEG  416
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +D EYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDQEYEG  122

Query  417  NVEA  428
            NVEA
Sbjct  123  NVEA  126



>gb|EYU46087.1| hypothetical protein MIMGU_mgv11b008897mg [Erythranthe guttata]
Length=304

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK+RAYFKRFQVKFKR REG TDYRAR R+INQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRFQVKFKRRREGKTDYRARIRMINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            + QIVSA+I GD +LA+AYA+ELP +GL+VGL+NYAAAYCTGLLL+RR+L+KLEMD EYE
Sbjct  61   ICQIVSATITGDHVLAAAYAHELPHFGLDVGLSNYAAAYCTGLLLSRRVLKKLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|NP_198790.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 ref|NP_001190439.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 sp|P49227.3|RL52_ARATH RecName: Full=60S ribosomal protein L5-2 [Arabidopsis thaliana]
 dbj|BAB11380.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAL84975.1| AT5g39740/MKM21_30 [Arabidopsis thaliana]
 gb|AAM13122.1| ribosomal protein L5 - like [Arabidopsis thaliana]
 gb|AAP42719.1| At5g39740 [Arabidopsis thaliana]
 gb|AED94469.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 gb|AED94470.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
Length=301

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K  K+ AYFKR+QVKF+R R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_010435855.1| PREDICTED: 60S ribosomal protein L5-1 isoform X1 [Camelina sativa]
 ref|XP_010435856.1| PREDICTED: 60S ribosomal protein L5-1 isoform X2 [Camelina sativa]
Length=301

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K  K+ AY+KR+QVKF+R R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPHKSNAYYKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLSVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|KCW46049.1| hypothetical protein EUGRSUZ_L00023 [Eucalyptus grandis]
Length=301

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K  K+RAY KR+QVK+KR R+G TDYRAR RLINQDKNKYNTPKYR VVRF+NK I
Sbjct  1    MAFVKALKSRAYSKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRIVVRFSNKFI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+SASIAGD++LA+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDQEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_010441086.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K  K+ AY+KR+QVKF+R R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPHKSNAYYKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLSVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_008650733.1| PREDICTED: 60S ribosomal protein L5-1-like [Zea mays]
 tpg|DAA43179.1| TPA: hypothetical protein ZEAMMB73_131299 [Zea mays]
Length=301

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  57   AFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  236
             F+K QKT AYFKRFQVKFKR R G TDYRAR RLINQDKNKYNTPKYRF+VRFTNKDI+
Sbjct  3    GFVKTQKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFIVRFTNKDII  62

Query  237  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEG  416
            AQIVSASI GD+ILA+AY+ ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++D EYEG
Sbjct  63   AQIVSASITGDIILAAAYSRELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRDLDQEYEG  122

Query  417  NVEA  428
            NVEA
Sbjct  123  NVEA  126



>gb|ACG36552.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  57   AFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  236
             F+K  K+ AYFKRFQVKFKR R G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKSNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  237  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEG  416
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +D EYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTRGLDKEYEG  122

Query  417  NVEA  428
            NVEA
Sbjct  123  NVEA  126



>ref|XP_003577351.1| PREDICTED: 60S ribosomal protein L5-1-like [Brachypodium distachyon]
Length=302

 Score =   171 bits (433),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QKTRAY KRFQVKFKR R+G TDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKTQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQIV A+IAGD+++A+AY++ELPRYGL VGLTNYAAAYCTGLLLARR+L+  E+D EYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLTVGLTNYAAAYCTGLLLARRILKYRELDQEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_006418614.1| hypothetical protein EUTSA_v10002621mg [Eutrema salsugineum]
 gb|ESQ37050.1| hypothetical protein EUTSA_v10002621mg [Eutrema salsugineum]
Length=301

 Score =   171 bits (433),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K  K+ AYFKR+QVKF+R R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++ ASAYA+ELP YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPHYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|KCW46050.1| hypothetical protein EUGRSUZ_L00023 [Eucalyptus grandis]
Length=300

 Score =   171 bits (433),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K  K+RAY KR+QVK+KR R+G TDYRAR RLINQDKNKYNTPKYR VVRF+NK I
Sbjct  1    MAFVKALKSRAYSKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRIVVRFSNKFI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+SASIAGD++LA+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDQEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|KJB10810.1| hypothetical protein B456_001G226000 [Gossypium raimondii]
Length=298

 Score =   171 bits (432),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MA++K QK++AYFKRFQVKFKR REG TDYRAR RLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MAYVKAQKSKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+ ASI+GD++LA+AY++ELP YGLEVGLTNYAAAYC GLLLARR+L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYSHELPHYGLEVGLTNYAAAYCVGLLLARRVLKQLEMDTEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|NP_566767.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
 sp|Q8LBI1.2|RL51_ARATH RecName: Full=60S ribosomal protein L5-1 [Arabidopsis thaliana]
 gb|AAL06822.1| AT5g39740/MKM21_30 [Arabidopsis thaliana]
 gb|AAL38279.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAM10263.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAM96985.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAN15730.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAO00787.1| ribosomal protein, putative [Arabidopsis thaliana]
 gb|AAO73340.1| ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAP42718.1| At3g25520 [Arabidopsis thaliana]
 gb|AEE77019.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
Length=301

 Score =   171 bits (433),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K  K+ AYFKR+QVKF+R R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSTKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|AAM64753.1| ribosomal protein, putative [Arabidopsis thaliana]
Length=301

 Score =   171 bits (433),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K  K+ AYFKR+QVKF+R R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSTKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_006284123.1| hypothetical protein CARUB_v10005255mg, partial [Capsella rubella]
 gb|EOA17021.1| hypothetical protein CARUB_v10005255mg, partial [Capsella rubella]
Length=322

 Score =   171 bits (434),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +3

Query  36   SSSTAPMAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVR  215
            SS    M F+K  K+ AYFKR+QVKF+R R G TDYRAR RLINQDKNKYNTPKYRFVVR
Sbjct  16   SSPQQTMVFVKSDKSNAYFKRYQVKFRRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVR  75

Query  216  FTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklE  395
            FTNKDIVAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LE
Sbjct  76   FTNKDIVAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLE  135

Query  396  MDXEYEGNVEA  428
            MD EYEGN+EA
Sbjct  136  MDDEYEGNLEA  146



>ref|XP_002870764.1| hypothetical protein ARALYDRAFT_916328 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47023.1| hypothetical protein ARALYDRAFT_916328 [Arabidopsis lyrata subsp. 
lyrata]
Length=302

 Score =   171 bits (433),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K  K+ AYFKR+QVKF+R R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>emb|CDX86312.1| BnaA06g30290D [Brassica napus]
Length=313

 Score =   171 bits (433),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  60   FIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  239
            F+K QK +AYFKR+QVKF+R R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDIVA
Sbjct  13   FVKPQKKQAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVA  72

Query  240  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEGN  419
            QIVSA+I GD++LASAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR+LQ LEMD EYEGN
Sbjct  73   QIVSATITGDIVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLQMLEMDAEYEGN  132

Query  420  VEA  428
             EA
Sbjct  133  AEA  135



>ref|XP_009151633.1| PREDICTED: 60S ribosomal protein L5-2-like isoform X1 [Brassica 
rapa]
Length=307

 Score =   171 bits (432),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK +AYFKR+QVKF+R R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPQKKQAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSA+I GD++LASAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR+LQ LEMD EYE
Sbjct  61   VAQIVSATITGDIVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLQMLEMDAEYE  120

Query  414  GNVE  425
            GN E
Sbjct  121  GNAE  124



>dbj|BAJ89012.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=301

 Score =   170 bits (431),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QKTRAY KRFQVKFKR R+G TDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKNQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++D EYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKCRDLDQEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|AEV92989.1| 60S ribosomal protein L5 [Triticum aestivum]
Length=301

 Score =   170 bits (431),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QKTRAY KRFQVKF+R R+G TDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKNQKTRAYSKRFQVKFRRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++D EYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKCRDLDQEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|NP_001172693.1| Os01g0896620 [Oryza sativa Japonica Group]
 dbj|BAH91423.1| Os01g0896620 [Oryza sativa Japonica Group]
Length=128

 Score =   165 bits (417),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  57   AFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  236
             F+K QKT AYFKRFQVKFKR R+G TDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDIT  62

Query  237  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEG  416
            AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L    +D EYEG
Sbjct  63   AQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLTLRGLDQEYEG  122

Query  417  NVE  425
            NVE
Sbjct  123  NVE  125



>ref|XP_009136123.1| PREDICTED: 60S ribosomal protein L5-1-like [Brassica rapa]
Length=302

 Score =   170 bits (431),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K  K+ AYFKR+QVKF+R R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  414  GNVEA  428
            GN+EA
Sbjct  121  GNLEA  125



>ref|XP_009102410.1| PREDICTED: 60S ribosomal protein L5-1 [Brassica rapa]
Length=302

 Score =   170 bits (431),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K  K+ AYFKR+QVKF+R R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  414  GNVEA  428
            GN+EA
Sbjct  121  GNLEA  125



>emb|CDY52294.1| BnaA03g57870D [Brassica napus]
Length=332

 Score =   171 bits (432),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K  K+ AYFKR+QVKF+R R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  31   MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  90

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  91   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  150

Query  414  GNVEA  428
            GN+EA
Sbjct  151  GNLEA  155



>ref|XP_004968269.1| PREDICTED: 60S ribosomal protein L5-1-like [Setaria italica]
Length=299

 Score =   169 bits (428),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F++ QK  AY+KRFQV+FKR R+G TDYRAR RLINQ+KNKY+TPKYRFVVRFTNKDI
Sbjct  1    MGFVRTQKANAYYKRFQVQFKRRRDGKTDYRARIRLINQEKNKYSTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQI+SASIAGDM+LASAY++ELPRYGLEVGL NYAAAYCTGLLLARR+L+  ++D EYE
Sbjct  61   TAQIMSASIAGDMVLASAYSHELPRYGLEVGLANYAAAYCTGLLLARRVLKLRDLDQEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_006296719.1| hypothetical protein CARUB_v10014269mg [Capsella rubella]
 gb|EOA29617.1| hypothetical protein CARUB_v10014269mg [Capsella rubella]
Length=301

 Score =   169 bits (427),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K  K+ AYFKR+QVKF+R R G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSDKSNAYFKRYQVKFRRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  414  GNVEA  428
            GN+EA
Sbjct  121  GNLEA  125



>gb|KHN27258.1| 60S ribosomal protein L5 [Glycine soja]
Length=301

 Score =   169 bits (427),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +3

Query  126  EGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELP  305
            EG TDYRAR RLINQDKNKYNTPKYRFVVRF+NKDIVAQI+SASIAGD++LA+AYA+ELP
Sbjct  28   EGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDIVAQIISASIAGDIVLAAAYAHELP  87

Query  306  RYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEGNVEA  428
            RYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYEGNVEA
Sbjct  88   RYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYEGNVEA  128



>ref|XP_006284122.1| hypothetical protein CARUB_v10005255mg [Capsella rubella]
 gb|EOA17020.1| hypothetical protein CARUB_v10005255mg [Capsella rubella]
Length=301

 Score =   168 bits (426),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K  K+ AYFKR+QVKF+R R G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSDKSNAYFKRYQVKFRRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  414  GNVEA  428
            GN+EA
Sbjct  121  GNLEA  125



>ref|XP_002524558.1| ribosomal protein L5, putative [Ricinus communis]
 gb|EEF37766.1| ribosomal protein L5, putative [Ricinus communis]
Length=298

 Score =   168 bits (426),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QKTRAYFKRFQVK+KR REG TDYRAR RLINQDKNKYNTPKYR VVRFTNKD+
Sbjct  1    MAFVKAQKTRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRLVVRFTNKDV  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQ++ + I GD++LA+AY++ELP YGL+VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQVIHSRIVGDIVLAAAYSHELPCYGLDVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  414  GNVEA  428
            GN EA
Sbjct  121  GNTEA  125



>ref|XP_010488654.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   168 bits (426),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K  K+ AYFKR+QVKF+R R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSCKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  414  GNVEA  428
            GN+EA
Sbjct  121  GNLEA  125



>ref|XP_010514215.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=302

 Score =   168 bits (426),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K  K+ AYFKR+QVKF+R R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSCKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  414  GNVEA  428
            GN+EA
Sbjct  121  GNLEA  125



>ref|XP_002885727.1| hypothetical protein ARALYDRAFT_480054 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61986.1| hypothetical protein ARALYDRAFT_480054 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   168 bits (425),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K  K+ AYFKR+QVKF+R R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  414  GNVEA  428
            GNV A
Sbjct  121  GNVVA  125



>gb|KHN36791.1| 60S ribosomal protein L5 [Glycine soja]
Length=240

 Score =   166 bits (420),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 114/124 (92%), Gaps = 3/124 (2%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M ++K QK++AYFKR+QVKFKR REG TDYRAR RLINQDKNKYNTPKYRFV   +NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFV---SNKDI  57

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  58   VAQIISASIAGDLVLATAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  117

Query  414  GNVE  425
            GNVE
Sbjct  118  GNVE  121



>gb|ABK21084.1| unknown [Picea sitchensis]
Length=297

 Score =   167 bits (424),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QKTRAYFKRFQVKFKR REG TDYRAR RLINQDKNKYNTPKYR VVRF+NKD+
Sbjct  1    MVFVKAQKTRAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRLVVRFSNKDV  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+ A++AGD+++A+AY+ ELPRYGLEVGLTNYAAAYCTGLLLARR+L++LEMD EY 
Sbjct  61   VAQIIYATLAGDVVMAAAYSRELPRYGLEVGLTNYAAAYCTGLLLARRVLKQLEMDEEYV  120

Query  414  GNVEA  428
            GN EA
Sbjct  121  GNEEA  125



>ref|XP_010039360.1| PREDICTED: 60S ribosomal protein L5-like [Eucalyptus grandis]
Length=382

 Score =   169 bits (429),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = +3

Query  45   TAPMAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTN  224
            T   AF+K  K+RAY KR+QVK+KR R+G TDYRAR RLINQDKNKYNTPKYR VVRF+N
Sbjct  79   TVYQAFVKALKSRAYSKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRIVVRFSN  138

Query  225  KDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDX  404
            K IVAQI+SASIAGD++LA+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD 
Sbjct  139  KFIVAQIISASIAGDLVLAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDQ  198

Query  405  EYEGNVEA  428
            EYEGNVEA
Sbjct  199  EYEGNVEA  206



>emb|CDY27889.1| BnaA07g04790D [Brassica napus]
Length=309

 Score =   167 bits (424),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
              F+K  K+ AYFKR+QVKF+R R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  8    FVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  67

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  68   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  127

Query  414  GNVEA  428
            GN+EA
Sbjct  128  GNLEA  132



>gb|EPS64989.1| hypothetical protein M569_09790, partial [Genlisea aurea]
Length=207

 Score =   164 bits (416),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  60   FIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  239
            F+K QK++AYFKRFQVKFKR R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI+A
Sbjct  1    FVKSQKSKAYFKRFQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIIA  60

Query  240  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEGN  419
            QIVSA+IAGD +LA+AY++EL  YGLEVGLTNYAAAYCTGLLL RR+L+KL++D EY+GN
Sbjct  61   QIVSATIAGDRVLAAAYSHELRHYGLEVGLTNYAAAYCTGLLLGRRVLKKLDLDQEYKGN  120

Query  420  VEA  428
            VEA
Sbjct  121  VEA  123



>emb|CDY15089.1| BnaC03g44500D [Brassica napus]
Length=319

 Score =   168 bits (425),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
              F+K  K+ AYFKR+QVKF+R R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  18   FVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  77

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  78   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  137

Query  414  GNVEA  428
            GN+EA
Sbjct  138  GNLEA  142



>ref|XP_006282684.1| hypothetical protein CARUB_v10005363mg [Capsella rubella]
 gb|EOA15582.1| hypothetical protein CARUB_v10005363mg [Capsella rubella]
Length=298

 Score =   167 bits (423),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K  K+ AYFKR+QVKF+R R G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSDKSNAYFKRYQVKFRRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASI GD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIVGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  414  GNVEA  428
            GN+EA
Sbjct  121  GNLEA  125



>emb|CDY50258.1| BnaC07g47930D [Brassica napus]
Length=310

 Score =   167 bits (424),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  60   FIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  239
            F+K  K+ AYFKR+QVKF+R R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDIVA
Sbjct  11   FVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVA  70

Query  240  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEGN  419
            QIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYEGN
Sbjct  71   QIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYEGN  130

Query  420  VEA  428
            +EA
Sbjct  131  LEA  133



>emb|CDY52293.1| BnaA03g57860D [Brassica napus]
Length=326

 Score =   168 bits (425),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  60   FIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  239
            F+K  K+ AYFKR+QVKF+R R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDIVA
Sbjct  27   FVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVA  86

Query  240  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEGN  419
            QIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYEGN
Sbjct  87   QIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYEGN  146

Query  420  VEA  428
            +EA
Sbjct  147  LEA  149



>emb|CDY15088.1| BnaC03g44490D [Brassica napus]
Length=335

 Score =   168 bits (425),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  60   FIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  239
            F+K  K+ AYFKR+QVKF+R R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDIVA
Sbjct  36   FVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVA  95

Query  240  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEGN  419
            QIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYEGN
Sbjct  96   QIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYEGN  155

Query  420  VEA  428
            +EA
Sbjct  156  LEA  158



>ref|XP_009136122.1| PREDICTED: 60S ribosomal protein L5-1-like [Brassica rapa]
Length=302

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K  K+ AYFKR+QVKF+R R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EY 
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYG  120

Query  414  GNVEA  428
            GN+EA
Sbjct  121  GNLEA  125



>ref|XP_006647221.1| PREDICTED: 60S ribosomal protein L5-1-like [Oryza brachyantha]
Length=303

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  57   AFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  236
            AF+K+QKT AY KRFQVKFKR R+G TDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    AFVKLQKTHAYHKRFQVKFKRRRQGKTDYRARVRLTNQDKNKYNTPKYRFVVRFTNKDIT  62

Query  237  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEG  416
             QI  A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++D EYEG
Sbjct  63   CQIAYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRDLDQEYEG  122

Query  417  NVEA  428
            NVEA
Sbjct  123  NVEA  126



>emb|CDX85331.1| BnaC07g26420D [Brassica napus]
Length=395

 Score =   169 bits (428),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  60   FIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  239
            F+K QK +AYFKR+QVKF+R R+G TDYRAR RLINQDKNKYNTPKYR+VVRFTNKDI+A
Sbjct  95   FVKPQKKQAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRYVVRFTNKDIIA  154

Query  240  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEGN  419
            QIVSA+I GD++LASAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR+LQ LEMD EYEGN
Sbjct  155  QIVSATITGDIVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLQMLEMDAEYEGN  214

Query  420  VEA  428
             EA
Sbjct  215  AEA  217



>ref|XP_010466965.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   166 bits (421),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K  K+ AYFKR+QVKF+R R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSCKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYC GLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCAGLLLARRVLKMLEMDDEYE  120

Query  414  GNVEA  428
            GN+EA
Sbjct  121  GNLEA  125



>dbj|BAD82173.1| putative ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|ACA50480.1| 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|EEC71953.1| hypothetical protein OsI_04778 [Oryza sativa Indica Group]
 gb|EEE55807.1| hypothetical protein OsJ_04400 [Oryza sativa Japonica Group]
Length=304

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +3

Query  57   AFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  236
             F+K QKT AYFKRFQVKFKR R+G TDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDIT  62

Query  237  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEG  416
            AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L    +D EYEG
Sbjct  63   AQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLTLRGLDQEYEG  122

Query  417  NVEA  428
            NVEA
Sbjct  123  NVEA  126



>gb|KJB22669.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=298

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 112/125 (90%), Gaps = 3/125 (2%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK++AYFKR+QVKFKR REG TDYRARNRLINQDKNKYNTPKYR V RF   DI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARF---DI  57

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI+ ASI+GD++LA+AYA+ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  58   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  117

Query  414  GNVEA  428
            GNVEA
Sbjct  118  GNVEA  122



>ref|NP_001045083.1| Os01g0896800 [Oryza sativa Japonica Group]
 sp|Q0JGY1.1|RL51_ORYSJ RecName: Full=60S ribosomal protein L5-1 [Oryza sativa Japonica 
Group]
 dbj|BAD82174.1| putative ribosomal protein L5 [Oryza sativa Japonica Group]
 dbj|BAF06997.1| Os01g0896800 [Oryza sativa Japonica Group]
 gb|ACA50481.1| 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 dbj|BAG96886.1| unnamed protein product [Oryza sativa Japonica Group]
Length=304

 Score =   166 bits (419),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +3

Query  57   AFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  236
             F+K QKT AY KRFQVKFKR R+G TDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTQKTNAYHKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDIT  62

Query  237  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEG  416
            AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +D EYEG
Sbjct  63   AQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEG  122

Query  417  NVEA  428
            N+EA
Sbjct  123  NIEA  126



>ref|XP_006395196.1| hypothetical protein EUTSA_v10004670mg [Eutrema salsugineum]
 gb|ESQ32482.1| hypothetical protein EUTSA_v10004670mg [Eutrema salsugineum]
Length=303

 Score =   165 bits (417),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QK + YFKR+QVKF+R REG TDYRAR RLINQDKNKYN+PK+R+VVRFTNKDI
Sbjct  1    MVFVKPQKKQPYFKRYQVKFRRRREGKTDYRARIRLINQDKNKYNSPKFRYVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            + QIVSA+I GD +LASAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IVQIVSATITGDNVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  414  GNVEA  428
            GN EA
Sbjct  121  GNAEA  125



>sp|A2WXX3.2|RL51_ORYSI RecName: Full=60S ribosomal protein L5-1 [Oryza sativa Indica 
Group]
 gb|EEC71954.1| hypothetical protein OsI_04779 [Oryza sativa Indica Group]
Length=304

 Score =   165 bits (417),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  57   AFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  236
             F+K QKT AY+KRFQVKFKR R+G TDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTQKTNAYYKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDIT  62

Query  237  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEG  416
            AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +D EYEG
Sbjct  63   AQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEG  122

Query  417  NVEA  428
            N+EA
Sbjct  123  NIEA  126



>ref|XP_006858792.1| hypothetical protein AMTR_s00066p00162800 [Amborella trichopoda]
 gb|ERN20259.1| hypothetical protein AMTR_s00066p00162800 [Amborella trichopoda]
Length=298

 Score =   165 bits (417),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QKT+AYFKRFQVKFKR REG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQI+SASIAGD++LAS+YA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L++LEMD EYE
Sbjct  61   IAQIISASIAGDLVLASSYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKQLEMDSEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_002876523.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52782.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=301

 Score =   164 bits (415),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 110/126 (87%), Gaps = 1/126 (1%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRAR-NRLINQDKNKYNTPKYRFVVRFTNKD  230
            M  +K Q +R Y  R+QVK++R R+G TDYRAR  RLINQDKNKYNTPKYRFVVRFTNKD
Sbjct  1    MVLVKPQNSRPYSMRYQVKYRRRRDGKTDYRARIRRLINQDKNKYNTPKYRFVVRFTNKD  60

Query  231  IVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEY  410
            I AQ+VSASIAGD+ILA+AYA+ELP+YGL VGLTNY+AAYCTGLLLARR+L+  EMD EY
Sbjct  61   ITAQLVSASIAGDVILAAAYAHELPQYGLNVGLTNYSAAYCTGLLLARRVLKMFEMDAEY  120

Query  411  EGNVEA  428
            EGN+EA
Sbjct  121  EGNLEA  126



>ref|XP_006645164.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X1 [Oryza 
brachyantha]
Length=306

 Score =   164 bits (415),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +3

Query  57   AFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  236
             F+K QKT AYFKRFQVKFKR R+G TDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  6    GFVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDIT  65

Query  237  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEG  416
            AQIV A+IAGD+++A+AY++ELPRYGLE GLTNYAAAYCTGLLLARR+L+   +D EYEG
Sbjct  66   AQIVYATIAGDIVMAAAYSHELPRYGLEAGLTNYAAAYCTGLLLARRVLKIRGLDQEYEG  125

Query  417  NVEA  428
            NVEA
Sbjct  126  NVEA  129



>ref|XP_006645165.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X2 [Oryza 
brachyantha]
Length=303

 Score =   164 bits (415),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +3

Query  57   AFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  236
             F+K QKT AYFKRFQVKFKR R+G TDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDIT  62

Query  237  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEG  416
            AQIV A+IAGD+++A+AY++ELPRYGLE GLTNYAAAYCTGLLLARR+L+   +D EYEG
Sbjct  63   AQIVYATIAGDIVMAAAYSHELPRYGLEAGLTNYAAAYCTGLLLARRVLKIRGLDQEYEG  122

Query  417  NVEA  428
            NVEA
Sbjct  123  NVEA  126



>ref|XP_010101365.1| 60S ribosomal protein L5 [Morus notabilis]
 gb|EXB88312.1| 60S ribosomal protein L5 [Morus notabilis]
Length=305

 Score =   164 bits (414),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 115/125 (92%), Gaps = 3/125 (2%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
             AF+K QKT+AYFKR+QVKFKR REG TDYRAR RLINQDKNKYNTPKYRFV   TNK+I
Sbjct  9    FAFVKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFV---TNKNI  65

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQIVSASIAGD++LA+AY+ ELP+YGLEVGLTNYAAAYCTGLL+ARR+L++LEMD EYE
Sbjct  66   IAQIVSASIAGDIVLAAAYSYELPQYGLEVGLTNYAAAYCTGLLVARRVLKQLEMDGEYE  125

Query  414  GNVEA  428
            GNVEA
Sbjct  126  GNVEA  130



>gb|KJB84073.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=297

 Score =   163 bits (412),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 110/125 (88%), Gaps = 3/125 (2%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QKT+AYFKR+QVKFKR REG TDYRARNRLINQDKNKYNTPKYR V RF   DI
Sbjct  1    MPFVKAQKTKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARF---DI  57

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQI+ ASI+GD++LA+AY +ELP YGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  58   IAQIIHASISGDIVLAAAYGHELPHYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  117

Query  414  GNVEA  428
            GNVEA
Sbjct  118  GNVEA  122



>gb|EPS61271.1| hypothetical protein M569_13526, partial [Genlisea aurea]
Length=242

 Score =   158 bits (399),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  126  EGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELP  305
            EG TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSA+IAGD +LA+AYA+EL 
Sbjct  1    EGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSATIAGDRVLAAAYAHELR  60

Query  306  RYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEGNVEA  428
             YGLEVGLTNYAAAYCTGLLL RR+L KL++D EYEGNVEA
Sbjct  61   HYGLEVGLTNYAAAYCTGLLLGRRVLNKLDLDQEYEGNVEA  101



>gb|AES74307.2| 60S ribosomal protein L5-2 [Medicago truncatula]
Length=300

 Score =   159 bits (403),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QK+ AYFKRFQVKFKR REG TDYRAR  LI QD NKY TPKYR+VVR TNKDI
Sbjct  1    MAFVKAQKSNAYFKRFQVKFKRRREGKTDYRARVSLITQDANKYGTPKYRYVVRLTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            V QIVSA+IAGD++LA+AYA+ELP++GL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VCQIVSATIAGDIVLAAAYAHELPQFGLHVGLTNYAAAYCTGLLLARRVLKTLEMDDEYE  120

Query  414  GNVEA  428
            GNV A
Sbjct  121  GNVVA  125



>ref|XP_010930276.1| PREDICTED: 60S ribosomal protein L5 [Elaeis guineensis]
Length=303

 Score =   159 bits (402),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M ++K QKT+AYFKR+QVKFKR R+G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVYVKTQKTKAYFKRYQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQIISASIAGDLVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>ref|XP_003604056.1| 60S ribosomal protein L5 [Medicago truncatula]
Length=331

 Score =   159 bits (403),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K QK+ AYFKRFQVKFKR REG TDYRAR  LI QD NKY TPKYR+VVR TNKDI
Sbjct  32   MAFVKAQKSNAYFKRFQVKFKRRREGKTDYRARVSLITQDANKYGTPKYRYVVRLTNKDI  91

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            V QIVSA+IAGD++LA+AYA+ELP++GL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  92   VCQIVSATIAGDIVLAAAYAHELPQFGLHVGLTNYAAAYCTGLLLARRVLKTLEMDDEYE  151

Query  414  GNVEA  428
            GNV A
Sbjct  152  GNVVA  156



>ref|XP_010912766.1| PREDICTED: 60S ribosomal protein L5-like [Elaeis guineensis]
Length=331

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 124/142 (87%), Gaps = 5/142 (4%)
 Frame = +3

Query  18   TPLRG*SSSTAP-----MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNK  182
            +PL   S   AP     M ++K QKT+AYFKRFQVKFKR R+G TDYRAR RLINQDKNK
Sbjct  12   SPLPPKSDLGAPKRGSAMVYVKTQKTKAYFKRFQVKFKRRRQGKTDYRARIRLINQDKNK  71

Query  183  YNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGl  362
            YNTPKYRFVVRFTNKDI+AQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGL
Sbjct  72   YNTPKYRFVVRFTNKDIIAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGL  131

Query  363  llarrllqklEMDXEYEGNVEA  428
            LLARR+L+ LEMD EYEGNVEA
Sbjct  132  LLARRVLKMLEMDEEYEGNVEA  153



>gb|EMT04099.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=298

 Score =   158 bits (400),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 110/125 (88%), Gaps = 3/125 (2%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+K QKTRAY KRFQVKFKR R+G TDYRAR RL NQDKNKYNTPKYRFV   TNKD+
Sbjct  1    MVFVKNQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFV---TNKDV  57

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++D EYE
Sbjct  58   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKCRDLDQEYE  117

Query  414  GNVEA  428
            GNVEA
Sbjct  118  GNVEA  122



>gb|EMT23062.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=299

 Score =   157 bits (398),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 110/125 (88%), Gaps = 3/125 (2%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M +IK QKTRAY KRFQVKFKR R+G TDYRAR RL NQDKNKYNTPKYRFV   TNKD+
Sbjct  1    MVYIKNQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFV---TNKDV  57

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++D EYE
Sbjct  58   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKNRDLDEEYE  117

Query  414  GNVEA  428
            GNVEA
Sbjct  118  GNVEA  122



>ref|XP_010258446.1| PREDICTED: 60S ribosomal protein L5 [Nelumbo nucifera]
Length=303

 Score =   157 bits (397),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAF+K  KT+AYFKRFQVK+KR REG TDYRAR RLINQDKNKYNTPKYRFVVRF+NK I
Sbjct  1    MAFVKAHKTKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKHI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            +AQI+SASIAGDMILA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEM+ EYE
Sbjct  61   IAQIISASIAGDMILAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMEDEYE  120

Query  414  GNVEA  428
            GNVEA
Sbjct  121  GNVEA  125



>gb|EMT20601.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=299

 Score =   157 bits (396),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 109/125 (87%), Gaps = 3/125 (2%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M +IK QKTRAY KRFQVKFKR R G TDYRAR RL NQDKNKYNTPKYRFV   TNKD+
Sbjct  1    MVYIKNQKTRAYSKRFQVKFKRRRRGKTDYRARLRLTNQDKNKYNTPKYRFV---TNKDV  57

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++D EYE
Sbjct  58   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKNRDLDEEYE  117

Query  414  GNVEA  428
            GNVEA
Sbjct  118  GNVEA  122



>gb|EMS59984.1| 60S ribosomal protein L5-2 [Triticum urartu]
Length=303

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 113/129 (88%), Gaps = 4/129 (3%)
 Frame = +3

Query  42   STAPMAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFT  221
            + AP+ +IK QKTRAY KRFQVKFKR R+G TDYRAR RL NQDKNKYNTPKYRFV   T
Sbjct  2    AAAPV-YIKNQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFV---T  57

Query  222  NKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMD  401
            NKD+ AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++D
Sbjct  58   NKDVTAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKNRDLD  117

Query  402  XEYEGNVEA  428
             EYEGNVEA
Sbjct  118  EEYEGNVEA  126



>ref|XP_001783620.1| predicted protein [Physcomitrella patens]
 gb|EDQ51584.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   155 bits (393),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAFIK  KT+AYFKRFQVK+KR R G TDYRAR RL  QDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKPNKTKAYFKRFQVKYKRRRAGKTDYRARIRLTTQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI  A++AGD++L SAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR L+  E+D EY 
Sbjct  61   VAQITYATLAGDIVLTSAYAHELPRYGLKGGLTNYAAAYCTGLLLARRHLKNFELDQEYV  120

Query  414  GNVEA  428
            GN  A
Sbjct  121  GNETA  125



>ref|XP_001783411.1| predicted protein [Physcomitrella patens]
 gb|EDQ51751.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   155 bits (391),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAFIK  KT+AYFKRFQVK+KR R G TDYRAR RL  QDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKPNKTKAYFKRFQVKYKRRRAGKTDYRARIRLTTQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI  A++AGD++L SAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR L+  ++D EY 
Sbjct  61   VAQITYATLAGDIVLTSAYAHELPRYGLKGGLTNYAAAYCTGLLLARRHLKNYDLDDEYV  120

Query  414  GNVEA  428
            GN +A
Sbjct  121  GNEQA  125



>sp|Q8L4L4.1|RL52_ORYSJ RecName: Full=60S ribosomal protein L5-2 [Oryza sativa Japonica 
Group]
 pdb|3J61|D Chain D, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAC06272.1| putative 60S ribosomal protein L5 [Oryza sativa Japonica Group]
Length=304

 Score =   154 bits (390),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 107/124 (86%), Gaps = 3/124 (2%)
 Frame = +3

Query  57   AFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  236
             F+K QKT AYFKRFQVKFKR R+G TDYRAR RL NQDKNKYNTPKYRFV   TNKDI 
Sbjct  6    GFVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFV---TNKDIT  62

Query  237  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEG  416
            AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L    +D EYEG
Sbjct  63   AQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLTLRGLDQEYEG  122

Query  417  NVEA  428
            NVEA
Sbjct  123  NVEA  126



>ref|XP_001767871.1| predicted protein [Physcomitrella patens]
 gb|EDQ67385.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   154 bits (390),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAFIK  KT+AYFKRFQVK+KR R G TDYRAR RL  QDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MAFIKPNKTKAYFKRFQVKYKRRRAGKTDYRARIRLTTQDKNKYNTPKYRLVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI  A++AGD++L SAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR L+  E+D EY 
Sbjct  61   VAQITYATLAGDIVLTSAYAHELPRYGLKGGLTNYAAAYCTGLLLARRHLKNFELDQEYV  120

Query  414  GNVEA  428
            GN +A
Sbjct  121  GNEQA  125



>ref|XP_001759628.1| predicted protein [Physcomitrella patens]
 gb|EDQ75540.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MAFIK  KT+AYFKRFQVK+KR R G TDYRAR RL  QDKNKYNTPKYR+VVRFTNKDI
Sbjct  1    MAFIKPNKTKAYFKRFQVKYKRRRAGKTDYRARIRLTTQDKNKYNTPKYRYVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI  A++AGD++L SAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR L+  E+D EY 
Sbjct  61   VAQITYATLAGDIVLTSAYAHELPRYGLKGGLTNYAAAYCTGLLLARRHLKNFELDQEYV  120

Query  414  GNVEA  428
            GN  A
Sbjct  121  GNETA  125



>dbj|BAC06273.1| putative 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|EAZ14478.1| hypothetical protein OsJ_04401 [Oryza sativa Japonica Group]
Length=301

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 107/124 (86%), Gaps = 3/124 (2%)
 Frame = +3

Query  57   AFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  236
             F+K QKT AY KRFQVKFKR R+G TDYRAR RL NQDKNKYNTPKYRFV   TNKDI 
Sbjct  3    GFVKTQKTNAYHKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFV---TNKDIT  59

Query  237  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEG  416
            AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +D EYEG
Sbjct  60   AQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEG  119

Query  417  NVEA  428
            N+EA
Sbjct  120  NIEA  123



>ref|XP_002967840.1| hypothetical protein SELMODRAFT_144921 [Selaginella moellendorffii]
 gb|EFJ31187.1| hypothetical protein SELMODRAFT_144921 [Selaginella moellendorffii]
Length=296

 Score =   152 bits (383),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MA  + QK+++Y+KR+QVK++R REG TDYRAR RL NQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAVARAQKSKSYYKRYQVKYRRRREGKTDYRARVRLTNQDKNKYNTPKYRFVVRFSNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI  A+IAGD+I+A+AYA+ELPRYGL+VGLTNYAAAYCTGLLLARRLL K+ M   YE
Sbjct  61   VAQIAYATIAGDVIMAAAYAHELPRYGLKVGLTNYAAAYCTGLLLARRLLTKMGMADIYE  120

Query  414  GNVE  425
            GN +
Sbjct  121  GNTD  124



>ref|XP_006376458.1| hypothetical protein POPTR_0013s13220g [Populus trichocarpa]
 gb|ERP54255.1| hypothetical protein POPTR_0013s13220g [Populus trichocarpa]
Length=292

 Score =   151 bits (382),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = +3

Query  156  RLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTN  335
            RLINQDKNKYNTPKYRFVVRF+NKDIVAQI SASI GD +LASAYA+ELPRYGLEVGLTN
Sbjct  30   RLINQDKNKYNTPKYRFVVRFSNKDIVAQITSASITGDTVLASAYAHELPRYGLEVGLTN  89

Query  336  YAAAYCTGlllarrllqklEMDXEYEGNVEA  428
            YAAAYCTGLLLARRLL+ LEMD EYEGNVEA
Sbjct  90   YAAAYCTGLLLARRLLKMLEMDEEYEGNVEA  120



>ref|XP_002981679.1| hypothetical protein SELMODRAFT_154687 [Selaginella moellendorffii]
 gb|EFJ17161.1| hypothetical protein SELMODRAFT_154687 [Selaginella moellendorffii]
Length=296

 Score =   151 bits (382),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            MA  + QK+++Y+KR+QVK++R REG TDYRAR RL NQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAVARAQKSKSYYKRYQVKYRRRREGKTDYRARVRLTNQDKNKYNTPKYRFVVRFSNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            VAQI  A+IAGD+I+A+AYA+ELPRYGL+VGLTNYAAAYCTGLLLARRLL K+ M   YE
Sbjct  61   VAQIAYATIAGDVIMAAAYAHELPRYGLKVGLTNYAAAYCTGLLLARRLLTKMGMADIYE  120

Query  414  GNVE  425
            GN +
Sbjct  121  GNTD  124



>gb|AFW84312.1| hypothetical protein ZEAMMB73_937605 [Zea mays]
Length=206

 Score =   148 bits (373),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 89/101 (88%), Gaps = 3/101 (3%)
 Frame = +3

Query  60   FIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  239
            F+K  KT AYFKRFQVKFKR R G TDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  4    FVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITA  63

Query  240  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAA---AYC  353
            QI+SASIAGDM+LASAY++ELPRYGLEVGLTNYA    A+C
Sbjct  64   QIISASIAGDMVLASAYSHELPRYGLEVGLTNYAPTALAFC  104



>gb|ACN25149.1| ribosomal-like protein [Pectinaria gouldii]
Length=269

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +3

Query  57   AFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  236
             F+KVQKT AYF R+QVKFKR REG TDY AR RLI QDKNKYNTPKYR +VRFTNKDI+
Sbjct  3    GFVKVQKTTAYFSRYQVKFKRRREGKTDYFARKRLICQDKNKYNTPKYRLIVRFTNKDII  62

Query  237  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYEG  416
             QI  A IAGD I+ SAYA+ELPRYGL+VGLTNY+AAYCTGLL+ARR+L+KL +D  YE 
Sbjct  63   TQIAYARIAGDFIICSAYAHELPRYGLKVGLTNYSAAYCTGLLMARRVLKKLNLDQVYEV  122

Query  417  NVE  425
            N E
Sbjct  123  NTE  125



>dbj|BAJ07363.1| Tt5 protein [Hydatigera taeniaeformis]
Length=162

 Score =   144 bits (362),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M  +KV K +AYFKRFQVKF+R REG TDY AR RLI QDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MGLVKVTKNKAYFKRFQVKFRRRREGKTDYYARKRLIWQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            V QI+ A + GD ++A+AY++ELPRYG++VGLTNY AAYCTGLLLARR+L+KL++D  Y+
Sbjct  61   VCQIIYACMDGDRVMATAYSHELPRYGVKVGLTNYPAAYCTGLLLARRVLKKLKLDGMYQ  120

Query  414  GNVE  425
            G  E
Sbjct  121  GQTE  124



>ref|XP_005345167.1| PREDICTED: 60S ribosomal protein L5-like [Microtus ochrogaster]
Length=136

 Score =   141 bits (355),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+KV K +AYFKR+QV+F+R REG TDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVRFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            + QI  A I GDMI+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLA RLL +  MD  YE
Sbjct  61   ICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLACRLLNRFGMDKIYE  120

Query  414  GNVEA  428
            G VE 
Sbjct  121  GQVEV  125



>ref|XP_005107604.1| PREDICTED: 60S ribosomal protein L5-like [Aplysia californica]
Length=294

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+KV K++AYFKRFQVKFKR REG TDY AR RLI QDKNKYNTPKYR +VRF+NKDI
Sbjct  1    MGFVKVVKSKAYFKRFQVKFKRRREGVTDYYARKRLIFQDKNKYNTPKYRLIVRFSNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            V QI  A I GD+I+ +AYA+ELPRYG++VGLTNYAAAYCTGLLLARRLL+K  +D  YE
Sbjct  61   VCQIAYARIEGDVIVCAAYAHELPRYGVKVGLTNYAAAYCTGLLLARRLLKKFGLDQTYE  120

Query  414  GNVE  425
            G VE
Sbjct  121  GQVE  124



>ref|XP_005889093.1| PREDICTED: 60S ribosomal protein L5-like [Bos mutus]
Length=149

 Score =   140 bits (354),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+KV K +AYFKR+QVKF+R +EG TDY AR RL+ QDKNKY+TPKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVKFRRRQEGKTDYYARKRLVIQDKNKYHTPKYRMIVRVTNRDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            + QI  A I GDMI+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLARRLL +  MD  YE
Sbjct  61   ICQIAYAHIEGDMIVGAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYE  120

Query  414  GNVE  425
            G VE
Sbjct  121  GQVE  124



>gb|ACO09732.1| 60S ribosomal protein L5 [Osmerus mordax]
Length=176

 Score =   141 bits (355),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+KV K +AYFKR+QVKF+R REG TDY AR RL+ QDKNKYNTPKYR +VRF+N+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYFARKRLVIQDKNKYNTPKYRMIVRFSNRDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            V QI  A I GDMI+ +AY++ELP+YG+ VGLTNYAAAYCTGLL+ARRLL K  +D  YE
Sbjct  61   VCQIAYAKIEGDMIVCAAYSHELPKYGIAVGLTNYAAAYCTGLLVARRLLNKFGLDKVYE  120

Query  414  GNVE  425
            G VE
Sbjct  121  GQVE  124



>ref|XP_010948703.1| PREDICTED: 60S ribosomal protein L5 [Camelus bactrianus]
Length=329

 Score =   145 bits (366),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = +3

Query  27   RG*SSSTAPMAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRF  206
            RG  S    M F+KV K +AYFKR+QVKF+R REG TDY AR RL+ QDKNKYNTPKYR 
Sbjct  24   RGLGSLFRRMGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRM  83

Query  207  VVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllq  386
            VVR TN+DI+ QI  A I GDMI+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLARRLL 
Sbjct  84   VVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLN  143

Query  387  klEMDXEYEGNVE  425
            +  MD  YEG VE
Sbjct  144  RFGMDKIYEGQVE  156



>gb|ACI70102.1| 60S ribosomal protein L5 [Salmo salar]
Length=164

 Score =   140 bits (353),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+KV K++AYFKR+QVKF+R REG TDY AR RL+ QDKNKYNTPKYR +VRF+N+DI
Sbjct  1    MGFVKVVKSKAYFKRYQVKFRRRREGKTDYFARKRLVIQDKNKYNTPKYRMIVRFSNRDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
              QI  A I GD I+A+AY++ELP+YG+ VGLTNYAAAYCTGLLLARRLL K  +D  YE
Sbjct  61   CCQIAYAKIEGDQIVAAAYSHELPKYGITVGLTNYAAAYCTGLLLARRLLNKFGLDQVYE  120

Query  414  GNVE  425
            G VE
Sbjct  121  GQVE  124



>gb|AAM33437.1| ribosomal protein L5 [Branchiostoma belcheri tsingtauense]
Length=207

 Score =   141 bits (356),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+KV K +AYFKRFQVKF+R REG TDY AR RL+ Q+KNKYNTPKYR +VRFTNKDI
Sbjct  1    MGFVKVVKNKAYFKRFQVKFRRRREGVTDYYARKRLVIQEKNKYNTPKYRLIVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            + Q+  A I GD+I+ +AYA+ELPRYG++VGLTNYAAAYCTGLLLARR+L+K  +D  YE
Sbjct  61   ICQVAYARIEGDVIVCAAYAHELPRYGIKVGLTNYAAAYCTGLLLARRILKKFSLDTIYE  120

Query  414  GNVE  425
            G  E
Sbjct  121  GCTE  124



>gb|ABN14903.1| 60S ribosomal protein L5A [Taenia asiatica]
Length=166

 Score =   140 bits (352),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M  +KV K +AYFKRFQVKF+R REG TDY AR RLI QDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MGLVKVTKNKAYFKRFQVKFRRRREGKTDYYARKRLIWQDKNKYNTPKYRSVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            V QI+ A + GD ++A+AY++ELPRYG+++GLTNY AAYCTGLLLARR+L+KL++D  Y+
Sbjct  61   VCQIIYACMDGDRVMATAYSHELPRYGVKIGLTNYPAAYCTGLLLARRVLKKLKLDSMYQ  120

Query  414  GNVE  425
            G  E
Sbjct  121  GQTE  124



>ref|XP_005359733.1| PREDICTED: 60S ribosomal protein L5 [Microtus ochrogaster]
Length=259

 Score =   142 bits (359),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+KV K +AYFKR+QV+F+R REG TDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVRFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            + QI  A I GDMI+ +AYANELP+YG++VGLTNYAAAYCTGLLLARRLL +  MD  YE
Sbjct  61   ICQIAYARIEGDMIVCAAYANELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYE  120

Query  414  GNVE  425
            G VE
Sbjct  121  GQVE  124



>ref|XP_008152973.1| PREDICTED: 60S ribosomal protein L5 [Eptesicus fuscus]
Length=381

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = +3

Query  27   RG*SSSTAPMAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRF  206
            RG  S    M F+KV K +AYFKR+QVKF+R REG TDY AR RL+ QDKNKYNTPKYR 
Sbjct  107  RGRGSLFRRMGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRM  166

Query  207  VVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllq  386
            +VR TN+DI+ QI  A I GDMI+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLARRLL 
Sbjct  167  IVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLN  226

Query  387  klEMDXEYEGNVE  425
            +  MD  YEG VE
Sbjct  227  RFGMDKIYEGQVE  239



>gb|ACJ61702.1| ribosomal protein L5 [Artemia franciscana]
Length=110

 Score =   138 bits (347),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+KV K +AYFKRFQVKF+R REG TDY AR RL+ QDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MGFVKVVKNKAYFKRFQVKFRRRREGKTDYYARRRLVIQDKNKYNTPKYRMVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTG  359
            V QI  A I GD+I+ +AYA+ELPRYG++VGLTNYAAAYCTG
Sbjct  61   VCQIAYARIEGDVIVCAAYAHELPRYGIKVGLTNYAAAYCTG  102



>emb|CDI98331.1| ribosomal protein l5 [Echinococcus multilocularis]
Length=299

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M  +KV K +AYFKRFQVKF+R REG TDY AR RLI QDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MGLVKVTKNKAYFKRFQVKFRRRREGKTDYYARKRLIWQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            V QI+ A + GD ++A+AY++ELPRYG+++GLTNY+AAYCTGLLLARR+L+KL++D  Y+
Sbjct  61   VCQIIYACMDGDRVVATAYSHELPRYGVKIGLTNYSAAYCTGLLLARRVLKKLKLDGLYQ  120

Query  414  GNVE  425
            G  E
Sbjct  121  GQTE  124



>emb|CDS19989.1| ribosomal protein l5 [Echinococcus granulosus]
Length=299

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M  +KV K +AYFKRFQVKF+R REG TDY AR RLI QDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MGLVKVTKNKAYFKRFQVKFRRRREGKTDYYARKRLIWQDKNKYNTPKYRFVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            V QI+ A + GD ++A+AY++ELPRYG+++GLTNY+AAYCTGLLLARR+L+KL++D  Y+
Sbjct  61   VCQIIYACMDGDRVVATAYSHELPRYGVKIGLTNYSAAYCTGLLLARRVLKKLKLDGLYQ  120

Query  414  GNVE  425
            G  E
Sbjct  121  GQTE  124



>gb|AFU54189.1| ribosomal protein L5, partial [Haliotis discus hannai]
Length=162

 Score =   139 bits (351),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+KV K +AYFKRFQVKF+R REG TDY AR RLI Q+KNKYNTPKYR +VRFTNKDI
Sbjct  1    MGFVKVVKNKAYFKRFQVKFRRRREGRTDYFARKRLIFQEKNKYNTPKYRLIVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            + QI  A I GD+I+A+AY++ELPRYG++VGLTNYAAA+CTGLLLARRLLQKL++D  Y 
Sbjct  61   ICQIAYARIEGDIIIAAAYSHELPRYGVKVGLTNYAAAHCTGLLLARRLLQKLKLDSIYT  120

Query  414  GNVEA  428
            G  EA
Sbjct  121  GVEEA  125



>ref|XP_010973953.1| PREDICTED: 60S ribosomal protein L5 [Camelus dromedarius]
Length=376

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = +3

Query  27   RG*SSSTAPMAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRF  206
            RG  S    M F+KV K +AYFKR+QVKF+R REG TDY AR RL+ QDKNKYNTPKYR 
Sbjct  71   RGLGSLFRRMGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRM  130

Query  207  VVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllq  386
            VVR TN+DI+ QI  A I GDMI+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLARRLL 
Sbjct  131  VVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLN  190

Query  387  klEMDXEYEGNVE  425
            +  MD  YEG VE
Sbjct  191  RFGMDKIYEGQVE  203



>ref|XP_008049787.1| PREDICTED: 60S ribosomal protein L5, partial [Tarsius syrichta]
Length=199

 Score =   140 bits (353),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+KV K +AYFKR+QVKF+R REG TDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            + QI  A I GD+I+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLARRLL    MD  YE
Sbjct  61   ICQIAYARIEGDVIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNSFGMDKTYE  120

Query  414  GNVE  425
            G VE
Sbjct  121  GQVE  124



>ref|XP_011283311.1| PREDICTED: 60S ribosomal protein L5 [Felis catus]
Length=364

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = +3

Query  27   RG*SSSTAPMAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRF  206
            RG  S    M F+KV K +AYFKR+QVKF+R REG TDY AR RL+ QDKNKYNTPKYR 
Sbjct  59   RGRRSLFRRMGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRM  118

Query  207  VVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllq  386
            +VR TN+DI+ QI  A I GDMI+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLARRLL 
Sbjct  119  IVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLN  178

Query  387  klEMDXEYEGNVE  425
            +  MD  YEG VE
Sbjct  179  RFGMDKIYEGQVE  191



>gb|AAO25760.1| ribosomal protein L5b [Ictalurus punctatus]
Length=226

 Score =   140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+KV K +AYFKR+QVKF+R REG TDY AR RL+ QDKNKYNTPKYR +VRF+N+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYFARKRLVIQDKNKYNTPKYRMIVRFSNRDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            V QI  A I GD I+ +AY++ELPRYG+ VGLTNYAAAYCTGLLLARRLL K  +D  YE
Sbjct  61   VCQIAYAKIEGDAIVCAAYSHELPRYGVSVGLTNYAAAYCTGLLLARRLLNKFNLDKVYE  120

Query  414  GNVE  425
            G VE
Sbjct  121  GQVE  124



>ref|XP_005969822.1| PREDICTED: 60S ribosomal protein L5-like [Pantholops hodgsonii]
Length=259

 Score =   141 bits (356),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+KV K +AYFKR+QVKF+R REG TDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            + QI  A I GDMI+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLARRLL +  MD  YE
Sbjct  61   ICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYE  120

Query  414  GNVE  425
            G VE
Sbjct  121  GQVE  124



>ref|XP_007073490.1| PREDICTED: 60S ribosomal protein L5-like [Panthera tigris altaica]
Length=423

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = +3

Query  27   RG*SSSTAPMAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRF  206
            RG  S    M F+KV K +AYFKR+QVKF+R REG TDY AR RL+ QDKNKYNTPKYR 
Sbjct  118  RGRRSLFRRMGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRM  177

Query  207  VVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllq  386
            +VR TN+DI+ QI  A I GDMI+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLARRLL 
Sbjct  178  IVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLN  237

Query  387  klEMDXEYEGNVE  425
            +  MD  YEG VE
Sbjct  238  RFGMDKIYEGQVE  250



>gb|ABO26701.1| ribosomal protein l5 [Haliotis discus discus]
Length=251

 Score =   141 bits (355),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+KV K +AYFKRFQVKF+R REG TDY AR RLI Q+KNKYNTPKYR +VRFTNKDI
Sbjct  1    MGFVKVVKNKAYFKRFQVKFRRRREGRTDYFARKRLIFQEKNKYNTPKYRLIVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            + QI  A I GD+I+A+AY++ELPRYG++VGLTNYAAAYCTGLLLARRLLQKL++D  Y 
Sbjct  61   ICQIAYARIEGDIIIAAAYSHELPRYGVKVGLTNYAAAYCTGLLLARRLLQKLKLDSIYT  120

Query  414  GNVEA  428
            G  EA
Sbjct  121  GVEEA  125



>ref|XP_011442103.1| PREDICTED: 60S ribosomal protein L5-like [Crassostrea gigas]
Length=189

 Score =   139 bits (350),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+KV K +AYFKRFQVKF+R REG TD+ AR RL+ Q+KNKYNTPKYR +VRFTNKDI
Sbjct  1    MGFVKVVKNKAYFKRFQVKFRRRREGKTDFFARKRLVIQEKNKYNTPKYRMIVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            + QI  A I GD+I+ +AY++ELPRYG++VGLTNYAAAYCTGLLLARRLLQKL++D  YE
Sbjct  61   ICQIAYARIEGDIIICAAYSHELPRYGVKVGLTNYAAAYCTGLLLARRLLQKLKLDDIYE  120

Query  414  GNVEA  428
            G  E 
Sbjct  121  GQKEV  125



>emb|CCQ18634.1| 60S ribosomal protein L5 [Sycon ciliatum]
Length=296

 Score =   142 bits (357),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+KV K R YFKRFQVK++R REG TDY AR RL  QDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MPFVKVVKDRQYFKRFQVKYRRRREGKTDYYARKRLCVQDKNKYNTPKYRLVVRFTNKDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            V Q+  A + GD+IL+SAY++ELPRYG++VGLTNYAAAYCTGLLLARR+L KL++   Y+
Sbjct  61   VTQVAYARLQGDIILSSAYSHELPRYGIQVGLTNYAAAYCTGLLLARRVLTKLDLAKHYD  120

Query  414  GNVE  425
            G  E
Sbjct  121  GQTE  124



>ref|XP_006197385.1| PREDICTED: 60S ribosomal protein L5 [Vicugna pacos]
Length=297

 Score =   141 bits (356),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+KV K +AYFKR+QVKF+R REG TDY AR RL+ QDKNKYNTPKYR VVR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMVVRVTNRDI  60

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            + QI  A I GDMI+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLARRLL +  MD  YE
Sbjct  61   ICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYE  120

Query  414  GNVE  425
            G VE
Sbjct  121  GQVE  124



>ref|XP_008334234.1| PREDICTED: 60S ribosomal protein L5, partial [Cynoglossus semilaevis]
Length=324

 Score =   142 bits (358),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +3

Query  54   MAFIKVQKTRAYfkrfqvkfkrxrEGXTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  233
            M F+KV K +AYFKR+QVKF+R REG TDY AR RL+ QDKNKYNTPKYR +VRF+N+DI
Sbjct  28   MGFVKVVKNKAYFKRYQVKFRRRREGKTDYFARKRLVIQDKNKYNTPKYRMIVRFSNRDI  87

Query  234  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDXEYE  413
            V QI  A I GDMI+ +AY++ELP+YG+ VGLTNYAAAYCTGLLLARRLL K  +D  YE
Sbjct  88   VCQIAYAKIEGDMIVCAAYSHELPKYGISVGLTNYAAAYCTGLLLARRLLNKFGLDKVYE  147

Query  414  GNVE  425
            G VE
Sbjct  148  GQVE  151



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553413336175